3PTNA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ptnA02
1AWHB 1V2VT 4TWWA 1QRZA 1V2OT 2ZHDA 4A92A 2P3UB 1AZ8A 2A5KA 3MU0A 1FQ3A 2VJ1A 2SNWA 2AMPA 3PMBB 1TPPA 1ANDA 4X6PA 6GCHF 3RC5A 2ZDMA 4K8BA 2CGAA 1SFIA 2ZG0H 5CHAB 2W5EA 2KAIA 3K6YA 1P2OA 4FVBA 1IHSH 2ZDLA 1MQ5A 1CHGA 4X6OA 1K2I1 2BX3A 2F9UA 2OCVB 4FXGH 4D8NA 1YCPK 2SGEE 1FY8E 1GHAF 3QZQA 2BM2A 2CXVA 3P8NA 1AVGH 2IOTA 4FU7A 4FUFA 4SGAE 5FXLA 3KL6A 4YOGA 4TYDA 4GCHF 2GCHG 2ZTXA 1C1TA 5TCCA 4Y79A 2EEKA 3LC5A 4ZUHA 4JYVH 3RXMA 1D6WA 1O5CB 3RC4A 1O3FA 1PJPA 2ZGBH 4OS7A 2OC7A 2WPIS 1QQ4A 1JIMA 1SLUB 1YBWA 5DPAA 2CJIA 1SGFG 1YLCA 2A45B 1GHVH 4NWLA 1ZYOA 1C2FA 3SGQE 1TQ0B 1GHWH 3KNXA 1IQMA 1EAXA 1SI5H 1F0TA 1AVXA 1MMJN 1MQ6A 1L1JA 2BDBA 2SGPE 4WVPE 1TNIA 5EOKA 1LQDB 4OS5A 5AHGH 4CR5A 1E0FD 4MPVA 4NWKA 3PTNA 1EAWA 4X8SH 1TNLA 3S7HB 1ABJH 1V2WT 3RMMH 4J2YB 2PKAB 1BT7A 2B8OH 1MUEB 3BN9A 1TYNA 1V3XA 1Z7KA 2WPLS 1ZMNA 3FVFB 2GX4A 1O33A 4TPYA 3MNBA 1P57B 2Y5HA 2ZFPH 2PKSB 1C9PA 3BTHE 4CH2B 3DD2H 5F6MA 3Q3KA 5SGAE 4NCYA 3U98H 2A1DB 1NO9H 2CHAB 5DO4H 3M5OA 2OTVA 1HAXB 4NIWA 3A8DA 1PPCE 5FPSA 2F9OA 1AE8H 3O8DA 5A0AE 3ITIA 4R0IA 4CR9A 1RXPA 2Z7FE 2ZU3A 3A88A 3MO9A 1HGTH 3SNBA 3FP8E 4KGAA 1LHCH 4H6SB 4CBNA 1DVAH 1K1IA 2VIWA 1V2RT 2HWLB 4NIVA 3A89A 1W7XH 4MDSA 4NZQA 1O2RA 1FIWA 5EW2H 1TX6A 2AEIH 1QL7A 5EQSA 4RN6A 2FZZA 4D7FA 2PUQH 2P8OB 4A1XA 2RG3A 3V13A 1VGCB 2G8TA 4CREA 1JRSA 2BOKA 1JIRA 1RTKA 4Y8YA 1BRBE 1H9IE 2HGTH 1W7GH 4KELA 4U01A 1PPBH 4YESB 1SGDE 2OXSA 1NRRH 1BMMH 3LC3A 2B5TB 3TIUA 3SI4H 2H5CA 3JZ2B 1Q31A 1HAHH 4I8KA 1TE0A 1PPZA 2WPKS 5DP6A 1Y3XA 1TALA 3PTBA 5DP8A 5IDKA 1QB6A 1YPHE 4BAQB 3KCGH 1HV7A 3BTKE 3RMLH 5HM9A 4Y8ZA 2ZHWH 1S85A 4AOQA 3E16B 3SNCA 3C27B 2XC0A 1RIWB 1PPGE 5HMAA 4INLA 5TJXA 2F3CE 4X2XA 2ALPA 2ZNKH 2GZ7A 1G32B 3GY3A 4O3UA 1MTNB 3GY4A 1KXCA 2XXLA 1OX1A 3ATLA 4CHAB 1GHZA 2UWOA 2A7CA 1SBWA 4I31A 3ZVGA 2P59A 2I6SA 1O31A 1FPCH 1TB6H 1TGNA 4MNXA 1O3IA 2BQ7B 2OBOA 4SGBE 2A4QA 4AFZA 1SGQE 2Z3EA 4IBLH 1L1NA 1WU1A 2A4RA 2BD4A 2FO9A 2FI3E 3HPTB 4MPXA 5FPYA 3T29A 1IQFA 1DITH 2EI8A 1RTLA 1TX8A 3KQEA 2A2XH 3TNTA 1PFXC 4K3JA 4H6TA 2P3TB 2UUJB 3BEIB 4UDWH 1AQ7A 2FTLE 1G30B 1SMFE 1C4V2 2AH4X 3HKJB 4E06H 4H42U 1F5KU 2ANKH 1NFUA 1TPAE 3UNRA 1SHYA 2FOFA 1C5MD 2PFEA 2XBXA 1G37A 1WV7H 1O5BB 1N6XA 3SU5A 3LONA 2VWOA 1E37B 3QTOH 2AYWA 1O5AB 1YPHC 3FP7E 3KGPA 8ESTE 1Z1IA 2Z94A 3N7OA 2TGDA 1MTSA 2SNVA 1ACBE 5PTPA 5GDSH 2OLGA 1KDQB 1O2XA 5LPFA 4X8UH 1QL9A 3H5CB 1GJAB 1OWJA 4YLQH 4YOIA 3TH2H 4ESTE 3SQEE 1ETTH 1GMHG 2VIVA 5HM2A 4O9VA 2FI5E 2YNBA 1P09A 1GHBG 4I32A 3T5FH 1H8DH 1P2MA 1XVOA 4FUDA 1P3CA 1M9UA 2RA3A 3E8LA 1C9TA 2WPJS 1OWKA 1VITG 4NZLA 3SU3A 1GI0A 2FEQH 1GBHA 2NU1E 1LVYA 4DG4A 1CU1A 1Z8RA 3RXKA 3FAOA 3Q3YA 1W0YH 1O2TA 2ZQ1A 2VWLA 4X1SU 1CE5A 2ZDAH 3RXSA 4WJG2 3RXUA 1GBTA 3ZZ7A 1UVSH 1MKWH 4GUXA 2J38A 3IG6B 1P9SA 3TH4H 1OYQA 2FOAA 1TIOA 3VEQB 1Y5BT 3RXRA 1DSUA 2FYQA 1TMTH 1EPTA 3OY6U 3STJA 3KN2A 4BOHA 2GCHF 1W3CA 3RU4T 3O8CA 4I8LA 1D3TB 1GBFA 1FY1A 1RRKA 3PLBA 3OTJE 3LT3A 3F68H 5EXNA 1AWFH 1O2MA 1INCA 3VGCC 4UONA 1B5GH 1YLDA 2VINA 3H7OA 1BRAA 1DXPA 1XUHA 2SFAA 3ZZ6A 2J92A 5AFYH 1TA6A 1DSTA 1TAWA 1GJ4H 3SUEA 1LTOA 1GBEA 3ENSB 2XRCA 3GCNA 5B6OA 3F9GA 1BTUA 1KIGH 2H6MA 2GV6A 4LZ4B 4IC5A 1IHTH 4BAKB 1HPGA 4NA8A 2CF9H 1K1JA 2ZU1A 1ELDE 1AD8H 2GCTC 3FP6E 4R8TB 1JMOH 4JMYA 4X1PU 1W14U 4K5ZA 1P2NA 1T8MA 1SLVB 3T26A 1E38B 1TPSA 1GJ6A 3W95A 1GG6C 1JWTA 1C1RA 5ESTE 1C1PA 4AGKA 1P05A 2A5AA 3A84A 2I6QA 3SV6A 1BTZA 1T8OA 1E35B 2BX4A 3TVJB 4CRDA 1TGSZ 3PMAB 2DUCA 5JBCS 4ZH8A 1XUKA 3PMJA 3KIDU 1NROH 2ZHEH 4X1RU 3LJOA 4OGYA 3M3TA 2A4OA 3P6ZB 5DK1A 1DANH 1ZRBA 2ZPRA 4O03A 2ZWLH 3M7QA 2BHGA 1LQEA 2FOHA 2R3UA 1FY4A 2XBYA 3GCOA 1TRNA 1EUFA 3A7VA 3BTWE 1O35A 3PO1C 1KDQA 2BZAA 4I8JA 1DOJA 3KEEA 2A7JA 2A2QH 1YCPM 3TITA 1ANCA 3A7WA 2W7SA 1UMAH 5A8YA 4ABEA 3BIVH 4RKOB 1K1MA 3BIUH 4B71A 1NTPA 3GICB 3F9EA 2TIOA 1BTHH 3GCHC 1O2IA 5T6FA 1MCVA 3TU7H 3QX5H 2GZ8A 1EJAA 1GMDG 1O3JA 3CENA 2WINI 1S5SA 1T8LA 2BQ6B 1F0SA 1K1NA 4KTUA 5FHTA 1P0SH 2FS9A 1XXDA 4AX9H 2Z9GA 5BPEA 5JPMH 4Y8XA 2WYJA 1ZSKA 3HK6B 3URCA 2BDHA 2P94A 1FN6A 1ZPCA 2EA3A 1C1WH 1QJ1B 2OC0A 1QURH 3GDVA 3SV8A 1JBUH 5DP9A 3E1XB 2R3YA 1P02A 1UK3A 5FCKA 3M36A 1K21H 1OSSA 1C5QA 3RLYH 1DICA 4X2YA 2F9VA 4NG9H 4INHA 3T25A 1HAPH 2AMDA 4D76A 1C1VH 4JK6A 1NRSH 1JOUB 2J95A 1BHXB 1CA0B 3SGBE 1C2HA 9LPRA 5FX5A 1GL1A 1MBQA 1MKWK 5FPTA 4AFSA 1LVMA 3M3SA 1UVOA 1O2UA 1GVLA 2GTBA 1X7AC 1C2JA 1UVTH 3RXCA 1C4U2 4X6MA 1RJXB 1V2MT 3SUGA 1GDNA 3BG8A 1TBRH 2GV7A 1ARBA 1VJ9U 1LCYA 1BMLA 1L0ZA 3SU6A 1F7ZA 1Y5AT 3PLKA 4ZXXH 4WMEA 1KXDA 3SJ8A 2AGEX 4FUBA 4ZHLU 4F49A 1EASA 4JZ1A 1QB1A 2FOEA 2G51A 4Y10E 1KLIH 2BTCE 1P04A 1ELVA 3MYWA 6CHAB 2VIOA 5F8ZA 1QB9A 7GCHG 2THFB 1OPHB 2O8MA 5FCRA 3ZZ4A 5LH8A 1K9OE 1A46H 1QJ7B 1BHXF 3GY7A 4B73A 3BG4C 1Y3YA 5JBTA 4WF8A 1CHOG 2Y5FA 4Y7AA 1ELBA 1AN1E 1SGIB 1V2QT 3UOUA 4CRBA 3LDXH 1THRH 4MG3A 1L1GA 3RP2A 3A7YA 1DFPA 2ZPQA 3U1IB 3SU4A 1P11E 1C5WB 1P3EA 1TX7A 2CV3A 1C5TA 2BOHB 5EPYA 1AFQC 3UQVA 