3TGJE

S195a trypsinogen complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
215
Chain Sequence
b'KIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Comparison of Anionic and Cationic Trypsinogens: The Anionic Activation Domain is More Flexible in Solution and Differs in its Mode of Bpti Binding in the Crystal Structure
pubmed rcsb
source organism Rattus norvegicus
molecule tags Complex (serine protease/inhibitor)
total genus 53
structure length 215
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgjE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgjE02
1K21H 2VVUA 3QWCH 4MTBA 2O9QA 2UUJB 2ZI2H 1H1BA 1HAHH 2O8WA 2UUYA 1NFWA 1GGDB 3M5OA 2BY8X 3DT0H 4K3JA 1LO6A 4ABIA 1W10U 2ALVA 3PMJA 4NIYA 3ZZAA 2ODPA 1C2EA 2BDBA 3A8BA 4B2CA 1V2NT 3SUEA 1K9OE 4SGAE 2JH6D 1BT7A 2BLOA 3P8FA 1GHAF 1C4Y2 1FIZA 2GZ7A 1A0JA 2A4QA 2G00A 5LPFA 3ZVCA 2BVRH 3ZZ4A 2M5TA 3AASA 3SN8A 3U98H 2EI7A 3KQBA 1AB9C 5L2YH 3A87A 1GGDC 6GCHG 5FCRA 3TH3H 4X2XA 1LQEA 4WMDA 4NSYA 5EU8A 3RMLH 2BX4A 1T4UH 1ZJKA 1Y3YA 3F9GA 3EA7A 3UNQA 2A45B 3RMMH 2GCHG 1C9PA 4KELA 1DS2E 2O8MA 3HKIB 1TA2A 1S83A 3S7KB 5B6OA 1AWHB 2VIWA 1RTLA 2ZWLH 3WY8A 2XCNA 5E8EH 4O03A 1DITH 1JOUB 1SQTA 1H8IH 3ATWA 2SNWA 3UY9A 1HGTH 1FPHH 2BDIA 3SJOA 2A7HA 1ESTA 1ZSKA 1OWEA 1TMBH 2Z3EA 4JYUH 2LPRA 4WXIA 1TNIA 1LPZB 4H42U 2VWNA 1O2XA 3SI4H 4ABDA 4AFSA 5FAHA 1IHSH 2VIDA 3SU4A 2ZPRA 3VEQB 3M3TA 3UOPA 3PM3A 1ETRH 2OC0A 2WPHS 1OP8A 1DPOA 1GI0A 1SGQE 2W26A 3FZZA 3QO6A 1AI8H 1CBWC 2YOLA 1NU7B 4WMFA 1TOCB 4J1YA 3QDZB 2ZFPH 1FJSA 2ZDLA 3U1JB 3E16B 4IBLH 5DO4H 4X1RU 2GT7A 1HJAB 2G51A 4X1QU 4VGCC 4ABJA 1P06A 2A7CA 1AKSB 4IW4E 5FBIA 3NZIA 1GHYH 4D76A 3GCNA 2C93B 1QBVH 2PLXA 1N6YA 3F1SB 4FUGA 1Z1JA 1Q2WA 5DJ7A 1MKWH 3VB7A 3FFGA 4CRFA 5A8ZA 2CJIA 1BTYA 2Y5HA 2J38A 1QL7A 1MCVA 3ZVEA 4WH6A 1L2EA 2FMJA 1YC0A 5DK1A 5I46H 3SGBE 1J16A 2THFB 3E0NB 3BTKE 