2G52A

Anomalous substructure of trypsin (p21)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
b'IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g52A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g52A01
2PHBA 2ZHDA 3QWCH 2G4TA 2O8MA 2QGRA 2Y5HA 4SGBE 1PYTC 3LH1A 1N8OB 1C2KA 2XBWA 1ZTKA 3SBKA 1C5XB 1HAGE 1P05A 1UK2A 3U98H 2NU2E 1BRCE 2AGGX 2ZDVH 2FXRA 2QYIA 2BY6X 4ZXXH 1FONA 1C1SA 2G52A 4ZKSU 5C1XA 1EAIA 1RIWC 3LGWA 2C90B 1SGFA 2VB0A 5FPTA 1C2HA 3C27B 1DE7H 1Y3UA 5E2OA 2VIDA 5C5NA 7KMEH 1SGIB 1HAPH 2I6SA 1IQJA 2C3SA 3M3TA 4CBOA 2P8OB 4XSKU 1BBRE 3I77A 3EA7A 2PR3A 1O2LA 1GBFA 1V2PT 2FMJA 1ZMJA 4UFFH 1Z8IB 3GY6A 1QL8A 1UTOA 2PKSC 1P03A 2R3UA 1BJUA 4GSOA 3EE0B 5E0JA 3SQEE 2WUBA 2WV4A 1SSXA 3MNSA 1BTZA 4O03A 1CSOE 3MI4A 2JH5D 1C5MD 5L30H 2Z3CA 2NU4E 1IQNA 3RM0H 2W7UA 3VXFH 1O2NA 4VGCB 2OXSA 4RSPA 4D8NA 4D7GA 2BDAA 4AFZA 1GBKA 2Y6TA 3CS7A 4UDWH 4BAKB 4JYVH 4NA8A 5A2MH 1UK4A 1V2UT 2BZAA 2HALA 3BTHE 1TPOA 2VGCC 2BD3A 1A3BH 1TQ7B 2Y7ZA 1TQ0B 2UUYA 1P9UA 1C5RA 4MPVA 1ZR0A 4TY6A 1QY6A 1RIWB 4JK6A 5SGAE 3M7TA 2P3FH 1V2OT 2GDDA 3KL6A 1O3BA 4K60A 4JZEH 4Y10E 3BTDE 4ZXYH 1GPZA 2Q1JA 3SOSA 1UTLM 3C1KA 1A5IA 5E0HA 4U30A 2FS9A 1DWEH 3A80A 3QGJA 2PKSB 2ZU3A 1CT2E 3QZRA 2CF8H 1NRSH 1NU7B 4INLA 4YZUA 4UFEH 5JBAS 5C5OA 1MCVA 1V2LT 4YLQH 1UTQA 1C2MA 5DP9A 1BA8B 1SG8B 2PW8H 4JZFH 1O38A 2Q6GA 1OPHB 2FOCA 5HM9A 1L4ZA 3MOCA 1GBHA 5LPFA 1TNHA 2SGEE 1QB6A 2EI6A 1P01A 3MH6A 1NS3A 2VGCB 2F91A 2VIOA 1EJAA 4E7RG 3GCTF 4JK5A 3FFGA 3H5CB 3P70B 4IS5A 1FIZA 1O34A 3RC5A 4ABBA 2PGBB 1KYNA 1UCYH 2H9HA 1GI5A 2ZTZA 2FX4A 1O35A 7GCHF 3T5FH 1QRZA 4IBLH 2BDYA 2VIVA 1L1NA 2BLVA 2F9PA 2FO9A 2FTMA 1FQ3A 1RTLA 5FPSA 4I8GA 1VJAU 2XYAA 1IQHA 4RKJB 5GIBA 4BXSA 1A46H 1BTUA 1ZGVA 2O8UA 5GCHG 1C4U2 2ZI2H 3CS0A 1FUJA 3ZVFA 2Q6DA 1ZGIA 1BITA 1PPEE 3F1SB 1ZSJA 5GJ4B 1HAVA 4CHAC 5EPYA 2DE9A 2ZA5A 5C2ZA 1FV9A 2SGDE 3T27A 3SJ9A 4ABGA 2KAIB 1UHBB 1O2SA 1RJXB 3MU8A 1GBLA 1NN6A 4Q7YA 4BOHA 3BEIB 1C1TA 2ZU4A 1IQFA 3U1IB 1GJ8B 2D1JA 5L6NH 1UTMA 3GISB 2BTCE 1O2MA 4FUIA 1FY8E 2BVSH 4X6OA 3ZZ8A 5AF9H 1P9SA 2IOTA 1K22H 1AMHA 2ZFQH 1H8DH 4K3JA 4I33A 3SU2A 1AWFH 1TB6H 2W5EA 1MKWH 3A87A 3SNBA 1YP9A 1LPKB 2ZHWH 1BUIA 1GJAB 4B1TA 3RLYH 2HNTC 1G3DA 1W12U 2OC7A 1ELVA 3ELAH 8GCHG 1GCTC 3QLPH 1QHRB 1BTWA 1KXDA 1Q31A 3GCHC 4I8LA 3K2UA 2OBOA 1GJ9B 2A0QB 1ETTH 4Y0YE 4CHAB 5FBIA 8ESTE 1K28D 1O3CA 2TBSA 1D4PB 1TMBH 3RXRA 1GI8B 1O5AB 3UFAA 1ZHMA 3SU5A 2BYAX 4OS1A 2ULLA 1DY8A 4AYVB 4H4FA 4M7GA 4NCYA 2BDGA 1CU1A 1EJNA 2DUCA 1DXWA 3ZZDA 3A7ZA 4K8BA 2FOHA 1O5GH 2ZDNA 1L1GA 2BOHB 1G37A 2AS9A 2UWOA 4LXBH 4Y11E 1J17T 2C8WB 3M5MA 1A4WH 2ASUB 1J16A 4HFPB 1SMFE 1GBBA 1O3IA 2C8ZB 2VIPA 3Q00A 4KKDA 1LKAA 4X1NU 1P06A 3UIRA 1BDAA 1P09A 2VIQA 1ZSKA 4INKA 4A6LA 1BTHH 3KF2A 1S6HA 5EW2H 1UVPA 2GV7A 5FX5A 1EATA 3EGKH 1YBWA 3D49H 3BTME 8LPRA 2F3CE 4ABIA 2QF0A 1GCTB 3TGKE 2ZECA 3GCHB 1G2LA 1C1OA 1D6WA 4Q7XA 1P02A 4NGAH 3LT3A 4LZ4B 2J34A 2Y7XA 1G9IE 2WYGA 1FPCH 1O32A 5GDSH 5C1UA 4AYYB 1VITG 1ANDA 5DJ7A 2VWOA 4O9VA 1KLIH 4BAHB 3ZV8A 3RXOA 1C5SA 1LPZB 1GHXH 3TK6A 1ZZZA 3D62A 1AIXH 4FU7A 3ZZCA 5FCKA 3TJVA 1LO6A 1W14U 3MH7A 1TWXB 3GY8A 1CA8B 3PMAB 4NIYA 1C2LA 4Y8ZA 4ZHAA 2WPMS 5E0GA 3RXLA 1THPB 3ATKA 3SGAE 1ABIH 3ODDA 4GCHF 3PTNA 2BVXH 5ESTE 3A7TA 2H2ZA 6ESTA 3NZIA 1GDNA 3KEEA 2AGEX 3FP8E 1GBCA 1DSTA 1ARCA 4OS4A 1AFEH 4X0WU 3HK6B 1GMDG 1QQUA 2HRVA 1C2FA 4U2WA 2ZFSA 2B0FA 1XM1A 2HNTF 1TALA 2RA0A 2ZU2A 2Z9KA 1FDPA 3SU3A 5ETXA 1C2JA 2I6QA 2QXGA 1K21H 1SQTA 1C5YB 2OINA 1RRKA 1E38B 2G81E 3V0XA 2Z7FE 2GZ9A 4NA7A 3KIDU 3TVJB 2HPPH 1CA0C 2WPJS 1PFXC 1AVGH 3UWIA 2C93B 3Q3YA 4CRDA 3F9FA 4XBBA 3RMOH 1AE8H 3SU6A 4BTTB 2Z6BD 3RP2A 1KXAA 4X2VA 2G8TA 5G4BA 5CHAC 1BB0B 1MKXK 1HV7A 3P8OA 2ZFFH 2FIRH 4UEHH 4A5TS 1AHTH 2Z9JA 2EI7A 4FUEA 1YPKH 3SV6A 4ISOA 4HZHA 1MTUA 1FIWA 4TYDA 3RMMH 4GCHG 1GHAG 3SNCA 4DJZB 3K6YA 4NSYA 1K2I1 2GD4B 1GI1A 4OS7A 1A0LA 1IQIA 5DGJA 4THNH 1GBEA 3D65E 3QK1A 1MU8B 2ANKH 3BTFE 4IW4E 1YGCH 1C1NA 1EKBB 4E06H 3M35A 3DHKH 1TBRH 3P95A 1GVKB 1LPGB 1P04A 3OSYA 2C4FH 1V2RT 1CA0B 3E91A 1BRUP 1F2SE 1SGEE 3E90B 2GCTC 3EA8A 4DIIH 3LC3A 5DP3A 1GG6C 3EYDA 4NFFA 3SV9A 1HAOH 1D3TB 5CHAB 3KQCA 1YF4A 3T26A 3PMBB 3QO6A 3VB7A 1UCYE 3SJKA 1O2VA 5GXPA 3VXEH 2CN0H 1O2TA 1N6XA 4B2AA 1FXYA 4DIHH 2ZNKH 3ESTA 1O2YA 3GY3A 3LJOA 1KY9A 1TGTA 1JXPA 1TNIA 2GKVE 1EZSC 1K9OE 3SUDA 2VINA 1EZUC 1SGRE 1LCYA 2ZC9H 2ZCHP 4F4OC 1ZPZA 1LHFH 1NFXA 1DLEA 1A5HA 9ESTA 1ZYOA 3S0NA 1GI9B 1DS2E 2QF3A 2RA3A 1TLDA 3UR9A 3LOXA 2BDHA 2FP7B 5DP6A 1QGFA 1XXFA 3MU1A 1DY9A 1HAXB 4GUXA 4X8SH 2ZCLP 1N6YA 3E3TA 3ZYEA 3TGIE 2VNTA 1AZZA 3RXHA 2UUFB 3ZZAA 5TCAA 2BQ7B 2WYJA 4FU9A 1Z6JH 4Y76A 1DX5M 2H9EH 2ZQ2A 3PO1C 4LOYH 4MG3A 3TJNA 3TLOA 4XFQA 5PTPA 1CT4E 2CHAC 1C2DA 2GCTB 3BTGE 1GWAA 3RU4D 1IQKA 1NESE 2LNCA 5F03A 2F83A 2OC8A 1D3QB 1NROH 1DWCH 3E8LA 4MPXA 2EI8A 1H9HE 4AGJA 4E7NA 2RDLA 1QBNA 3P17H 5EPNA 4ABDA 1MH0A 3SGBE 1CO7E 1GVLA 1OSSA 1TPPA 3VEQB 1AD8H 3ZZ4A 2KAIA 1OP0A 1SLVB 1SFIA 1MUEB 2G55A 4TPYA 5AHGH 4B75A 4I8HA 5DG6A 5BPEA 2NWNA 4Z0KA 