2QXIA 3V3MA 1FONA 1SGNE 5K7RA 3FFGA 3T28A 2F9PA 1V2PT 1GMHF 2FDAA 1T4VH 1MCTA 2XC5A 1CBWB 4KP0A 1S6HA 1GHBF 2BVRH 1F5RA 2HNTF 4YLUA 1EP6A 1ESAA 2Y80A 1O3EA 3KQBA 1GGDB 2VNTA 2GGVB 1O2KA 3ZZAA 2UUKB 1WBGB 2GVFA 1P10A 1EPTC 2PGBB 1AO5A 2BMGB 1O34A 1DE7H 7LPRA 1VITF 3HKIB 5C3NA 5CE1A 3TK5A 1LVBA 1IQEA 1SB1H 4NIXA 1QA7A 1LHFH 5H4IB 2NU3E 3VB3A 2ZCKP 1WQSA 3AAVA 1QIXB 1BBRE 3WY8A 6LPRA 3CS7A 1KTTB 2PSYA 3RU4D 1N6YA 3ZYEA 4BANB 2OQUA 3E90B 1QBVH 2D26C 1ID5H 1N8OC 3UFAA 1H4WA 2R9PA 1C5VA 2AFQB 1T32A 2OD3B 3D65E 4YT7H 3P95A 4MNWA 4IC6A 1W8BH 2JH5D 1HIAB 2ASUB 3G01A 3UR9A 1WAYB 1ESBA 4TWYA 4XOJA 4CBOA 1LHGH 4MPUA 1C5NH 5L2YH 2ANWA 2AERH 2VVUA 1G3BA 1S84A 1JXPA 1YF4A 2BD7A 3VB4A 1G2LA 1K1OA 1B0FA 2EI6A 1B0EA 3MNSA 3U9AH 1TNJA 2O8TA 2TPIZ 1S83A 4B75A 3URDA 1EJNA 1QQUA 1BB0B 1MAXA 1RD3B 4H4FA 3RDZA 1O3BA 4WH6A 4D7GA 5EODA 1EKBB 1UTJA 2XWBI 4DCDA 5C1UA 3A85A 4U2WA 1Z8GA 1YPMH 1P9UA 1V2ST 2R0KA 1SQOA 2W26A 4B1TA 1NC6A 2IPHA 1HAOH 3U8OH 3U1JB 4FUHA 1O3KA 3M35A 2J4IA 3ZVFA 1ESTA 2B0FA 2VIQA 1UTOA 1GPZA 2TGPZ 2ZU2A 1SGEE 4Q80A 4ABHA 4DIHH 4X2WA 1KSNA 3GOVB 1QHRB 3LPRA 1BBRH 2BDCA 4GHTA 1D4PB 1GCTC 4ABBA 1GI5A 3P17H 1BDAA 1AKSB 3RXEA 1GI4A 2ZF0H 4GVUA 4RKJB 5FBEA 3MNXA 1MZAA 4Q7XA 1OWIA 1O2YA 2BDAA 1W2KH 3PV4A 3Q3XA 1KYNA 1S0RA 2OC8A 4JZIA 1FI8A 1V2JT 3Q00A 2J34A 4OGXA 2GKVE 4BTIB 2HPPH 1HB0B 5E2PA 1HJAC 1O3NA 1O2PA 4DT7B 4AZ2B 3LGYA 5AVDA 3D62A 4A6LA 4BTTB 2HPQH 1C1NA 4GSOA 4LZ1H 1ZTJA 3U8RH 1GJCB 2XWAA 5DP4A 2AIQA 2VIDA 6ESTA 1C2GA 1P03A 7ESTE 1BITA 2V6NA 1KLJH 1UVUH 1V2TT 3ATIA 1NM6A 4IN2A 2GD4B 1BMAA 3ZVAA 1O3HA 2Q6DA 3M61U 3ZZCA 4IW4E 4ZHAA 4YOJA 2BXTH 3ZZ3A 4CRCA 2C90B 2Y5GA 3EYDA 1GWAA 5AFZH 1XM1A 1ZHPA 3K2UA 1BRUP 3MU1A 4BXWA 3A81A 1GI2A 3OX7U 1K1PA 4I8HA 3ATKA 1O2HA 5DG6A 3F1SB 1UVPA 2G5NA 2QXHA 2FS8A 3RC6A 3GYLB 2G55A 1O36A 1ZMJA 3ZZ9A 1FY3A 1YGCH 3LH3A 3SNAA 4I33A 5JDUB 5T3HA 4DURA 4JCNA 5C2ZA 3SV9A 2GMTC 3ATWA 3VPKA 1C2DA 2HVXA 1O2OA 2QAAA 1H9HE 1IQJA 2G52A 4TY6A 1SOZA 3GY6A 3LIWA 4B74A 1DLEA 3SBKA 1RGQA 1NU9A 3M7UA 1GBDA 4XDEA 4GPGA 2VVCA 5FAHA 2EC9H 2ZDNA 3EA8A 1HIAA 2FYRA 1CT4E 1HBTH 1EX3A 2CMYA 1P01A 1G3CA 2QV1A 5FX6A 5E0JA 4LOYH 3EA7A 2HALA 3ZZ8A 1CSOE 1FAXA 2BY5X 3A7XA 3E91A 1QNJA 2WUBA 1EZSC 2LNCA 1GI1A 2XW9A 3LU9B 1QRXA 2K1QA 2PKAA 1DY8A 2DE9A 3RXIA 5C20A 3ZV9A 1O5GH 1CVWH 4K60A 2G81E 1YYY1 4NA9H 4E7NA 2NU0E 3Q76A 4K1SA 1MU8B 4WMDA 2FXRA 2F83A 1IAUA 4AG1A 3SHAH 5T6DA 1MBMA 4F4OC 2J9NA 4KTSA 5DP7A 4A5TS 2QY0B 2XTTB 1GHYH 2W3IA 3UIRA 1RS0A 2HOBA 3ZZBA 3PROA 1LHEH 2C93B 2Y7XA 1ZSJA 2QF0A 2Z9JA 2CF8H 3TJOA 1UK4A 2XBWA 5EGMA 4I7YH 4VGCC 3QTVH 2OC1A 3LGWA 1D3QB 2FIRH 4DVAU 2H9EH 1UCYH 5F8XA 5GXPA 3M7TA 3R3GB 4XBCA 1DLKB 2ZO3H 2R2WU 1ELTA 1C5XB 2OINA 1C4Y2 1C1MA 2PTNA 3F9HA 1CHOF 1AU8A 6GCHG 3CP7A 3ZV8A 1ZPZA 1AE5A 2H1UA 3UUZA 1SGRE 3DFJA 3UNQA 3T2NA 1C2LA 1O2JA 4YTAA 3NKKA 1GHXH 3RXDA 1BBRK 1EXFA 2RA0A 4Y71A 5EG4A 5GJ4B 2P93A 3A82A 2VGCC 1NESE 5JBBS 3MMGA 4UEHH 1TA2A 4UFFH 1ORFA 3EE0B 2B7DH 1HAYB 3A8CA 2TRMA 4GCHG 4MNYA 2BDYA 4MTBA 1A7SA 1UO6A 3QUMP 1L4ZA 1FAKH 3S9AA 1C2MA 3M5NA 3MH5A 4AFQA 2JH0D 3MO6A 3R0FA 1GI7B 3GCTG 1PQ8A 3SU0A 3H7TA 4Q7YA 1ELEE 4B76A 4B2AA 3SI3H 3E0NB 2G5VA 1GMCG 4NSVA 2W7UA 1Z8IB 2ZGCA 2PSXA 2BD2A 3I29A 3QZRA 3TGIE 1QY6A 4B2CA 1ARCA 1QFKH 1THSH 1LVOA 1VCWA 3RXGA 1V6DA 1ETRH 2GMTB 1IQKA 4YZUA 2NWNA 3BTDE 4JK5A 5C1YA 4AORA 1XUIA 1VZQH 1VJAU 1ZPBA 4RSPA 4A7IB 2QN5T 1AB9C 4IN1A 1QA0A 3KHVA 3RM0H 3SU2A 1SLWB 1O3OA 1XX9A 4A1VA 1AMHA 1MAYA 1MD7A 1OWDA 3T62A 1WTGH 2ANYA 8GCHG 1BTXA 1EOJA 2ZFSA 3MH6A 4FU9A 1B7XB 3RXFA 1UTNA 3T27A 5TCAA 1SVPA 1NFYA 3SORA 2VH0A 2HRVA 5EPNA 4NIYA 3RXQA 1VCQA 4IS5A 3BTTE 4THNH 5E2OA 4Y0YE 2XCNA 2JETC 2RDLA 2BY9X 4ISIH 5ABWA 2D8WA 2HNTC 4Y11E 1HXEH 5EW1H 1Z71A 1IQHA 4MLFB 1FIZA 1C1UH 1XMNB 4IMZA 3ESTA 1DUEA 2JKHA 3S9CA 1AVWA 1AZZA 2Y6TA 2UWLA 1LKAA 2ZU5A 2XBVA 4AB9A 1J15A 2PLXA 2FTMA 2ZP0H 3HGNA 3AVZA 1HJ9A 2ANMH 4OS2A 2Z3CA 4ABFA 2C8WB 1BTWA 3TK9A 4WXIA 1G3EA 5AF9H 2PGQB 1GJ7B 4TPIZ 1NZQH 1GJ8B 2P16A 4MPWA 3TPIZ 1A5IA 3P8OA 1QBNA 4FUIA 2ZFRH 2R0LA 4DW2U 1QTFA 2VIPA 2Q1JA 2ZPSA 1O3AA 1HCGA 1GBLA 5CHAC 3AAUA 3ZVBA 3SOSA 3V0XA 1GBAA 1KTSB 3OSYA 2TGAA 1SGCA 1ZZZA 1Y8TA 1HLTH 1UTPA 2V3HH 4FU8A 3ZZ5A 1XVMA 4ASHA 1DY9A 1A0JA 5A8XA 1T8NA 5C1XA 3RXLA 2FPZA 3TGKE 3QGNB 1H8IH 4BXSA 2ZQ2A 1SC8U 1GJ5H 1SGFA 2BD9A 2CN0H 1A0HB 3TH3H 3A87A 3ODDA 1NRPH 1ZHMA 1MH0A 1NRQH 2SGQE 4XFQA 2R2MB 1UCYK 3P70B 1BA8B 2OBQA 3RU4E 1KLTA 1A4WH 1FLEE 1GDQA 2ODQA 1MTVA 5JYIA 1WSSH 3SJKA 1A61H 1P2QA 3ATMA 1GVZA 1FV9A 4J1YA 3NUMA 4ZMAH 4M7GA 1T4UH 3PB1E 3LOXA 4GAWA 1O3DA 2VWMA 3P8FA 2ZEBA 2BB4A 1TPOA 1BMNH 4A1TA 1ELCA 1C5UA 1TQ7B 1ZTLA 4UFEH 1BOQA 1SFQB 1GI6A 1D6RA 2VU8E 1LDTT 1GI3A 2J2UA 3MU8A 1E36B 1O3LA 4WMFA 1BUIA 2C4FH 1P2KA 1Z6EA 4ABIA 1O2SA 3UWJH 4D9RA 1C2EA 1QGFA 2IJOB 3VGCB 1N1LA 2ZIQH 3GY5A 3LKWA 1K1LA 5EXLA 4UFGH 1P06A 1CGIE 2D2DA 1YPLH 1C5ZB 3EGKH 1CA8B 1LMWB 2CHAC 4DJZB 5IYTA 2STAE 3SU1A 4WWYA 3A7ZA 4FUGA 3ZVDA 3MU4A 3RM2H 3I77A 3MH4A 1C1QA 2AMQA 1Y3VA 1UJ1A 