2RDLA 1SSXA 2OP9A 4MLFB 3NUMA 4Y6DA 2QXIA 3SU2A 1HCGA 2OQ5A 3LH3A 1AFQB 2VINA 1WOFA 1FIWA 5EG4A 1IQGA 1HAGE 1CVWH 1C2HA 1C5YB 1X7AC 2ZGHA 5IDKA 4J2YB 3V7TA 3ATIA 2AFQB 1LVBA 1JXPA 3P92A 1KLJH 4MG3A 3QZQA 4Y7BA 5ABWA 1Z7KA 4NA7A 1P2IA 1GBBA 2F91A 4FUBA 5C1YA 1Z6EA 1ELGA 2P94A 2GZ9A 4HFPB 1LQDB 1GMHG 2PHBA 3TLOA 1J15A 1J17T 1D3PB 1C9TA 5GPIB 3ZV9A 1F0SA 1RTKA 1YPJH 3A81A 3D23A 4X0WU 7GCHF 2HPPH 1QJ7B 2FS9A 3HK3B 3PWBA 3F9HA 5C1XA 2EC9H 3PTBA 1ELDE 2Y5GA 3RDZA 1G3DA 1H9HE 1AQ7A 3H5CB 3EA8A 2VIOA 3BIVH 5DG6A 1T7CA 5EODA 1F0UA 1C2MA 1GCTB 1DVAH 1HAXB 4GCHF 4GSOA 2A5AA 2VWLA 5GDSH 5EGMA 1AO5A 1C1UH 2BOHB 3UIRA 1FY4A 4PROA 1K1MA 4ZKSU 4AFZA 4D9RA 2OLGA 3M5NA 3P8NA 3GY5A 1FN6A 2STBE 2WYGA 1AUJA 1LPKB 2A2XH 3S9AA 4FXGH 2D8WA 1O2QA 4A92A 1E37B 2Z9IA 1ZHMA 4MPWA 3OSYA 4Y10E 1SQAA 4ZHMU 2F3CE 2NU3E 5EW1H 1AVGH 1MU6B 4BAKB 1F5KU 3BEFB 1TNHA 3RXIA 4FUEA 3UUZA 1V2TT 2SNVA 1A5HA 2TGPZ 5E2OA 3IG6B 3ZZDA 4NZQA 1LCYA 1FAXA 3KL6A 1QQ4A 1P02A 1DE7H 1ZYOA 1AHTH 1H8DH 4CREA 4GHQA 2HGTH 3LT3A 1HLTH 3UNSA 1B0EA 2W7UA 3W95A 3MO3A 3S0NA 3Q77A 1K1NA 1C2DA 1HFDA 1P03A 2G8TA 5FX6A 2H9HA 3GY3A 4INKA 1QFKH 2H2ZA 4KTUA 1GMHF 2JH5D 3P95A 3T25A 1D9IA 1DX5M 3LGVA 5A8XA 3H7TA 2Q6FA 2ZGXH 1HIAB 2P3UB 1K1IA 3E3TA 1O2UA 3TGIE 1T8LA 1BDAA 2XBYA 1O31A 4KGAA 2ZDVH 3MI4A 3KNXA 1GBLA 1OKXA 1KLTA 1ZMNA 1NESE 3U9AH 1QTFA 4XBCA 3T29A 1ZSJA 4NG9H 1ZJDA 1ZGIA 2HALA 2GV7A 1C5SA 1JWTA 1CHGA 4I8GA 1BMMH 3SUFA 1GHWH 2B7DH 1Z8JB 2FXRA 1D3DB 3KIDU 4K2YA 2CF9H 3D65E 2JH0D 3AW1A 1W2KH 1BOQA 2AERH 3A86A 3KGPA 3UPEA 3SQHE 5ETXA 2A32A 4MPXA 2Z7FE 1UTOA 1B0FA 1GMCF 1O3MA 3KQCA 4Y8ZA 4E7RG 4A6LA 1G36A 1D3TB 4X2YA 3KQDA 4ABGA 4CBNA 1LVMA 3RXVA 1INCA 1SOTA 2FOBA 5JBTA 1NZQH 1QL9A 3BEUA 1MQ5A 3MMGA 3F68H 3TK9A 3RXFA 1PQ7A 1TMTH 4QT8C 3AVZA 5JPMH 5IYTA 4BTUB 3E1XB 4A7IB 2GZ8A 1TPOA 1AZ8A 2I6QA 2WPIS 1S0QA 4Y11E 1GBAA 1TGBA 1ZPZA 2F83A 