1AFQC 1XMNB 2GT8A 3P6ZB 2AMDA 4AFSA 2ILNA 4NZQA 5A8XA 2ZQ1A 2ZHQH 1S5SA 1SGTA 1EXFA 2BMGB 1W3CA 3H7TA 1UTPA 3QTOH 3A86A 3RXGA 1MTWA 1P2IA 1A7SA 5F8TA 1V2ST 4B2BA 1P0SH 1OWHA 2CF9H 1G3CA 7ESTE 3LDXH 1T8NA 3PO1B 1F5RA 1OYTH 2CMYA 2A2QH 3GCNA 2G00A 3AW1A 5DKMA 4X8TH 2H1UA 1HB0B 3JZ1B 3LJJA 1O3FA 4J1YA 3H7OA 2BD2A 2AFQB 3V3MA 2BY8X 2ODQA 1DT2A 5AFYH 1OWIA 1GI7B 4U32A 1F7ZA 2ZPRA 3RXMA 3UOPA 1SL3A 3M5LA 4Q7ZA 2ZDLA 1GBMA 1KLJH 1WTGH 3A84A 4FUCA 3MO6A 3URDA 3LGYA 1AFQB 4CR9A 1GJ7B 4MLFB 1JOUB 3BG8A 1MU6B 1TRYA 3AASA 3VB6A 1AU8A 4INHA 4PROA 5JYIA 2ZPSA 5DP7A 4MVNA 3NCLA 1C5UA 2XCNA 2HNTE 1GJDB 2BXTH 4NFEA 1ZJDA 3M5OA 4NA9H 3Q76A 3RUOA 1C5OH 3I78A 1ANEA 2THFB 1AUTC 2A32A 3IG6B 1MAXA 4CREA 1YC0A 3BIUH 1TOCB 2SFAA 2J2UA 3RC4A 1XUFA 1QFKH 1TGCA 1O3JA 1GBJA 1LKBA 3ZV9A 1KSNA 4OGYA 1MTVA 2BQWB 1O2XA 4X1PU 1Z1IA 3KGPA 4BTIB 5F8XA 3RLWH 2WPKS 1HFDA 2G51A 4CH8B 4BNRA 5I46H 2TRMA 2BM2A 3VB4A 4XE4A 1ANBA 1NFUA 4WMDA 2SGAA 1MZAA 4Y7AA 1C9PA 3LGUA 2AEIH 1DXPA 1MCTA 1QIXB 1AGJA 1ELGA 3QX5H 3RMNH 1C5ZB 1GHYH 3QDZB 3DT0H 4R0IA 1UVUH 1SQAA 3P8NA 1WQVH 1EB2A 3O8DA 2OC1A 4AOQA 2GTBA 3JZ2B 2Y81A 1VZQH 2ZU5A 1CGJE 1GJ5H 2JKHA 4I7YH 5GCHF 3BSQA 1GI0A 2G5NA 1D6RA 1G2MA 1QA0A 4KTSA 3A8AA 3SV8A 2SNVA 1UVOA 2W26A 1TRMA 5F8ZA 5DO4H 2ZP0H 5L2ZH 3M37A 1C1VH 2VVCA 3PLKA 3VPKA 1FI8A 1RFNA 3S7HB 4JZDH 3F9GA 4AFUA 4AB8A 2B9LA 1BRAA 1GMHG 3UNRA 4ABFA 5C1YA 3PROA 1CT0E 3TH4H 3SJIA 4NWLA 3A8BA 2A5AA 1INCA 1C4V2 5FXLA 3ZZBA 3EAJA 1KIGH 1A1RA 2QAAA 1YLDA 2UWLA 2HGTH 3RXIA 1O2QA 3RXAA 3LIWA 1BZXE 4A1XA 4B71A 1V2VT 1K1PA 2VWLA 1WOFA 1YCPK 1WYKA 1NRRH 4X2XA 4IN1A 4GAWA 3S7KB 1VR1H 8GCHF 2XBVA 2D26C 2XW9A 3SN8A 1LHEH 4YLUA 2XRCA 1TNKA 1ELCA 1IQGA 1GVZA 3SQHE 4A1TA 2A7JA 2NU1E 5EXLA 3SHCH 3KNXA 4Y71A 3SNEA 1HUTH 1ZOMA 3PWBA 3DFLA 4X1SU 2V35A 3SJOA 2FOFA 1LVBA 1DFPA 1O2OA 5I25A 1C5QA 4ZKRU 4IN2A 1ETSH 4FUGA 2PTNA 2F9OA 1TE0A 3A8CA 2BY9X 1O2RA 1VITH 4O3UA 3ZYDA 2D2DA 1GHWH 2PLXA 4WMFA 4JZ1A 1P10A 2R3YA 1QRXA 1XKBC 5LGOA 1S0QA 2AIPA 2XXLA 1Y5AT 2IPHA 2FYQA 1LVOA 4X2WA 1CHGA 3ODFA 1W11U 3LGTA 4DGJA 2GV6A 1ZPCA 1F0SA 1OS8A 3U1JB 3E6PH 1ELTA 2EA3A 1P12E 1W0YH 1CVWH 1MAYA 3SW2B 1HGTH 1K1IA 1TFXA 3E16B 2PUQH 2ZGHA 2XCFA 2JETC 1ESBA 2PWXA 4O3TA 5JDUB 1F92A 2QN5T 3ZVCA 3QUMP 2RCEA 3LGVA 2AMQA 1NC6A 1VITF 2WUCA 1A3EH 2SNWA 1P2JA 2ODYB 4OS6A 3M3SA 3E1XB 1U6QA 2Z9GA 1NRPH 1TABE 1P3CA 3TU7H 2ZFRH 3MNCA 4Y7BA 2ANWA 1TX7A 2XTTB 3PB1E 5EXMA 1TNGA 3ATIA 4Y6DA 2WPIS 1S81A 2OBQA 1EJMA 1LHDH 2BX3A 4X6PA 2VVUA 1GJBB 2Z3EA 2GT7A 1HXEH 3AAVA 5DP8A 2A2XH 2BB4A 2ANMH 1WBGB 2FX6A 1K1OA 2FI3E 3PLPA 2CGAA 2VU8E 1W10U 4AG1A 4XBCA 5T6DA 2H5DA 3NPSA 3P8FA 4E05H 1NPMA 1L4DA 3SUFA 3TNTA 4TPIZ 1GMDF 1YPLH 2Q6FA 1QBOA 2HPQH 3GY7A 3NUMA 1NTPA 4B2CA 4HTCH 1S84A 1Y59T 1S6FA 5DK1A 2JETB 1TOMH 1QNJA 1XUKA 1C1RA 1ZTJA 2R9PA 2RG3A 1PPGE 5EODA 2OLGA 2ODPA 2FWWA 2H5CA 3LKWA 3NK8A 1ZMLA 3MFJA 3A82A 4WF8A 1KLTA 1AZ8A 4UONA 4MNXA 3HPTB 2B8OH 1ORFA 1FY5A 1XUGA 2ANYA 1PPCE 4ZROA 2TPIZ 2Z9LA 4ESTE 2FOBA 2Z94A 4B73A 2XC5A 1YM0A 2A4QA 1C5PA 4WMEA 5E8EH 2O8LA 5EQQA 2BD5A 4H6TA 1YPHE 2ZGBH 3TH3H 1BHXB 2ZG0H 1O2IA 2BD8A 1MMJN 3PV4A 1KDQA 1HAYB 2B7DH 3FVFB 1V2WT 1Y3YA 4ISIH 4KTCA 5E2PA 1GHAF 2FI5E 3FZDA 3DA9B 2ZPQA 3ZVBA 2STAE 2TGDA 3ZZ9A 1ESTA 2STBE 2XC4A 1F5KU 2A7HA 2BY7X 4Z6AH 2TGPZ 4JYTA 2GMTC 1ACBE 1EPTA 1AVXA 1NY22 1DSUA 3OY5U 2ZIQH 1QJ6B 5JPMH 1GCDA 1Z71A 3PMHB 2PTCE 2J95A 3ZVEA 1SGDE 1V2TT 1RD3B 3MH4A 1MQ5A 4K1SA 1A61H 4NIVA 3NKKA 3MMGA 3NXPA 1GGDC 1B5GH 1UJ1A 1GJCB 1AB9C 1OWKA 1GI3A 1P3EA 4ABEA 5HYOA 3MWIU 2ESTE 1OKXA 1SVPA 1C4Y2 2FYRA 1LQDB 2DE8A 3UPEA 3MNBA 3VB5A 5JB8S 5TJXA 2ZTXA 4H42U 1V2QT 4K69A 2UWPA 3SUGA 2QC2A 4YO9A 2ZFPH 1BMNH 4CRFA 1GMCF 1FY4A 3E0PB 5T6GA 1T7CA 4X6NA 2FDAA 3F68H 1B7XB 3BEFB 3FANA 1ZLRA 2ZGJA 5A0CA 1MTSA 2EC9H 1O3MA 2Y5FA 3RXJA 2QXHA 1DWDH 3K9XB 1QL7A 2CJIA 1FMGA 4GPGA 3U8RH 1EZXC 1EOLA 2FZZA 1TGSZ 2GMTB 2B5TB 3EDXB 3M61U 1SR5C 1GI4A 1V2MT 2OUAA 4I32A 1TX6A 3A89A 4ZKNU 3AW0A 4BANB 4X1RU 1DUAA 2BDCA 3RDZA 1MQ6A 3OYPA 2J9NA 3S9CA 2OC0A 1AKSB 3MO9A 1EASA 1D3PB 1UTNA 1O30A 3GYMA 3QGNB 5B6OA 1GGDB 1AB9B 4JCNA 1T4UH 2R2WU 1GBAA 3FP7E 1E0FD 1JRSA 3MYWA 1P2MA 1EP6A 2Z9IA 2A4RA 1SHYA 4ABJA 4NSVA 3RXFA 4BAMB 1Z7KA 2O8TA 5IDKA 1WTHD 2TGTA 5A8ZA 1SLUB 2V3HH 1P2QA 3QTVH 1C2GA 7LPRA 2J94A 1FY3A 1E35B 1NZQH 4IC5A 1CHOG 1O3NA 1EB1H 1RGQA 1B0EA 3A7WA 1A2CH 1GMCG 2W7SA 1EQ9A 2V6NA 2GCHG 4AORA 2V3OH 4JYUH 4ZUHA 2A5KA 4F49A 1FAKH 3SHAH 3RMLH 1RS0A 5LH8A 3CENA 1BMAA 2YNAA 2ZFTA 1KXEA 3PLBA 3T25A 1HPGA 5F6MA 1DICA 4OGXA 2SGPE 2ZF0H 3OY6U 2HWLB 1LMWB 3IWMA 1E37B 2F9BH 3QN7A 1GL1A 1Z8RA 5A0BA 1T8OA 1XUHA 3DUXH 4UFGH 4HI3A 1BTPA 1KXCA 2AMPA 1QA7A 3DD2H 4X1QU 1Y8TA 1T8MA 3TITA 3BF6H 3PMJA 4ZHLU 1IAUA 2ZWLH 1FAXA 5EU8A 4FU8A 1P2NA 3ATWA 4CRCA 1GG6B 5EOKA 2R2MB 5FPYA 2Z3DA 1THRH 4AB9A 4A92A 1MD7A 2BOKA 2FI4E 5C3NA 2ZDKA 3D23A 3L3TA 1O2HA 2QCYA 4O97A 3TK9A 5C67A 1C1WH 3A8DA 1JBUH 2ZDMA 1B0FA 3SV2H 3TK5A 2HOBA 2XWAA 1EPTC 1YCPH 1TRNA 2FOEA 1ELEE 1V2JT 1GL0E 1QURH 1A5GH 2PFEA 5J4SA 4CH2B 4NG9H 