1HAIH 2GCTB 1O39A 2NU2E 2C8XB 2PV9B 1T7CA 4LXBH 4ZXYH 1EB1H 1D9IA 3RXPA 1TBQH 1GG6B 1FZZA 1SG8B 1UHBB 3SQHE 4I8GA 5A0CA 2O8WA 1C5LH 2PTCE 4AGJA 1WYKA 2G4UA 1NFXA 5JBAS 3SNDA 4AYVB 2G00A 4X8VH 1O3MA 1EZXC 3BTGE 3D23A 4ABJA 2AS9A 4IGDA 1QCPA 2BY7X 4OS6A 1EB2A 2P8OC 1W13U 2LPRA 3QLPH 1PPEE 1GBIA 1RFNA 1TGBA 1VGCC 5LPEA 1FPHH 2XNIA 4HI3A 4INKA 1TOMH 1BQYA 3S0NA 1OOKB 1KXEA 3TNSA 3CS0A 1RTFB 3KF2A 3SHCH 3SW2B 3QK1A 1GCDA 1MD8A 5C5NA 2NU4E 3RXAA 3W94A 3PO1B 3QN7A 1PPFE 1QRWA 2Q6GA 4LK4A 1OWEA 3M5MA 5L2ZH 4AN7A 2AIPA 1D3DB 4DOQA 2XC4A 2XYAA 4IMQA 3TLOA 5FBIA 5C5OA 5F8TA 3RXBA 3TJUA 4YM9A 1RIWC 3GCHB 1Y59T 3GYMA 5DGJA 1ZHRA 3JZ1B 1ZR0A 4X6NA 3HGPA 3UR6A 1S6FA 2V3OH 1NFWA 3F6UH 3BEUA 1XKBC 1MTNC 3UTUH 4CH8B 2BD3A 1GBCA 4CHAC 3GY2A 1KXAA 1HAZB 1WUNH 3M5LA 1J8AA 2JH6D 3P8GA 3OYPA 3GCTF 2QF3A 2QIQA 5L30H 3RMNH 4KTCA 1CGHA 1NT1A 1XUFA 1ZOMA 1P2IA 1W0ZU 4GHQA 2BLQA 5GPIB 1GMCF 3UREA 2FLRH 4WXVA 1TOCB 3VXFH 1S82A 5HGGA 1DT2A 1J14A 3UOPA 2C8ZB 3DUXH 1ZRKA 3O8RA 5LGOA 4ISOA 2A31A 3P92A 1P12E 2QA9E 1O2ZA 1O2LA 4Y0ZE 3FANA 3DHKH 3SUDA 5J4SA 3UY9A 2V0BA 1DDJA 1ZMLA 3KQCA 1HJ8A 3U8TH 2FI4E 2ZFTA 1PQ5A 3QWCH 3BV9B 2M5TA 1ELGA 5C67A 3D49H 1F92A 1YC0A 3E3TA 3LJJA 1QR3E 1O2VA 1OWHA 3QO6A 4ISNA 4ISHH 3A80A 1GBKA 1ANEA 2H2ZA 4FVDA 2P3FH 1EOLA 1AHTH 5CMXH 4MNVA 1XKAC 2ILNA 8GCHF 1GJ9B 1SHHB 2ULLA 3FZZA 2BYAX 1GBBA 1THPB 1MKXH 2GDEH 2UWPA 4Y6DA 3SNEA 2PUXB 3MI4A 2Z6BD 1CT0E 2Y82A 4CRGA 3UWIA 3DA9B 1AUTC 4HGCA 2FOGA 2GT7A 3F9FA 1FN8A 5ETXA 4ZKNU 4TY7A 1LO6A 1EQ9A 2OQ5A 5EQQA 3RMOH 1TMUH 3LGUA 4ABDA 1ABIH 1DXWA 2ZA5A 1UHBA 4HTCH 2YOLA 4U30A 1OP0A 3I78A 3BSQA 1EZQA 5F03A 2ZGHA 4ZKOU 3RXVA 3LGTA 1GI9B 3IITA 2J94A 4ABAA 2ZFQH 3BG4B 1SL3A 1J17T 1HNEE 1AUJA 1G2MA 1ZJDA 1TFXA 2UUFB 1A1RA 2XCFA 1DX5M 1NU7B 1TGTA 1YKTA 4K69A 1A5GH 3HATH 4WH8A 1KXFA 3MU5A 4XBBA 3FZDA 1AFQB 4X2VA 2O8UA 3MOCA 1SGYE 3VXEH 2QCYA 5EU8A 1NS3A 1GBMA 1NPMA 1H9LB 1EAIA 1T31A 1V2NT 2BDGA 3SUFA 1LKBA 3AASA 1SGPE 3ZYDA 1OP2A 1GMDF 4X1QU 1EPTB 3BTME 4K2YA 3PLPA 3EQ0H 2SGAA 1LPKB 1OKXA 5EQRA 1WQVH 2HLCA 1A3BH 3C1KA 4Y76A 2AGGX 1HAVB 4O97A 2GZ9A 1H1BA 1P8VC 2GP9B 1UCYE 1S81A 1Z6JH 2BLOA 4FUJA 3SV7A 4B2BA 1TMBH 3PWCA 1Q2WA 3VB7A 3V7TA 1GI8B 1N8OB 4XBDA 5GCHG 3EA9A 3S69A 1EJMA 3MFJA 1FXYA 2A0QB 1WOFA 3LGIA 1DWDH 3ODFA 2QYIA 3S7KB 2WV5A 3NXPA 2Y7ZA 1GL0E 1P2JA 4NSYA 1IQLA 1UTQA 2BLVA 2F91A 2H5DA 2ODYB 1TNHA 1SR5C 1A5HA 4NGAH 2FOMB 1HUTH 1LHDH 1GDUA 1YPJH 5L6NH 1E34B 1SSXA 2FMJA 3NWUA 5HYOA 3A83A 1MTUA 1O3PB 1WCZA 2BXUH 1J9CH 1D3PB 5GWZA 4KKDA 1GBJA 2H9TH 2PHBA 2ZHFH 1Y3UA 1EATA 3RXJA 1YP9A 1BJUA 2EI7A 2TGTA 1BJVA 3SZNA 1F0UA 2DE8A 3VFEA 4X8TH 1L4DA 1LPGB 2FODA 5A8ZA 2FOBA 4OS1A 7GCHF 3HK3B 3LGVA 2A4GA 1GCTB 4OS4A 5I46H 3BTFE 1TBZH 5GIBA 1AKSA 1F5LA 3SO3A 2Q6FA 4AFUA 1PYTC 1ZSLA 1O5FH 1DWEH 1TNGA 1V2KT 1DS2E 2FESH 1CT2E 2Y81A 1XUJA 3Q77A 4K1EA 1AY6H 1TWXB 1ETSH 3VB6A 1C1SA 2FP7B 2OUAA 1BTYA 1F0RA 2VWNA 3E6PH 3M37A 5BRRE 1SLXB 3L33A 4Q7ZA 2H9HA 1VR1H 3A8BA 2IN2A 4JYUH 4NFFA 1GJBB 2Z9IA 1V2LT 1BZXE 1MKXK 1HJAB 2OP9A 2ZGXH 4DIIH 3M3VA 1GHAG 1IQGA 1OP8A 1O5DH 3PM3A 3GDUA 1LPZB 2P95A 1FUJA 1G3DA 2HNTE 1FY5A 1BRCE 1DWCH 4X0WU 1DPOA 1W10U 1IOEA 2BD8A 4D9QA 1Y3WA 4QT8C 1AGJA 4Z6AH 3QGJA 1UTMA 3SJIA 2W3KA 1C5PA 1DUAA 3BTEE 5JB9S 1YM0A 1O3CA 5DP3A 3ZVEA 1BCUH 4AB8A 1K22H 1SOTA 3K9XB 2ESTE 1CO7E 5A2MH 2A32A 3A86A 4NFEA 4UE7H 3E0PB 5LPRA 1U6QA 1OYTH 1O0DH 1FJSA 1PQAA 1PYTD 2STBE 5T6GA 3MWIU 4CRAA 1UTLM 2FX4A 3GDSA 3SGAE 1ZLRA 4X1NU 1HAGE 1HAVA 1L2EA 2ZFFH 1CA0C 1C5RA 4BTUB 2ZZUH 1K28D 1ZGVA 1O5EH 5DP5A 1O37A 3GY8A 1PQ7A 1ZTKA 4WY3A 1QL8A 4MVNA 2ZDKA 1UK2A 4K8YA 3L6PA 2WPMS 2ZU4A 3A8AA 5G4BA 8KME2 4BAOB 3ELAH 3TJNA 2ZGJA 2BD5A 1O2QA 5EXMA 4BNRA 1XXFA 3NPSA 3RLWH 4PROA 1EZUC 1NN6A 3BEFB 1QBOA 2C8YB 3B23B 2AGIX 1IQNA 2ZECA 4JZDH 3PMHB 3K65B 5J4QA 2G4TA 5A09A 4HFPB 1O3GA 1HXFH 6CHAC 3ZZDA 3S9BA 1VITH 4K1TA 1TRYA 3K6ZA 3RXOA 3A7TA 1DWBH 4JZFH 2YNAA 3RUOA 3DFLA 1YPGH 1SQTA 2QC2A 3NCLA 4XE4A 2WV4A 2FOCA 2ZDVH 1YCPH 2SGDE 2C3SA 4ISLA 3VB5A 2ZTZA 3UPEA 1W11U 3MNCA 3TGJE 1G9IE 1BTPA 2Z9LA 2BVSH 5DJ7A 4YO9A 1Y5UT 1GJDB 1W12U 2FLBH 1V2UT 4HZHA 2O8LA 2PWXA 1ZGIA 4Y7BA 3PWBA 1YPEH 1KXBA 1CGJE 1SPJA 4VGCB 2TBSA 2KAIB 3KQDA 2B9LA 1CBWC 3MH7A 4UFDH 2BQWB 2GT8A 2O9QA 5ESBA 1SQAA 3EAJA 2ZHQH 4ZAEA 5DKMA 3V12A 2VVVA 1GGDC 3O8BA 1EAUA 1CQQA 3RXHA 2ZCLP 1AFEH 2ODPA 4ZKRU 4NA7A 4FUEA 5E0GA 5A0BA 1C5SA 4DGJA 1C1OA 4ZROA 1BIOA 1HFDA 1F2SE 1O2WA 2FX6A 4JYTA 2ALVA 1TLDA 1WTHD 1FMGA 1NY22 4AYYB 3QDZB 4BAHB 2ZC9H 4YT6H 4U32A 9ESTA 1QJ6B 3IWMA 1EP5A 3OU0A 4CRFA 4MQAA 2PW8H 3UQOA 2VGCB 1A0LA 4O3TA 3STIA 3B8JA 2SGFE 4JZEH 2FM2A 3PYHA 1HYLA 1UTKA 1ELFA 1VCPA 3AW1A 1FNIA 1A3EH 2WPHS 2BZ6H 5E8EH 2WYGA 1DM4B 1TNKA 3ZVCA 1O32A 2PR3A 3UNSA 3GISB 2F9NA 2BY6X 1C5YB 3U69H 1Z1JA 3TK6A 1HRTH 1TRMA 2ZCHP 3RXTA 5JB8S 1AI8H 2BDIA 3MHWU 2WUCA 2RCEA 2QXJA 3L3TA 2BY8X 2VB0A 1AIXH 4GLYA 2Z3DA 3OY5U 3BTQE 3MTYA 1TONA 5GCHF 2QGRA 7KMEH 1KY9A 1G36A 2PKSC 2FWWA 1ANBA 2QXGA 4FUCA 3NK8A 1IQIA 1ZJKA 5HXFA 1C5OH 8LPRA 3MO3A 1TABE 2GDDA 1C2IA 2V35A 2BLWA 4Q2KA 1MZDA 4UD9H 3LH1A 2ZTYA 1OS8A 1Q3XA 1O2GH 1AB9B 1A2CH 1FDPA 1J16A 4Z0KA 1SGTA 3SJ9A 1XUGA 2ZI2H 5I25A 2F9BH 3SV2H 2Z9KA 3AW0A 3DT0H 1ELAA 1MU6B 1O38A 1MTWA 1PPHE 1O30A 5K0HA 1OXGA 2UUYA 4ZKSU 1HDTH 3SN8A 1Z8JB 2A5IA 1JRTA 2JETB 3BF6H 1C2KA 3NZIA 4ZHMU 1TGCA 4ABGA 4E05H 1S0QA 4DY7B 5E0HA 2A7HA 1GVKB 1O2NA 1YPKH 3B9FH 4BAMB 4XSKU 2ZKSA 2BVXH 2D1JA 1NRNH 3SJOA 3EDXB 4AG2A 4E7RG 3TJVA 2VH6A
