2BLVA

Trypsin before a high dose x-ray "burn"
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA02
1PJPA 2C90B 1IQJA 1H9IE 2UWPA 2BY7X 2BOHB 2ZF0H 3LGTA 5DP5A 1ZLRA 1Y59T 2R3UA 2WPHS 3BV9B 2QXHA 4ZHLU 1UTPA 1C2MA 1EUFA 1ZYOA 7ESTE 5JBTA 5TCCA 1ESTA 2QF0A 6GCHG 2GZ9A 1MU8B 1G2LA 4ABJA 4TYDA 4NA8A 3P17H 1NC6A 1E38B 5EQRA 1FIZA 1KSNA 4D9QA 2XWAA 1BRCE 1QCPA 3UOUA 1O2PA 1ELEE 1K1JA 1P3CA 1F92A 1OYTH 2ANYA 3F68H 3LDXH 3PLPA 3O8BA 3H5CB 2Z9GA 2XXLA 3T29A 1MTUA 3HKJB 3EAJA 5LGOA 1WQVH 1BIOA 1NM6A 1OWKA 2EEKA 2FDAA 2HGTH 1TNKA 4TPIZ 4NWLA 4JCNA 2I6QA 3DHKH 2ESTE 4Y0ZE 1HAPH 1VITH 1SR5C 5TJXA 1TPAE 1O39A 1QQ4A 3EE0B 1U6QA 3RU4T 2ZFRH 1O2LA 3FFGA 1C2EA 1LCYA 4KELA 1OP0A 1AI8H 1ZPBA 1UTOA 3QO6A 3RM2H 1A3EH 2NU2E 3Q00A 3E3TA 3URDA 3KHVA 2FOCA 2XBYA 4HGCA 1HAOH 3ODDA 2G8TA 1PQ8A 3SN8A 5FXLA 2DUCA 3QZRA 3SNAA 3T27A 2PKAB 1XUKA 7LPRA 1BTXA 4UONA 2OQ5A 1SGTA 2F91A 4WVPE 3VB3A 1IQMA 4RN6A 2BZ6H 4AGKA 1KTTB 3K6ZA 1MQ5A 1XUJA 1PQ5A 5JBAS 3RU4D 2BDAA 1FI8A 1AUTC 4ABHA 1E34B 3GY8A 1QJ7B 3RDZA 2WPLS 4OGYA 1QB6A 3PMAB 1YPKH 1QL8A 4WXVA 1HNEE 1SGFA 5JBBS 2TIOA 1A1RA 5EXLA 2GCHG 2H9TH 1O3IA 4B76A 3RXLA 3UREA 2LPRA 1T7CA 1O3BA 4XFQA 1JBUH 1RIWB 3K9XB 2PSXA 5FPYA 2VGCC 3GY5A 1XVMA 1QFKH 3GYLB 1T8OA 3GY2A 1EJNA 3PMJA 4KTUA 2QXGA 2QCYA 1O2ZA 4WY3A 2BY9X 1BRUP 1GCTC 1PYTD 2ZHWH 1O2KA 1EJAA 2AMDA 2OC1A 1GDNA 1G32B 2ZFPH 3P8GA 4DIHH 2FOMB 1V2KT 1C1TA 1GJ5H 4NGAH 1P10A 3NZIA 2OBOA 4R0IA 1Z8IB 1HJAB 5A0BA 3RXQA 1Z1IA 1GBKA 5C1YA 1JIRA 1O36A 1UJ1A 4E7RG 3BTQE 3F6UH 4FUEA 1F7ZA 1V6DA 1NU7B 1GBMA 3UQVA 5EPYA 3KEEA 4BTTB 1O5DH 1YM0A 3V0XA 1K1LA 2ZCHP 2C8XB 2CV3A 4AZ2B 1VJ9U 3KQBA 4XBDA 1GJCB 3K2UA 3SUFA 1V3XA 3ATMA 1IQEA 1EPTC 2ZPQA 3ATLA 1ZZZA 3DA9B 2GZ8A 1HAVB 1CHGA 1K2I1 3RXIA 2F9BH 2K1QA 3TJUA 6CHAB 1J14A 2ZGCA 3NWUA 1NFXA 5E2PA 5JYIA 1WCZA 2AGGX 2A7HA 2A5IA 2THFB 4OS7A 2C4FH 3U1JB 2NU3E 5B6OA 1L0ZA 2A1DB 5GPIB 1VCPA 4F49A 5AHGH 1LVMA 1CT0E 3DFJA 2Z3EA 2PFEA 2CHAC 1C1QA 2EA3A 3E91A 1WV7H 1PPZA 5EXMA 2GP9B 5DK1A 2WINI 1QQUA 3S9AA 1TNLA 3GOVB 1A5HA 2XC4A 1SGDE 2FOFA 1YP9A 4INLA 1TX7A 1C1PA 4MNYA 2SGEE 2FEQH 1LVYA 2H2ZA 3VGCC 4U01A 1BTWA 1QB9A 1VITG 1RXPA 4WMFA 1C5QA 1GG6B 1E37B 1MAYA 2AMPA 1O2GH 5C1UA 1KDQB 1S0QA 1TIOA 3CS7A 2O8UA 2WYJA 3BN9A 4Y7AA 4IN1A 3P6ZB 4BAQB 5C5NA 2PW8H 1JIMA 3MU1A 4YM9A 1NRPH 3RUOA 1NRQH 2ODPA 1VZQH 3O8RA 3D62A 5C1XA 4B2CA 2BY5X 5DP8A 1L1JA 1QY6A 2BDBA 2IN2A 9ESTA 4OS4A 3QDZB 3E16B 4YLUA 3ZZ7A 1TABE 2B7DH 3MH4A 5E0GA 3TVJB 2BDGA 3ZVCA 3T62A 1YLDA 1AIXH 2M5TA 2Z3CA 2PR3A 3GCTF 3GCHB 4NIWA 1LHCH 4WMEA 4IGDA 2AIQA 3ZZCA 4AGJA 2A31A 5DP4A 4ZROA 2STAE 3OX7U 2G81E 1P09A 1CSOE 1CVWH 1GBJA 1HUTH 4TY6A 4AFSA 8KME2 1ID5H 4B71A 1C5MD 3OTJE 3SUEA 3SW2B 2V35A 3SGQE 4LZ1H 4X8VH 2OC0A 2ZEBA 1C9TA 2RA3A 4RKJB 2FP7B 4Y76A 2XBWA 3HGNA 4E05H 1NROH 2FYQA 2PLXA 4WMDA 4ZUHA 1YPMH 2UWOA 3V3MA 2PKSB 4JK5A 1GI8B 2WUBA 2Y5HA 2ZI2H 2PKAA 1QA0A 1BMMH 3G01A 1H9HE 2GD4B 2B5TB 5FHTA 4NZQA 3A80A 3SI3H 2FESH 1GHZA 2QIQA 3BTDE 4JZ1A 1NTPA 4VGCC 1O3OA 3BEFB 5FBEA 3RXHA 4IW4E 3Q3YA 4LOYH 1CBWC 8GCHG 5LH8A 2BLVA 1NFYA 1HJ9A 1ZGVA 5F8TA 5DGJA 2ZIQH 3SNEA 3UPEA 1O3MA 1LQEA 4GPGA 4YOGA 1DSUA 2QF3A 5FCKA 1FV9A 1HAZB 5SGAE 2ASUB 1SI5H 3UWJH 1V2WT 4ZH8A 1TLDA 6GCHF 2FOEA 4ABFA 1PPCE 2Q6FA 4ABEA 4INKA 1H1BA 1UTQA 1CQQA 1S84A 1IQHA 3V12A 1WYKA 4BTUB 2UWLA 1D4PB 1H4WA 1GL0E 1SGEE 4WJG2 2B0FA 3A89A 4KTCA 4GAWA 1V2QT 4XSKU 1GI3A 4E06H 2ZFTA 3H7TA 1N1LA 3VB4A 3LONA 3BG4B 1C5WB 1G3BA 3ATKA 3GY4A 3T25A 4CRBA 1S5SA 1G9IE 1PFXC 2ZU5A 4ZMAH 1GJDB 3RXKA 2BD7A 1BBRH 4OS1A 4IC6A 3SU6A 1DANH 1VGCB 1C2IA 2ZG0H 4DJZB 1HAIH 4NIVA 2Z7FE 1GBCA 1GBLA 5ESTE 3RXMA 2Z3DA 5DP7A 2XCNA 1XXDA 3LGYA 2ZQ2A 3ODFA 3HGPA 5EGMA 4CRAA 1P9SA 2G4TA 1FMGA 3A84A 1O3DA 2C8YB 4NIXA 3NCLA 1HAVA 1TAWA 1IQIA 3MNBA 3PLKA 1BTPA 2DE8A 2BY8X 2NU4E 4MTBA 1RD3B 2JKHA 1GI2A 1FY5A 1DT2A 1FAXA 1G36A 1ZJKA 1Z1JA 1V2LT 1YCPH 2ZDMA 1F2SE 1T4VH 1YGCH 2GGVB 2Z9JA 1TBRH 1Q31A 5BRRE 2A2XH 2RCEA 4X8UH 2BDCA 3RXOA 5FCRA 1XKAC 4UFFH 4A7IB 5DG6A 1O38A 3E6PH 2AGEX 5FX6A 3GCOA 2Z9LA 3UWIA 2ZHFH 3WY8A 2GCHF 3SJ9A 3TK5A 1DX5M 4A1TA 1UK2A 3BSQA 3M7TA 2HNTF 5JBCS 9LPRA 2BD2A 3KF2A 5F8ZA 2F3CE 2AYWA 3ESTA 1GPZA 3MO3A 1OOKB 3U98H 3VXFH 2ZFSA 3V7TA 4AFZA 1TMUH 1ZHPA 3ITIA 5C67A 3SNDA 1XM1A 1P12E 1OPHB 1DWBH 1YKTA 1KDQA 5FPTA 3SU2A 1BZXE 2Z94A 3D65E 4R8TB 3U8RH 2A4GA 4B2BA 2AS9A 3MNXA 5J4QA 4MLFB 1CT2E 4WWYA 2BLWA 3PB1E 3M3SA 4MQAA 2EI8A 4CHAC 4K8BA 2XYAA 1P01A 2FOHA 2TGPZ 1K9OE 2W5EA 5LPEA 3F9FA 3A8CA 5DKMA 1TX8A 1Y5BT 2OBQA 4NWKA 2IOTA 4ABAA 4JYUH 1C2JA 3LIWA 1IHSH 5EXNA 3ZVEA 1AB9B 3RMLH 1C4U2 1TA6A 3TU7H 3E8LA 2W3IA 1JXPA 3S69A 2UUFB 1O2HA 2Q1JA 1O5FH 1RTFB 1P8VC 4I7YH 1WBGB 2YNBA 3T26A 2FI5E 3ZZ4A 5IYTA 2P3FH 3ATIA 1GI7B 3GY7A 1Y3WA 1O3LA 3SUDA 1NRRH 1C1WH 3M5MA 5DO4H 3LOXA 1O35A 1FIWA 3A81A 3SO3A 2ZWLH 3LGVA 4BOHA 4B73A 2Y5GA 1HBTH 4DW2U 5CHAB 1GHXH 2GDDA 2IPHA 3MU0A 3RLYH 2Q6DA 3QTOH 5T6DA 1AVWA 2XNIA 1KXFA 4WH8A 3TH2H 1TRYA 1SQAA 3QN7A 1LVBA 2FS9A 4FVBA 4DURA 5EW1H 5HM9A 2Y5FA 1AQ7A 1GVKB 2SGDE 