2ZKSA 1O3LA 4FUHA 3RU4E 4NZLA 1LHCH 5BRRE 3RC6A 1BJVA 2W3KA 1O39A 2F9VA 1QRWA 2W3IA 2LPRA 1KTTB 2FESH 3EA9A 1BBRK 1FY1A 1C5TA 1GHBF 3BTTE 3UR6A 4LK4A 5AVDA 3ZVAA 1SB1H 5J4QA 2BHGA 1ELFA 4DVAU 2CHAB 1H1BA 3SJ8A 4B76A 3BTEE 1DWBH 4GVUA 1HJAC 4Q80A 3KN2A 5TCCA 1JRTA 1NM6A 2Y5GA 3U69H 2VH0A 1HLTH 2G4UA 1KDQB 1V3XA 2SGFE 2YNBA 4K8YA 3SU4A 3M7QA 1ZRKA 1ZHRA 5HGGA 1GBIA 2QIQA 2H9TH 1IQLA 2P3UB 3G01A 3A81A 1C2EA 3ZVGA 4AX9H 1PQ5A 1EPTB 3U8OH 1HIAA 1O3OA 4DY7B 1GJ6A 1ANCA 1LTOA 2PUXB 3UOUA 3BTWE 1P8VC 4K5ZA 8KME2 1O3DA 2BD9A 1PQ7A 4QT8C 3RXDA 1F0TA 1BTYA 4KELA 2P3TB 1UTJA 3SORA 1H8IH 4ZKOU 1E34B 1NRNH 1W2KH 1Z8JB 4VGCC 1ELDE 4I31A 1C1UH 1MBMA 4Y79A 1UK3A 3GDSA 3S9BA 3GDVA 1FZZA 2FOAA 3TIUA 1PPBH 1C5LH 2QY0B 1NT1A 3UQOA 5EXNA 1M9UA 1GHBG 1HJAB 3TPIZ 2ALPA 2O8WA 1VGCC 1SLWB 1SOTA 1GMHF 2EEKA 3LU9B 4ZMAH 3UNSA 3GYLB 4YESB 3MH5A 2P95A 1K1LA 1OYQA 2P16A 4WH8A 4FVDA 1NO9H 3UWJH 2C8XB 2GX4A 3HKIB 5JBBS 1LQEA 3HATH 4X8VH 3TNSA 4FUJA 2WPLS 3GY2A 2G5VA 3A7YA 3O8CA 4HGCA 1LHGH 2P59A 1BTXA 4MPUA 4ZH8A 1GI2A 2V0BA 4ZHMU 3I29A 3SU0A 2JH0D 2Y82A 1FJSA 5HXFA 1ZPBA 4WWYA 5FCRA 2BLWA 1ETRH 1EP5A 1UVTH 3ATMA 1ZSLA 2VVVA 1F5LA 3T28A 3E0NB 2JH6D 1O2JA 1THSH 3ENSB 2GDEH 1TAWA 3STJA 1H9LB 3BTKE 3K65B 6GCHF 4OS2A 1L1JA 3A85A 1TMUH 3VFEA 1VGCB 1XVMA 3V13A 1P11E 1QR3E 2ZZUH 2QV1A 1MD8A 5T3HA 1D9IA 2ZCKP 1J15A 1HAHH 1G32B 4BAOB 3R3GB 4YOJA 2J4IA 3SGQE 2OQ5A 5FBEA 3F9EA 2WINI 2FODA 1OX1A 1UTKA 4CR5A 1Z6EA 2ZGCA 1PJPA 1O3HA 2VWNA 4I8JA 1ZJKA 3P92A 4D9QA 1WAYB 1BCUH 3WY8A 1T4VH 1ZMNA 2A7CA 1QCPA 1ARBA 1RTKA 1BT7A 2IJOB 1C1QA 3A83A 3EQ0H 3ZZ3A 2FEQH 4DOQA 1GI6A 1W7XH 1TGBA 3SI4H 2OTVA 3V12A 1TYNA 1GHZA 2A1DB 3Q3KA 3T2NA 1D3DB 2PKAA 4IC6A 3MU5A 4WVPE 3SO3A 1O5DH 2Y80A 1HDTH 3Q3XA 1G30B 5LPEA 2A31A 2ZHEH 3STIA 1AVWA 3RM2H 1X7AC 3VGCC 1EAWA 4JZIA 1SFQB 1T8LA 1EX3A 2J38A 3MU0A 1HCGA 1HXFH 4RN6A 2FOMB 3GY5A 5CMXH 1YKTA 6GCHG 5EQSA 1VCQA 1TBZH 4K1TA 5EG4A 4CRAA 1C5VA 3HK3B 4YOGA 1AKSA 1RXPA 1MKXH 3U9AH 2SGQE 3KQBA 2AERH 4YOIA 1VJ9U 1YPEH 3AAUA 2AH4X 3OTJE 4R8TB 3BV9B 1O2PA 1Q3XA 2GVFA 3UNQA 9LPRA 3RXCA 1HJ8A 2ZGXH 3RXKA 1O2WA 2BD4A 2F9UA 2AGIX 1XVOA 4I8KA 1IQEA 3ZVDA 1AE5A 5JBCS 1KXFA 3P8GA 1CQQA 1ID5H 1SGNE 1O33A 2XBXA 1W7GH 4WJG2 3F9HA 5DP5A 2A45B 1K1JA 3B23B 2P93A 1A0HB 1AO5A 4DURA 1KTSB 1EZQA 4YT7H 1TGNA 1BMMH 1SHHB 4WXIA 1XXDA 1UMAH 4AFQA 3A7VA 3VGCB 3S9AA 4D76A 1OWJA 4YM9A 2VH6A 1AUJA 1JIMA 1TPSA 3MNXA 4ABAA 1BOQA 3HGPA 4KP0A 3GCTG 1SC8U 4CRBA 4DG4A 2FTLE 2ZDAH 3ITIA 3SUEA 1WV7H 3SU1A 1AQ7A 3V7TA 5FHTA 7GCHG 1QB9A 1BMLA 1CE5A 4BTUB 3RXPA 1HIAB 3KCGH 3T29A 2XC0A 5FX6A 3UTUH 1IOEA 5AFZH 1MZDA 1SGPE 5JBTA 1LVMA 3GOVB 5HMAA 1HRTH 1XX9A 1IHSH 1C1PA 4OS5A 1TNLA 2GZ8A 4KTUA 1FLEE 2PSXA 3M7UA 2D8WA 1WUNH 1XKAC 1PPZA 3UY9A 3NWUA 4YT6H 1P57B 1TPAE 4DW2U 3U8TH 1Z1JA 3ZZ7A 1HAZB 5DP4A 1O3KA 5DPAA 3FP6E 4GHQA 1C9TA 2GZ7A 2BDIA 3FZZA 3Q77A 1CGIE 1HYLA 3VB3A 1O2KA 1O2UA 5H4IB 1OWEA 2C8YB 3BN9A 1FN8A 4TWYA 3L33A 4FXGH 4UD9H 2ALVA 1Y3WA 1DOJA 1HBTH 2TGAA 3PM3A 1AY6H 1O2ZA 1Z8GA 1HNEE 1UVSH 3RXUA 4Y8YA 1O5BB 1ELAA 3LH3A 1JMOH 3TJUA 4Y0ZE 3A7XA 2WPHS 2OCVB 2HVXA 1A0JA 1CBWC 1F0RA 1TX8A 4MNYA 1K1NA 2R0KA 1EOJA 1PPFE 3ATLA 4NWKA 2QXIA 1MTNC 1NU9A 1G36A 4JMYA 2QXJA 4K1EA 4AN7A 3TGJE 1DUEA 4D7FA 2ZO3H 4DCDA 2O9QA 2NU3E 2HLCA 3M5NA 3ZZ6A 3UREA 1QBVH 1J8AA 4NIWA 1E36B 2AYWA 1Y5BT 2CXVA 1QTFA 1W13U 5L2YH 1TA2A 1BBRH 1O5EH 1S82A 1Q2WA 2WV5A 1QJ7B 3TJOA 4FVBA 2QA9E 1GHVH 5K0HA 1DM4B 2BZ6H 4H6SB 3SNAA 1L2EA 3MHWU 4A7IB 4X2YA 1WSSH 1J9CH 2XNIA 1S85A 2TIOA 4IGDA 1CBWB 1NFYA 5JB9S 4KGAA 1H4WA 1KXBA 5EGMA 3RXTA 4FUBA 1TMTH 1PQ8A 1UCYK 2UUKB 1O3EA 1OP8A 1H9IE 1PYTD 1SGCA 3KQDA 1W0ZU 1MTNB 1CHOF 1GBDA 2OP9A 1SPJA 3LPRA 1QB1A 3T62A 6LPRA 1XUJA 1YPMH 4LZ1H 2GCHF 1Y3VA 1QJ1B 2IN2A 1BHXF 1SLXB 3O8RA 4RKOB 5T6FA 4MNVA 1G3EA 5C20A 1S83A 2PKAB 1LDTT 1BIOA 1O3PB 4X6MA 2PSYA 5FAHA 1VCPA 6CHAC 1YCPM 4UE7H 1SBWA 1O31A 1YLCA 1O5CB 4ZAEA 4DT7B 1SQOA 2FLBH 2XBYA 3QZQA 2AIQA 3KHVA 1EAXA 2XWBI 3IITA 5K7RA 1OP2A 1SGYE 2F9NA 4NIXA 1Y3XA 1TBQH 5IYTA 2P94A 3LGIA 3DFJA 4Q2KA 2FLRH 4XOJA 2FS8A 1NRQH 1BQYA 1WU1A 4B74A 1Y5UT 4TWWA 1UO6A 4FUDA 3OX7U 1DITH 1SGFG 4ASHA 2CV3A 4Y8XA 1C2IA 1G3BA 1JIRA 2FOGA 1LVYA 1HAVB 2BQ6B 1ABJH 1O37A 1PPHE 2BVRH 4ABHA 1MKWK 2A4OA 3M3VA 3RXSA 1DANH 1DVAH 1SGQE 2M5TA 2K1QA 1L0ZA 1F0UA 1AI8H 4WH6A 2NU0E 1ZHPA 5A0AE 1JWTA 1QQ4A 1RTFB 2YOLA 5A09A 1IHTH 1OXGA 3MTYA 2VIWA 1FN6A 3MU4A 6CHAB 3M36A 1IQMA 2J92A 4MPWA 3B9FH 1OWDA 4MNWA 3HGNA 4AGKA 3GY4A 4ISNA 3SV7A 1W8BH 1ESAA 2R0LA 4UFDH 1CGHA 1TNJA 4FUFA 5EQRA 3BG4C 2BDBA 3KQEA 1O3GA 1AN1E 5A8YA 4A1VA 4AG2A 1V2NT 4AZ2B 2VJ1A 3BIVH 1VCWA 3F6UH 1ZRBA 2ZU1A 2BD7A 1SI5H 2GP9B 3PWCA 2BLQA 3SZNA 1XUIA 3UQVA 1T31A 3RXBA 1J14A 4X8UH 1NFWA 1P2OA 2BY5X 1EUFA 1C1MA 1O36A 5CE1A 3GICB 4MQAA 1FNIA 3RU4T 3URCA 2H6MA 1PQAA 3O8BA 4SGAE 4YTAA 3W94A 5GWZA 1GBTA 2OD3B 1DPOA 3LONA 1TONA 2BX4A 1AWHB 3RXQA 1WQSA 1O3AA 3TH2H 5GPIB 1O0DH 1TIOA 3MO3A 3PTBA 4K2YA 4XDEA 1P2KA 3S69A 3GDUA 3RXVA 4BAQB 4MDSA 3GCOA 4ISLA 2PV9B 2PGQB 4IMQA 1GJ4H 1O5FH 2FPZA 1S0RA 5ABWA 1ELBA 2OQUA 3A88A 4XBDA 1O2GH 1FPHH 1UHBA 1YPHC 3BG4B 2A4GA 5LPRA 1YPGH 2VWMA 3BEUA 1MBQA 2GGVB 1TA6A 4IMZA 3ZZ5A 3W95A 1V6DA 1C5WB 1N8OC 1HJ9A 1QL9A 3UUZA 4WY3A 1N1LA 1OOKB 3SI3H 3OU0A 4TY7A 4ISHH 1DLKB 1K1MA 3LC5A 3RXEA 2A5IA 3BTQE 1V2KT 3SNDA 1GDUA 5HM2A 1YPJH 2BXUH 2ZTYA 3AVZA 1YYY1 4GLYA 4CBNA 3PYHA 2ZEBA 1ZTLA 1WCZA 5EW1H 3FAOA 4MTBA 2P8OC 4GHTA 1BRBE 3L6PA 4U01A 3B8JA 1EAUA 1HAIH 2BLOA 2ZHFH 1SOZA 2UUJB 4CRGA 2FM2A 3HKJB 3K6ZA 1GDQA 3N7OA 1DDJA 4J2YB 3CP7A 4WXVA 1C5NH 3R0FA 4BXWA 4D9RA 1T32A 5ESBA