chains in the Genus database with same CATH superfamily
1AWHB 1V2VT 5DN6D 4TWWA 1QRZA 1V2OT 2ZHDA 4A92A 2P3UB 1AZ8A 2A5KA 3MU0A 1FQ3A 2VJ1A 2SNWA 2AMPA 3PMBB 1TPPA 1ANDA 4X6PA 6GCHF 3RC5A 2ZDMA 4K8BA 2CGAA 3VG8A 1SFIA 2ZG0H 5CHAB 1K0HA 2W5EA 2KAIA 4FOUC 3K6YA 1P2OA 4FVBA 1IHSH 2ZDLA 1MQ5A 1CHGA 4X6OA 1K2I1 2BX3A 2F9UA 2OCVB 4FXGH 4D8NA 1YCPK 2SGEE 1FY8E 1GHAF 3QZQA 2BM2A 2CXVA 3P8NA 1AVGH 2IOTA 4FU7A 4FUFA 4SGAE 5FXLA 3KL6A 4YOGA 4TYDA 2KX4A 4GCHF 2GCHG 2ZTXA 1C1TA 5TCCA 4Y79A 2EEKA 3LC5A 4ZUHA 4JYVH 3RXMA 1D6WA 1O5CB 3RC4A 1O3FA 1PJPA 2ZGBH 1EFRD 4OS7A 2OC7A 2WPIS 2KZ4A 1QQ4A 1JIMA 1SLUB 1YBWA 5DPAA 2CJIA 1SGFG 1YLCA 2A45B 1GHVH 4NWLA 1ZYOA 1C2FA 3SGQE 1TQ0B 1GHWH 3KNXA 1IQMA 1EAXA 1SI5H 4FETA 1F0TA 1AVXA 1MMJN 1MQ6A 1L1JA 2BDBA 2SGPE 4WVPE 1TNIA 5EOKA 2K0QA 1LQDB 4OS5A 5AHGH 4CR5A 1E0FD 4MPVA 4NWKA 3PTNA 1EAWA 4X8SH 1TNLA 3S7HB 1ABJH 1V2WT 3RMMH 4J2YB 2PKAB 1BT7A 2B8OH 1MUEB 3SZEA 3BN9A 1TYNA 1V3XA 1Z7KA 2WPLS 1ZMNA 3FVFB 2GX4A 1O33A 4TPYA 3MNBA 1P57B 2Y5HA 2ZFPH 2PKSB 1C9PA 3BTHE 4CH2B 3DD2H 5F6MA 2W6JD 3Q3KA 5SGAE 4NCYA 3U98H 2A1DB 1NO9H 2CHAB 5DO4H 3M5OA 2OTVA 1HAXB 4NIWA 3A8DA 1PPCE 5FPSA 2F9OA 2JJ1D 1AE8H 3O8DA 5A0AE 3ITIA 4R0IA 4CR9A 1RXPA 2Z7FE 2ZU3A 3A88A 3MO9A 1HGTH 3SNBA 3FP8E 2WZQA 4KGAA 1LHCH 4H6SB 4CBNA 1DVAH 1K1IA 2VIWA 1V2RT 2HWLB 4NIVA 5C0UA 3A89A 1W7XH 4MDSA 4NZQA 1O2RA 1FIWA 5EW2H 1TX6A 2AEIH 1QL7A 5EQSA 4RN6A 2FZZA 4D7FA 2PUQH 2P8OB 4A1XA 2RG3A 3V13A 1VGCB 2G8TA 4CREA 1JRSA 2BOKA 1JIRA 2V7QD 1RTKA 4Y8YA 1BRBE 1H9IE 1VKYA 1W7GH 2HGTH 4KELA 4U01A 1PPBH 4YESB 1SGDE 2OXSA 1NRRH 1BMMH 3LC3A 2JJ2D 2B5TB 3TIUA 3SI4H 2H5CA 3JZ2B 1Q31A 1HAHH 4I8KA 1TE0A 1PPZA 2WPKS 3FOAA 5DP6A 1Y3XA 1TALA 3PTBA 5DP8A 5IDKA 1QB6A 1YPHE 4BAQB 3KCGH 1HV7A 3BTKE 3RMLH 5HM9A 4Y8ZA 2ZHWH 1S85A 4AOQA 3E16B 3SNCA 3C27B 2XC0A 1RIWB 1PPGE 5HMAA 4INLA 5TJXA 2F3CE 1COWD 4X2XA 2ALPA 2ZNKH 2GZ7A 1G32B 3GY3A 4O3UA 1MTNB 3GY4A 1KXCA 2XXLA 1OX1A 3ATLA 4CHAB 1GHZA 2UWOA 2A7CA 1SBWA 4I31A 3ZVGA 2P59A 2I6SA 1O31A 1FPCH 1TB6H 1TGNA 4MNXA 1O3IA 2BQ7B 2OBOA 4SGBE 2A4QA 4AFZA 1SGQE 2Z3EA 4IBLH 1L1NA 1WU1A 2A4RA 2BD4A 2FO9A 2FI3E 3HPTB 4MPXA 5FPYA 3T29A 1IQFA 1DITH 2EI8A 1RTLA 1TX8A 3KQEA 2A2XH 3TNTA 1PFXC 4K3JA 4H6TA 2P3TB 2OK5A 2UUJB 3BEIB 3OAAD 4UDWH 1AQ7A 2FTLE 1G30B 1SMFE 1C4V2 2AH4X 3HKJB 4E06H 4H42U 1F5KU 2XNDD 2ANKH 1NFUA 1TPAE 3UNRA 1SHYA 2FOFA 1C5MD 2PFEA 2XBXA 1G37A 1WV7H 1O5BB 1N6XA 3SU5A 3LONA 2VWOA 1E37B 3QTOH 2AYWA 1O5AB 1YPHC 3FP7E 3KGPA 8ESTE 1Z1IA 2Z94A 3N7OA 2TGDA 1MTSA 2SNVA 1ACBE 5PTPA 5GDSH 2OLGA 1KDQB 1O2XA 5LPFA 4X8UH 1QL9A 3H5CB 1GJAB 1OWJA 4YLQH 4YOIA 3TH2H 4ESTE 3SQEE 1ETTH 1GMHG 2VIVA 5HM2A 4O9VA 2FI5E 2YNBA 1P09A 1GHBG 4I32A 3T5FH 3GS9A 1H8DH 1P2MA 1XVOA 4FUDA 1P3CA 1M9UA 2RA3A 1NBME 3E8LA 1C9TA 2WPJS 1OWKA 1VITG 4NZLA 3SU3A 1GI0A 2FEQH 1GBHA 2NU1E 1LVYA 4DG4A 1CU1A 1Z8RA 3RXKA 3FAOA 3Q3YA 1W0YH 1O2TA 2ZQ1A 2VWLA 4X1SU 1CE5A 2ZDAH 3RXSA 2L74A 4WJG2 3RXUA 1GBTA 3ZZ7A 1UVSH 1MKWH 4GUXA 2J38A 3IG6B 1P9SA 3TH4H 1OYQA 2FOAA 1TIOA 3VEQB 1Y5BT 1UW7A 3RXRA 1DSUA 3KYGA 2FYQA 1TMTH 1EPTA 3OY6U 3STJA 5FL7D 3KN2A 4BOHA 2GCHF 1W3CA 3RU4T 3O8CA 4I8LA 1D3TB 1GBFA 1FY1A 1RRKA 3PLBA 3OTJE 3LT3A 3F68H 5EXNA 3F3BA 1AWFH 1O2MA 1INCA 3VGCC 4UONA 1B5GH 1YLDA 2VINA 2WV9A 3H7OA 1BRAA 1DXPA 1XUHA 2SFAA 3ZZ6A 2J92A 5AFYH 1TA6A 1DSTA 1TAWA 1GJ4H 3SUEA 1LTOA 1GBEA 3ENSB 2XRCA 3GCNA 5B6OA 3F9GA 1BTUA 1KIGH 2H6MA 2GV6A 4LZ4B 4IC5A 1IHTH 4BAKB 1HPGA 4NA8A 2CF9H 1K1JA 2ZU1A 1ELDE 1AD8H 2GCTC 3FP6E 4R8TB 1JMOH 4JMYA 4X1PU 1W14U 4K5ZA 1P2NA 1T8MA 1SLVB 3T26A 1E38B 1TPSA 5GNDA 1GJ6A 3W95A 1GG6C 1JWTA 1C1RA 5ESTE 1C1PA 4AGKA 1P05A 2A5AA 3A84A 2I6QA 3SV6A 1BTZA 1T8OA 1E35B 2BX4A 3TVJB 4CRDA 1TGSZ 3PMAB 2DUCA 5JBCS 4ZH8A 1SKYE 1XUKA 3PMJA 3KIDU 1NROH 2ZHEH 4X1RU 3LJOA 4OGYA 3M3TA 2A4OA 3P6ZB 5DK1A 1DANH 1ZRBA 2ZPRA 4O03A 2ZWLH 3M7QA 2BHGA 2KFWA 1LQEA 2FOHA 2R3UA 1FY4A 2XBYA 4P00A 3GCOA 1TRNA 1EUFA 3A7VA 3BTWE 1O35A 3PO1C 1KDQA 2BZAA 4I8JA 4TSFD 1DOJA 4OM9A 3KEEA 2A7JA 2A2QH 1YCPM 3TITA 2KM0A 1ANCA 1NBMD 3A7WA 1UMAH 2W7SA 5A8YA 4ABEA 3BIVH 4RKOB 1K1MA 3BIUH 4B71A 1NTPA 3GICB 3F9EA 2TIOA 1BTHH 3GCHC 1O2IA 5T6FA 1MCVA 3TU7H 3QX5H 2GZ8A 1EJAA 1GMDG 1O3JA 3CENA 2WINI 1S5SA 1T8LA 2BQ6B 1F0SA 1K1NA 4KTUA 2RDEA 1P0SH 5FHTA 2FS9A 1XXDA 2JIZD 4AX9H 2Z9GA 5BPEA 5JPMH 4XD7D 4Y8XA 2WYJA 1ZSKA 3HK6B 3URCA 2BDHA 2P94A 1FN6A 1ZPCA 2EA3A 1C1WH 3N7EA 1QJ1B 2OC0A 1QURH 3GDVA 3SV8A 1JBUH 5DP9A 3E1XB 2R3YA 1P02A 1UK3A 5FCKA 3M36A 2L6OA 1K21H 1OSSA 1C5QA 3RLYH 1DICA 4X2YA 2F9VA 4NG9H 4INHA 3T25A 1HAPH 2AMDA 