4BAKB 1BMAA 1HYLA 2H5CA 1S81A 5AVDA 1UK4A 2BTCE 1UVPA 1O2QA 2VWOA 3LC5A 1SBWA 4QT8C 2XWBI 2ZO3H 1INCA 2XTTB 2CXVA 4TWYA 1VITF 2XC0A 5L30H 1AZZA 1TNIA 1WTHD 2SNVA 3IWMA 4ZKOU 4BAOB 3MO6A 2ODYB 3P8FA 1ESBA 1PPBH 1C5ZB 1GGDB 5L6NH 2GT7A 1A3BH 1SOZA 3EGKH 2PUXB 3ELAH 2YOLA 1C1VH 3SU4A 3PO1C 1ZR0A 1S0RA 4WF8A 3SGBE 1BMNH 1O2NA 1THSH 4O97A 1QL9A 2VWMA 3LH3A 2D26C 1FXYA 1P3EA 1W3CA 1KIGH 4MPVA 1ZHMA 2G5VA 5L2YH 1EZSC 1GBEA 1TNGA 1UTMA 1UVTH 4KP0A 1N6XA 1QL7A 3D23A 2H5DA 2VH6A 2Z6BD 4XOJA 4NCYA 2ZZUH 4DCDA 3C1KA 1TE0A 1TFXA 1NS3A 1MTNC 2VB0A 1N8OB 1DS2E 3QGJA 1MCVA 3LT3A 1O0DH 3ZZAA 4K60A 1BJVA 2W3KA 4BANB 3LJOA 2FIRH 2JETC 2CMYA 2A2QH 4H6SB 1Z7KA 2BYAX 1F0RA 1F0UA 1C5TA 1MQ6A 1FQ3A 1ETTH 3LU9B 2EI7A 3SJKA 1SHHB 1SQOA 1Z8GA 1C5OH 3RP2A 1QRWA 4O3UA 1D3TB 4CH8B 1C2DA 5JDUB 3LGIA 1QBNA 2A7JA 2ZPRA 4UD9H 4DGJA 3A7TA 5DP9A 1V2JT 2ZCKP 2BD3A 1NPMA 4D76A 2V6NA 2P8OB 4HZHA 1HV7A 1AE8H 2QXJA 2Z9IA 4O03A 4X2YA 4FUCA 3VB5A 3KN2A 3GY6A 1TA2A 1HXFH 1DE7H 3MU4A 1AD8H 3T28A 2HPQH 1TBZH 1OWIA 1OS8A 1O2XA 4NG9H 4WH6A 1A61H 4CRDA 3ZZDA 4IN2A 1RTLA 1W8BH 2VH0A 8GCHF 2ZU4A 7GCHG 1L1NA 4XDEA 5A2MH 1KLTA 1FPCH 1MAXA 1O2RA 2G51A 1Y3YA 2GV7A 5C5OA 1EQ9A 2BD5A 1O34A 4Q7XA 4HFPB 3RXEA 2FMJA 5A8XA 1ZMJA 2ALPA 3FZZA 3ZYEA 2A45B 1H8DH 3TGJE 2CGAA 4ABDA 3M61U 2OUAA 5C3NA 3EA9A 4CRCA 2A7CA 4X1SU 1LKAA 4NIYA 4BNRA 1PPEE 1D3PB 2P59A 4TPYA 1C1RA 1ANBA 4GVUA 3D49H 3MWIU 5DJ7A 4FU9A 4YZUA 1HXEH 2BDYA 2GT8A 1W0ZU 1Y3UA 2HPPH 2VIDA 3GDUA 2AERH 3ZZ9A 3BF6H 1QBOA 4DIIH 1TGTA 2B8OH 3Q3KA 3U1IB 3BTHE 1GMDG 1AFQC 2VNTA 1GHWH 2UUKB 4Y6DA 1FNIA 1BQYA 2QGRA 1C2FA 1AVXA 4THNH 1L1GA 4FVDA 2GKVE 1TOMH 1GMHG 2GDEH 1C5LH 4BAHB 1BTYA 4IC5A 5HM2A 3MH7A 4NA7A 1FONA 1GDUA 1GI1A 1UCYK 2Q6GA 3MH6A 1A0LA 1W14U 4NZLA 3GDSA 2PTNA 1PPGE 4Q7ZA 1HJ8A 1ZTLA 3AAVA 3A7ZA 3IITA 4FUDA 3BTEE 5JB8S 3V13A 4AOQA 1RTKA 1TALA 1DXWA 1B7XB 1DXPA 3LJJA 1C1MA 3NXPA 2ZP0H 5EQSA 2VIWA 3UNRA 3GISB 4UEHH 1V2UT 4XBCA 1ELAA 1TOCB 1BHXB 2VIPA 2Y7ZA 3P70B 4JYVH 4X2WA 5F8XA 3SORA 1GVZA 5EPNA 3KCGH 2I6SA 1T8NA 3M3VA 3SUGA 4MNWA 1OSSA 4GHTA 1HGTH 2GCTC 1AU8A 1GHBG 4RSPA 1C1NA 4TWWA 1ESAA 1KXDA 4X0WU 2SGPE 1ABJH 1P9UA 1TGNA 1W7GH 2W26A 2ULLA 1AO5A 5GJ4B 3STIA 1GI9B 2QA9E 2FTLE 2VGCB 2O8MA 3BIUH 5E2OA 1UVOA 2GMTC 2ZGJA 2ZNKH 4H6TA 1EOLA 2FXRA 3A7WA 2H6MA 5A8YA 1C2LA 2Y6TA 4MPWA 1WSSH 5A09A 1HB0B 2A4OA 3MO9A 1F5KU 1TBQH 1O5EH 2CN0H 1SPJA 4K8YA 5I46H 3MNCA 4FUIA 3MU5A 1PQAA 1DICA 5GDSH 4X2VA 2H1UA 1A5IA 2WYGA 2HWLB 1W12U 1SLXB 2BVRH 2R3YA 4UDWH 4I8LA 2WUCA 4IMZA 1SQTA 2ZDVH 4D7GA 2FOAA 3QTVH 3RXUA 3FVFB 1GI6A 1ZSJA 4K5ZA 3F9GA 4ABBA 3PMHB 3TJNA 3DUXH 1EP5A 1O2WA 2BZAA 5AFYH 4B2AA 1HRTH 1UTLM 5FAHA 1EAUA 1MKXK 3UQOA 1TB6H 2ANKH 1P2QA 1ORFA 1EKBB 4MDSA 1NFUA 2PUQH 1EPTB 3QGNB 3MFJA 1HDTH 2TPIZ 4ZXXH 3MYWA 2F83A 2BQWB 3U9AH 4AG1A 4X8TH 4Y8ZA 2BM2A 4X2XA 3AW1A 1BOQA 4Z6AH 4CBNA 1J8AA 1TGBA 3M5OA 2BX4A 3MTYA 4B74A 5L2ZH 2HRVA 2BD8A 3RC4A 3MH5A 1AE5A 4I8KA 1ZSKA 3O8DA 2FX4A 4GSOA 2BVSH 5LPFA 1K21H 3KGPA 3TPIZ 2BB4A 3C27B 3ZV9A 2FO9A 2CHAB 1TPPA 1K1NA 3RXPA 3M7QA 4LXBH 1TQ7B 1MH0A 1VCWA 1ZTKA 1C5PA 3PLBA 1DDJA 2OC8A 3RXGA 5JPMH 1DFPA 3SHCH 4ZHMU 1C1SA 1O3KA 2PGQB 5FBIA 1DWDH 2BDIA 1H8IH 3NK8A 3LKWA 1P2OA 1BRAA 3NKKA 3SV7A 3B9FH 3VGCB 3TJOA 4ABGA 4YOJA 1W10U 1C1OA 2STBE 3ZVGA 4GHQA 4Y10E 1WOFA 1B0EA 4A5TS 1FY3A 2G52A 2JH5D 1EAXA 1O3HA 3KIDU 1OKXA 4ISLA 4WXIA 1ANEA 1TQ0B 2VIQA 2FOGA 3RXTA 3SJIA 1D3DB 1FN6A 2WPKS 4MNVA 3SU3A 3GY3A 1DPOA 1UVUH 1Y8TA 4JZFH 3SJ8A 4Y8YA 3BIVH 4U2WA 3AASA 2J92A 1S82A 4DOQA 3SOSA 3HATH 1GBFA 1KTSB 1HIAB 4K1EA 2C8WB 1FY4A 1C5VA 1CHOG 3PWBA 2B9LA 3E0NB 1K1MA 2CF8H 2O8WA 2D2DA 2R0KA 1TONA 4AFQA 1QTFA 4LK4A 3JZ1B 1DY9A 3UNQA 2BOKA 4YT6H 5F6MA 1T4UH 2A5AA 1DVAH 2Y81A 3GCNA 1ZMNA 1OP2A 2SGFE 1ELGA 4O9VA 3SZNA 3S0NA 3SU5A 1D3QB 3VPKA 3SV8A 1L2EA 1V2VT 1BB0B 2BQ7B 4NSYA 1DLEA 1CA0C 4ZKRU 3ZV8A 3W94A 1NN6A 1QGFA 2BX3A 2A4RA 1QJ6B 1DY8A 2CF9H 4FUJA 1HAYB 2ZTYA 3A88A 3Q77A 2VWLA 1EASA 3AW0A 1RJXB 3FZDA 4H4FA 3OSYA 3GYMA 1CE5A 1NO9H 3RMMH 1B5GH 4YLQH 5GCHG 1O2YA 1UCYE 4AYYB 1AGJA 2P3UB 2H9HA 4AB9A 1C5XB 4VGCB 4Q80A 1EAIA 5G4BA 4LZ4B 4KKDA 4CRGA 3UY9A 3BTWE 1Y5UT 3N7OA 1CBWB 1N6YA 2BVXH 1SFQB 1C2HA 1WAYB 2FOBA 3QLPH 1UTNA 1GBHA 3GDVA 2BXTH 3UOPA 1PPHE 3F9HA 1CGJE 1GJBB 2WV5A 5GWZA 3ENSB 7GCHF 3VB6A 1P57B 4U30A 2ZDLA 3UTUH 5E0HA 1QURH 2ZFFH 3M37A 3LPRA 1G30B 1PPFE 1WU1A 3RXBA 1LTOA 2J34A 3FP7E 1EB1H 2XBXA 1E36B 1GBDA 2WPIS 3KQCA 1SGNE 3H7OA 1AZ8A 5A0AE 3LGUA 3BTME 3SV2H 5HGGA 2Z9KA 1GJ9B 3IG6B 1O3EA 4Z0KA 2BHGA 1EJMA 4Y0YE 3ZVDA 4SGBE 1GMCG 2BD4A 1AMHA 1P2JA 1MBQA 4ISIH 4BAMB 1PQ7A 3SQHE 2RDLA 4A1XA 4BXSA 2FPZA 1GMDF 2J94A 1ABIH 1BTUA 2C3SA 3RXJA 3OYPA 1O5CB 1A0HB 1NY22 1O32A 1GMHF 1KXBA 1Z8RA 5FX5A 1J17T 1BTHH 1C5NH 1G3EA 1OXGA 3RXFA 1C1UH 1SGFG 1LPKB 3K6YA 4ZAEA 3A86A 2P93A 2AGIX 1Y3VA 1GI0A 2VVCA 1ZMLA 3PTNA 1MZAA 3QWCH 2FLRH 1EPTA 3FAOA 2ZTZA 3RXCA 2A0QB 3TGIE 1YPHE 1Q2WA 3MMGA 2G00A 1NRSH 1AKSA 1MBMA 2HNTC 1SLUB 3QX5H 4I8JA 1AHTH 3K65B 1RFNA 3ZZ3A 2O8TA 3CP7A 1QHRB 