chains in the Genus database with same CATH superfamily
2PHBA 2ZHDA 3QWCH 2G4TA 2O8MA 2QGRA 2Y5HA 4SGBE 1PYTC 3LH1A 1N8OB 1C2KA 2XBWA 1ZTKA 3SBKA 1C5XB 1HAGE 1P05A 1UK2A 3U98H 2NU2E 2W6ID 1BRCE 2AGGX 2ZDVH 2FXRA 2QE7D 2QYIA 2BY6X 4ZXXH 3CNRA 1FONA 1C1SA 2G52A 4ZKSU 5C1XA 1EAIA 1RIWC 3LGWA 2C90B 1SGFA 2VB0A 5FPTA 1C2HA 5C17A 3C27B 1DE7H 1Y3UA 5E2OA 2VIDA 5C5NA 7KMEH 1SGIB 1HAPH 2I6SA 1IQJA 2C3SA 3M3TA 4CBOA 2P8OB 4XSKU 4B6FA 1BBRE 2WV9A 3I77A 3EA7A 2PR3A 1O2LA 1GBFA 1V2PT 2FMJA 1ZMJA 4UFFH 1Z8IB 3GY6A 3OE7D 1QL8A 1UTOA 2IJD1 3SYJA 2PKSC 1P03A 2R3UA 1BJUA 4GSOA 3EE0B 5E0JA 3SQEE 2WUBA 2WV4A 1SSXA 3MNSA 1BTZA 4O03A 1CSOE 3MI4A 2JH5D 1C5MD 5L30H 2Z3CA 2NU4E 1IQNA 3RM0H 2W7UA 3VXFH 1O2NA 4VGCB 2OXSA 4RSPA 4D8NA 4D7GA 2BDAA 4AFZA 1GBKA 2Y6TA 3CS7A 4UDWH 4BAKB 4JYVH 4NA8A 5A2MH 1UK4A 1V2UT 2BZAA 2HALA 3BTHE 1TPOA 2VGCC 2BD3A 1A3BH 1TQ7B 2PP6A 2Y7ZA 1TQ0B 2UUYA 1P9UA 1C5RA 4MPVA 1ZR0A 4TY6A 3N99A 1QY6A 1RIWB 4JK6A 5SGAE 3M7TA 2P3FH 1V2OT 2GDDA 3KL6A 1O3BA 4K60A 4JZEH 4Y10E 3BTDE 4ZXYH 1GPZA 2Q1JA 3SOSA 1UTLM 3C1KA 1A5IA 5E0HA 4U30A 2FS9A 1DWEH 3A80A 3QGJA 2PKSB 2J98B 5KEDA 2ZU3A 1CT2E 3QZRA 2CF8H 1NRSH 1NU7B 4INLA 4YZUA 4UFEH 5JBAS 5C5OA 1MCVA 1V2LT 3DSOA 4YLQH 1UTQA 1C2MA 5DP9A 1BA8B 1SG8B 2PW8H 4JZFH 1O38A 2Q6GA 1OPHB 2FOCA 5HM9A 1L4ZA 2WZQA 3H09A 3MOCA 1GBHA 5LPFA 1TNHA 2SGEE 1QB6A 2EI6A 1P01A 3MH6A 1NS3A 5F53A 2VGCB 2F91A 2VIOA 1EJAA 3W1EA 4E7RG 3GCTF 4JK5A 3FFGA 3H5CB 3P70B 4IS5A 1FIZA 1O34A 3RC5A 4ABBA 2PGBB 1KYNA 4B6EA 1UCYH 2H9HA 1GI5A 2QF4A 2ZTZA 2FX4A 1O35A 7GCHF 3T5FH 1BMFD 1QRZA 4IBLH 2BDYA 2VIVA 4TSFD 1L1NA 2BLVA 2F9PA 2FO9A 2FTMA 1FQ3A 1RTLA 5FPSA 2HLDD 2L74A 4I8GA 1VJAU 2XYAA 1IQHA 4RKJB 5GIBA 4BXSA 1A46H 3PV5A 1BTUA 1ZGVA 2O8UA 5GCHG 1C4U2 2ZI2H 3CS0A 1FUJA 3ZVFA 2Q6DA 1ZGIA 1BITA 1PPEE 3F1SB 1ZSJA 3FN8A 5GJ4B 1HAVA 4CHAC 5EPYA 2DE9A 2ZA5A 5C2ZA 1FV9A 2SGDE 3T27A 3SJ9A 4ABGA 2KAIB 1UHBB 1O2SA 1RJXB 3MU8A 1GBLA 1NN6A 4Q7YA 5FL7D 4BOHA 3NRLA 3BEIB 1C1TA 2ZU4A 1IQFA 3U1IB 1GJ8B 2D1JA 5L6NH 1UTMA 3GISB 2BTCE 1O2MA 4FUIA 1FY8E 2BVSH 4X6OA 3ZZ8A 5AF9H 1P9SA 2IOTA 1K22H 5HIYA 1AMHA 2ZFQH 5IK2D 2W6JD 1H8DH 4K3JA 4I33A 3SU2A 1AWFH 1TB6H 4P02A 2W5EA 1MKWH 3A87A 3SNBA 1YP9A 1LPKB 2ZHWH 1BUIA 1GJAB 4B1TA 3RLYH 2HNTC 1G3DA 1W12U 2OC7A 1ELVA 3ELAH 8GCHG 1GCTC 3QLPH 1QHRB 1BTWA 3N7DA 1KXDA 1Q31A 3GCHC 4I8LA 3K2UA 2OBOA 1GJ9B 2A0QB 1ETTH 4Y0YE 4CHAB 5FBIA 8ESTE 1K28D 1O3CA 2TBSA 1D4PB 1TMBH 3RXRA 1GI8B 1O5AB 5CHBA 3UFAA 1ZHMA 3SU5A 2BYAX 4OS1A 3FKSD 2ULLA 1DY8A 4AYVB 4H4FA 2XNDD 4M7GA 4XRNA 4NCYA 2BDGA 1CU1A 1EJNA 2DUCA 1DXWA 3ZZDA 3A7ZA 4K8BA 3F3BA 2FOHA 1O5GH 2ZDNA 2KZ4A 1L1GA 2BOHB 1G37A 2AS9A 2UWOA 4LXBH 4Y11E 1J17T 2C8WB 3M5MA 1A4WH 2ASUB 1J16A 4HFPB 1SMFE 1GBBA 1O3IA 2C8ZB 2VIPA 3Q00A 4KKDA 1LKAA 4X1NU 1P06A 3UIRA 1BDAA 1P09A 2VIQA 1ZSKA 4INKA 4A6LA 1BTHH 3KF2A 1S6HA 5EW2H 1UVPA 2GV7A 5FX5A 1EATA 3EGKH 1YBWA 3D49H 3BTME 8LPRA 2F3CE 4ABIA 2QF0A 1GCTB 3TGKE 2ZECA 3GCHB 1G2LA 1C1OA 1D6WA 4Q7XA 1P02A 4NGAH 3LT3A 4LZ4B 2J34A 2Y7XA 1G9IE 2WYGA 1FPCH 1O32A 5GDSH 5C1UA 4AYYB 1VITG 1ANDA 5DJ7A 2VWOA 4O9VA 1KLIH 4BAHB 3ZV8A 3RXOA 1C5SA 1LPZB 1GHXH 3TK6A 1ZZZA 3D62A 1AIXH 4FU7A 3ZZCA 5FCKA 3TJVA 1LO6A 1W14U 3MH7A 1TWXB 3GY8A 1CA8B 3OTPA 3PMAB 1C2LA 2V3MA 3F0OA 4NIYA 4Y8ZA 2WPMS 5E0GA 4ZHAA 3RXLA 1THPB 3OFND 1W0KD 3ATKA 3SGAE 1ABIH 3ODDA 4GCHF 3PTNA 2BVXH 5ESTE 3A7TA 2H2ZA 6ESTA 3NZIA 1GDNA 3KEEA 2AGEX 3FP8E 1GBCA 1DSTA 1ARCA 4OS4A 1AFEH 4X0WU 3HK6B 1GMDG 1QQUA 2HRVA 1C2FA 4U2WA 2RFKC 2ZFSA 2B0FA 1XM1A 2HNTF 1TALA 2RA0A 2ZU2A 2Z9KA 1FDPA 3SU3A 5ETXA 1C2JA 2I6QA 5EJZA 2QXGA 1K21H 1SQTA 1C5YB 2OINA 1RRKA 1E38B 2G81E 3V0XA 2Z7FE 1OHHD 2GZ9A 4NA7A 3KIDU 3TVJB 2HPPH 1CA0C 2WPJS 1PFXC 1AVGH 3UWIA 1NBME 2C93B 3Q3YA 4CRDA 3F9FA 4XBBA 3RMOH 1AE8H 3SU6A 4BTTB 2Z6BD 3RP2A 1KXAA 4X2VA 2G8TA 5G4BA 5CHAC 1BB0B 1MKXK 1HV7A 3P8OA 2ZFFH 2FIRH 4UEHH 4A5TS 1AHTH 2Z9JA 2EI7A 4FUEA 1YPKH 3SV6A 4ISOA 4HZHA 1MTUA 1FIWA 4TYDA 3RMMH 4GCHG 1K0HA 1GHAG 3SNCA 4DJZB 3K6YA 4NSYA 1K2I1 2GD4B 1GI1A 4OS7A 1A0LA 1IQIA 5DGJA 4THNH 1GBEA 2KCOA 3D65E 3FOAA 3QK1A 1MU8B 2ANKH 3BTFE 4IW4E 1YGCH 1C1NA 1EKBB 4E06H 3M35A 3DHKH 1TBRH 3P95A 1GVKB 1LPGB 1P04A 3OSYA 5GNDA 2C4FH 1V2RT 1CA0B 3E91A 1BRUP 1F2SE 1SGEE 3E90B 2GCTC 3EA8A 4DIIH 3LC3A 5DP3A 1GG6C 3EYDA 4NFFA 3SV9A 1HAOH 1D3TB 5CHAB 3KQCA 1YF4A 3T26A 3PMBB 3QO6A 3VB7A 1UCYE 3SJKA 1O2VA 5GXPA 3VXEH 2CN0H 1O2TA 2VBCA 1N6XA 4B2AA 1FXYA 4DIHH 2ZNKH 3ESTA 1O2YA 3GY3A 3LJOA 1KY9A 1MABB 