4D76A 1C1VH 4JK6A 1NRSH 1JOUB 2J97A 2J95A 1BHXB 1CA0B 3SGBE 1C2HA 1E79D 4P02A 9LPRA 5FX5A 1GL1A 1MBQA 1MKWK 5FPTA 4YXWD 4AFSA 1LVMA 3M3SA 1UVOA 2F4LA 1O2UA 1GVLA 2GTBA 1X7AC 1C2JA 1UVTH 3RXCA 1C4U2 4X6MA 1RJXB 1V2MT 1QZ8A 3SUGA 1GDNA 3BG8A 1TBRH 2GV7A 1ARBA 3WWBA 1VJ9U 3MQKC 1LCYA 1BMLA 1L0ZA 3SU6A 1F7ZA 1Y5AT 3PLKA 4ZXXH 4WMEA 1KXDA 3SJ8A 2AGEX 4FUBA 4ZHLU 4F49A 1EASA 4JZ1A 3UB0A 1QB1A 2FOEA 2G51A 3KQ5A 4Y10E 1KLIH 2BTCE 1P04A 1ELVA 3MYWA 6CHAB 2VIOA 5F8ZA 1QB9A 7GCHG 2THFB 1W0KD 1OPHB 2O8MA 5FCRA 4F48B 3ZZ4A 5LH8A 1K9OE 1A46H 1QJ7B 1BHXF 3GY7A 4B73A 3BG4C 1Y3YA 5JBTA 4WF8A 1CHOG 2Y5FA 3DCLA 4Y7AA 1ELBA 1AN1E 1SGIB 1V2QT 3UOUA 4CRBA 3LDXH 1THRH 4MG3A 1L1GA 3RP2A 3A7YA 1DFPA 2ZPQA 3U1IB 3SU4A 1P11E 1C5WB 1P3EA 1TX7A 2CV3A 1C5TA 2BOHB 5EPYA 1AFQC 3UQVA 2QXIA 3V3MA 1FONA 1SGNE 5K7RA 3FFGA 3T28A 2F9PA 1V2PT 1GMHF 2FDAA 1T4VH 3DSOA 1MCTA 2XC5A 1CBWB 3F2HA 2YMSB 1S6HA 4KP0A 1GHBF 2BVRH 1F5RA 2HNTF 4YLUA 1EP6A 1ESAA 2Y80A 1O3EA 3KQBA 1GGDB 2VNTA 2GGVB 1O2KA 3ZZAA 2UUKB 1WBGB 2GVFA 1P10A 1EPTC 2PGBB 1AO5A 2BMGB 1O34A 1DE7H 7LPRA 1VITF 3HKIB 5C3NA 5CE1A 3TK5A 1LVBA 5DSFA 1IQEA 1SB1H 4NIXA 1QA7A 1LHFH 5H4IB 2NU3E 3VB3A 2ZCKP 2KCOA 1WQSA 3AAVA 1QIXB 1BBRE 3WY8A 6LPRA 3CS7A 1OHHD 1KTTB 2PSYA 3RU4D 1N6YA 3ZYEA 4BANB 2OQUA 3E90B 1QBVH 2D26C 1ID5H 1N8OC 3UFAA 1H4WA 2R9PA 1C5VA 2AFQB 3UAIC 1T32A 2OD3B 3D65E 4YT7H 3P95A 4MNWA 4IC6A 1W8BH 2JH5D 1HIAB 2ASUB 2HVYB 3G01A 3UR9A 1WAYB 1ESBA 4TWYA 4XOJA 4CBOA 1LHGH 4MPUA 1C5NH 2W6ID 5L2YH 2ANWA 2AERH 2VVUA 1G3BA 1S84A 1JXPA 1YF4A 2BD7A 3VB4A 1G2LA 1K1OA 1B0FA 2EI6A 1B0EA 3MNSA 3U9AH 1TNJA 2O8TA 2TPIZ 1S83A 4B75A 3URDA 1EJNA 1QQUA 1BB0B 1MAXA 1RD3B 4H4FA 2WHXA 3RDZA 1O3BA 4WH6A 4D7GA 5EODA 1EKBB 1UTJA 2XWBI 4DCDA 5C1UA 3A85A 4U2WA 1Z8GA 3OTPA 1YPMH 1P9UA 1V2ST 2R0KA 1SQOA 2W26A 4B1TA 1NC6A 2IPHA 1HAOH 3U8OH 3U1JB 4FUHA 1O3KA 3M35A 2J4IA 3ZVFA 1ESTA 2B0FA 2VIQA 1UTOA 1GPZA 2TGPZ 2ZU2A 5C0TA 1SGEE 4Q80A 4ABHA 4DIHH 4X2WA 1KSNA 3GOVB 1QHRB 3LPRA 1BBRH 2BDCA 4GHTA 1D4PB 1GCTC 4ABBA 1GI5A 3P17H 1BDAA 1AKSB 3RXEA 4RI0A 1GI4A 2ZF0H 4GVUA 4RKJB 5FBEA 3MNXA 1MZAA 4Q7XA 1OWIA 1O2YA 2BDAA 1W2KH 3PV4A 3Q3XA 2IPQX 1KYNA 1S0RA 2OC8A 4JZIA 1FI8A 4ASUD 1V2JT 3Q00A 4M9FA 2J34A 4OGXA 2GKVE 4BTIB 2HPPH 1HB0B 5E2PA 1HJAC 1O3NA 1O2PA 4DT7B 4AZ2B 3LGYA 5AVDA 3D62A 4A6LA 4BTTB 2HPQH 1C1NA 4GSOA 4LZ1H 1ZTJA 3U8RH 1GJCB 2XWAA 5DP4A 2AIQA 5F53A 3H09A 2VIDA 6ESTA 1C2GA 1P03A 7ESTE 1BITA 2V6NA 1WDIA 1KLJH 1UVUH 1V2TT 3ATIA 1NM6A 3W1EA 4IN2A 2GD4B 1BMAA 3ZVAA 1O3HA 2Q6DA 3M61U 3ZZCA 4IW4E 4ZHAA 4YOJA 2BXTH 3ZZ3A 4CRCA 2C90B 2Y5GA 3EYDA 1GWAA 5AFZH 1XM1A 1ZHPA 3K2UA 1BRUP 3MU1A 4BXWA 3A81A 1GI2A 3OX7U 1K1PA 4I8HA 4B6FA 3ATKA 1O2HA 5DG6A 3F1SB 1UVPA 2G5NA 2QXHA 2FS8A 3RC6A 3GYLB 2G55A 1O36A 1ZMJA 3ZZ9A 4RT1A 1FY3A 1YGCH 3LH3A 3SNAA 4I33A 5JDUB 5T3HA 4DURA 4JCNA 5C2ZA 3SV9A 2GMTC 4HG6A 3ATWA 3VPKA 1C2DA 3SYJA 2HVXA 1O2OA 2QAAA 1H9HE 1IQJA 2G52A 4TY6A 1SOZA 3GY6A 3LIWA 4B74A 1DLEA 3SBKA 1RGQA 1NU9A 3M7UA 1GBDA 3N7DA 4XDEA 4GPGA 2VVCA 5FAHA 2EC9H 2ZDNA 3U28C 3EA8A 1HIAA 2FYRA 1CT4E 1HBTH 1EX3A 2CMYA 1P01A 1G3CA 2QV1A 5FX6A 2GJGA 5E0JA 4LOYH 3EA7A 4ZCNA 2HALA 3ZZ8A 1CSOE 1FAXA 2BY5X 3A7XA 3E91A 1QNJA 2WUBA 1EZSC 2LNCA 1GI1A 2XW9A 3LU9B 1QRXA 2K1QA 2PKAA 1DY8A 2DE9A 3RXIA 5C20A 3ZV9A 1O5GH 1CVWH 3F0PA 4K60A 2G81E 1YYY1 4NA9H 4E7NA 2WSSD 2NU0E 3Q76A 4K1SA 1MU8B 4WMDA 2FXRA 2F83A 1IAUA 4AG1A 3SHAH 3FN8A 1MBMA 5T6DA 2F43B 4F4OC 2J9NA 4KTSA 3FKSD 5DP7A 4A5TS 2QY0B 2XTTB 1GHYH 2W3IA 3UIRA 1RS0A 2HOBA 3ZZBA 3PROA 1LHEH 2C93B 2Y7XA 1ZSJA 2QF0A 2Z9JA 2CF8H 3TJOA 1UK4A 2XBWA 5EGMA 4I7YH 4VGCC 3QTVH 2OC1A 3LGWA 1D3QB 2FIRH 4DVAU 2H9EH 1UCYH 5F8XA 5GXPA 3M7TA 3R3GB 4XBCA 1DLKB 2ZO3H 2R2WU 1ELTA 1C5XB 2OINA 3WW7A 1C4Y2 1C1MA 2PTNA 3F9HA 1CHOF 1AU8A 6GCHG 3CP7A 3ZV8A 1ZPZA 1AE5A 2H1UA 3UUZA 1SGRE 1S6LA 5EJLA 3DFJA 3UNQA 3T2NA 1C2LA 1O2JA 4YTAA 3NKKA 1GHXH 3RXDA 1BBRK 5KECA 4I86A 1EXFA 2RA0A 4Y71A 5EG4A 5GJ4B 2LELA 2P93A 3A82A 2VGCC 1NESE 5JBBS 3MMGA 4UEHH 1TA2A 4UFFH 1ORFA 3EE0B 2B7DH 1HAYB 3A8CA 2TRMA 4GCHG 4MNYA 2BDYA 4MTBA 1A7SA 1UO6A 3QUMP 1L4ZA 1FAKH 3S9AA 1C2MA 3M5NA 3MH5A 4AFQA 2JH0D 3MO6A 3R0FA 3FO8D 1GI7B 3GCTG 3F0OA 1PQ8A 3SU0A 3H7TA 4Q7YA 1ELEE 4B76A 3EE7A 4B2AA 3SI3H 1H8ED 3E0NB 2G5VA 1GMCG 4Z1MD 4NSVA 2W7UA 1Z8IB 2ZGCA 2PSXA 2BD2A 3I29A 3QZRA 3TGIE 1QY6A 4B2CA 1ARCA 1QFKH 1THSH 1LVOA 1VCWA 3RXGA 1V6DA 1ETRH 2GMTB 1IQKA 2M2AA 4YZUA 2NWNA 3DSGA 3BTDE 4JK5A 5C1YA 4AORA 1XUIA 1VZQH 1VJAU 1ZPBA 4RSPA 4A7IB 2QN5T 1AB9C 4IN1A 1QA0A 3KHVA 1H8HD 3RM0H 1KMHB 3SU2A 1SLWB 1O3OA 1XX9A 4A1VA 1AMHA 1MAYA 1MD7A 1OWDA 3T62A 1WTGH 2ANYA 8GCHG 1BTXA 1EOJA 2ZFSA 3MH6A 4FU9A 1B7XB 3RXFA 1UTNA 3T27A 3PRDA 5TCAA 1SVPA 1NFYA 3SORA 2VH0A 2HRVA 5EPNA 4NIYA 3RXQA 1VCQA 4IS5A 3BTTE 4THNH 5E2OA 4Y0YE 2XCNA 2JETC 2RDLA 2BY9X 4ISIH 5ABWA 2D8WA 2HNTC 4Y11E 1HXEH 5EW1H 1Z71A 3KYFA 1IQHA 3PV5A 4MLFB 1FIZA 1C1UH 1XMNB 4IMZA 3ESTA 1DUEA 2JKHA 4Q63A 3S9CA 1AVWA 1AZZA 2Y6TA 2UWLA 1LKAA 2ZU5A 2XBVA 4AB9A 1J15A 1FX0B 2PLXA 