3P70B 1GJDB 4O97A 3DFJA 1IQJA 4MNVA 4CRDA 5DGJA 1NPMA 3MO6A 2BDHA 1GHBF 1IQLA 1EPTB 3RXSA 3M7TA 1EAUA 1DSUA 1YPKH 1SGPE 3AAVA 3A8DA 1PQ5A 1FY1A 4WWYA 1O35A 3GDSA 2AMQA 1SG8B 5CE1A 1Y5BT 5FPSA 1FY3A 4B2AA 1O5BB 4UE7H 1J14A 5F8TA 6CHAB 3RM2H 1XVMA 2A5KA 4NIXA 1DY9A 2QF3A 2HLCA 1C1SA 1EZUC 4X1NU 4U30A 3IITA 1Z1IA 1GWAA 1P0SH 1SGFA 1PFXC 3RXKA 1AMHA 2PFEA 1SLVB 4HTCH 2UWOA 2C8XB 3MH6A 4X2WA 2FOCA 1EP5A 1DSTA 4DIIH 3PV4A 1HXFH 2SGPE 3SHCH 1AVXA 1VITF 2Z9GA 1EX3A 1GL1A 3HGPA 3KF2A 3R0FA 1XM1A 5C2ZA 1F7ZA 1C2LA 3K65B 1C1NA 1KXDA 2OCVB 1QRZA 1AUTC 2ZHDA 1LVYA 4IGDA 2B8OH 4IC6A 2Z3DA 1A3EH 3PO1C 2BB4A 4OS4A 3RP2A 1GJBB 2Z6BD 2ZECA 4X8TH 3RXAA 3MU5A 1GCDA 1SC8U 2FTLE 2FI4E 1ZMLA 1O39A 2BLWA 2AIQA 1PQAA 1AKSA 3HK6B 4AORA 3V13A 1HAZB 1LTOA 3KCGH 1HPGA 4DJZB 1D4PB 1NM6A 1DWBH 1P04A 1O2JA 4UFGH 1AU8A 3G01A 1FXYA 5LPEA 5T6FA 5GIBA 2Q6GA 4H6TA 5HGGA 2CF8H 1BITA 1ANDA 4WY3A 1K1LA 2F9BH 3ZZ3A 1GBMA 2C8YB 4ZH8A 2ZEBA 4ABHA 2C4FH 1TNKA 1CHOF 5CHAC 1Y3UA 1RS0A 2TGAA 1MD8A 3HGNA 1UK3A 2Z9JA 1LVOA 3ODFA 4XOJA 1PYTD 2RA3A 4JYTA 3MH4A 3E8LA 3PMHB 2O8LA 3NXPA 2FTMA 2GCTB 3T26A 1WSSH 1C2IA 2Y82A 4JYVH 4A1XA 4B73A 4D7GA 4TY7A 3DUXH 1DUEA 1TBRH 1B5GH 2V3HH 1GHAG 2J95A 2BD3A 4UFEH 2R2MB 2ZTXA 4GAWA 4I8LA 1C5UA 2H9TH 3O8DA 2VH6A 3MNCA 3MH7A 1H4WA 4CBOA 2GP9B 2ZHEH 3ZZ9A 3ZVDA 1O2NA 4E05H 1GI7B 2A0QB 1E35B 4IN2A 1W0ZU 1MKXK 1FAKH 1FV9A 1ZZZA 2JKHA 4K60A 1SHHB 3DFLA 1BHXF 1KXFA 3MNSA 1C1WH 5FPTA 2IPHA 3NPSA 1UK4A 2OQUA 2P59A 4FU8A 3ENSB 1TWXB 1O3PB 2G5NA 3LOXA 3BTGE 4E7NA 1ZTLA 1ORFA 3ATMA 1LPGB 1SGEE 2FYQA 3K2UA 1V2LT 1MTNB 2J92A 1DWEH 1C1VH 3Q3YA 3L3TA 1AWFH 1FLEE 3BTFE 4B75A 4X1SU 4JCNA 1FY5A 3EYDA 3DA9B 3B23B 3RUOA 3U1IB 1TNLA 2OXSA 2PW8H 4Y0YE 1K2I1 1GHXH 2A31A 1G9IE 2VIPA 5FX5A 3MU8A 2BM2A 1YBWA 2P16A 5GXPA 1GBJA 2ZZUH 5DP9A 2ANMH 2W3IA 2WPJS 4AFQA 3SGQE 1C5OH 1Y5UT 2FOEA 3RXGA 2UWPA 1MTNC 1TFXA 