1TGTA 1JXPA 1TNIA 2GKVE 1EZSC 1K9OE 3SUDA 2VINA 1EZUC 1SGRE 1LCYA 2ZC9H 2ZCHP 4F4OC 1ZPZA 1LHFH 2WSSD 1NFXA 1DLEA 2EY4C 1A5HA 9ESTA 1ZYOA 3S0NA 1GI9B 1DS2E 2QF3A 2RA3A 1TLDA 3UR9A 3LOXA 2BDHA 2FP7B 5DP6A 1QGFA 1XXFA 3MU1A 1DY9A 1HAXB 4GUXA 4X8SH 2ZCLP 1N6YA 3E3TA 3ZYEA 3TGIE 2VNTA 1AZZA 3RXHA 2UUFB 3ZZAA 3F2HA 5TCAA 4FOUC 2BQ7B 2WYJA 4FU9A 3UB0A 1Z6JH 3F0PA 4Y76A 3PRDA 1DX5M 2H9EH 2ZQ2A 3PO1C 4LOYH 4MG3A 3TJNA 3TLOA 4XFQA 5PTPA 1CT4E 2CHAC 1C2DA 2GCTB 3BTGE 1GWAA 3RU4D 1IQKA 1NESE 4F55A 2LNCA 5F03A 2F83A 2OC8A 1D3QB 1NROH 1DWCH 3E8LA 4MPXA 2EI8A 1H9HE 4AGJA 4E7NA 2RDLA 5EJLA 1QBNA 3P17H 5EPNA 4ABDA 1MH0A 4ACAA 3PRBA 3SGBE 1CO7E 1GVLA 1OSSA 1TPPA 3VEQB 1AD8H 3ZZ4A 2KAIA 1OP0A 1SLVB 1SFIA 1MUEB 2G55A 4TPYA 5AHGH 4B75A 4I8HA 5DG6A 5BPEA 2NWNA 4Z0KA 1AFQC 1XMNB 2GT8A 3P6ZB 2AMDA 4AFSA 2ILNA 4NZQA 5A8XA 4AC9A 2ZQ1A 2CK3D 2ZHQH 1S5SA 1SGTA 1EXFA 2BMGB 1W3CA 3H7TA 1UTPA 2KX4A 3QTOH 3A86A 3RXGA 1MTWA 1P2IA 1A7SA 5F8TA 1V2ST 4B2BA 1P0SH 1OWHA 2CF9H 1G3CA 7ESTE 2J5UA 3LDXH 1T8NA 3PO1B 1F5RA 1OYTH 2CMYA 2A2QH 3GCNA 3ZIAD 2G00A 3AW1A 5T1VA 5DKMA 4X8TH 2H1UA 1HB0B 3JZ1B 3LJJA 1O3FA 4J1YA 3H7OA 2BD2A 2AFQB 3V3MA 2BY8X 2ODQA 1DT2A 2LP6A 5AFYH 1OWIA 1GI7B 4U32A 1F7ZA 5CDFE 2ZPRA 3RXMA 3UOPA 1SL3A 3M5LA 4Q7ZA 2ZDLA 1GBMA 1KLJH 1WTGH 3A84A 4FUCA 3MO6A 3URDA 3LGYA 1AFQB 4CR9A 1GJ7B 4MLFB 3WWBA 1JOUB 3BG8A 1MU6B 1TRYA 3AASA 3VB6A 1AU8A 4INHA 4PROA 5JYIA 2ZPSA 5DP7A 4MVNA 3NCLA 1C5UA 2XCNA 2HNTE 1GJDB 2BXTH 4NFEA 1ZJDA 3M5OA 4NA9H 3Q76A 3RUOA 1C5OH 3I78A 1ANEA 2K8IA 2THFB 1AUTC 2A32A 3IG6B 1MAXA 4CREA 1YC0A 3BIUH 1TOCB 2SFAA 2J2UA 3RC4A 1XUFA 1QFKH 1TGCA 1O3JA 1GBJA 1LKBA 3ZV9A 1KSNA 4OGYA 1MTVA 2BQWB 1O2XA 4X1PU 5EIYA 1Z1IA 3KGPA 4BTIB 5F8XA 3RLWH 2WPKS 1HFDA 2G51A 4CH8B 4BNRA 5I46H 2TRMA 2BM2A 3VB4A 4XE4A 1ANBA 1NFUA 4WMDA 2SGAA 1MZAA 4Y7AA 1C9PA 3LGUA 2AEIH 1DXPA 1MCTA 1QIXB 1AGJA 1ELGA 3QX5H 3RMNH 1C5ZB 1GHYH 3QDZB 3DT0H 4R0IA 1UVUH 1SQAA 3P8NA 1WQVH 1EB2A 3O8DA 2OC1A 4AOQA 2GTBA 2AHME 3JZ2B 2L6OA 2Y81A 2JJ1D 1VZQH 2ZU5A 1E1RD 1CGJE 1GJ5H 2JKHA 4I7YH 5GCHF 3BSQA 1GI0A 2KFWA 2G5NA 1D6RA 1G2MA 1QA0A 4KTSA 3A8AA 3SV8A 2SNVA 1UVOA 2W26A 1TRMA 5F8ZA 5DO4H 2ZP0H 5L2ZH 3M37A 1C1VH 2VVCA 3PLKA 3VPKA 1FI8A 1RFNA 3S7HB 4JZDH 3F9GA 4AFUA 4AB8A 2B9LA 1BRAA 1GMHG 3UNRA 4ABFA 5C1YA 3PROA 1CT0E 3TH4H 3SJIA 4NWLA 3A8BA 2A5AA 1INCA 2WPDD 1C4V2 5FXLA 3ZZBA 3EAJA 1KIGH 1A1RA 2QAAA 1YLDA 2UWLA 2HGTH 3RXIA 1O2QA 3RXAA 3LIWA 1BZXE 4A1XA 4B71A 1V2VT 1K1PA 1H8ED 2VWLA 1WOFA 1YCPK 1WYKA 1NRRH 3FO8D 4X2XA 4IN1A 4GAWA 3S7KB 1VR1H 8GCHF 2XBVA 2D26C 1FX0B 2XW9A 3SN8A 1LHEH 4YLUA 2XRCA 1TNKA 1ELCA 1IQGA 1GVZA 3SQHE 4A1TA 2A7JA 2NU1E 5EXLA 3SHCH 3KNXA 4Y71A 3SNEA 1HUTH 1ZOMA 3PWBA 3DFLA 4X1SU 2V35A 3SJOA 2FOFA 1LVBA 1DFPA 1O2OA 5I25A 1C5QA 4Q63A 4ZKRU 4IN2A 1ETSH 4FUGA 2PTNA 2F9OA 1TE0A 3A8CA 2BY9X 1O2RA 1VITH 4O3UA 3ZYDA 2D2DA 1GHWH 2PLXA 4WMFA 4JZ1A 1P10A 2R3YA 1QRXA 1UW7A 2JIZD 3WWFA 1XKBC 5LGOA 1S0QA 2AIPA 2XXLA 1Y5AT 2IPHA 2FYQA 1LVOA 2IPQX 4X2WA 1CHGA 3ODFA 1W11U 3LGTA 4DGJA 2GV6A 1ZPCA 1F0SA 1OS8A 3U1JB 3E6PH 1ELTA 2EA3A 1P12E 1W0YH 1CVWH 1MAYA 3SW2B 1HGTH 1K1IA 1TFXA 3EE7A 3E16B 2PUQH 2ZGHA 2XCFA 2JETC 1E79D 1ESBA 2PWXA 4O3TA 2QF5A 5JDUB 1F92A 2QN5T 3ZVCA 3QUMP 2RCEA 3LGVA 2AMQA 1NC6A 1VITF 2WUCA 1A3EH 5HIZA 2SNWA 1P2JA 2ODYB 4OS6A 3M3SA 3E1XB 1U6QA 2Z9GA 1NRPH 1TABE 1P3CA 3TU7H 2ZFRH 3MNCA 4Y7BA 2ANWA 1TX7A 2XTTB 3PB1E 5EXMA 1TNGA 3ATIA 4Y6DA 2WPIS 1S81A 2OBQA 1EJMA 1LHDH 5DN6D 2BX3A 4X6PA 2VVUA 1GJBB 2Z3EA 2GT7A 1HXEH 3AAVA 5DP8A 2A2XH 2BB4A 2ANMH 1WBGB 2FX6A 1K1OA 2FI3E 3PLPA 2CGAA 2VU8E 1W10U 4AG1A 4XBCA 5T6DA 2H5DA 3NPSA 3P8FA 4E05H 1NPMA 1L4DA 3SUFA 3TNTA 4TPIZ 2HVYB 1GMDF 1YPLH 5DSFA 2Q6FA 1QBOA 2HPQH 3GY7A 3NUMA 1NTPA 4B2CA 4HTCH 1S84A 1Y59T 1S6FA 2KM0A 5DK1A 2JETB 1TOMH 1QNJA 1XUKA 1C1RA 1ZTJA 2R9PA 2RG3A 1PPGE 5EODA 2OLGA 2ODPA 2FWWA 2H5CA 3LKWA 3NK8A 2GJGA 1ZMLA 3MFJA 3A82A 4WF8A 1KLTA 1AZ8A 4UONA 4MNXA 3HPTB 2B8OH 1ORFA 1FY5A 2KCPA 1XUGA 2ANYA 1PPCE 4ZROA 2TPIZ 2Z9LA 4ESTE 2FOBA 2Z94A 4B73A 2XC5A 1YM0A 2A4QA 1C5PA 4WMEA 5E8EH 2O8LA 5EQQA 2BD5A 4H6TA 1YPHE 2ZGBH 3TH3H 1BHXB 2ZG0H 1O2IA 2BD8A 1MMJN 3PV4A 1KDQA 1HAYB 1YY3A 2B7DH 3FVFB 1V2WT 1Y3YA 4ISIH 4KTCA 5E2PA 1GHAF 2FI5E 3FZDA 3DA9B 2ZPQA 3ZVBA 2STAE 2TGDA 3ZZ9A 1ESTA 2STBE 5C0TA 2XC4A 1F5KU 2A7HA 2BY7X 4Z6AH 2TGPZ 4JYTA 2GMTC 1ACBE 1EPTA 1AVXA 1NY22 1DSUA 3OY5U 4P00A 2ZIQH 1QJ6B 5JPMH 1GCDA 1Z71A 2LELA 2PTCE 3PMHB 2J95A 3ZVEA 1SGDE 1V2TT 1RD3B 3MH4A 1MQ5A 4K1SA 1A61H 1NBMD 4NIVA 3NKKA 3MMGA 3NXPA 1GGDC 1B5GH 1UJ1A 1GJCB 1AB9C 1OWKA 1GI3A 1P3EA 4ABEA 5EJ1A 5HYOA 3MWIU 2ESTE 1OKXA 1SVPA 1C4Y2 2FYRA 1LQDB 2DE8A 3UPEA 3MNBA 3VB5A 5JB8S 5TJXA 2ZTXA 4H42U 1V2QT 4K69A 2UWPA 3SUGA 2QC2A 4YO9A 2ZFPH 1BMNH 4CRFA 1GMCF 1FY4A 3E0PB 5T6GA 1T7CA 4X6NA 2FDAA 3F68H 1B7XB 3BEFB 3FANA 1ZLRA 2ZGJA 5A0CA 1MTSA 2EC9H 1O3MA 2Y5FA 3RXJA 2QXHA 1DWDH 3K9XB 2KR7A 1QL7A 2CJIA 1FMGA 4GPGA 3U8RH 1EZXC 1EOLA 2FZZA 1TGSZ 2XOKD 2GMTB 2B5TB 3EDXB 3M61U 1SR5C 1GI4A 1V2MT 2OUAA 4I32A 1TX6A 3A89A 4ZKNU 