1GHAG 1WUNH 1QJ1B 3SQEE 3I29A 3RC6A 2QXIA 1KXCA 2FTMA 1V2NT 1YPLH 1XXFA 2OP9A 3M5LA 4FXGH 3A8DA 5DP3A 1NT1A 6ESTA 2WV4A 4D8NA 1Z6JH 1MU6B 1GHBF 1EB2A 2JH6D 4INHA 1GJAB 3PYHA 1GWAA 1LPZB 1SG8B 1V2OT 1QBVH 2F9PA 1ACBE 1EP6A 2ZGBH 3KQEA 1LMWB 3MU8A 1HAHH 4ABIA 1ELTA 3A8BA 4NSVA 4MNXA 2VWNA 1XUGA 2QC2A 4FUGA 1LVOA 1THPB 1M9UA 3TK6A 2Y7XA 1O5AB 2HNTE 1ARCA 3A85A 1MD8A 5EG4A 1W13U 1AWFH 1RIWC 2TGDA 1CT4E 5K0HA 3EA8A 1SGPE 2PSYA 1BHXF 3E90B 4CHAB 2FLBH 3MI4A 4CBOA 2RA0A 1UTJA 3HK3B 1QB1A 4IS5A 3PV4A 1MD7A 4FUBA 3I78A 4X8SH 5EW2H 4FU7A 1Q3XA 2YNAA 4NFFA 1ELBA 4CR5A 2OC7A 1HIAA 2C93B 2ZECA 1QIXB 4K1TA 4A1VA 4DVAU 3TGKE 7KMEH 2ZU1A 5GIBA 1L4ZA 1ZGIA 3TH3H 2J2UA 4X1PU 3BTGE 2GZ7A 4AX9H 3GICB 2R2MB 2QYIA 3TK9A 4DY7B 4MG3A 3CENA 5EOKA 4K1SA 3A8AA 1HJAC 4K69A 4ZKSU 1SL3A 1O2VA 1MTWA 1T8MA 3KL6A 1TMBH 2BQ6B 3QUMP 5J4SA 1S6FA 4Q2KA 1A5GH 1SLVB 1TYNA 3SHAH 3S9CA 2AEIH 3S7KB 1O3PB 5IDKA 2TGTA 1AWHB 2AIPA 3EA7A 1ANCA 2GV6A 2NU0E 3OY5U 3SNCA 1EAWA 1YF4A 1SSXA 2O8LA 1O3NA 4AB8A 3UFAA 2FS8A 4GCHG 2LNCA 3BTKE 3VFEA 1DUAA 3AAUA 2R9PA 1VJAU 4XBBA 1DWEH 6CHAC 2ZHDA 1BJUA 1BMLA 1X7AC 1O2SA 4CH2B 2OINA 3U8TH 1P03A 1ETRH 2XBVA 1K1OA 2ZCLP 2VVUA 1O2UA 4I32A 2Y80A 1SVPA 3B23B 1DM4B 1JMOH 3TITA 3TIUA 1TGSZ 4U32A 1MUEB 1UMAH 3E1XB 1F0TA 3U8OH 2ZPSA 1G37A 1NESE 1EOJA 4KTSA 2J38A 3A7XA 1IHTH 1O2IA 3R0FA 4OS2A 3RXSA 4AN7A 5TCAA 3F9EA 3RXVA 2GX4A 1P2IA 1FUJA 1T32A 1IAUA 3F1SB 1MTVA 3OU0A 2J9NA 3PO1B 8ESTE 1HLTH 3SU0A 1DSTA 2FX6A 1GG6C 1THRH 1V2RT 4ISOA 2QN5T 4H42U 1C4V2 4E7NA 1CHOF 2VVVA 3EYDA 1F0SA 2ZTXA 5HMAA 4Y7BA 4F4OC 5H4IB 1G2MA 3I77A 2NWNA 2NU1E 1MTNB 1C5SA 3M3TA 1D6RA 2G4UA 2PGBB 2ZDAH 1SGQE 1KLIH 3RC5A 1IQFA 1HAGE 2Y82A 1P04A 2JETB 4MVNA 4CREA 1OX1A 5ABWA 1BT7A 4IMQA 3L6PA 1YPEH 1L4DA 1SC8U 4AFUA 1BCUH 1FZZA 3HKIB 3SV6A 1BA8B 2V3OH 4JYTA 1IQGA 1P2KA 4X6MA 1Y3XA 1LKBA 2ZQ1A 4MPUA 1Z71A 2FM2A 4OGXA 1F5RA 1A7SA 2ANWA 4BXWA 3GCHC 2QY0B 2ZKSA 3P95A 1ZTJA 3TH4H 5GCHF 3T2NA 4AORA 1J15A 4JMYA 1Z6EA 3AVZA 2VIVA 5E8EH 1NU9A 1ZPCA 1O33A 2WPJS 2ZGXH 3O8CA 3ZZBA 1BITA 1JRTA 3QK1A 4J2YB 1O2MA 3A7YA 1VR1H 3UNSA 3SNBA 4X6PA 1D9IA 2ILNA 4X1QU 1KXEA 1K22H 3ATWA 3RMOH 3RMNH 1J9CH 1OWJA 1IOEA 1EX3A 4Q7YA 3SV9A 2PKSC 1LO6A 3SBKA 1BBRK 2KAIA 1K1IA 2SNWA 1YYY1 1LHEH 1KXAA 1OYQA 1AFEH 1SFIA 4J1YA 1SGIB 1MKWK 1YLCA 2O9QA 1EXFA 1O37A 3TNSA 1AN1E 1AY6H 1GCTB 2ZC9H 5AF9H 1E35B 1HPGA 2ZA5A 8LPRA 4K2YA 3SGAE 1ZHRA 2EC9H 2PTCE 3SU1A 1IQNA 1S85A 1TRNA 2AMQA 2R0LA 1RGQA 1XUHA 2TGAA 1EZQA 1YCPK 1B0FA 1GMCF 3P8NA 1Y5AT 1O3GA 1VCQA 1DOJA 1C9PA 1P2MA 2SGQE 2ODQA 3SI4H 1AFQB 1TPSA 2F9NA 1BRBE 5PTPA 1O30A 1A4WH 1CU1A 5A0CA 1UHBB 5F03A 1A0JA 1QR3E 4AG2A 5EU8A 4ZHAA 1XUFA 2F9OA 1LHGH 2R2WU 4GLYA 1G3CA 5DP6A 2G55A 1NFWA 3BEIB 3PMBB 5GXPA 2VU8E 2EI6A 3RM0H 3DD2H 4TY7A 5HYOA 3EDXB 1TX6A 2JH0D 1C2GA 4I8HA 2UUJB 1GJ7B 4X6NA 4UE7H 1ZRKA 4B1TA 2XRCA 3HPTB 2PWXA 3A7VA 1AKSB 2P16A 4UFEH 3NPSA 3BG4C 4K3JA 3NUMA 3Q76A 4MPXA 1CA8B 2ALVA 3DFLA 4I31A 1JWTA 2FWWA 1GJ8B 1ARBA 4A92A 2BDHA 3RXAA 4Y8XA 1GVLA 1VGCC 3FP8E 4YT7H 1P0SH 1YBWA 1LHFH 2VINA 1TNJA 3QZQA 4X1NU 1PYTC 2F9VA 1GHAF 4I8GA 1WTGH 1O2OA 3P8OA 2GCTB 5CE1A 2OTVA 1P05A 2UUYA 2PV9B 1W0YH 2ZDNA 2A4QA 3RU4E 3STJA 1BUIA 2XC5A 4A6LA 1SGCA 2W7SA 1QRXA 1O3FA 4AYVB 4SGAE 4ZKNU 3FP6E 2ANMH 5AFZH 1C2KA 2GMTB 2P94A 3CS0A 4FUHA 4HI3A 1JOUB 5T3HA 1XX9A 3ZVFA 1GI4A 1GL1A 4UFDH 2V0BA 1FLEE 1P06A 1ETSH 1TRMA 2PHBA 5I25A 3S7HB 1K28D 4PROA 1T31A 1OP8A 2GVFA 4CR9A 1O3JA 1ZSLA 1W7XH 1LDTT 3BEUA 1V2ST 1FN8A 1UCYH 3RXRA 3BTFE 3EQ0H 1MCTA 2TBSA 5T6FA 1O5BB 3B8JA 1ANDA 3R3GB 3BG8A 3PM3A 1DLKB 1ELVA 3M7UA 5CMXH 2RG3A 1O3AA 1A2CH 4XE4A 3VEQB 3PWCA 1ELCA 1YCPM 2QV1A 1GDQA 1SLWB 1SB1H 1OWEA 4YO9A 1IQKA 1YC0A 5ESBA 1FJSA 3VB7A 3E0PB 1O2JA 2G5NA 3TJVA 3UUZA 2OQUA 1FY1A 3MOCA 2ZFQH 1EATA 3UIRA 4Y71A 2BLOA 3FANA 4M7GA 1KY9A 4DT7B 1FDPA 1XUIA 2VJ1A 5HXFA 2FZZA 3SJOA 1NRNH 1GJ4H 2D1JA 1A46H 3TLOA 3L33A 4D9RA 3PTBA 1C5UA 3M5NA 1LPGB 1AB9C 3A87A 3URCA 4UFGH 1O2TA 4GUXA 1GJ6A 4NA9H 5C20A 2XCFA 1UTKA 1OWDA 2HLCA 4RKOB 1BDAA 4FUFA 2ZU2A 1F5LA 1C5RA 2BLQA 1S83A 3TNTA 1MMJN 1AUJA 1GHVH 5JB9S 1MKWH 1ZPZA 3W95A 3L3TA 1RRKA 1WQSA 1C4Y2 4O3TA 1GHYH 1TPOA 2OXSA 3Q3XA 2XW9A 4ISNA 1P02A 2ZHEH 4B75A 4GCHF 1GCDA 1GBIA 2HALA 1W2KH 4DG4A 4FU8A 4ESTE 1DWCH 1SOTA 3OY6U 5EODA 4X6OA 5FPSA 2AH4X 4KGAA 3S9BA 1IQLA 2OD3B 3P92A 4OS5A 4ASHA 4BTIB 3PROA 3UR6A 5CHAC 3M36A 1KYNA 1TMTH 1ZJDA 2J95A 3ZYDA 4Y79A 1H9LB 6LPRA 1J16A 1O5GH 1GBAA 4YTAA 4JZDH 2BD9A 1MKXH 1SMFE 1GBBA 2ZDKA 3HK6B 1P2NA 4JZIA 2C8ZB 3LGWA 1HAXB 1UVSH 3M35A 1UK3A 2HOBA 1SGRE 1T8LA 1BTZA 1C5YB 1YPJH 1YPHC 1MZDA 4CRFA 1OWHA 3MNSA 1W11U 1SGYE 4D7FA 1BBRE 3ZZ8A 1XKBC 1EZUC 4X1RU 4NFEA 2DE9A 1DUEA 5EQQA 2P3TB 2BY6X 2A5KA 1GGDC 1CGIE 3BTTE 1CO7E 1ZRBA 3MHWU 1O3CA 1K1PA 1G3DA 5BPEA 2A32A 3UR9A 1V2MT 3T5FH 1V2TT 1CGHA 2ZGHA 2FODA 2TRMA 1JRSA 1ZOMA 2HVXA 1UHBA 1GBTA 1LHDH 1D6WA 3RXDA 4JZEH 5A8ZA 1Z8JB 1CA0B 2OCVB 2BMGB 1QNJA 1HFDA 1E0FD 4IBLH 2ZHQH 1YPGH 1RS0A 2F9UA 2CJIA 3GCTG 4YESB 1N8OC 1HCGA 1O31A 3ZVAA 1TNHA 4YOIA 2V3HH 4ISHH 4HTCH 1S6HA 2P95A 2OLGA 2FI4E 3ZZ6A 2QAAA 3ZVBA 2SGAA 5C2ZA 1QRZA 1TGCA 1QA7A 3ZZ5A 4Y11E 1XMNB 1LQDB 2H9EH 1DITH 2WPMS 4ZXYH 4OS6A 2J4IA 2GTBA 2ZU3A 1MTSA 4I33A 1SHYA 3LH1A 1UO6A 2IJOB 2D8WA 3RLWH 3KNXA 1TWXB 3DT0H 2KAIB 1XVOA 1EZXC 2AFQB 2FYRA 1V2PT 1ELFA 5ETXA 3U69H 3VXEH 4JK6A 3A83A 3KQDA 1P11E 1FAKH 2P8OC 3LC3A 2SFAA 1FY8E 5DPAA 1ELDE 2W7UA 2VIOA 2BXUH 5T6GA 1KLJH 5LPRA 1GI5A 1NZQH 2FI3E 3A82A 5E0JA 5K7RA 1FPHH 3JZ2B 1AVGH