1IHTH 1YF4A 3KQEA 3TJUA 2ZGBH 1PJPA 1MQ6A 2WUCA 3MTYA 1UTJA 1LDTT 1M9UA 2R3UA 2BY5X 3STJA 4OS5A 1DDJA 4CRBA 1O36A 3A82A 3LGIA 2HOBA 2SFAA 4DY7B 1GJ7B 2VNTA 1QL8A 2ZU2A 5EXMA 5JBAS 1WAYB 2G4UA 5JB9S 1ETSH 4MPVA 2I6SA 3VXEH 2HWLB 4Y7AA 6LPRA 1A3BH 1C5NH 1MTUA 1QQUA 1T8NA 4ZKNU 4GHTA 1C5PA 1BBRK 4D7FA 5F6MA 3A80A 1C4U2 1P3CA 2HPQH 4ZUHA 1TRMA 2XRCA 2ZFRH 4JK5A 1A61H 2GD4B 2AGEX 2EEKA 2HNTC 1MAYA 2OD3B 4GPGA 5C3NA 5HXFA 5FPYA 3RU4T 4LXBH 1T31A 1O2VA 3QUMP 1GI9B 1THRH 5C5OA 1O37A 4ZKOU 1WTGH 2DE9A 2IJOB 1QY6A 2OUAA 1OX1A 1XKBC 1O2YA 4NA8A 3NCLA 3TNTA 1OS8A 3F9FA 1QR3E 1WQSA 1F92A 2FX4A 1G2LA 8KME2 1C5QA 1MZDA 1PPFE 1HRTH 1O5DH 2BXUH 3MFJA 2BQ7B 3UR9A 1V2JT 2R0KA 4DVAU 3FVFB 1Z6JH 4DOQA 1YM0A 1RXPA 3KHVA 4B1TA 5J4QA 2GDEH 2C3SA 1G32B 4MNYA 3OYPA 4ZXXH 3RC5A 4LZ4B 4K69A 1EATA 2ZCKP 3SI3H 2FYRA 2XWAA 4NWLA 3PMBB 1PPBH 2EA3A 3E90B 1PPEE 2NU2E 1V2RT 5HM9A 1MTWA 4B71A 5DP4A 2ODYB 5JBBS 1UTLM 1FDPA 4NA9H 4ABAA 7GCHG 3UNRA 3A7WA 1UTPA 4DT7B 4Z6AH 1UTQA 1A4WH 2FOHA 2PTNA 4ZMAH 4X6MA 1ELVA 2XYAA 2A2QH 4LOYH 2W7SA 3STIA 3RXMA 1C1TA 1F5RA 2STAE 3GY7A 1XUIA 4GCHG 2ANYA 1GI8B 1P05A 1OOKB 1T8OA 2FS8A 2Z9LA 3TGKE 2J4IA 3GDVA 1TX7A 4Z0KA 1G2MA 2QC2A 4Q7YA 5A0AE 4B74A 5BPEA 4OS1A 1O2WA 1NRRH 2VU8E 1PPCE 1UVUH 2SGFE 1SVPA 3LGWA 1DFPA 1LHCH 1EJMA 3M5LA 1HJAC 2EI8A 1KDQB 1TGTA 5ESTE 1CE5A 5A8YA 1AY6H 1P2MA 2CGAA 1S85A 1C1QA 4I8JA 1NFUA 3SNDA 1ZR0A 1BJUA 2TBSA 1GJ5H 2GVFA 1SQOA 5TJXA 2BQ6B 2ANWA 2FLRH 2VVVA 4O3UA 2BHGA 1FQ3A 2PKAB 1SGIB 1YPEH 2SGEE 1EASA 2GV6A 1PPHE 4NIVA 1YPHC 1UO6A 1P9SA 1T32A 5AFYH 2TGDA 3LC3A 3RMOH 4JZ1A 3HPTB 1IQMA 3JZ1B 1BMNH 4MVNA 1OWHA 4X6OA 1KYNA 1AFQC 2RA0A 1TABE 3SV7A 4ABEA 4XSKU 1EOJA 3H7OA 3V12A 4D8NA 4BAMB 1NS3A 4K8YA 2AIPA 4NCYA 3S9BA 1WYKA 2WPKS 4FU7A 1GI6A 1E38B 1EB1H 2BY9X 1G30B 1VCWA 2BD2A 4X8VH 3URCA 1OP2A 2AGGX 4WVPE 2Z94A 5TCCA 3A89A 3MWIU 4TYDA 1O3JA 1MKXH 2YNAA 