2FTMA 2ZP0H 3HGNA 3AVZA 1HJ9A 2ANMH 4OS2A 2Z3CA 4ABFA 3F2FA 2C8WB 1BTWA 2J98B 3TK9A 4WXIA 1G3EA 5AF9H 2PGQB 1GJ7B 4TPIZ 1NZQH 1GJ8B 2P16A 4MPWA 3TPIZ 1A5IA 3P8OA 1QBNA 4FUIA 2ZFRH 2R0LA 4DW2U 1QTFA 2VIPA 2Q1JA 2ZPSA 1O3AA 1HCGA 1GBLA 5CHAC 3AAUA 3ZVBA 3SOSA 3V0XA 1GBAA 1KTSB 3OSYA 2TGAA 1SGCA 1ZZZA 1Y8TA 1HLTH 1UTPA 2V3HH 4FU8A 3ZZ5A 1XVMA 4ASHA 1DY9A 1A0JA 5A8XA 1T8NA 5C1XA 3RXLA 2FPZA 3TGKE 3QGNB 1H8IH 4BXSA 2ZQ2A 1SC8U 1GJ5H 1SGFA 2BD9A 2CN0H 1A0HB 3TH3H 3A87A 3ODDA 1NRPH 1ZHMA 1MH0A 1NRQH 2SGQE 4XFQA 2R2MB 1UCYK 3P70B 1BA8B 2OBQA 3RU4E 1KLTA 1A4WH 1FLEE 1GDQA 2ODQA 1MTVA 5JYIA 1WSSH 3SJKA 1A61H 1P2QA 3ATMA 1GVZA 1FV9A 4J1YA 3NUMA 4ZMAH 4M7GA 1T4UH 3PB1E 3LOXA 1MABB 4GAWA 1O3DA 2VWMA 3P8FA 2ZEBA 2BB4A 1TPOA 1BMNH 2PP6A 4A1TA 1ELCA 1C5UA 1TQ7B 1ZTLA 4UFEH 1BOQA 1SFQB 1GI6A 1D6RA 2VU8E 1LDTT 1GI3A 2J2UA 3MU8A 1E36B 1O3LA 4WMFA 1BUIA 2C4FH 1P2KA 1Z6EA 4ABIA 1O2SA 3UWJH 4D9RA 1C2EA 1QGFA 2IJOB 3VGCB 1E1QD 1N1LA 2ZIQH 3GY5A 3LKWA 3NRLA 1K1LA 5EXLA 4UFGH 1P06A 1CGIE 2D2DA 3F2GA 4AC9A 1YPLH 1C5ZB 3EGKH 1CA8B 1LMWB 2CHAC 4DJZB 5IYTA 2STAE 3SU1A 4WWYA 3A7ZA 4FUGA 3ZVDA 3MU4A 3RM2H 3I77A 3MH4A 1C1QA 2AMQA 1Y3VA 1UJ1A 1HAIH 2GCTB 1O39A 2NU2E 2C8XB 2PV9B 1T7CA 4LXBH 4ZXYH 1EB1H 1D9IA 3RXPA 1TBQH 1GG6B 1FZZA 1SG8B 1UHBB 3SQHE 4I8GA 5A0CA 2O8WA 1C5LH 2PTCE 3OE7D 4AGJA 1WYKA 2G4UA 1NFXA 5JBAS 3SNDA 4AYVB 2G00A 4X8VH 1O3MA 1EZXC 3BTGE 3D23A 4ABJA 2AS9A 4IGDA 1QCPA 2BY7X 4OS6A 1EB2A 1W13U 2LPRA 2P8OC 3QLPH 1PPEE 1GBIA 1RFNA 1TGBA 1VGCC 4RT0A 5LPEA 1FPHH 2XNIA 4HI3A 4INKA 1TOMH 1BQYA 2LP6A 3S0NA 1OOKB 1KXEA 3TNSA 2J98A 1RTFB 3CS0A 3KF2A 3SHCH 3SW2B 3QK1A 1GCDA 1MD8A 5C5NA 2NU4E 3RXAA 3W94A 3PO1B 3OEHD 3QN7A 1PPFE 1QRWA 2Q6GA 4LK4A 1OWEA 3M5MA 5L2ZH 4AN7A 2AIPA 1D3DB 4DOQA 2XC4A 2XYAA 4IMQA 3TLOA 5FBIA 5C5OA 5F8TA 3RXBA 3TJUA 4YM9A 1RIWC 3GCHB 1Y59T 3GYMA 5DGJA 1ZHRA 3JZ1B 1ZR0A 4X6NA 3HGPA 3UR6A 1S6FA 2V3OH 1NFWA 3F6UH 3BEUA 4ACBA 5EJ1A 2KCAA 1XKBC 1MTNC 3UTUH 4CH8B 2BD3A 1GBCA 4CHAC 3GY2A 1KXAA 1HAZB 1WUNH 4DT4A 3M5LA 1J8AA 2JH6D 3P8GA 3OYPA 3GCTF 2QF3A 2QIQA 5L30H 3RMNH 4KTCA 1CGHA 1NT1A 1XUFA 1ZOMA 1P2IA 1W0ZU 4GHQA 2BLQA 5GPIB 1GMCF 3UREA 2FLRH 4WXVA 1TOCB 3VXFH 1S82A 5HGGA 1DT2A 1J14A 3UOPA 2C8ZB 3DUXH 1ZRKA 3O8RA 5LGOA 4ISOA 2WPDD 2A31A 3P92A 1P12E 2QA9E 1O2ZA 1O2LA 4Y0ZE 3FANA 3DHKH 3SUDA 5J4SA 3UY9A 2V0BA 1DDJA 1ZMLA 3KQCA 1HJ8A 3U8TH 3OFND 2FI4E 2ZFTA 1PQ5A 3QWCH 3BV9B 2M5TA 1ELGA 5C67A 3D49H 1F92A 1YC0A 3E3TA 3LJJA 1QR3E 1O2VA 1OWHA 3QO6A 4ISNA 4ISHH 3A80A 1GBKA 1ANEA 2H2ZA 4FVDA 3ZIAD 2P3FH 1EOLA 1AHTH 5CMXH 4MNVA 1XKAC 2ILNA 8GCHF 1GJ9B 1SHHB 2ULLA 3FZZA 2BYAX 1GBBA 1THPB 1MKXH 2GDEH 2UWPA 4Y6DA 3SNEA 2PUXB 3MI4A 2Z6BD 1CT0E 2Y82A 4CRGA 3UWIA 3DA9B 1AUTC 4HGCA 2FOGA 2GT7A 3F9FA 1FN8A 5ETXA 4ZKNU 4TY7A 1LO6A 1EQ9A 2OQ5A 5EQQA 3AK5A 3RMOH 1TMUH 3LGUA 4ABDA 1E1RD 1ABIH 1DXWA 2ZA5A 1UHBA 4HTCH 2YOLA 4U30A 1OP0A 3I78A 3BSQA 1EZQA 5F03A 2ZGHA 4ZKOU 3RXVA 4XRNA 2HLDD 1GI9B 3LGTA 3IITA 2J94A 4ABAA 2ZFQH 3BG4B 1SL3A 1J17T 1HNEE 1AUJA 1G2MA 1ZJDA 1TFXA 2UUFB 1A1RA 2XCFA 1DX5M 1NU7B 1TGTA 1YKTA 4K69A 1A5GH 3HATH 4WH8A 1KXFA 3MU5A 4XBBA 3FZDA 1AFQB 2XOKD 4X2VA 2O8UA 3MOCA 1WXRA 1SGYE 3VXEH 2QCYA 5EU8A 2VBCA 1NS3A 1GBMA 1NPMA 1H9LB 1EAIA 1T31A 1V2NT 2BDGA 3SUFA 1LKBA 3AASA 1SGPE 3ZYDA 1OP2A 1GMDF 4X1QU 1EPTB 3BTME 4K2YA 3PLPA 3EQ0H 2SGAA 1LPKB 5HIYA 1OKXA 5EQRA 1WQVH 2HLCA 5HKKD 1A3BH 3C1KA 4Y76A 2AGGX 1HAVB 4O97A 2GZ9A 2KR7A 1H1BA 1P8VC 2GP9B 1UCYE 1S81A 1Z6JH 2BLOA 4FUJA 3SV7A 4B2BA 4B6EA 1TMBH 3PWCA 1Q2WA 1BMFD 3VB7A 5C94A 3V7TA 1GI8B 1N8OB 4XBDA 5GCHG 3WWFA 3EA9A 3S69A 1EJMA 3MFJA 1FXYA 2A0QB 1WOFA 3LGIA 1DWDH 3ODFA 2QYIA 3S7KB 3DSPA 2WV5A 3NXPA 2Y7ZA 5EIYA 1GL0E 1P2JA 4NSYA 1IQLA 1UTQA 2BLVA 2F91A 2H5DA 2ODYB 1TNHA 1SR5C 1A5HA 4NGAH 2FOMB 1HUTH 1LHDH 1GDUA 1YPJH 5L6NH 1E34B 1SSXA 2FMJA 3NWUA 5HYOA 5HIZA 3A83A 1MTUA 1O3PB 1WCZA 2BXUH 2K8IA 1J9CH 1D3PB 5GWZA 4KKDA 5C17A 1GBJA 2H9TH 2PHBA 2ZHFH 1Y3UA 1EATA 5EJZA 3RXJA 1YP9A 1BJUA 2EI7A 5IK2D 2TGTA 1BJVA 3PRBA 3SZNA 1F0UA 2DE8A 3VFEA 4X8TH 3N99A 1L4DA 1LPGB 2FODA 5A8ZA 2FOBA 4OS1A 7GCHF 3HK3B 3LGVA 2A4GA 1GCTB 4OS4A 5I46H 3BTFE 5B6LA 1TBZH 5GIBA 1AKSA 2QF4A 1F5LA 3SO3A 2Q6FA 4AFUA 1PYTC 1ZSLA 1O5FH 1DWEH 1TNGA 1V2KT 1DS2E 2FESH 1CT2E 2Y81A 1XUJA 3Q77A 3CNRA 4K1EA 1AY6H 1TWXB 2IJD1 1ETSH 3VB6A 1C1SA 2FP7B 2OUAA 1BTYA 1F0RA 2VWNA 3E6PH 3M37A 5BRRE 1SLXB 3L33A 4Q7ZA 2H9HA 1VR1H 3A8BA 2IN2A 4JYUH 4NFFA 1GJBB 2Z9IA 1V2LT 1BZXE 1MKXK 1HJAB 2OP9A 2ZGXH 4DIIH 3M3VA 1GHAG 1IQGA 1OP8A 1O5DH 3PM3A 3GDUA 1LPZB 2J5UA 2P95A 1FUJA 1G3DA 2HNTE 1FY5A 1BRCE 1DWCH 4X0WU 1DPOA 1W10U 1IOEA 2BD8A 4D9QA 1Y3WA 3OEED 1AGJA 4QT8C 4Z6AH 3QGJA 1YWUA 1UTMA 3SJIA 2W3KA 1C5PA 1DUAA 3BTEE 5JB9S 1YM0A 1O3CA 5DP3A 3ZVEA 1BCUH 4AB8A 1K22H 1SOTA 3K9XB 2ESTE 1CO7E 5A2MH 2A32A 3A86A 4NFEA 4UE7H 3E0PB 5LPRA 1U6QA 1OYTH 1O0DH 1FJSA 1PQAA 1PYTD 2STBE 5T6GA 3MWIU 4CRAA 1UTLM 2FX4A 2KCYA 3GDSA 3SGAE 1ZLRA 4X1NU 1HAGE 1HAVA 1L2EA 2ZFFH 1CA0C 1C5RA 4BTUB 2ZZUH 1K28D 1ZGVA 1O5EH 5DP5A 