chains in the Genus database with same CATH superfamily
1PJPA 2C90B 1IQJA 1H9IE 2UWPA 3KYGA 2BY7X 2BOHB 2ZF0H 3LGTA 5DP5A 1ZLRA 1Y59T 2R3UA 2WPHS 3BV9B 2QXHA 4ZHLU 1UTPA 1C2MA 1EUFA 1ZYOA 7ESTE 5JBTA 5TCCA 1ESTA 2QF0A 6GCHG 2GZ9A 1MU8B 1G2LA 4ABJA 4TYDA 4NA8A 3P17H 1NC6A 1E38B 5EQRA 1FIZA 2OK5A 1KSNA 4D9QA 2XWAA 1BRCE 1QCPA 3UOUA 1O2PA 1ELEE 1K1JA 1P3CA 1F92A 1OYTH 2ANYA 3F68H 3LDXH 3PLPA 3O8BA 3H5CB 2Z9GA 2XXLA 3T29A 1MTUA 3HKJB 3EAJA 5LGOA 1WQVH 1BIOA 1NM6A 1OWKA 2EEKA 2FDAA 2HGTH 1TNKA 4TPIZ 4NWLA 4JCNA 2I6QA 3DHKH 2ESTE 4Y0ZE 1BMFD 1HAPH 1VITH 1SR5C 5TJXA 1TPAE 1O39A 1QQ4A 3EE0B 1U6QA 3RU4T 2ZFRH 1O2LA 3FFGA 1C2EA 1LCYA 4KELA 1OP0A 1AI8H 1ZPBA 1UTOA 3QO6A 3RM2H 5IK2D 1A3EH 2NU2E 3Q00A 3E3TA 3URDA 3KHVA 2FOCA 2XBYA 4HGCA 1HAOH 3ODDA 2G8TA 1PQ8A 3SN8A 5FXLA 2DUCA 3QZRA 3SNAA 3T27A 2PKAB 1XUKA 7LPRA 1BTXA 2VBCA 2RDEA 4UONA 2OQ5A 1SGTA 2F91A 4WVPE 3VB3A 1IQMA 4RN6A 2BZ6H 4AGKA 4RI0A 1KTTB 3K6ZA 1MQ5A 1XUJA 1PQ5A 5JBAS 3RU4D 2BDAA 1FI8A 1AUTC 4ABHA 1E34B 3GY8A 1QJ7B 3RDZA 2WPLS 4OGYA 1QB6A 3PMAB 1YPKH 1QL8A 4WXVA 1H8HD 1HNEE 1SGFA 5JBBS 2TIOA 1A1RA 5EXLA 2GCHG 2H9TH 1O3IA 4B76A 3RXLA 3UREA 2LPRA 1T7CA 1O3BA 4XFQA 1JBUH 1RIWB 3K9XB 2PSXA 5FPYA 2VGCC 3GY5A 1XVMA 1QFKH 3GYLB 1T8OA 3GY2A 1EJNA 3PMJA 4KTUA 2QXGA 2QCYA 1O2ZA 4WY3A 2BY9X 1BRUP 1GCTC 1PYTD 2ZHWH 1O2KA 1EJAA 2AMDA 2OC1A 1GDNA 1G32B 2ZFPH 3P8GA 4DIHH 2FOMB 1V2KT 1C1TA 1GJ5H 4NGAH 1P10A 3NZIA 2OBOA 4TT3D 4R0IA 5DN6D 1Z8IB 1HJAB 5A0BA 3RXQA 1Z1IA 1GBKA 5C1YA 1JIRA 1O36A 1UJ1A 4E7RG 4ASUD 3BTQE 3F6UH 4FUEA 3WWBA 1F7ZA 1V6DA 1NU7B 1GBMA 3UQVA 5EPYA 3KEEA 3WWFA 1O5DH 4BTTB 1YM0A 3V0XA 1K1LA 4XRNA 2ZCHP 2C8XB 2CV3A 4AZ2B 1VJ9U 3KQBA 4XBDA 1GJCB 3K2UA 3SUFA 1V3XA 3ATMA 1IQEA 1EPTC 2ZPQA 3ATLA 1ZZZA 3DA9B 2GZ8A 1HAVB 1CHGA 1K2I1 3RXIA 2F9BH 2K1QA 3TJUA 6CHAB 1J14A 2ZGCA 3NWUA 1NFXA 5E2PA 5JYIA 1WCZA 2AGGX 2A7HA 2A5IA 2THFB 4OS7A 2C4FH 3U1JB 2NU3E 3DSPA 5B6OA 1L0ZA 2A1DB 5GPIB 1VCPA 4F49A 5AHGH 1LVMA 1CT0E 3DFJA 2Z3EA 2PFEA 2CHAC 1C1QA 2EA3A 3E91A 1WV7H 1PPZA 5EXMA 2GP9B 5DK1A 2WINI 1QQUA 3S9AA 1TNLA 3GOVB 1A5HA 2XC4A 1SGDE 2FOFA 2QF4A 1YP9A 4INLA 1TX7A 1C1PA 4MNYA 2SGEE 2FEQH 1LVYA 2H2ZA 3VGCC 4U01A 1BTWA 1QB9A 1VITG 1RXPA 4WMFA 1C5QA 1GG6B 1E37B 1MAYA 2AMPA 1O2GH 5C1UA 1KDQB 1S0QA 1TIOA 3CS7A 2O8UA 2WYJA 3BN9A 2AHME 5C94A 4Y7AA 4IN1A 3P6ZB 4BAQB 5C5NA 2PW8H 1JIMA 3MU1A 4YM9A 1NRPH 3RUOA 1NRQH 2ODPA 1VZQH 3O8RA 3D62A 5C1XA 4B2CA 2BY5X 2LELA 5DP8A 1L1JA 1QY6A 2L6OA 2BDBA 2IN2A 2L74A 9ESTA 4OS4A 3QDZB 3E16B 4YLUA 3ZZ7A 1TABE 2B7DH 3MH4A 5E0GA 3TVJB 2BDGA 3ZVCA 3T62A 1YLDA 1AIXH 2M5TA 2Z3CA 2PR3A 2V7QD 3GCTF 3GCHB 4NIWA 1LHCH 4WMEA 4IGDA 2AIQA 3ZZCA 4AGJA 2A31A 5DP4A 4ZROA 2STAE 3OX7U 2G81E 1P09A 1CSOE 3UB0A 1CVWH 1GBJA 1HUTH 2KZ4A 4TY6A 5T1VA 4AFSA 1ID5H 8KME2 4B71A 1C5MD 3OTJE 3SUEA 3SW2B 2V35A 3SGQE 4LZ1H 4X8VH 2OC0A 2ZEBA 1C9TA 2JDID 2RA3A 4RKJB 5C0TA 2FP7B 4Y76A 2XBWA 3HGNA 4E05H 1NROH 2FYQA 2PLXA 4WMDA 4ZUHA 1YPMH 2UWOA 3V3MA 2PKSB 4JK5A 1GI8B 2WUBA 2Y5HA 2ZI2H 2PKAA 1QA0A 1BMMH 3G01A 1H9HE 2WV9A 3F3BA 2GD4B 2B5TB 5FHTA 4NZQA 3A80A 3SI3H 2FESH 1GHZA 2QIQA 3BTDE 4JZ1A 1NTPA 4VGCC 1O3OA 3BEFB 2IPQX 5FBEA 3RXHA 1UW7A 4IW4E 3Q3YA 4LOYH 1CBWC 8GCHG 5LH8A 2BLVA 1NFYA 1HJ9A 1ZGVA 5F8TA 5DGJA 4RT1A 2ZIQH 3SNEA 3UPEA 1O3MA 1LQEA 4GPGA 4YOGA 1DSUA 2QF3A 3PV5A 5FCKA 1FV9A 1HAZB 5SGAE 2ASUB 1SI5H 3UWJH 1V2WT 4ZH8A 1TLDA 6GCHF 2FOEA 4ABFA 4FOUC 5F53A 3OAAD 1PPCE 2Q6FA 4ABEA 4INKA 1H1BA 1UTQA 1CQQA 1S84A 1IQHA 3V12A 1WYKA 4BTUB 2UWLA 1D4PB 1H4WA 1GL0E 1SGEE 4WJG2 2B0FA 3A89A 2PP6A 4KTCA 4GAWA 1V2QT 4XSKU 1GI3A 4E06H 2ZFTA 3H7TA 1N1LA 3VB4A 3LONA 3W1EA 3BG4B 1C5WB 1G3BA 3ATKA 3GY4A 3T25A 4CRBA 1S5SA 1G9IE 1PFXC 2ZU5A 4ZMAH 1GJDB 3RXKA 2BD7A 1BBRH 4OS1A 4IC6A 3SU6A 1DANH 1VGCB 1C2IA 2ZG0H 4DJZB 1HAIH 4NIVA 2Z7FE 1GBCA 1GBLA 5ESTE 3RXMA 2Z3DA 5DP7A 2XCNA 1QZ8A 1XXDA 3LGYA 2ZQ2A 3ODFA 3HGPA 5EGMA 4CRAA 1P9SA 2G4TA 1FMGA 3A84A 1O3DA 2C8YB 4NIXA 3NCLA 1HAVA 1TAWA 1IQIA 3MNBA 3PLKA 4P02A 1BTPA 2DE8A 2BY8X 2NU4E 4MTBA 1RD3B 2JKHA 1GI2A 1FY5A 4ACAA 1DT2A 1FAXA 1G36A 1WDIA 1Z1JA 1V2LT 1YCPH 1ZJKA 2ZDMA 1F2SE 1T4VH 1YGCH 2GGVB 2Z9JA 1TBRH 1Q31A 5BRRE 2A2XH 2RCEA 4X8UH 2BDCA 3RXOA 5FCRA 1XKAC 4UFFH 4A7IB 5DG6A 1O38A 3E6PH 2CK3D 2AGEX 5FX6A 3GCOA 2Z9LA 3DSGA 3UWIA 2ZHFH 3WY8A 2GCHF 3SJ9A 3TK5A 1DX5M 4A1TA 1UK2A 3BSQA 3M7TA 2HNTF 5JBCS 9LPRA 2BD2A 3KF2A 5F8ZA 2F3CE 2AYWA 3ESTA 5HKKD 1GPZA 3MO3A 1NBME 2KR7A 1OOKB 3U98H 3VXFH 2ZFSA 3V7TA 4AFZA 1TMUH 1ZHPA 3ITIA 5C67A 3SNDA 1XM1A 1P12E 1OPHB 1DWBH 1YKTA 1KDQA 5C17A 