2CMYA 3SO3A 3M35A 1SBWA 3U8OH 1C1MA 1TLDA 3RU4D 5GJ4B 5E0JA 1EXFA 3EQ0H 4K8BA 2HNTE 1XUKA 1CQQA 2XW9A 1EUFA 1KLIH 2FP7B 1ELFA 1MUEB 1XVOA 3LONA 1SHYA 1Y3WA 4WH8A 5H4IB 1W14U 3OX7U 1O2MA 2QF0A 1NRPH 2GKVE 1GMCG 2OBOA 3RU4E 3S69A 4UDWH 1LKAA 3EE0B 2H1UA 3BN9A 4OS2A 2OC7A 2BY7X 1KXBA 2W3KA 3RXHA 1GCTC 2ZDAH 1TMUH 2J9NA 1C5LH 5L2ZH 2F9OA 1BRAA 1BTXA 1SGYE 4ISOA 5C1UA 1PPZA 3T28A 1OXGA 4HGCA 1BMAA 1CA8B 2BZ6H 4K1TA 4X6NA 1UMAH 1MMJN 1Y59T 3PLKA 1EOLA 2BVXH 1LKBA 1Z71A 4FUJA 3PTNA 5EPYA 4FU9A 3SZNA 1L1GA 1BTZA 1TGNA 2BZAA 2QYIA 3ZZ8A 1GHBG 3O8BA 1L4ZA 3A84A 5LGOA 1FZZA 2VWOA 5E2PA 3UR6A 3SNEA 1DLEA 1V2QT 3BTDE 4Y8YA 1FI8A 1BB0B 4WJG2 3OTJE 1O34A 1GI1A 5AFZH 3RXRA 4Q2KA 1BBRH 4DCDA 2R2WU 1O2SA 4AYYB 4KTCA 1IQNA 2FIRH 2WINI 1A0HB 2IOTA 1GBKA 1VCPA 4TPIZ 3TJOA 2OC8A 1TB6H 4YOIA 5GCHF 3SUGA 1SPJA 1E34B 4WXVA 1FPCH 1C5MD 4Y0ZE 3BEIB 2XNIA 3FZDA 3PYHA 1VITG 1PYTC 1FMGA 1KXEA 5C5NA 1CGJE 5EQQA 3LGTA 1ZLRA 2GMTB 1WUNH 1O3IA 3Q76A 1UJ1A 1V2KT 1CSOE 1O5EH 2AMPA 2R9PA 3SHAH 1L0ZA 1Y8TA 1DM4B 4HI3A 2XC4A 5E0HA 3LIWA 2AEIH 4NFFA 2BD5A 4YOJA 2P3FH 3C1KA 4Y76A 1F0TA 1O2OA 2FI5E 3I29A 3ZV8A 2BXTH 3SJIA 4ASHA 2FOFA 1EZXC 1EJNA 2PUQH 1C4V2 1YPHE 5C20A 2WV4A 1JRTA 2V35A 2GMTC 3RXCA 1GJ4H 1HBTH 1TYNA 4BOHA 2ZP0H 1QURH 1ELBA 1QB9A 1RD3B 1UHBB 1YLDA 2JETB 4Q80A 3ATLA 3HKJB 1CHOG 3E6PH 2Y6TA 3MNBA 1V2MT 4FUHA 4JZEH 1GVLA 5DKMA 3VGCB 1DUAA 1O3NA 1MTSA 3A8CA 2G81E 4AG1A 3RLWH 2P8OB 3M37A 3ZZCA 1V2VT 4MDSA 3MO9A 4BAHB 3GICB 2GTBA 4CH8B 3ZVAA 2WPLS 1TPPA 4X6PA 3URDA 3RMNH 2BTCE 1YPMH 1JMOH 1XXFA 2JETC 3BTHE 4YT6H 3T62A 4XDEA 1AE5A 3A8AA 4SGBE 2B5TB 1V2UT 3W94A 1ZPBA 2J94A 3QZRA 1NC6A 1O33A 4YZUA 3BF6H 1C5VA 5ESBA 1OWDA 4LK4A 2ZKSA 3BTEE 5FXLA 8GCHF 5JBCS 1IQKA 1UTKA 1OPHB 1EPTC 3ZZBA 1XUFA 2ZQ1A 2G55A 1QIXB 2V3OH 2XWBI 3OY5U 4X1PU 1EZSC 1TONA 1T4VH 4AG2A 1KY9A 1UVTH 2J2UA 3TJVA 1O38A 1OYTH 1P57B 4BAOB 