1O37A 3GY8A 1PQ7A 1ZTKA 4WY3A 2KCPA 1QL8A 4MVNA 2ZDKA 1UK2A 4K8YA 3L6PA 2WPMS 2ZU4A 3A8AA 5G4BA 8KME2 4BAOB 3ELAH 3TJNA 2ZGJA 2BD5A 1O2QA 5EXMA 4BNRA 1XXFA 3NPSA 3RLWH 4PROA 1EZUC 1NN6A 3BEFB 1QBOA 1YLNA 2C8YB 3B23B 2AGIX 1IQNA 2ZECA 4JZDH 3PMHB 1YY3A 3K65B 5J4QA 2G4TA 5A09A 4HFPB 2CK3D 1O3GA 3PV2A 1HXFH 6CHAC 3ZZDA 3S9BA 1VITH 2QF5A 4K1TA 1TRYA 3K6ZA 3RXOA 3A7TA 1DWBH 1W0JD 4JZFH 2YNAA 3RUOA 3DFLA 2JDID 1YPGH 1SQTA 2QC2A 3NCLA 4XE4A 2WV4A 2FOCA 2ZDVH 1YCPH 2SGDE 2C3SA 4ISLA 3VB5A 2ZTZA 3UPEA 1W11U 3MNCA 3TGJE 1G9IE 1BTPA 2Z9LA 2BVSH 5DJ7A 4YO9A 1Y5UT 1GJDB 1W12U 2FLBH 1V2UT 4HZHA 2O8LA 2PWXA 1ZGIA 4Y7BA 3PWBA 1YPEH 1KXBA 1CGJE 1SPJA 4VGCB 2TBSA 2EQNA 4Q4LA 4F55A 2KAIB 3KQDA 2B9LA 1CBWC 3MH7A 2YMSC 4UFDH 2BQWB 2GT8A 2O9QA 5ESBA 1SQAA 3EAJA 2ZHQH 4ZAEA 5DKMA 3V12A 2VVVA 1GGDC 3O8BA 1EAUA 1CQQA 3RXHA 2ZCLP 1AFEH 2ODPA 4ZKRU 4NA7A 4FUEA 5E0GA 5A0BA 1C5SA 2V3MA 4DGJA 1C1OA 4ZROA 1BIOA 1HFDA 1F2SE 1O2WA 2FX6A 4JYTA 2ALVA 1TLDA 1WTHD 1FMGA 1NY22 4AYYB 3QDZB 1SQRA 4BAHB 2ZC9H 4YT6H 4U32A 9ESTA 1QJ6B 3IWMA 1EP5A 3OU0A 4CRFA 4MQAA 2PW8H 3UQOA 2VGCB 1A0LA 4O3TA 3STIA 3B8JA 5CHBA 2SGFE 4JZEH 5CDFE 2RFKC 2FM2A 3PYHA 1HYLA 1UTKA 1ELFA 1VCPA 3AW1A 1FNIA 1A3EH 2WPHS 2BZ6H 5E8EH 2WYGA 1DM4B 2QE7D 4TT3D 1TNKA 3ZVCA 1O32A 2PR3A 3UNSA 3GISB 2F9NA 2BY6X 4ACAA 1C5YB 3U69H 1Z1JA 3TK6A 1HRTH 1TRMA 2ZCHP 3RXTA 5JB8S 1AI8H 2BDIA 3MHWU 2WUCA 2RCEA 2QXJA 3L3TA 2BY8X 2VB0A 2AHME 5KGOA 1AIXH 2YMSD 4GLYA 2Z3DA 3OY5U 3BTQE 3MTYA 1TONA 5GCHF 2QGRA 7KMEH 1KY9A 1G36A 2PKSC 2FWWA 1ANBA 2QXGA 4FUCA 3NK8A 1IQIA 1ZJKA 5HXFA 1C5OH 8LPRA 3MO3A 1TABE 2GDDA 1C2IA 2V35A 2BLWA 4Q2KA 1MZDA 4UD9H 3LH1A 2ZTYA 1OS8A 1Q3XA 1O2GH 1AB9B 1A2CH 1FDPA 1J16A 4Z0KA 1SGTA 3SJ9A 1XUGA 2ZI2H 5I25A 2F9BH 3SV2H 2Z9KA 3AW0A 3DT0H 1ELAA 1MU6B 1O38A 1MTWA 1PPHE 1O30A 5K0HA 1OXGA 2UUYA 4ZKSU 1HDTH 3SN8A 1Z8JB 2A5IA 1JRTA 2JETB 3BF6H 1C2KA 3NZIA 4ZHMU 1TGCA 4ABGA 4E05H 1S0QA 4DY7B 5E0HA 2A7HA 1GVKB 1O2NA 1YPKH 3B9FH 4BAMB 4XSKU 2ZKSA 2BVXH 2D1JA 2EY4C 1NRNH 3SJOA 3EDXB 4AG2A 5T1VA 4E7RG 3TJVA 5KEDA 2VH6A
chains in the Genus database with same CATH topology
1AWHB 1V2VT 4TWWA 1QRZA 1V2OT 2ZHDA 4A92A 2P3UB 1AZ8A 2A5KA 3MU0A 1FQ3A 2VJ1A 2SNWA 2AMPA 3PMBB 1TPPA 1ANDA 4X6PA 6GCHF 3RC5A 2ZDMA 4K8BA 2CGAA 1SFIA 2ZG0H 5CHAB 2W5EA 2KAIA 3K6YA 1P2OA 4FVBA 1IHSH 2ZDLA 1MQ5A 1CHGA 4X6OA 1K2I1 2BX3A 2F9UA 2OCVB 4FXGH 4D8NA 1YCPK 2SGEE 1FY8E 1GHAF 3QZQA 2BM2A 2CXVA 3P8NA 1AVGH 2IOTA 4FU7A 4FUFA 4SGAE 5FXLA 3KL6A 4YOGA 4TYDA 4GCHF 2GCHG 2ZTXA 1C1TA 5TCCA 4Y79A 2EEKA 3LC5A 4ZUHA 4JYVH 3RXMA 1D6WA 1O5CB 3RC4A 1O3FA 1PJPA 2ZGBH 4OS7A 2OC7A 2WPIS 1QQ4A 1JIMA 1SLUB 1YBWA 5DPAA 2CJIA 1SGFG 1YLCA 2A45B 1GHVH 4NWLA 1ZYOA 1C2FA 3SGQE 1TQ0B 1GHWH 3KNXA 1IQMA 1EAXA 1SI5H 1F0TA 1AVXA 1MMJN 1MQ6A 1L1JA 2BDBA 2SGPE 4WVPE 1TNIA 5EOKA 1LQDB 4OS5A 5AHGH 4CR5A 1E0FD 4MPVA 4NWKA 3PTNA 1EAWA 4X8SH 1TNLA 3S7HB 1ABJH 1V2WT 3RMMH 4J2YB 2PKAB 1BT7A 2B8OH 1MUEB 3BN9A 1TYNA 1V3XA 1Z7KA 2WPLS 1ZMNA 3FVFB 2GX4A 1O33A 4TPYA 3MNBA 1P57B 2Y5HA 2ZFPH 2PKSB 1C9PA 3BTHE 4CH2B 3DD2H 5F6MA 3Q3KA 5SGAE 4NCYA 3U98H 2A1DB 1NO9H 2CHAB 5DO4H 3M5OA 2OTVA 1HAXB 4NIWA 3A8DA 1PPCE 5FPSA 2F9OA 1AE8H 3O8DA 5A0AE 3ITIA 4R0IA 4CR9A 1RXPA 2Z7FE 2ZU3A 3A88A 3MO9A 1HGTH 3SNBA 3FP8E 4KGAA 1LHCH 4H6SB 4CBNA 1DVAH 1K1IA 2VIWA 1V2RT 2HWLB 4NIVA 3A89A 1W7XH 4MDSA 4NZQA 1O2RA 1FIWA 5EW2H 1TX6A 2AEIH 1QL7A 5EQSA 4RN6A 2FZZA 4D7FA 2PUQH 2P8OB 4A1XA 2RG3A 3V13A 1VGCB 2G8TA 4CREA 1JRSA 2BOKA 1JIRA 1RTKA 4Y8YA 1BRBE 1H9IE 2HGTH 1W7GH 4KELA 4U01A 1PPBH 4YESB 1SGDE 2OXSA 1NRRH 1BMMH 3LC3A 2B5TB 3TIUA 3SI4H 2H5CA 3JZ2B 1Q31A 1HAHH 4I8KA 1TE0A 1PPZA 2WPKS 5DP6A 1Y3XA 1TALA 3PTBA 5DP8A 5IDKA 1QB6A 1YPHE 4BAQB 3KCGH 1HV7A 3BTKE 3RMLH 5HM9A 4Y8ZA 2ZHWH 1S85A 4AOQA 3E16B 3SNCA 3C27B 2XC0A 1RIWB 1PPGE 5HMAA 4INLA 5TJXA 2F3CE 4X2XA 2ALPA 2ZNKH 2GZ7A 1G32B 3GY3A 4O3UA 1MTNB 3GY4A 1KXCA 2XXLA 1OX1A 3ATLA 4CHAB 1GHZA 2UWOA 2A7CA 1SBWA 4I31A 3ZVGA 2P59A 2I6SA 1O31A 1FPCH 1TB6H 1TGNA 4MNXA 1O3IA 2BQ7B 2OBOA 4SGBE 2A4QA 4AFZA 1SGQE 2Z3EA 4IBLH 1L1NA 1WU1A 2A4RA 2BD4A 2FO9A 2FI3E 3HPTB 4MPXA 5FPYA 3T29A 1IQFA 1DITH 2EI8A 1RTLA 1TX8A 3KQEA 2A2XH 3TNTA 1PFXC 4K3JA 4H6TA 2P3TB 2UUJB 3BEIB 4UDWH 1AQ7A 2FTLE 1G30B 1SMFE 1C4V2 2AH4X 3HKJB 4E06H 4H42U 1F5KU 2ANKH 1NFUA 1TPAE 3UNRA 1SHYA 2FOFA 1C5MD 2PFEA 2XBXA 1G37A 1WV7H 1O5BB 1N6XA 3SU5A 3LONA 2VWOA 1E37B 3QTOH 2AYWA 1O5AB 1YPHC 3FP7E 3KGPA 8ESTE 1Z1IA 2Z94A 3N7OA 2TGDA 1MTSA 2SNVA 1ACBE 5PTPA 5GDSH 2OLGA 1KDQB 1O2XA 5LPFA 4X8UH 1QL9A 3H5CB 1GJAB 1OWJA 4YLQH 4YOIA 3TH2H 4ESTE 3SQEE 1ETTH 1GMHG 2VIVA 5HM2A 4O9VA 2FI5E 2YNBA 1P09A 1GHBG 4I32A 3T5FH 1H8DH 1P2MA 1XVOA 4FUDA 1P3CA 1M9UA 2RA3A 3E8LA 1C9TA 2WPJS 1OWKA 1VITG 4NZLA 3SU3A 1GI0A 2FEQH 1GBHA 2NU1E 1LVYA 4DG4A 1CU1A 1Z8RA 3RXKA 3FAOA 3Q3YA 1W0YH 1O2TA 2ZQ1A 2VWLA 4X1SU 1CE5A 2ZDAH 3RXSA 4WJG2 3RXUA 1GBTA 3ZZ7A 1UVSH 1MKWH 4GUXA 2J38A 3IG6B 1P9SA 3TH4H 1OYQA 2FOAA 1TIOA 3VEQB 1Y5BT 3RXRA 1DSUA 2FYQA 1TMTH 1EPTA 3OY6U 3STJA 3KN2A 4BOHA 