3AW0A 4BANB 4X1RU 3KQ5A 1DUAA 2BDCA 3RDZA 1MQ6A 1SQRA 3OYPA 2J9NA 3S9CA 2OC0A 1AKSB 3MO9A 1EASA 1D3PB 1UTNA 1O30A 3GYMA 3QGNB 5B6OA 1GGDB 1AB9B 4JCNA 1T4UH 2R2WU 4XD7D 1GBAA 3FP7E 1E0FD 1JRSA 3MYWA 1P2MA 1EP6A 2Z9IA 2A4RA 1SHYA 4ABJA 4NSVA 3RXFA 4BAMB 1Z7KA 2O8TA 5IDKA 1WTHD 2TGTA 5A8ZA 1SLUB 2V3HH 1P2QA 3QTVH 1C2GA 7LPRA 2J94A 1FY3A 2YMSD 1E35B 1NZQH 4DT4A 4IC5A 1CHOG 1O3NA 1EB1H 1RGQA 1B0EA 3A7WA 1A2CH 1GMCG 2W7SA 4RI0A 1EQ9A 2F4LA 2V6NA 2GCHG 4AORA 2V3OH 4JYUH 4ZUHA 2A5KA 2KCAA 4F49A 1FAKH 3SHAH 3RMLH 1RS0A 5LH8A 3CENA 1BMAA 2YNAA 2ZFTA 1KXEA 3PLBA 3T25A 1HPGA 5F6MA 1DICA 4OGXA 2SGPE 2ZF0H 3U28C 3OY6U 2HWLB 1LMWB 3IWMA 1E37B 2F9BH 3QN7A 1GL1A 1Z8RA 5A0BA 1T8OA 1XUHA 3DUXH 4UFGH 4HI3A 1BTPA 1KXCA 2AMPA 1QA7A 3DD2H 4X1QU 1Y8TA 1T8MA 3TITA 3BF6H 3PMJA 4ZHLU 1IAUA 2ZWLH 1FAXA 5EU8A 1WDIA 1P2NA 3ATWA 4FU8A 4CRCA 1GG6B 5EOKA 2R2MB 5FPYA 2Z3DA 3OEED 1THRH 4AB9A 4A92A 1MD7A 2EQNA 2BOKA 2FI4E 5C3NA 2ZDKA 3D23A 3L3TA 1O2HA 2QCYA 2JJ2D 4O97A 3TK9A 5C67A 1C1WH 3A8DA 1JBUH 2ZDMA 1B0FA 3SV2H 3TK5A 2HOBA 4Z1MD 2XWAA 1EPTC 1YCPH 1TRNA 2FOEA 1ELEE 2JDID 1V2JT 1GL0E 1QURH 1A5GH 2PFEA 5J4SA 4CH2B 4NG9H 2ZKSA 1O3LA 4FUHA 3RU4E 4NZLA 1LHCH 5BRRE 3RC6A 1BJVA 2W3KA 1O39A 2F9VA 1QRWA 2W3IA 2LPRA 1KTTB 2FESH 3EA9A 1BBRK 1FY1A 1C5TA 1GHBF 3BTTE 3UR6A 4LK4A 2RDEA 5AVDA 3ZVAA 1SB1H 5J4QA 2BHGA 1ELFA 4DVAU 2CHAB 1H1BA 3SJ8A 4B76A 3BTEE 1DWBH 1SKYE 4GVUA 1HJAC 4Q80A 3KN2A 5TCCA 1JRTA 3WW7A 4M9FA 1NM6A 2Y5GA 3U69H 2VH0A 1HLTH 2G4UA 1KDQB 1V3XA 2SGFE 2YNBA 4K8YA 3SU4A 3M7QA 1ZRKA 1ZHRA 5HGGA 1GBIA 2QIQA 2H9TH 1IQLA 3SZEA 2P3UB 3G01A 3A81A 1C2EA 3ZVGA 4AX9H 2KCYA 1PQ5A 1EPTB 3U8OH 1HIAA 1O3OA 4DY7B 1GJ6A 1ANCA 1LTOA 2PUXB 3UOUA 3BTWE 1P8VC 4OM9A 4K5ZA 8KME2 1O3DA 2BD9A 1PQ7A 4QT8C 3RXDA 1F0TA 1BTYA 4KELA 2P3TB 1UTJA 3SORA 1H8IH 4ZKOU 1E34B 1NRNH 1W2KH 1Z8JB 4VGCC 1ELDE 3OAAD 4I31A 1C1UH 1MBMA 4Y79A 1UK3A 3GDSA 3S9BA 3GDVA 1FZZA 2FOAA 3TIUA 1PPBH 1C5LH 2QY0B 1NT1A 3UQOA 5EXNA 1M9UA 1GHBG 1HJAB 3TPIZ 2ALPA 1VGCC 2O8WA 1SLWB 1SOTA 1GMHF 2EEKA 3LU9B 4ZMAH 3UNSA 3GYLB 4YESB 3MH5A 2P95A 1K1LA 1OYQA 2P16A 4WH8A 4FVDA 1NO9H 3UWJH 2C8XB 2GX4A 2WHXA 3OEHD 3HKIB 5JBBS 1LQEA 3HATH 4X8VH 3TNSA 4FUJA 2WPLS 3GY2A 2G5VA 3A7YA 3O8CA 4HGCA 1LHGH 2P59A 1BTXA 4MPUA 4ZCNA 4ZH8A 1GI2A 2V0BA 4ZHMU 3I29A 3SU0A 2JH0D 2Y82A 1FJSA 5HXFA 1ZPBA 4WWYA 5FCRA 2BLWA 1ETRH 1EP5A 1UVTH 3ATMA 1ZSLA 2VVVA 1F5LA 2J97A 3T28A 3E0NB 2JH6D 1O2JA 1THSH 3ENSB 2GDEH 1TAWA 3STJA 1H9LB 3DCLA 3BTKE 3K65B 3N7EA 6GCHF 4OS2A 1L1JA 2YMSC 3A85A 1TMUH 3VFEA 1VGCB 1XVMA 3V13A 1P11E 1QR3E 2ZZUH 2QV1A 1MD8A 5T3HA 1D9IA 2ZCKP 1J15A 1HAHH 1G32B 4BAOB 3R3GB 4YOJA 2J4IA 3SGQE 2OQ5A 5FBEA 3F9EA 2WINI 3MQKC 2FODA 1OX1A 1UTKA 4CR5A 1Z6EA 2ZGCA 1PJPA 1O3HA 2VWNA 4I8JA 4FETA 4HG6A 1ZJKA 3P92A 4D9QA 1WAYB 1BCUH 3WY8A 1T4VH 1ZMNA 2A7CA 1QCPA 1ARBA 1RTKA 1BT7A 2IJOB 1C1QA 3A83A 3EQ0H 3ZZ3A 2FEQH 3F2FA 4DOQA 1GI6A 1W7XH 1TGBA 3SI4H 2OTVA 3V12A 1TYNA 1GHZA 2A1DB 1COWD 3Q3KA 3T2NA 1D3DB 2PKAA 4IC6A 3MU5A 4WVPE 3SO3A 1O5DH 2Y80A 1HDTH 3Q3XA 1G30B 5LPEA 2A31A 2ZHEH 3STIA 1AVWA 2YMSB 3RM2H 1X7AC 3VGCC 1EAWA 4JZIA 1SFQB 1T8LA 1EX3A 2J38A 3MU0A 1HCGA 1HXFH 3PV2A 4RN6A 2FOMB 3GY5A 5CMXH 1YKTA 6GCHG 5EQSA 1VCQA 1TBZH 4K1TA 5EG4A 4CRAA 1C5VA 3HK3B 4YOGA 1AKSA 1RXPA 1MKXH 3U9AH 2SGQE 5C94A 3KQBA 2AERH 4YOIA 1VJ9U 1YPEH 3AAUA 2AH4X 3OTJE 4R8TB 3BV9B 1O2PA 1Q3XA 2GVFA 3UNQA 9LPRA 3RXCA 1HJ8A 2ZGXH 3RXKA 1O2WA 2BD4A 2F9UA 2AGIX 3GS9A 1XVOA 4I8KA 1IQEA 3ZVDA 1AE5A 5JBCS 1KXFA 3P8GA 1CQQA 1ID5H 1SGNE 1O33A 2XBXA 1W7GH 4WJG2 3F9HA 5DP5A 2A45B 1K1JA 3B23B 2P93A 1A0HB 1AO5A 4DURA 1KTSB 4RT1A 1EZQA 4YT7H 1TGNA 1BMMH 1SHHB 4WXIA 1XXDA 1UMAH 4AFQA 3A7VA 3VGCB 3S9AA 4D76A 1OWJA 4YM9A 2VH6A 1AUJA 1JIMA 1TPSA 3MNXA 4ABAA 1BOQA 3HGPA 4KP0A 3GCTG 1SC8U 4CRBA 4DG4A 2FTLE 2ZDAH 3ITIA 3SUEA 1WV7H 3SU1A 1AQ7A 3V7TA 5FHTA 7GCHG 1QB9A 1BMLA 1CE5A 3DSPA 4BTUB 3RXPA 1HIAB 3KCGH 1S6LA 2XC0A 5FX6A 3T29A 3UTUH 1IOEA 5AFZH 1MZDA 1SGPE 5JBTA 1LVMA 3GOVB 3KYGA 5HMAA 1HRTH 1XX9A 1IHSH 1C1PA 4OS5A 1TNLA 2GZ8A 4KTUA 1FLEE 2PSXA 3M7UA 2V7QD 2D8WA 1WUNH 1XKAC 1PPZA 3UY9A 3NWUA 4YT6H 1P57B 1TPAE 4DW2U 3VG8A 3U8TH 1Z1JA 3ZZ7A 1HAZB 5DP4A 1O3KA 5DPAA 3FP6E 4GHQA 1C9TA 2GZ7A 2BDIA 3FZZA 3Q77A 1CGIE 3UAIC 1HYLA 3VB3A 1O2KA 1O2UA 5H4IB 1OWEA 2C8YB 3BN9A 1FN8A 4TWYA 3L33A 4FXGH 4UD9H 2ALVA 1Y3WA 1DOJA 4ASUD 1HBTH 2TGAA 3PM3A 1AY6H 1KMHB 1O2ZA 1Z8GA 5HKKD 2F43B 1HNEE 1UVSH 3RXUA 3DSGA 4Y8YA 1O5BB 1ELAA 3LH3A 1JMOH 3TJUA 4Y0ZE 3A7XA 2WPHS 2OCVB 2HVXA 1A0JA 1WXRA 1CBWC 1F0RA 1TX8A 4MNYA 1K1NA 2R0KA 1EOJA 1PPFE 3ATLA 4NWKA 2QXIA 5KECA 1MTNC 1NU9A 1G36A 4JMYA 2QXJA 4K1EA 4AN7A 3TGJE 1DUEA 4D7FA 2ZO3H 4DCDA 2O9QA 2NU3E 2HLCA 3M5NA 3ZZ6A 3UREA 1QBVH 1J8AA 4NIWA 1E36B 2AYWA 1Y5BT 2CXVA 1QTFA 1W13U 5L2YH 1TA2A 1BBRH 1O5EH 1S82A 1Q2WA 2WV5A 1QJ7B 3TJOA 4FVBA 2QA9E 1GHVH 5K0HA 1DM4B 2BZ6H 4H6SB 3SNAA 1L2EA 3MHWU 4A7IB 4X2YA 1WSSH 1J9CH 2XNIA 1S85A 2TIOA 4IGDA 1CBWB 1NFYA 5JB9S 4KGAA 1H4WA 1KXBA 5EGMA 3RXTA 4FUBA 1TMTH 1PQ8A 1UCYK 2UUKB 1O3EA 1OP8A 1H9IE 