5FPTA 3SU2A 1BZXE 2Z94A 3D65E 4R8TB 3U8RH 2A4GA 4B2BA 2AS9A 3MNXA 5J4QA 4MLFB 1CT2E 4WWYA 2BLWA 4F55A 3PB1E 3M3SA 4MQAA 2EI8A 4CHAC 4K8BA 2XYAA 1P01A 2FOHA 2TGPZ 1K9OE 2W5EA 5LPEA 3F9FA 3A8CA 5DKMA 1TX8A 1Y5BT 2OBQA 4NWKA 2IOTA 4ABAA 4JYUH 1C2JA 3LIWA 1IHSH 5EXNA 3ZVEA 1AB9B 3RMLH 1C4U2 1TA6A 5EJLA 3TU7H 3E8LA 2W3IA 1JXPA 3S69A 2UUFB 1O2HA 2Q1JA 1O5FH 1RTFB 1P8VC 4I7YH 1WBGB 2YNBA 3T26A 2FI5E 3ZZ4A 5IYTA 2P3FH 3ATIA 1GI7B 3GY7A 1Y3WA 1O3LA 3SUDA 1NRRH 1C1WH 3M5MA 5DO4H 3LOXA 1O35A 1FIWA 3A81A 3SO3A 2ZWLH 3LGVA 4BOHA 4B73A 1YY3A 2Y5GA 1HBTH 4DW2U 5CHAB 1GHXH 2GDDA 2IPHA 3MU0A 3RLYH 2Q6DA 3QTOH 5T6DA 1AVWA 2XNIA 1KXFA 4WH8A 3TH2H 1TRYA 1SQAA 3QN7A 1LVBA 2FS9A 4FVBA 4DURA 5EW1H 5HM9A 2Y5FA 1AQ7A 1GVKB 2SGDE 4BAKB 1BMAA 1HYLA 2H5CA 1S81A 5AVDA 1UK4A 1KMHB 2BTCE 1UVPA 1O2QA 2VWOA 3WW7A 3LC5A 1SBWA 4QT8C 2XWBI 2ZO3H 3N7EA 1INCA 2XTTB 4AC9A 2CXVA 4TWYA 1VITF 2XC0A 5L30H 1AZZA 1TNIA 1WTHD 2SNVA 3IWMA 4ZKOU 4BAOB 3MO6A 2ODYB 3P8FA 1ESBA 4F48B 1PPBH 1C5ZB 1GGDB 5L6NH 2GT7A 1A3BH 1SOZA 2K0QA 3EGKH 2PUXB 3ELAH 2YOLA 1C1VH 3SU4A 3PO1C 1ZR0A 1S0RA 2J98B 4WF8A 3SGBE 1BMNH 1O2NA 3N99A 1THSH 4O97A 1QL9A 2VWMA 3LH3A 2D26C 1FXYA 1P3EA 1W3CA 1KIGH 4MPVA 1ZHMA 2G5VA 5L2YH 1EZSC 1GBEA 1TNGA 1UTMA 1UVTH 4I86A 4KP0A 1N6XA 1QL7A 3D23A 2H5DA 2VH6A 2Z6BD 4XOJA 4NCYA 2ZZUH 4DCDA 3C1KA 1TE0A 1TFXA 1NS3A 1MTNC 2VB0A 1N8OB 1DS2E 3QGJA 1MCVA 3LT3A 1O0DH 3ZZAA 4K60A 1BJVA 2W3KA 4BANB 3LJOA 2FIRH 2EY4C 2JETC 2CMYA 2A2QH 4H6SB 1Z7KA 2BYAX 1F0RA 1F0UA 1C5TA 1MQ6A 1FQ3A 1ETTH 3LU9B 2EI7A 3SJKA 1SHHB 1SQOA 1Z8GA 1C5OH 3RP2A 1QRWA 4O3UA 1D3TB 4CH8B 1C2DA 5JDUB 3LGIA 1QBNA 2A7JA 2ZPRA 4UD9H 4DGJA 3A7TA 5DP9A 1V2JT 2ZCKP 2BD3A 4OM9A 1NPMA 5CHBA 3OEHD 4D76A 2V6NA 2P8OB 4HZHA 1HV7A 1AE8H 2QXJA 2Z9IA 4O03A 2WSSD 4X2YA 4FUCA 3VB5A 3KN2A 3GY6A 1TA2A 1HXFH 1DE7H 3MU4A 1AD8H 3T28A 2HPQH 1TBZH 1OWIA 1OS8A 1O2XA 4NG9H 4WH6A 2V3MA 1A61H 3SYJA 4CRDA 3ZZDA 4IN2A 1RTLA 1W8BH 2VH0A 8GCHF 2ZU4A 7GCHG 1L1NA 4XDEA 5A2MH 1KLTA 2IJD1 1FPCH 1MAXA 3KYFA 2W6JD 1O2RA 2G51A 1Y3YA 2GV7A 5C5OA 1EQ9A 5KEDA 2BD5A 1O34A 4Q7XA 4HFPB 3RXEA 2FMJA 5A8XA 1ZMJA 2ALPA 3FZZA 3ZYEA 2A45B 1H8DH 3TGJE 5CDFE 2CGAA 4ABDA 3M61U 2OUAA 5C3NA 3EA9A 4CRCA 2A7CA 4X1SU 1LKAA 4NIYA 4BNRA 1PPEE 1D3PB 2P59A 1VKYA 1C1RA 1ANBA 4TPYA 4GVUA 3D49H 3MWIU 5DJ7A 4FU9A 4YZUA 1HXEH 2BDYA 2GT8A 1W0ZU 1Y3UA 2HPPH 2VIDA 3GDUA 2AERH 3ZZ9A 3BF6H 1QBOA 4DIIH 1TGTA 2B8OH 3Q3KA 3U1IB 3BTHE 1GMDG 1AFQC 2VNTA 1GHWH 2UUKB 4Y6DA 1FNIA 1BQYA 2QGRA 1C2FA 3EE7A 1AVXA 4THNH 1L1GA 4FVDA 2GKVE 1TOMH 1GMHG 2GDEH 1C5LH 4BAHB 1BTYA 4IC5A 5HM2A 3MH7A 4NA7A 1FONA 1GDUA 1GI1A 1UCYK 2Q6GA 3MH6A 1A0LA 1W14U 4NZLA 3GDSA 2PTNA 1PPGE 4Q7ZA 1HJ8A 1ZTLA 3AAVA 3A7ZA 3IITA 4FUDA 3BTEE 5JB8S 3V13A 4AOQA 1RTKA 1TALA 1DXWA 1B7XB 1DXPA 3LJJA 1C1MA 3NXPA 2ZP0H 5EQSA 2VIWA 3UNRA 3GISB 4UEHH 1V2UT 2JJ1D 4XBCA 1ELAA 1TOCB 2EQNA 1BHXB 2VIPA 2Y7ZA 3P70B 4JYVH 4X2WA 5F8XA 3SORA 1GVZA 5EPNA 3KCGH 2I6SA 1T8NA 3M3VA 3SUGA 4MNWA 2JJ2D 1OSSA 4GHTA 1HGTH 2GCTC 1AU8A 1GHBG 4RSPA 1C1NA 4TWWA 1ESAA 1KXDA 4X0WU 2SGPE 1ABJH 1P9UA 1TGNA 1W7GH 2W26A 2ULLA 1AO5A 5GJ4B 3STIA 1GI9B 2QA9E 4ACBA 2FTLE 2VGCB 2O8MA 3BIUH 5E2OA 1UVOA 2GMTC 2ZGJA 2ZNKH 4H6TA 1EOLA 2FXRA 3A7WA 2H6MA 5A8YA 1C2LA 2Y6TA 4MPWA 1WSSH 5A09A 1HB0B 2A4OA 3MO9A 1F5KU 1TBQH 1O5EH 2CN0H 1SPJA 4K8YA 5I46H 3MNCA 4FUIA 3MU5A 1PQAA 1DICA 5GDSH 4X2VA 2H1UA 1A5IA 1NBMD 2WYGA 2HWLB 1W12U 1SLXB 2BVRH 2R3YA 4UDWH 4I8LA 2WUCA 4IMZA 1SQTA 2ZDVH 4D7GA 2FOAA 3QTVH 3RXUA 3FVFB 2M2AA 1GI6A 1ZSJA 4K5ZA 3F9GA 4ABBA 3PMHB 3PV2A 3TJNA 3ZIAD 3DUXH 2J98A 1EP5A 1O2WA 2BZAA 5AFYH 4B2AA 1HRTH 1UTLM 5FAHA 3OE7D 1EAUA 1MKXK 3UQOA 1TB6H 2ANKH 1P2QA 1ORFA 1EKBB 4MDSA 1NFUA 2PUQH 1EPTB 3QGNB 3MFJA 1HDTH 2TPIZ 4ZXXH 3MYWA 2F83A 2BQWB 3U9AH 4AG1A 4X8TH 4Y8ZA 2BM2A 4X2XA 3AW1A 1BOQA 4Z6AH 4CBNA 1J8AA 2KM0A 1TGBA 3M5OA 2BX4A 3MTYA 4B74A 5L2ZH 2HRVA 1E79D 2BD8A 3RC4A 3MH5A 2J5UA 1AE5A 4I8KA 1ZSKA 3O8DA 2FX4A 4GSOA 2BVSH 5LPFA 1K21H 3KGPA 3TPIZ 2BB4A 3C27B 3ZV9A 2FO9A 2CHAB 1TPPA 1K1NA 3RXPA 3M7QA 4LXBH 1YLNA 5HIZA 1TQ7B 1MH0A 1VCWA 1ZTKA 1C5PA 3PLBA 1DDJA 2OC8A 3RXGA 5JPMH 1DFPA 3SZEA 3SHCH 4ZHMU 1C1SA 1O3KA 2PGQB 3PRBA 5FBIA 1DWDH 2BDIA 1H8IH 1S6LA 3NK8A 3LKWA 5EJ1A 1P2OA 1BRAA 3NKKA 3SV7A 3B9FH 3VGCB 3TJOA 4ABGA 4YOJA 1W10U 1C1OA 2STBE 1OHHD 3ZVGA 4GHQA 4Y10E 1WOFA 1B0EA 4A5TS 1FY3A 2G52A 2JH5D 1EAXA 1O3HA 5C0UA 2KCYA 5EJZA 3KIDU 1OKXA 4ISLA 4WXIA 1ANEA 1H8ED 1TQ0B 2VIQA 2FOGA 3RXTA 3SJIA 1D3DB 1FN6A 2WPKS 4MNVA 3SU3A 3GY3A 1DPOA 1UVUH 2XNDD 1Y8TA 4JZFH 3SJ8A 4Y8YA 3BIVH 4Q63A 4U2WA 3AASA 2KCAA 2J92A 1S82A 4DOQA 3SOSA 3HATH 1GBFA 1KTSB 1HIAB 4K1EA 2C8WB 1FY4A 1C5VA 1CHOG 3PWBA 2B9LA 3E0NB 1K1MA 2CF8H 2O8WA 2D2DA 1WXRA 2R0KA 1TONA 4AFQA 1QTFA 4LK4A 3JZ1B 1DY9A 3NRLA 3UNQA 2BOKA 4YT6H 5F6MA 1T4UH 3FO8D 2A5AA 1DVAH 2Y81A 3GCNA 1ZMNA 1OP2A 2SGFE 1ELGA 2YMSC 4O9VA 3SZNA 3S0NA 3SU5A 1D3QB 3VPKA 3SV8A 1L2EA 1V2VT 1BB0B 2BQ7B 4NSYA 1DLEA 1CA0C 4ZKRU 3ZV8A 3W94A 1NN6A 1QGFA 2BX3A 2A4RA 3FN8A 1QJ6B 1DY8A 2CF9H 4FUJA 