2GCHF 1W3CA 3RU4T 3O8CA 4I8LA 1D3TB 1GBFA 1FY1A 1RRKA 3PLBA 3OTJE 3LT3A 3F68H 5EXNA 1AWFH 1O2MA 1INCA 3VGCC 4UONA 1B5GH 1YLDA 2VINA 3H7OA 1BRAA 1DXPA 1XUHA 2SFAA 3ZZ6A 2J92A 5AFYH 1TA6A 1DSTA 1TAWA 1GJ4H 3SUEA 1LTOA 1GBEA 3ENSB 2XRCA 3GCNA 5B6OA 3F9GA 1BTUA 1KIGH 2H6MA 2GV6A 4LZ4B 4IC5A 1IHTH 4BAKB 1HPGA 4NA8A 2CF9H 1K1JA 2ZU1A 1ELDE 1AD8H 2GCTC 3FP6E 4R8TB 1JMOH 4JMYA 4X1PU 1W14U 4K5ZA 1P2NA 1T8MA 1SLVB 3T26A 1E38B 1TPSA 1GJ6A 3W95A 1GG6C 1JWTA 1C1RA 5ESTE 1C1PA 4AGKA 1P05A 2A5AA 3A84A 2I6QA 3SV6A 1BTZA 1T8OA 1E35B 2BX4A 3TVJB 4CRDA 1TGSZ 3PMAB 2DUCA 5JBCS 4ZH8A 1XUKA 3PMJA 3KIDU 1NROH 2ZHEH 4X1RU 3LJOA 4OGYA 3M3TA 2A4OA 3P6ZB 5DK1A 1DANH 1ZRBA 2ZPRA 4O03A 2ZWLH 3M7QA 2BHGA 1LQEA 2FOHA 2R3UA 1FY4A 2XBYA 3GCOA 1TRNA 1EUFA 3A7VA 3BTWE 1O35A 3PO1C 1KDQA 2BZAA 4I8JA 1DOJA 3KEEA 2A7JA 2A2QH 1YCPM 3TITA 1ANCA 3A7WA 2W7SA 1UMAH 5A8YA 4ABEA 3BIVH 4RKOB 1K1MA 3BIUH 4B71A 1NTPA 3GICB 3F9EA 2TIOA 1BTHH 3GCHC 1O2IA 5T6FA 1MCVA 3TU7H 3QX5H 2GZ8A 1EJAA 1GMDG 1O3JA 3CENA 2WINI 1S5SA 1T8LA 2BQ6B 1F0SA 1K1NA 4KTUA 5FHTA 1P0SH 2FS9A 1XXDA 4AX9H 2Z9GA 5BPEA 5JPMH 4Y8XA 2WYJA 1ZSKA 3HK6B 3URCA 2BDHA 2P94A 1FN6A 1ZPCA 2EA3A 1C1WH 1QJ1B 2OC0A 1QURH 3GDVA 3SV8A 1JBUH 5DP9A 3E1XB 2R3YA 1P02A 1UK3A 5FCKA 3M36A 1K21H 1OSSA 1C5QA 3RLYH 1DICA 4X2YA 2F9VA 4NG9H 4INHA 3T25A 1HAPH 2AMDA 4D76A 1C1VH 4JK6A 1NRSH 1JOUB 2J95A 1BHXB 1CA0B 3SGBE 1C2HA 9LPRA 5FX5A 1GL1A 1MBQA 1MKWK 5FPTA 4AFSA 1LVMA 3M3SA 1UVOA 1O2UA 1GVLA 2GTBA 1X7AC 1C2JA 1UVTH 3RXCA 1C4U2 4X6MA 1RJXB 1V2MT 3SUGA 1GDNA 3BG8A 1TBRH 2GV7A 1ARBA 1VJ9U 1LCYA 1BMLA 1L0ZA 3SU6A 1F7ZA 1Y5AT 3PLKA 4ZXXH 4WMEA 1KXDA 3SJ8A 2AGEX 4FUBA 4ZHLU 4F49A 1EASA 4JZ1A 1QB1A 2FOEA 2G51A 4Y10E 1KLIH 2BTCE 1P04A 1ELVA 3MYWA 6CHAB 2VIOA 5F8ZA 1QB9A 7GCHG 2THFB 1OPHB 2O8MA 5FCRA 3ZZ4A 5LH8A 1K9OE 1A46H 1QJ7B 1BHXF 3GY7A 4B73A 3BG4C 1Y3YA 5JBTA 4WF8A 1CHOG 2Y5FA 4Y7AA 1ELBA 1AN1E 1SGIB 1V2QT 3UOUA 4CRBA 3LDXH 1THRH 4MG3A 1L1GA 3RP2A 3A7YA 1DFPA 2ZPQA 3U1IB 3SU4A 1P11E 1C5WB 1P3EA 1TX7A 2CV3A 1C5TA 2BOHB 5EPYA 1AFQC 3UQVA 2QXIA 3V3MA 1FONA 1SGNE 5K7RA 3FFGA 3T28A 2F9PA 1V2PT 1GMHF 2FDAA 1T4VH 1MCTA 2XC5A 1CBWB 4KP0A 1S6HA 1GHBF 2BVRH 1F5RA 2HNTF 4YLUA 1EP6A 1ESAA 2Y80A 1O3EA 3KQBA 1GGDB 2VNTA 2GGVB 1O2KA 3ZZAA 2UUKB 1WBGB 2GVFA 1P10A 1EPTC 2PGBB 1AO5A 2BMGB 1O34A 1DE7H 7LPRA 1VITF 3HKIB 5C3NA 5CE1A 3TK5A 1LVBA 1IQEA 1SB1H 4NIXA 1QA7A 1LHFH 5H4IB 2NU3E 3VB3A 2ZCKP 1WQSA 3AAVA 1QIXB 1BBRE 3WY8A 6LPRA 3CS7A 1KTTB 2PSYA 3RU4D 1N6YA 3ZYEA 4BANB 2OQUA 3E90B 1QBVH 2D26C 1ID5H 1N8OC 3UFAA 1H4WA 2R9PA 1C5VA 2AFQB 1T32A 2OD3B 3D65E 4YT7H 3P95A 4MNWA 4IC6A 1W8BH 2JH5D 1HIAB 2ASUB 3G01A 3UR9A 1WAYB 1ESBA 4TWYA 4XOJA 4CBOA 1LHGH 4MPUA 1C5NH 5L2YH 2ANWA 2AERH 2VVUA 1G3BA 1S84A 1JXPA 1YF4A 2BD7A 3VB4A 1G2LA 1K1OA 1B0FA 2EI6A 1B0EA 3MNSA 3U9AH 1TNJA 2O8TA 2TPIZ 1S83A 4B75A 3URDA 1EJNA 1QQUA 1BB0B 1MAXA 1RD3B 4H4FA 3RDZA 1O3BA 4WH6A 4D7GA 5EODA 1EKBB 1UTJA 2XWBI 4DCDA 5C1UA 3A85A 4U2WA 1Z8GA 1YPMH 1P9UA 1V2ST 2R0KA 1SQOA 2W26A 4B1TA 1NC6A 2IPHA 1HAOH 3U8OH 3U1JB 4FUHA 1O3KA 3M35A 2J4IA 3ZVFA 1ESTA 2B0FA 2VIQA 1UTOA 1GPZA 2TGPZ 2ZU2A 1SGEE 4Q80A 4ABHA 4DIHH 4X2WA 1KSNA 3GOVB 1QHRB 3LPRA 1BBRH 2BDCA 4GHTA 1D4PB 1GCTC 4ABBA 1GI5A 3P17H 1BDAA 1AKSB 3RXEA 1GI4A 2ZF0H 4GVUA 4RKJB 5FBEA 3MNXA 1MZAA 4Q7XA 1OWIA 1O2YA 2BDAA 1W2KH 3PV4A 3Q3XA 1KYNA 1S0RA 2OC8A 4JZIA 1FI8A 1V2JT 3Q00A 2J34A 4OGXA 2GKVE 4BTIB 2HPPH 1HB0B 5E2PA 1HJAC 1O3NA 1O2PA 4DT7B 4AZ2B 3LGYA 5AVDA 3D62A 4A6LA 4BTTB 2HPQH 1C1NA 4GSOA 4LZ1H 1ZTJA 3U8RH 1GJCB 2XWAA 5DP4A 2AIQA 2VIDA 6ESTA 1C2GA 1P03A 7ESTE 1BITA 2V6NA 1KLJH 1UVUH 1V2TT 3ATIA 1NM6A 4IN2A 2GD4B 1BMAA 3ZVAA 1O3HA 2Q6DA 3M61U 3ZZCA 4IW4E 4ZHAA 4YOJA 2BXTH 3ZZ3A 4CRCA 2C90B 2Y5GA 3EYDA 1GWAA 5AFZH 1XM1A 1ZHPA 3K2UA 1BRUP 3MU1A 4BXWA 3A81A 1GI2A 3OX7U 1K1PA 4I8HA 3ATKA 1O2HA 5DG6A 3F1SB 1UVPA 2G5NA 2QXHA 2FS8A 3RC6A 3GYLB 2G55A 1O36A 1ZMJA 3ZZ9A 1FY3A 1YGCH 3LH3A 3SNAA 4I33A 5JDUB 5T3HA 4DURA 4JCNA 5C2ZA 3SV9A 2GMTC 3ATWA 3VPKA 1C2DA 2HVXA 1O2OA 2QAAA 1H9HE 1IQJA 2G52A 4TY6A 1SOZA 3GY6A 3LIWA 4B74A 1DLEA 3SBKA 1RGQA 1NU9A 3M7UA 1GBDA 4XDEA 4GPGA 2VVCA 5FAHA 2EC9H 2ZDNA 3EA8A 1HIAA 2FYRA 1CT4E 1HBTH 1EX3A 2CMYA 1P01A 1G3CA 2QV1A 5FX6A 5E0JA 4LOYH 3EA7A 2HALA 3ZZ8A 1CSOE 1FAXA 2BY5X 3A7XA 3E91A 1QNJA 2WUBA 1EZSC 2LNCA 1GI1A 2XW9A 3LU9B 1QRXA 2K1QA 2PKAA 1DY8A 2DE9A 3RXIA 5C20A 3ZV9A 1O5GH 1CVWH 4K60A 2G81E 1YYY1 4NA9H 4E7NA 2NU0E 3Q76A 4K1SA 1MU8B 4WMDA 2FXRA 2F83A 1IAUA 4AG1A 3SHAH 5T6DA 1MBMA 4F4OC 2J9NA 4KTSA 5DP7A 4A5TS 2QY0B 2XTTB 1GHYH 2W3IA 3UIRA 1RS0A 2HOBA 3ZZBA 3PROA 1LHEH 2C93B 2Y7XA 1ZSJA 2QF0A 2Z9JA 2CF8H 3TJOA 1UK4A 2XBWA 5EGMA 4I7YH 4VGCC 3QTVH 2OC1A 3LGWA 1D3QB 2FIRH 4DVAU 2H9EH 1UCYH 5F8XA 5GXPA 3M7TA 3R3GB 4XBCA 1DLKB 2ZO3H 2R2WU 1ELTA 1C5XB 2OINA 1C4Y2 1C1MA 2PTNA 3F9HA 1CHOF 1AU8A 6GCHG 3CP7A 3ZV8A 1ZPZA 1AE5A 2H1UA 3UUZA 1SGRE 3DFJA 3UNQA 3T2NA 1C2LA 1O2JA 4YTAA 3NKKA 1GHXH 3RXDA 1BBRK 1EXFA 2RA0A 4Y71A 5EG4A 5GJ4B 2P93A 3A82A 2VGCC 1NESE 5JBBS 3MMG