1PYTD 1SGCA 3KQDA 1W0ZU 1MTNB 1CHOF 1GBDA 2OP9A 1SPJA 3LPRA 1QB1A 3T62A 6LPRA 1XUJA 1YPMH 4LZ1H 3AK5A 2GCHF 1Y3VA 1QJ1B 2IN2A 1BHXF 1SLXB 3O8RA 4RKOB 5T6FA 4MNVA 1G3EA 5C20A 1S83A 2PKAB 1LDTT 1BIOA 1O3PB 4X6MA 2PSYA 5FAHA 1VCPA 6CHAC 1YCPM 4UE7H 1SBWA 1O31A 1YLCA 1O5CB 4ZAEA 4DT7B 1SQOA 2FLBH 2XBYA 3QZQA 4ACBA 2AIQA 3F2GA 1EAXA 3KHVA 2XWBI 3IITA 5K7RA 1OP2A 1SGYE 2F9NA 4NIXA 1Y3XA 1TBQH 5IYTA 2P94A 3LGIA 3DFJA 4Q2KA 2FLRH 4XOJA 2FS8A 1NRQH 1BQYA 1WU1A 4B74A 1Y5UT 1EFRD 4TWWA 1UO6A 4FUDA 4YXWD 3OX7U 1DITH 1SGFG 4ASHA 2CV3A 4Y8XA 1C2IA 1G3BA 1JIRA 2FOGA 1LVYA 1HAVB 2BQ6B 1ABJH 1O37A 1PPHE 2BVRH 1YWUA 1MKWK 4ABHA 2A4OA 3M3VA 3RXSA 1DANH 1DVAH 1SGQE 2M5TA 2OK5A 2K1QA 1L0ZA 1F0UA 1AI8H 4WH6A 2NU0E 1ZHPA 5A0AE 1JWTA 1QQ4A 1RTFB 2YOLA 5A09A 1IHTH 1OXGA 3MTYA 2VIWA 1FN6A 3MU4A 6CHAB 3M36A 1IQMA 2J92A 4MPWA 3B9FH 1OWDA 4MNWA 3HGNA 1E1QD 4AGKA 3GY4A 4ISNA 2J98A 3SV7A 1W8BH 1ESAA 2R0LA 2K0QA 4UFDH 1CGHA 1TNJA 4FUFA 5EQRA 3BG4C 2BDBA 3KQEA 1O3GA 1AN1E 5A8YA 5KGOA 4A1VA 4AG2A 1V2NT 4AZ2B 2VJ1A 3BIVH 1VCWA 3F6UH 1ZRBA 2ZU1A 3KYFA 2BD7A 1SI5H 2GP9B 1W0JD 2BLQA 3PWCA 3SZNA 1XUIA 3UQVA 1T31A 5B6LA 3RXBA 1J14A 1YLNA 4X8UH 1NFWA 1P2OA 2BY5X 1EUFA 1C1MA 1O36A 5CE1A 3GICB 4MQAA 1FNIA 1VKYA 3RU4T 3URCA 2H6MA 1PQAA 3O8BA 4SGAE 4YTAA 3W94A 5GWZA 1GBTA 2OD3B 4RT0A 1DPOA 3LONA 1TONA 2BX4A 4I86A 1AWHB 3RXQA 1WQSA 1O3AA 3TH2H 5GPIB 1O0DH 1TIOA 3MO3A 3PTBA 4K2YA 4XDEA 1P2KA 3S69A 1H8HD 3GDUA 3RXVA 4BAQB 4MDSA 3GCOA 4ISLA 2PV9B 2PGQB 4IMQA 1GJ4H 1O5FH 2FPZA 1S0RA 5ABWA 1ELBA 2OQUA 3A88A 4XBDA 1O2GH 1FPHH 1UHBA 1YPHC 3BG4B 2A4GA 5LPRA 4Q4LA 1YPGH 2VWMA 3BEUA 1MBQA 2GGVB 1TA6A 4IMZA 2M2AA 3ZZ5A 3W95A 1V6DA 1C5WB 1N8OC 1HJ9A 1QL9A 3UUZA 4WY3A 1N1LA 1OOKB 3SI3H 3OU0A 4TY7A 4ISHH 1DLKB 1K1MA 3LC5A 3RXEA 2A5IA 3BTQE 1V2KT 3SNDA 1GDUA 5HM2A 1YPJH 2BXUH 2ZTYA 3AVZA 1YYY1 4GLYA 4CBNA 3PYHA 2ZEBA 1ZTLA 1WCZA 5EW1H 3FAOA 4MTBA 2P8OC 4GHTA 1BRBE 3L6PA 4U01A 3B8JA 1EAUA 1HAIH 2BLOA 2ZHFH 1SOZA 2UUJB 4CRGA 2FM2A 3HKJB 1QZ8A 3K6ZA 1GDQA 3N7OA 1DDJA 4J2YB 3CP7A 4TT3D 4WXVA 1C5NH 4F48B 3R0FA 4BXWA 4D9RA 1T32A 5C0UA 5ESBA
chains in the Genus database with same CATH topology
2PHBA 2ZHDA 3QWCH 2G4TA 2O8MA 2QGRA 2Y5HA 4SGBE 1PYTC 3LH1A 1N8OB 1C2KA 2XBWA 1ZTKA 3SBKA 1C5XB 1HAGE 1P05A 1UK2A 3U98H 2NU2E 1BRCE 2AGGX 2ZDVH 2FXRA 2QYIA 2BY6X 4ZXXH 1FONA 1C1SA 2G52A 4ZKSU 5C1XA 1EAIA 1RIWC 3LGWA 2C90B 1SGFA 2VB0A 5FPTA 1C2HA 3C27B 1DE7H 1Y3UA 5E2OA 2VIDA 5C5NA 7KMEH 1SGIB 1HAPH 2I6SA 1IQJA 2C3SA 3M3TA 4CBOA 2P8OB 4XSKU 1BBRE 3I77A 3EA7A 2PR3A 1O2LA 1GBFA 1V2PT 2FMJA 1ZMJA 4UFFH 1Z8IB 3GY6A 1QL8A 1UTOA 2PKSC 1P03A 2R3UA 1BJUA 4GSOA 3EE0B 5E0JA 3SQEE 2WUBA 2WV4A 1SSXA 3MNSA 1BTZA 4O03A 1CSOE 3MI4A 2JH5D 1C5MD 5L30H 2Z3CA 2NU4E 1IQNA 3RM0H 2W7UA 3VXFH 1O2NA 4VGCB 2OXSA 4RSPA 4D8NA 4D7GA 2BDAA 4AFZA 1GBKA 2Y6TA 3CS7A 4UDWH 4BAKB 4JYVH 4NA8A 5A2MH 1UK4A 1V2UT 2BZAA 2HALA 3BTHE 1TPOA 2VGCC 2BD3A 1A3BH 1TQ7B 2Y7ZA 1TQ0B 2UUYA 1P9UA 1C5RA 4MPVA 1ZR0A 4TY6A 1QY6A 1RIWB 4JK6A 5SGAE 3M7TA 2P3FH 1V2OT 2GDDA 3KL6A 1O3BA 4K60A 4JZEH 4Y10E 3BTDE 4ZXYH 1GPZA 2Q1JA 3SOSA 1UTLM 3C1KA 1A5IA 5E0HA 4U30A 2FS9A 1DWEH 3A80A 3QGJA 2PKSB 2ZU3A 1CT2E 3QZRA 2CF8H 1NRSH 1NU7B 4INLA 4YZUA 4UFEH 5JBAS 5C5OA 1MCVA 1V2LT 4YLQH 1UTQA 1C2MA 5DP9A 1BA8B 1SG8B 2PW8H 4JZFH 1O38A 2Q6GA 1OPHB 2FOCA 5HM9A 1L4ZA 3MOCA 1GBHA 5LPFA 1TNHA 2SGEE 1QB6A 2EI6A 1P01A 3MH6A 1NS3A 2VGCB 2F91A 2VIOA 1EJAA 4E7RG 3GCTF 4JK5A 3FFGA 3H5CB 3P70B 4IS5A 1FIZA 1O34A 3RC5A 4ABBA 2PGBB 1KYNA 1UCYH 2H9HA 1GI5A 2ZTZA 2FX4A 1O35A 7GCHF 3T5FH 1QRZA 4IBLH 2BDYA 2VIVA 1L1NA 2BLVA 2F9PA 2FO9A 2FTMA 1FQ3A 1RTLA 5FPSA 4I8GA 1VJAU 2XYAA 1IQHA 4RKJB 5GIBA 4BXSA 1A46H 1BTUA 1ZGVA 2O8UA 5GCHG 1C4U2 2ZI2H 3CS0A 1FUJA 3ZVFA 2Q6DA 1ZGIA 1BITA 1PPEE 3F1SB 1ZSJA 5GJ4B 1HAVA 4CHAC 5EPYA 2DE9A 2ZA5A 5C2ZA 1FV9A 2SGDE 3T27A 3SJ9A 4ABGA 2KAIB 1UHBB 1O2SA 1RJXB 3MU8A 1GBLA 1NN6A 4Q7YA 4BOHA 3BEIB 1C1TA 2ZU4A 1IQFA 3U1IB 1GJ8B 2D1JA 5L6NH 1UTMA 3GISB 2BTCE 1O2MA 4FUIA 1FY8E 2BVSH 4X6OA 3ZZ8A 5AF9H 1P9SA 2IOTA 1K22H 1AMHA 2ZFQH 1H8DH 4K3JA 4I33A 3SU2A 1AWFH 1TB6H 2W5EA 1MKWH 3A87A 3SNBA 1YP9A 1LPKB 2ZHWH 1BUIA 1GJAB 4B1TA 3RLYH 2HNTC 1G3DA 1W12U 2OC7A 1ELVA 3ELAH 8GCHG 1GCTC 3QLPH 1QHRB 1BTWA 1KXDA 1Q31A 3GCHC 4I8LA 3K2UA 2OBOA 1GJ9B 2A0QB 1ETTH 4Y0YE 4CHAB 5FBIA 8ESTE 1K28D 1O3CA 2TBSA 1D4PB 1TMBH 3RXRA 1GI8B 1O5AB 3UFAA 1ZHMA 3SU5A 2BYAX 4OS1A 2ULLA 1DY8A 4AYVB 4H4FA 4M7GA 4NCYA 2BDGA 1CU1A 1EJNA 2DUCA 1DXWA 3ZZDA 3A7ZA 4K8BA 2FOHA 1O5GH 2ZDNA 1L1GA 2BOHB 1G37A 2AS9A 2UWOA 4LXBH 4Y11E 1J17T 2C8WB 3M5MA 1A4WH 2ASUB 1J16A 4HFPB 1SMFE 1GBBA 1O3IA 2C8ZB 2VIPA 3Q00A 4KKDA 1LKAA 4X1NU 1P06A 3UIRA 1BDAA 1P09A 2VIQA 1ZSKA 4INKA 4A6LA 1BTHH 3KF2A 1S6HA 5EW2H 1UVPA 2GV7A 5FX5A 1EATA 3EGKH 1YBWA 3D49H 3BTME 8LPRA 2F3CE 4ABIA 2QF0A 1GCTB 3TGKE 2ZECA 3GCHB 1G2LA 1C1OA 1D6WA 4Q7XA 1P02A 4NGAH 3LT3A 4LZ4B 2J34A 2Y7XA 1G9IE 2WYGA 1FPCH 1O32A 5GDSH 5C1UA 4AYYB 1VITG 1ANDA 5DJ7A 2VWOA 4O9VA 1KLIH 4BAHB 3ZV8A 3RXOA 1C5SA 1LPZB 1GHXH 3TK6A 1ZZZA 3D62A 1AIXH 