1HAYB 2ZTYA 3A88A 3Q77A 2VWLA 3F0PA 1EASA 3AW0A 2KX4A 1RJXB 3FZDA 4H4FA 3OSYA 3GYMA 1CE5A 1NO9H 3RMMH 1B5GH 4YLQH 5GCHG 1O2YA 1UCYE 4AYYB 3F2GA 1AGJA 2P3UB 5GNDA 2H9HA 4AB9A 1C5XB 4VGCB 4Q80A 1EAIA 5G4BA 4LZ4B 4KKDA 4CRGA 3UY9A 3BTWE 1Y5UT 3N7OA 1CBWB 1N6YA 2BVXH 1SFQB 1C2HA 1WAYB 2FOBA 3QLPH 1UTNA 1GBHA 5KGOA 3GDVA 2BXTH 3UOPA 1PPHE 3F9HA 1CGJE 1GJBB 2WV5A 5GWZA 3ENSB 7GCHF 3VB6A 1P57B 4U30A 2ZDLA 3UTUH 5E0HA 1QURH 2ZFFH 3M37A 3LPRA 1G30B 1PPFE 1WU1A 3RXBA 1LTOA 2J34A 3FP7E 1EB1H 2XBXA 1E36B 1GBDA 2KCOA 2WPIS 3KQCA 1SGNE 3H7OA 1AZ8A 5A0AE 3LGUA 3BTME 3SV2H 5HGGA 2Z9KA 1GJ9B 3IG6B 1O3EA 4Z0KA 2BHGA 4FETA 1EJMA 4Y0YE 3F2FA 3ZVDA 4SGBE 1GMCG 2BD4A 1AMHA 1P2JA 1MBQA 4ISIH 4BAMB 1PQ7A 3SQHE 2RDLA 4A1XA 4B6EA 4BXSA 2FPZA 1GMDF 2J94A 1ABIH 1BTUA 2C3SA 3RXJA 3OYPA 1O5CB 1A0HB 3PRDA 1NY22 1O32A 1GMHF 1KXBA 1Z8RA 5FX5A 1J17T 1BTHH 1C5NH 1G3EA 1OXGA 3RXFA 1C1UH 1SGFG 1LPKB 3K6YA 4ZAEA 3A86A 2P93A 2AGIX 1Y3VA 1GI0A 2VVCA 1ZMLA 3PTNA 1MZAA 3QWCH 2FLRH 1EPTA 3FAOA 2ZTZA 3RXCA 4Z1MD 2A0QB 3TGIE 1YPHE 1Q2WA 3MMGA 2G00A 1NRSH 1AKSA 1MBMA 2HNTC 1SLUB 3GS9A 3QX5H 4I8JA 1AHTH 3K65B 1RFNA 3ZZ3A 2O8TA 3CP7A 1QHRB 1GHAG 1WUNH 1QJ1B 3SQEE 3I29A 3RC6A 2QXIA 1KXCA 2FTMA 1V2NT 1YPLH 1XXFA 2OP9A 3M5LA 4FXGH 3A8DA 5DP3A 1NT1A 6ESTA 2WV4A 4D8NA 1Z6JH 1MU6B 1GHBF 1EB2A 2JH6D 4INHA 1GJAB 3PYHA 1GWAA 1LPZB 1SG8B 1V2OT 1QBVH 2F9PA 1ACBE 1EP6A 2ZGBH 3KQEA 1LMWB 3MU8A 1HAHH 3OFND 4ABIA 1ELTA 3A8BA 4NSVA 4MNXA 2VWNA 1XUGA 2QC2A 4FUGA 1LVOA 1THPB 1M9UA 3TK6A 2Y7XA 1O5AB 2HNTE 1ARCA 3A85A 1MD8A 5EG4A 1W13U 1AWFH 1RIWC 2TGDA 1CT4E 5K0HA 3EA8A 1SGPE 2PSYA 1BHXF 3E90B 4CHAB 2FLBH 3MI4A 4CBOA 2RA0A 1UTJA 3HK3B 1QB1A 4IS5A 3PV4A 1MD7A 4FUBA 3I78A 4X8SH 5EW2H 4FU7A 1Q3XA 2YNAA 4NFFA 1ELBA 4CR5A 2OC7A 1HIAA 2HVYB 2C93B 2ZECA 1QIXB 4K1TA 3DCLA 4A1VA 4DVAU 3TGKE 7KMEH 2ZU1A 5GIBA 1L4ZA 2WHXA 1ZGIA 3TH3H 2J2UA 4X1PU 3BTGE 2GZ7A 4AX9H 3GICB 2R2MB 2QYIA 3TK9A 4DY7B 4MG3A 3CENA 5EOKA 2QE7D 4K1SA 3A8AA 1HJAC 4K69A 4ZKSU 1SL3A 1O2VA 1MTWA 1T8MA 3KL6A 1TMBH 2BQ6B 3QUMP 5J4SA 1S6FA 4Q2KA 1A5GH 1SLVB 1TYNA 3SHAH 3S9CA 2AEIH 3S7KB 1O3PB 5IDKA 2TGTA 1AWHB 2AIPA 3EA7A 1ANCA 2GV6A 2NU0E 3OY5U 3SNCA 1EAWA 5HIYA 1YF4A 1SSXA 2O8LA 1O3NA 4AB8A 3UFAA 2FS8A 4GCHG 2LNCA 3BTKE 3VFEA 1DUAA 3AAUA 2R9PA 1VJAU 4XBBA 1DWEH 6CHAC 2ZHDA 1BJUA 1K0HA 1BMLA 1X7AC 1O2SA 4CH2B 2OINA 3U8TH 4M9FA 5DSFA 1P03A 1ETRH 2XBVA 1K1OA 2ZCLP 2VVUA 1O2UA 4I32A 2Y80A 1SVPA 3B23B 1DM4B 1JMOH 3TITA 3TIUA 1TGSZ 4U32A 1MUEB 1UMAH 3E1XB 1F0TA 3U8OH 2ZPSA 1G37A 1NESE 1EOJA 4KTSA 2J38A 4XD7D 3A7XA 1IHTH 1O2IA 3R0FA 4OS2A 3RXSA 4AN7A 5TCAA 3F9EA 3RXVA 2GX4A 1P2IA 1FUJA 3CNRA 1T32A 1IAUA 3F1SB 1MTVA 3OU0A 1COWD 2J9NA 3PO1B 8ESTE 1HLTH 4YXWD 3SU0A 1DSTA 2FX6A 1GG6C 1THRH 1V2RT 4ISOA 2QN5T 4H42U 1C4V2 4E7NA 1CHOF 2VVVA 3EYDA 1F0SA 2ZTXA 5HMAA 4Y7BA 4F4OC 5H4IB 1G2MA 3I77A 2NWNA 2NU1E 1MTNB 1C5SA 3M3TA 1D6RA 2G4UA 2PGBB 2ZDAH 1SGQE 1KLIH 3RC5A 1IQFA 1HAGE 2Y82A 1P04A 2JETB 4MVNA 4CREA 1OX1A 5ABWA 1BT7A 4IMQA 3L6PA 1YPEH 1L4DA 1SC8U 4AFUA 1BCUH 1FZZA 3HKIB 3SV6A 1BA8B 2V3OH 4JYTA 1IQGA 1P2KA 4X6MA 2F4LA 1Y3XA 1LKBA 2ZQ1A 4MPUA 1Z71A 2FM2A 4OGXA 1F5RA 1A7SA 1YWUA 2ANWA 4BXWA 3GCHC 4TSFD 2QY0B 2ZKSA 3P95A 1ZTJA 3TH4H 5GCHF 3T2NA 4AORA 1J15A 4JMYA 1Z6EA 3AVZA 2K8IA 2VIVA 5E8EH 1NU9A 1ZPCA 1O33A 2WPJS 2ZGXH 3O8CA 3ZZBA 1BITA 1JRTA 3QK1A 4J2YB 1O2MA 3A7YA 1VR1H 3UNSA 3SNBA 4X6PA 1D9IA 2ILNA 4X1QU 1KXEA 1K22H 3ATWA 3RMOH 3RMNH 1J9CH 1OWJA 2QF5A 1IOEA 1EX3A 4Q7YA 3SV9A 2PKSC 4P00A 1LO6A 3SBKA 1BBRK 2KAIA 1K1IA 2SNWA 5B6LA 1YYY1 1LHEH 1KXAA 2YMSD 1OYQA 5KECA 1AFEH 2HLDD 1SFIA 4J1YA 1SGIB 1MKWK 1YLCA 1SKYE 2O9QA 1EXFA 1O37A 3TNSA 1AN1E 1AY6H 1GCTB 2ZC9H 5AF9H 1E35B 1HPGA 2ZA5A 4B6FA 8LPRA 4K2YA 3SGAE 1ZHRA 2EC9H 2PTCE 2XOKD 3SU1A 1IQNA 1S85A 3N7DA 1TRNA 2AMQA 2R0LA 1RGQA 1XUHA 2TGAA 1EZQA 1YCPK 1B0FA 1GMCF 3P8NA 1Y5AT 1O3GA 1VCQA 1DOJA 1C9PA 1P2MA 2SGQE 2ODQA 3SI4H 1AFQB 1TPSA 2F9NA 1BRBE 1FX0B 3DSOA 1O30A 5PTPA 1A4WH 1CU1A 5A0CA 1UHBB 5F03A 1A0JA 1QR3E 4AG2A 5EU8A 4ZHAA 1XUFA 2F9OA 1LHGH 2R2WU 4GLYA 1G3CA 5DP6A 2W6ID 2G55A 1NFWA 3BEIB 3PMBB 5GXPA 2VU8E 2EI6A 3RM0H 3DD2H 4TY7A 5HYOA 3EDXB 1TX6A 2JH0D 1C2GA 4I8HA 2UUJB 1GJ7B 4X6NA 4UE7H 1ZRKA 4B1TA 2XRCA 3HPTB 2PWXA 3A7VA 1AKSB 2P16A 4UFEH 3NPSA 3BG4C 4K3JA 3NUMA 3Q76A 4MPXA 1CA8B 2ALVA 3DFLA 4I31A 1JWTA 2FWWA 1GJ8B 1ARBA 4A92A 2BDHA 3RXAA 4Y8XA 1GVLA 1VGCC 3FP8E 4YT7H 1P0SH 1YBWA 1LHFH 2VINA 1TNJA 3QZQA 4X1NU 1PYTC 2F9VA 1GHAF 4I8GA 1WTGH 1O2OA 3P8OA 2GCTB 5CE1A 2OTVA 1P05A 2UUYA 2PV9B 1W0YH 2ZDNA 2A4QA 3RU4E 3STJA 1BUIA 2XC5A 4A6LA 1SGCA 2W7SA 1QRXA 1O3FA 2WPDD 4SGAE 4AYVB 3OEED 4ZKNU 3FP6E 2ANMH 5AFZH 1C2KA 2GMTB 2P94A 3CS0A 4FUHA 4HI3A 1JOUB 3UAIC 5T3HA 1XX9A 3ZVFA 1GI4A 1GL1A 4UFDH 2V0BA 1FLEE 1P06A 1ETSH 1TRMA 3OTPA 2PHBA 5I25A 3S7HB 1E1RD 1K28D 4PROA 3F0OA 1T31A 1OP8A 2GVFA 4CR9A 1O3JA 1ZSLA 2RFKC 1W7XH 1LDTT 3BEUA 1V2ST 1FN8A 1UCYH 3RXRA 3BTFE 3EQ0H 1MCTA 2TBSA 5T6FA 1O5BB 3B8JA 1MABB 1ANDA 3R3GB 3BG8A 3PM3A 1DLKB 1ELVA 3M7UA 5CMXH 2F43B 