4FU7A 3ZZCA 5FCKA 3TJVA 1LO6A 1W14U 3MH7A 1TWXB 3GY8A 1CA8B 3PMAB 4NIYA 1C2LA 4Y8ZA 4ZHAA 2WPMS 5E0GA 3RXLA 1THPB 3ATKA 3SGAE 1ABIH 3ODDA 4GCHF 3PTNA 2BVXH 5ESTE 3A7TA 2H2ZA 6ESTA 3NZIA 1GDNA 3KEEA 2AGEX 3FP8E 1GBCA 1DSTA 1ARCA 4OS4A 1AFEH 4X0WU 3HK6B 1GMDG 1QQUA 2HRVA 1C2FA 4U2WA 2ZFSA 2B0FA 1XM1A 2HNTF 1TALA 2RA0A 2ZU2A 2Z9KA 1FDPA 3SU3A 5ETXA 1C2JA 2I6QA 2QXGA 1K21H 1SQTA 1C5YB 2OINA 1RRKA 1E38B 2G81E 3V0XA 2Z7FE 2GZ9A 4NA7A 3KIDU 3TVJB 2HPPH 1CA0C 2WPJS 1PFXC 1AVGH 3UWIA 2C93B 3Q3YA 4CRDA 3F9FA 4XBBA 3RMOH 1AE8H 3SU6A 4BTTB 2Z6BD 3RP2A 1KXAA 4X2VA 2G8TA 5G4BA 5CHAC 1BB0B 1MKXK 1HV7A 3P8OA 2ZFFH 2FIRH 4UEHH 4A5TS 1AHTH 2Z9JA 2EI7A 4FUEA 1YPKH 3SV6A 4ISOA 4HZHA 1MTUA 1FIWA 4TYDA 3RMMH 4GCHG 1GHAG 3SNCA 4DJZB 3K6YA 4NSYA 1K2I1 2GD4B 1GI1A 4OS7A 1A0LA 1IQIA 5DGJA 4THNH 1GBEA 3D65E 3QK1A 1MU8B 2ANKH 3BTFE 4IW4E 1YGCH 1C1NA 1EKBB 4E06H 3M35A 3DHKH 1TBRH 3P95A 1GVKB 1LPGB 1P04A 3OSYA 2C4FH 1V2RT 1CA0B 3E91A 1BRUP 1F2SE 1SGEE 3E90B 2GCTC 3EA8A 4DIIH 3LC3A 5DP3A 1GG6C 3EYDA 4NFFA 3SV9A 1HAOH 1D3TB 5CHAB 3KQCA 1YF4A 3T26A 3PMBB 3QO6A 3VB7A 1UCYE 3SJKA 1O2VA 5GXPA 3VXEH 2CN0H 1O2TA 1N6XA 4B2AA 1FXYA 4DIHH 2ZNKH 3ESTA 1O2YA 3GY3A 3LJOA 1KY9A 1TGTA 1JXPA 1TNIA 2GKVE 1EZSC 1K9OE 3SUDA 2VINA 1EZUC 1SGRE 1LCYA 2ZC9H 2ZCHP 4F4OC 1ZPZA 1LHFH 1NFXA 1DLEA 1A5HA 9ESTA 1ZYOA 3S0NA 1GI9B 1DS2E 2QF3A 2RA3A 1TLDA 3UR9A 3LOXA 2BDHA 2FP7B 5DP6A 1QGFA 1XXFA 3MU1A 1DY9A 1HAXB 4GUXA 4X8SH 2ZCLP 1N6YA 3E3TA 3ZYEA 3TGIE 2VNTA 1AZZA 3RXHA 2UUFB 3ZZAA 5TCAA 2BQ7B 2WYJA 4FU9A 1Z6JH 4Y76A 1DX5M 2H9EH 2ZQ2A 3PO1C 4LOYH 4MG3A 3TJNA 3TLOA 4XFQA 5PTPA 1CT4E 2CHAC 1C2DA 2GCTB 3BTGE 1GWAA 3RU4D 1IQKA 1NESE 2LNCA 5F03A 2F83A 2OC8A 1D3QB 1NROH 1DWCH 3E8LA 4MPXA 2EI8A 1H9HE 4AGJA 4E7NA 2RDLA 1QBNA 3P17H 5EPNA 4ABDA 1MH0A 3SGBE 1CO7E 1GVLA 1OSSA 1TPPA 3VEQB 1AD8H 3ZZ4A 2KAIA 1OP0A 1SLVB 1SFIA 1MUEB 2G55A 4TPYA 5AHGH 4B75A 4I8HA 5DG6A 5BPEA 2NWNA 4Z0KA 1AFQC 1XMNB 2GT8A 3P6ZB 2AMDA 4AFSA 2ILNA 4NZQA 5A8XA 2ZQ1A 2ZHQH 1S5SA 1SGTA 1EXFA 2BMGB 1W3CA 3H7TA 1UTPA 3QTOH 3A86A 3RXGA 1MTWA 1P2IA 1A7SA 5F8TA 1V2ST 4B2BA 1P0SH 1OWHA 2CF9H 1G3CA 7ESTE 3LDXH 1T8NA 3PO1B 1F5RA 1OYTH 2CMYA 2A2QH 3GCNA 2G00A 3AW1A 5DKMA 4X8TH 2H1UA 1HB0B 3JZ1B 3LJJA 1O3FA 4J1YA 3H7OA 2BD2A 2AFQB 3V3MA 2BY8X 2ODQA 1DT2A 5AFYH 1OWIA 1GI7B 4U32A 1F7ZA 2ZPRA 3RXMA 3UOPA 1SL3A 3M5LA 4Q7ZA 2ZDLA 1GBMA 1KLJH 1WTGH 3A84A 4FUCA 3MO6A 3URDA 3LGYA 1AFQB 4CR9A 1GJ7B 4MLFB 1JOUB 3BG8A 1MU6B 1TRYA 3AASA 3VB6A 1AU8A 4INHA 4PROA 5JYIA 2ZPSA 5DP7A 4MVNA 3NCLA 1C5UA 2XCNA 2HNTE 1GJDB 2BXTH 4NFEA 1ZJDA 3M5OA 4NA9H 3Q76A 3RUOA 1C5OH 3I78A 1ANEA 2THFB 1AUTC 2A32A 3IG6B 1MAXA 4CREA 1YC0A 3BIUH 1TOCB 2SFAA 2J2UA 3RC4A 1XUFA 1QFKH 1TGCA 1O3JA 1GBJA 1LKBA 3ZV9A 1KSNA 4OGYA 1MTVA 2BQWB 1O2XA 4X1PU 1Z1IA 3KGPA 4BTIB 5F8XA 3RLWH 2WPKS 1HFDA 2G51A 4CH8B 4BNRA 5I46H 2TRMA 2BM2A 3VB4A 4XE4A 1ANBA 1NFUA 4WMDA 2SGAA 1MZAA 4Y7AA 1C9PA 3LGUA 2AEIH 1DXPA 1MCTA 1QIXB 1AGJA 1ELGA 3QX5H 3RMNH 1C5ZB 1GHYH 3QDZB 3DT0H 4R0IA 1UVUH 1SQAA 3P8NA 1WQVH 1EB2A 3O8DA 2OC1A 4AOQA 2GTBA 3JZ2B 2Y81A 1VZQH 2ZU5A 1CGJE 1GJ5H 2JKHA 4I7YH 5GCHF 3BSQA 1GI0A 2G5NA 1D6RA 1G2MA 1QA0A 4KTSA 3A8AA 3SV8A 2SNVA 1UVOA 2W26A 1TRMA 5F8ZA 5DO4H 2ZP0H 5L2ZH 3M37A 1C1VH 2VVCA 3PLKA 3VPKA 1FI8A 1RFNA 3S7HB 4JZDH 3F9GA 4AFUA 4AB8A 2B9LA 1BRAA 1GMHG 3UNRA 4ABFA 5C1YA 3PROA 1CT0E 3TH4H 3SJIA 4NWLA 3A8BA 2A5AA 1INCA 1C4V2 5FXLA 3ZZBA 3EAJA 1KIGH 1A1RA 2QAAA 1YLDA 2UWLA 2HGTH 3RXIA 1O2QA 3RXAA 3LIWA 1BZXE 4A1XA 4B71A 1V2VT 1K1PA 2VWLA 1WOFA 1YCPK 1WYKA 1NRRH 4X2XA 4IN1A 4GAWA 3S7KB 1VR1H 8GCHF 2XBVA 2D26C 2XW9A 3SN8A 1LHEH 4YLUA 2XRCA 1TNKA 1ELCA 1IQGA 1GVZA 3SQHE 4A1TA 2A7JA 2NU1E 5EXLA 3SHCH 3KNXA 4Y71A 3SNEA 1HUTH 1ZOMA 3PWBA 3DFLA 4X1SU 2V35A 3SJOA 2FOFA 1LVBA 1DFPA 1O2OA 5I25A 1C5QA 4ZKRU 4IN2A 1ETSH 4FUGA 2PTNA 2F9OA 1TE0A 3A8CA 2BY9X 1O2RA 1VITH 4O3UA 3ZYDA 2D2DA 1GHWH 2PLXA 4WMFA 4JZ1A 1P10A 2R3YA 1QRXA 1XKBC 5LGOA 1S0QA 2AIPA 2XXLA 1Y5AT 2IPHA 2FYQA 1LVOA 4X2WA 1CHGA 3ODFA 1W11U 3LGTA 4DGJA 2GV6A 1ZPCA 1F0SA 1OS8A 3U1JB 3E6PH 1ELTA 2EA3A 1P12E 1W0YH 1CVWH 1MAYA 3SW2B 1HGTH 1K1IA 1TFXA 3E16B 2PUQH 2ZGHA 2XCFA 2JETC 1ESBA 2PWXA 4O3TA 5JDUB 1F92A 2QN5T 3ZVCA 3QUMP 2RCEA 3LGVA 2AMQA 1NC6A 1VITF 2WUCA 1A3EH 2SNWA 1P2JA 2ODYB 4OS6A 3M3SA 3E1XB 1U6QA 2Z9GA 1NRPH 1TABE 1P3CA 3TU7H 2ZFRH 3MNCA 4Y7BA 2ANWA 1TX7A 2XTTB 3PB1E 5EXMA 1TNGA 3ATIA 4Y6DA 2WPIS 1S81A 2OBQA 1EJMA 1LHDH 2BX3A 4X6PA 2VVUA 1GJBB 2Z3EA 2GT7A 1HXEH 3AAVA 5DP8A 2A2XH 2BB4A 2ANMH 1WBGB 2FX6A 1K1OA 2FI3E 3PLPA 2CGAA 2VU8E 1W10U 4AG1A 4XBCA 5T6DA 2H5DA 3NPSA 3P8FA 4E05H 1NPMA 1L4DA 3SUFA 3TNTA 4TPIZ 1GMDF 1YPLH 2Q6FA 1QBOA 2HPQH 3GY7A 3NUMA 1NTPA 4B2CA 4HTCH 1S84A 1Y59T 1S6FA 5DK1A 2JETB 1TOMH 1QNJA 1XUKA 1C1RA 1ZTJA 2R9PA 2RG3A 1PPGE 5EODA 2OLGA 2ODPA 2FWWA 2H5CA 3LKWA 3NK8A 1ZMLA 3MFJA 3A82A 4WF8A 1KLTA 1AZ8A 4UONA 4MNXA 3HPTB 2B8OH 1ORFA 1FY5A 1XUGA 2ANYA 1PPCE 4ZROA 2TPIZ 2Z9LA 4ESTE 2FOBA 2Z94A 4B73A 2XC5A 1YM0A 2A4QA 1C5PA 4WMEA 5E8EH 2O8LA 5EQQA 2BD5A 4H6TA 1YPHE 2ZGBH