2RG3A 1O3AA 1A2CH 4XE4A 3VEQB 3PWCA 1ELCA 1YCPM 2QV1A 1GDQA 1SLWB 1SB1H 1OWEA 4YO9A 1IQKA 1YC0A 5ESBA 1FJSA 3VB7A 3E0PB 1O2JA 2G5NA 3TJVA 3UUZA 3VG8A 2OQUA 1FY1A 2KFWA 3MOCA 2ZFQH 1EATA 3UIRA 4Y71A 2BLOA 3FANA 1E1QD 4M7GA 1KY9A 4DT7B 1FDPA 1XUIA 2WZQA 2VJ1A 5HXFA 2FZZA 3SJOA 1NRNH 1GJ4H 2D1JA 1A46H 3TLOA 3L33A 4D9RA 3PTBA 1C5UA 5EIYA 3M5NA 1LPGB 1AB9C 3A87A 3URCA 1W0KD 5FL7D 4UFGH 1O2TA 4GUXA 1GJ6A 4NA9H 5C20A 2XCFA 1UTKA 1OWDA 2HLCA 4RKOB 3AK5A 1BDAA 4FUFA 4RT0A 2ZU2A 1F5LA 1C5RA 2BLQA 1S83A 3TNTA 1MMJN 1AUJA 1GHVH 5JB9S 1MKWH 1ZPZA 3W95A 3L3TA 1RRKA 1WQSA 1C4Y2 4O3TA 1GHYH 1TPOA 2OXSA 3Q3XA 2XW9A 4ISNA 1P02A 2ZHEH 4B75A 4GCHF 1GCDA 1GBIA 2HALA 1W2KH 4DG4A 4FU8A 4ESTE 1DWCH 1SOTA 3OY6U 5EODA 4X6OA 5FPSA 2AH4X 4KGAA 3S9BA 1IQLA 2OD3B 3P92A 4OS5A 4ASHA 4BTIB 3PROA 3UR6A 5CHAC 3M36A 2LP6A 1KYNA 1TMTH 1ZJDA 2J95A 3ZYDA 4Y79A 1H9LB 6LPRA 1J16A 1O5GH 1GBAA 4YTAA 4JZDH 2BD9A 1MKXH 1SMFE 1GBBA 2ZDKA 3HK6B 1P2NA 1SQRA 4JZIA 2C8ZB 3LGWA 1HAXB 1UVSH 3M35A 1UK3A 2HOBA 1SGRE 1T8LA 4HG6A 2J97A 1BTZA 1C5YB 1YPJH 1YPHC 1MZDA 4CRFA 1OWHA 3MNSA 1W11U 1SGYE 4D7FA 1BBRE 3ZZ8A 1XKBC 1EZUC 2KCPA 4X1RU 4DT4A 4NFEA 2DE9A 1DUEA 5EQQA 2P3TB 2BY6X 3H09A 2A5KA 3FKSD 1GGDC 1CGIE 3BTTE 1CO7E 1ZRBA 3MHWU 1O3CA 3FOAA 1K1PA 1G3DA 5BPEA 2A32A 3UR9A 1V2MT 3T5FH 1V2TT 1CGHA 2YMSB 2FODA 2ZGHA 2TRMA 1JRSA 4Q4LA 1ZOMA 2HVXA 1UHBA 1GBTA 1LHDH 1D6WA 3RXDA 4JZEH 5A8ZA 1Z8JB 1CA0B 2BMGB 2OCVB 1QNJA 1HFDA 3MQKC 1E0FD 4IBLH 2ZHQH 1YPGH 1RS0A 2F9UA 2CJIA 3GCTG 4YESB 1N8OC 1HCGA 1O31A 3ZVAA 4ZCNA 1TNHA 4YOIA 2V3HH 1W0JD 4ISHH 4HTCH 1S6HA 2P95A 1EFRD 2OLGA 2FI4E 3ZZ6A 2QAAA 3ZVBA 2SGAA 5C2ZA 1QRZA 1TGCA 1QA7A 3ZZ5A 4Y11E 1XMNB 1LQDB 2H9EH 1DITH 2WPMS 4ZXYH 4OS6A 2J4IA 2GTBA 2ZU3A 1MTSA 4I33A 1SHYA 3F2HA 3LH1A 1UO6A 2IJOB 2D8WA 3KQ5A 3RLWH 3KNXA 1TWXB 2GJGA 3DT0H 2KAIB 1XVOA 1EZXC 2AFQB 2FYRA 1V2PT 1ELFA 5ETXA 3U69H 3VXEH 4JK6A 3U28C 3A83A 3KQDA 1P11E 1FAKH 2P8OC 3LC3A 2SFAA 1FY8E 5DPAA 1ELDE 2W7UA 2VIOA 2BXUH 5T6GA 1KLJH 5LPRA 1GI5A 1NZQH 2FI3E 3A82A 5E0JA 2JIZD 5K7RA 1FPHH 3JZ2B 1AVGH
chains in the Genus database with same CATH topology
1PJPA 2C90B 1IQJA 1H9IE 2UWPA 2BY7X 2BOHB 2ZF0H 3LGTA 5DP5A 1ZLRA 1Y59T 2R3UA 2WPHS 3BV9B 2QXHA 4ZHLU 1UTPA 1C2MA 1EUFA 1ZYOA 7ESTE 5JBTA 5TCCA 1ESTA 2QF0A 6GCHG 2GZ9A 1MU8B 1G2LA 4ABJA 4TYDA 4NA8A 3P17H 1NC6A 1E38B 5EQRA 1FIZA 1KSNA 4D9QA 2XWAA 1BRCE 1QCPA 3UOUA 1O2PA 1ELEE 1K1JA 1P3CA 1F92A 1OYTH 2ANYA 3F68H 3LDXH 3PLPA 3O8BA 3H5CB 2Z9GA 2XXLA 3T29A 1MTUA 3HKJB 3EAJA 5LGOA 1WQVH 1BIOA 1NM6A 1OWKA 2EEKA 2FDAA 2HGTH 1TNKA 4TPIZ 4NWLA 4JCNA 2I6QA 3DHKH 2ESTE 4Y0ZE 1HAPH 1VITH 1SR5C 5TJXA 1TPAE 1O39A 1QQ4A 3EE0B 1U6QA 3RU4T 2ZFRH 1O2LA 3FFGA 1C2EA 1LCYA 4KELA 1OP0A 1AI8H 1ZPBA 1UTOA 3QO6A 3RM2H 1A3EH 2NU2E 3Q00A 3E3TA 3URDA 3KHVA 2FOCA 2XBYA 4HGCA 1HAOH 3ODDA 2G8TA 1PQ8A 3SN8A 5FXLA 2DUCA 3QZRA 3SNAA 3T27A 2PKAB 1XUKA 7LPRA 1BTXA 4UONA 2OQ5A 1SGTA 2F91A 4WVPE 3VB3A 1IQMA 4RN6A 2BZ6H 4AGKA 1KTTB 3K6ZA 1MQ5A 1XUJA 1PQ5A 5JBAS 3RU4D 2BDAA 1FI8A 1AUTC 4ABHA 1E34B 3GY8A 1QJ7B 3RDZA 2WPLS 4OGYA 1QB6A 3PMAB 1YPKH 1QL8A 4WXVA 1HNEE 1SGFA 5JBBS 2TIOA 1A1RA 5EXLA 2GCHG 2H9TH 1O3IA 4B76A 3RXLA 3UREA 2LPRA 1T7CA 1O3BA 4XFQA 1JBUH 1RIWB 3K9XB 2PSXA 5FPYA 2VGCC 3GY5A 1XVMA 1QFKH 3GYLB 1T8OA 3GY2A 1EJNA 3PMJA 4KTUA 2QXGA 2QCYA 1O2ZA 4WY3A 2BY9X 1BRUP 1GCTC 1PYTD 2ZHWH 1O2KA 1EJAA 2AMDA 2OC1A 1GDNA 1G32B 2ZFPH 3P8GA 4DIHH 2FOMB 1V2KT 1C1TA 1GJ5H 4NGAH 1P10A 3NZIA 2OBOA 4R0IA 1Z8IB 1HJAB 5A0BA 3RXQA 1Z1IA 1GBKA 5C1YA 1JIRA 1O36A 1UJ1A 4E7RG 3BTQE 3F6UH 4FUEA 1F7ZA 1V6DA 1NU7B 1GBMA 3UQVA 5EPYA 3KEEA 4BTTB 1O5DH 1YM0A 3V0XA 1K1LA 2ZCHP 2C8XB 2CV3A 4AZ2B 1VJ9U 3KQBA 4XBDA 1GJCB 3K2UA 3SUFA 1V3XA 3ATMA 1IQEA 1EPTC 2ZPQA 3ATLA 1ZZZA 3DA9B 2GZ8A 1HAVB 1CHGA 1K2I1 3RXIA 2F9BH 2K1QA 3TJUA 6CHAB 1J14A 2ZGCA 3NWUA 1NFXA 5E2PA 5JYIA 1WCZA 2AGGX 2A7HA 2A5IA 2THFB 4OS7A 2C4FH 3U1JB 2NU3E 5B6OA 1L0ZA 2A1DB 5GPIB 1VCPA 4F49A 5AHGH 1LVMA 1CT0E 3DFJA 2Z3EA 2PFEA 2CHAC 1C1QA 2EA3A 3E91A 1WV7H 1PPZA 5EXMA 2GP9B 5DK1A 2WINI 1QQUA 3S9AA 1TNLA 3GOVB 1A5HA 2XC4A 1SGDE 2FOFA 1YP9A 4INLA 1TX7A 1C1PA 4MNYA 2SGEE 2FEQH 1LVYA 2H2ZA 3VGCC 4U01A 1BTWA 1QB9A 1VITG 1RXPA 4WMFA 1C5QA 1GG6B 1E37B 1MAYA 2AMPA 1O2GH 5C1UA 1KDQB 1S0QA 1TIOA 3CS7A 2O8UA 2WYJA 3BN9A 4Y7AA 4IN1A 3P6ZB 4BAQB 5C5NA 2PW8H 1JIMA 3MU1A 4YM9A 1NRPH 3RUOA 1NRQH 2ODPA 1VZQH 3O8RA 3D62A 5C1XA 4B2CA 2BY5X 5DP8A 1L1JA 1QY6A 2BDBA 2IN2A 9ESTA 4OS4A 3QDZB 3E16B 4YLUA 3ZZ7A 1TABE 2B7DH 3MH4A 5E0GA 3TVJB 2BDGA 3ZVCA 3T62A 1YLDA 1AIXH 2M5TA 2Z3CA 2PR3A 3GCTF 3GCHB 4NIWA 1LHCH 4WMEA 4IGDA 2AIQA 3ZZCA 4AGJA 2A31A 5DP4A 4ZROA 2STAE 3OX7U 2G81E 1P09A 1CSOE 1CVWH 1GBJA 1HUTH 4TY6A 4AFSA 8KME2 1ID5H 4B71A 1C5MD 3OTJE 3SUEA 3SW2B 2V35A 3SGQE 4LZ1H 4X8VH 2OC0A 2ZEBA 1C9TA 2RA3A 4RKJB 2FP7B 4Y76A 2XBWA 3HGNA 4E05H 1NROH 2FYQA 2PLXA 4WMDA 4ZUHA 1YPMH 2UWOA 3V3MA 2PKSB 4JK5A 1GI8B 2WUBA 2Y5HA 2ZI2H 2PKAA 1QA0A 1BMMH 3G01A 1H9HE 2GD4B 2B5TB 5FHTA 4NZQA 3A80A 3SI3H 2FESH 1GHZA 2QIQA 3BTDE 4JZ1A 1NTPA 4VGCC 1O3OA 3BEFB 5FBEA 3RXHA 4IW4E 3Q3YA 4LOYH 1CBWC 8GCHG 5LH8A 2BLVA 1NFYA 1HJ9A 1ZGVA 5F8TA 5DGJA 2ZIQH 3SNEA 3UPEA 1O3MA 1LQEA 4GPGA 4YOGA 1DSUA 2QF3A 5FCKA 1FV9A 1HAZB 5SGAE 2ASUB 1SI5H 3UWJH 1V2WT 4ZH8A 1TLDA 6GCHF 2FOEA 4ABFA 1PPCE 2Q6FA 4ABEA 4INKA 1H1BA 1UTQA 1CQQA 1S84A 1IQHA 3V12A 1WYKA 4BTUB 2UWLA 1D4PB 1H4WA 1GL0E 1SGEE 4WJG2 2B0FA 3A89A 4KTCA 4GAWA 1V2QT 4XSKU 1GI3A 4E06H 2ZFTA 3H7TA 1N1LA 3VB4A 3LONA 3BG4B 1C5WB 1G3BA 3ATKA 3GY4A 3T25A 4CRBA 1S5SA 1G9IE 1PFXC 2ZU5A 4ZMAH 1GJDB 3RXKA 2BD7A 1BBRH 4OS1A 4IC6A 3SU6A 1DANH 1VGCB 1C2IA 2ZG0H 4DJZB 1HAIH 4NIVA 2Z7FE 1GBCA 1GBLA 5ESTE 3RXMA 2Z3DA 5DP7A 2XCNA 1XXDA 3LGYA 2ZQ2A 3ODFA 3HGPA 5EGMA 4CRAA 1P9SA 2G4TA 1FMGA 3A84A 1O3DA 2C8YB 4NIXA 3NCLA 1HAVA 1TAWA 1IQIA 3MNBA 3PLKA 1BTPA 2DE8A 2BY8X 2NU4E 4MTBA 1RD3B 2JKHA 1GI2A 1FY5A 1DT2A 1FAXA 1G36A 1ZJKA 1Z1JA 1V2LT 1YCPH 2ZDMA 1F2SE 1T4VH 1YGCH 2GGVB 2Z9JA 1TBRH 1Q31A 5BRRE 2A2XH 2RCEA 4X8UH 2BDCA 3RXOA 5FCRA 1XKAC 4UFFH 4A7IB 5DG6A 1O38A 3E6PH 2AGEX 5FX6A 3GCOA 2Z9LA 3UWIA 2ZHFH 3WY8A 2GCHF 3SJ9A 3TK5A 1DX5M 4A1TA 1UK2A 3BSQA 3M7TA 2HNTF 5JBCS 9LPRA 2BD2A 3KF2A 5F8ZA 2F3CE 2AYWA 3ESTA 1GPZA 3MO3A 1OOKB 3U98H 3VXFH 2ZFSA 3V7TA 4AFZA 1TMUH 1ZHPA 3ITIA 5C67A 3SNDA 1XM1A 1P12E 1OPHB 1DWBH 1YKTA 1KDQA 5FPTA 3SU2A 1BZXE 2Z94A 3D65E 4R8TB 3U8RH 2A4GA 4B2BA 2AS9A 3MNXA 5J4QA 4MLFB 1CT2E 4WWYA 2BLWA 3PB1E 3M3SA 4MQAA 2EI8A 4CHAC 4K8BA 2XYAA 1P01A 2FOHA 2TGPZ 1K9OE 2W5EA 5LPEA 3F9FA 3A8CA 5DKMA 1TX8A 1Y5BT 2OBQA 4NWKA 2IOTA 4ABAA 4JYUH 1C2JA 3LIWA 1IHSH 5EXNA 3ZVEA 1AB9B 3RMLH 1C4U2 1TA6A 3TU7H 3E8LA 2W3IA 1JXPA 3S69A 2UUFB 1O2HA 2Q1JA 1O5FH 1RTFB 1P8VC 4I7YH 1WBGB 2YNBA 3T26A 2FI5E 3ZZ4A 5IYTA 2P3FH 3ATIA 1GI7B 3GY7A 1Y3WA 1O3LA 3SUDA 1NRRH 1C1WH 3M5MA 5DO4H 3LOXA 1O35A 1FIWA 3A81A 3SO3A 2ZWLH 3LGVA 4BOHA 4B73A 2Y5GA 1HBTH 4DW2U 5CHAB 1GHXH 2GDDA 2IPHA 3MU0A 3RLYH 2Q6DA 3QTOH 5T6DA 1AVWA 2XNIA 1KXFA 4WH8A 3TH2H 1TRYA 1SQAA 3QN7A 1LVBA 2FS9A 4FVBA 4DURA 5EW1H 5HM9A 2Y5FA 1AQ7A 1GVKB 2SGDE 4BAKB 1BMAA 1HYLA 2H5CA 1S81A 5AVDA 1UK4A 2BTCE 1UVPA 1O2QA 2VWOA 3LC5A 1SBWA 4QT8C 2XWBI 2ZO3H 1INCA 2XTTB 2CXVA 4TWYA 1VITF 2XC0A 5L30H 1AZZA 1TNIA 1WTHD 2SNVA 3IWMA 4ZKOU 4BAOB 3MO6A 2ODYB 3P8FA 1ESBA 1PPBH 1C5ZB 1GGDB 5L6NH 2GT7A 1A3BH 1SOZA 3EGKH 2PUXB 3ELAH 2YOLA 1C1VH 3SU4A 3PO1C 1ZR0A 1S0RA 4WF8A 3SGBE 1BMNH 1O2NA 1THSH 4O97A 1QL9A 2VWMA 3LH3A 2D26C 1FXYA 1P3EA 1W3CA 1KIGH 4MPVA 1ZHMA 2G5VA 5L2YH 1EZSC 1GBEA 1TNGA 1UTMA 1UVTH 4KP0A 1N6XA 1QL7A 3D23A 2H5DA 2VH6A 2Z6BD 4XOJA 4NCYA 2ZZUH 4DCDA 3C1KA 1TE0A 1TFXA 1NS3A 1MTNC 2VB0A 1N8OB 1DS2E 3QGJA 1MCVA 3LT3A 1O0DH 3ZZAA 4K60A 1BJVA 2W3KA 4BANB 3LJOA 2FIRH 2JETC 2CMYA 2A2QH 4H6SB 1Z7KA 2BYAX 1F0RA 1F0UA 1C5TA 1MQ6A 1FQ3A 1ETTH 3LU9B 2EI7A 3SJKA 1SHHB 1SQOA 1Z8GA 1C5OH 3RP2A 1QRWA 4O3UA 1D3TB 4CH8B 1C2DA 5JDUB 3LGIA 1QBNA 2A7JA 2ZPRA 4UD9H 4DGJA 3A7TA 5DP9A 1V2JT 2ZCKP 2BD3A 1NPMA 4D76A 2V6NA 2P8OB 4HZHA 1HV7A 1AE8H 2QXJA 2Z9IA 4O03A 4X2YA 4FUCA 3VB5A 3KN2A 3GY6A 1TA2A 1HXFH 1DE7H 3MU4A 1AD8H 3T28A 2HPQH 1TBZH 1OWIA 1OS8A 1O2XA 4NG9H 4WH6A 1A61H 4CRDA 3ZZDA 4IN2A 1RTLA 1W8BH 2VH0A 8GCHF 2ZU4A 7GCHG 1L1NA 4XDEA 5A2MH 1KLTA 1FPCH 1MAXA 1O2RA 2G51A 1Y3YA 2GV7A 5C5OA 1EQ9A 2BD5A 1O34A 4Q7XA 4HFPB 3RXEA 2FMJA 5A8XA 1ZMJA 2ALPA 3FZZA 3ZYEA 2A45B 1H8DH 3TGJE 2CGAA 4ABDA 3M61U 2OUAA 5C3NA 3EA9A 4CRCA 2A7CA 4X1SU 1LKAA 4NIYA 4BNRA 1PPEE 1D3PB 2P59A 4TPYA 1C1RA 1ANBA 4GVUA 3D49H 3MWIU 5DJ7A 4FU9A 4YZUA 1HXEH 2BDYA 2GT8A 1W0ZU 1Y3UA 2HPPH 2VIDA 3GDUA 2AERH 3ZZ9A 3BF6H 1QBOA 4DIIH 1TGTA 2B8OH 3Q3KA 3U1IB 3BTHE 1GMDG 1AFQC 2VNTA 1GHWH 2UUKB 4Y6DA 1FNIA 1BQYA 2QGRA 1C2FA 1AVXA 4THNH 1L1GA 4FVDA 2GKVE 1TOMH 1GMHG 2GDEH 1C5LH 4BAHB 1BTYA 4IC5A 5HM2A 3MH7A 4NA7A 1FONA 1GDUA 1GI1A 1UCYK 2Q6GA 3MH6A 1A0LA 1W14U 4NZLA 3GDSA 2PTNA 1PPGE 4Q7ZA 1HJ8A 1ZTLA 3AAVA 3A7ZA 3IITA 4FUDA 3BTEE 5JB8S 3V13A 4AOQA 1RTKA 1TALA 1DXWA 1B7XB 1DXPA 3LJJA 1C1MA 3NXPA 2ZP0H 5EQSA 2VIWA 3UNRA 3GISB 4UEHH 1V2UT 4XBCA 1ELAA 1TOCB 1BHXB 2VIPA 2Y7ZA 3P70B 4JYVH 4X2WA 5F8XA 3SORA 1GVZA 5EPNA 3KCGH 2I6SA 1T8NA 3M3VA 3SUGA 4MNWA 1OSSA 4GHTA 1HGTH 2GCTC 1AU8A 1GHBG 4RSPA 1C1NA 4TWWA 1ESAA 1KXDA 4X0WU 2SGPE 1ABJH 1P9UA 1TGNA 1W7GH 2W26A 2ULLA 1AO5A 5GJ4B 3STIA 1GI9B 2QA9E 2FTLE 2VGCB 2O8MA 3BIUH 5E2OA 1UVOA 2GMTC 2ZGJA 2ZNKH 4H6TA 1EOLA 2FXRA 3A7WA 2H6MA 5A8YA 1C2LA 2Y6TA 4MPWA 1WSSH 5A09A 1HB0B 2A4OA 3MO9A 1F5KU 1TBQH 1O5EH 2CN0H 1SPJA 4K8YA 5I46H 3MNCA 4FUIA 3MU5A 1PQAA 1DICA 5GDSH 4X2VA 2H1UA 1A5IA 2WYGA 2HWLB 1W12U 1SLXB 2BVRH 2R3YA 4UDWH 4I8LA 2WUCA 4IMZA 1SQTA 2ZDVH 4D7GA 2FOAA 3QTVH 3RXUA 3FVFB 1GI6A 1ZSJA 4K5ZA 3F9GA 4ABBA 3PMHB 3TJNA 3DUXH 1EP5A 1O2WA 2BZAA 5AFYH 4B2AA 1HRTH 1UTLM 5FAHA 1EAUA 1MKXK 3UQOA 1TB6H 2ANKH 1P2QA 1ORFA 1EKBB 4MDSA 1NFUA 2PUQH 1EPTB 3QGNB 3MFJA 1HDTH 2TPIZ 4ZXXH 3MYWA 2F83A 2BQWB 3U9AH 4AG1A 4X8TH 4Y8ZA 2BM2A 4X2XA 3AW1A 1BOQA 4Z6AH 4CBNA 1J8AA 1TGBA 3M5OA 2BX4A 3MTYA 4B74A 5L2ZH 2HRVA 2BD8A 3RC4A 3MH5A 1AE5A 4I8KA 1ZSKA 3O8DA 2FX4A 4GSOA 2BVSH 5LPFA 1K21H