1CT4E 1DLKB 1ANBA 6CHAC 1BRUP 2DE8A 1TBQH 5A0CA 8ESTE 1ABJH 4A1TA 1OP0A 2ZU1A 3PB1E 3ZZ7A 2SGDE 3RXEA 3SOSA 3ZVBA 2VGCB 1VGCB 3OU0A 1C5XB 2V0BA 1SGDE 4ISLA 2QN5T 4MNWA 1O3BA 1TE0A 1O2PA 4AGKA 2ZDMA 4OS7A 5A0BA 2VIQA 9ESTA 2BDGA 1NROH 5F8XA 2BYAX 3GY4A 1O32A 1C5RA 3MHWU 1WV7H 3RC4A 2ZO3H 1TBZH 1XUGA 1BBRE 1P10A 1SGCA 4NIWA 3ZYEA 1GJCB 2WYJA 1A5IA 5GWZA 2YNBA 1NRNH 2ZQ2A 4KKDA 4Y79A 4YT7H 4FVBA 3UFAA 1W11U 3T5FH 1C2GA 4YO9A 1IAUA 2Z9KA 4WMEA 1ESAA 1NT1A 4Y8XA 3GCHB 2BVSH 1TQ0B 3L33A 4NWKA 5EXLA 1SL3A 2TGTA 3GCTF 5A09A 3M3SA 2PKAA 3S9CA 3F9EA 1BQYA 4RKOB 1VJAU 1ZGVA 1AGJA 2CN0H 3LDXH 1TRYA 1EJAA 3BTME 2BX3A 4U32A 3P8GA 4CHAB 4KTSA 1QBOA 2GCTC 4CRCA 1EAIA 2FEQH 2WPMS 1IOEA 4F4OC 4FUDA 3GCHC 4THNH 5EQSA 2DUCA 3RXDA 2Q6DA 1RRKA 1W3CA 1DT2A 3A7ZA 2Y5FA 1GI2A 2P95A 4E06H 1SFQB 5DP3A 1TGSZ 1KSNA 2Y80A 2NU4E 2OTVA 2XBXA 1RIWB 1W13U 2ULLA 4XE4A 3U8TH 3BV9B 1CT0E 1N8OB 3LKWA 1ANEA 3SQEE 4BTTB 2PUXB 1DOJA 3BIUH 1L1NA 3ELAH 4A5TS 2O8UA 3BTTE 4H4FA 3M7QA 2ZDKA 5FBEA 1AVWA 1P2JA 1TNGA 1XKAC 2QA9E 1HAVB 4X8SH 4ESTE 1H9IE 4I31A 3TU7H 5JYIA 1XXDA 3LJJA 3PLBA 4I7YH 1QRWA 5JB8S 3RXTA 1P01A 3ZVGA 1ELTA 3I77A 2P3TB 4GVUA 1MTVA 4U2WA 1ARCA 5DP6A 1GBHA 1ANCA 2WUBA 1MBMA 1GMDF 4XFQA 3L6PA 1O3AA 1SR5C 1Z8IB 2VVCA 2ZFQH 4ISIH 4TWYA 3E91A 5DPAA 1Y5AT 3TH4H 2ZTYA 2ZGCA 7LPRA 4AGJA 3GCOA 1P2KA 3RXOA 5JDUB 3M3VA 2B9LA 2ZU4A 3TPIZ 4LZ1H 4R0IA 1EP6A 3GISB 3A7VA 5CMXH 2QAAA 4OS6A 1GJ9B 1WCZA 1QHRB 1UTMA 4CR9A 1L4DA 1V3XA 1AB9B 2GDDA 1C2KA 3SNBA 1CGIE 1C2JA 2NWNA 2ZHWH 2PGQB 2QV1A 4ISHH 2ILNA 3LH1A 1HUTH 2BD8A 4DURA 3F6UH 5EW2H 1S6HA 2D2DA 3UWIA 1O2HA 2TPIZ 1GHVH 1NRQH 5BRRE 3BG8A 1V2PT 2ZC9H 3AW0A 1D3QB 4KP0A 1HIAA 1MZAA 2Y81A 4ABFA 2HRVA 2BD4A 5HYOA 1ZRBA 1O2KA 2PSYA 1YYY1 3FAOA 4I8HA 2Q1JA 3MU0A 3FP6E 2K1QA 5EQRA 1A2CH 4B76A 2A5IA 1E36B 2G52A 1PPGE 3BSQA 1V2OT 2ZPSA 1ZTKA 1GVKB 3U8RH 2SGAA 3D49H 3SU6A 1YPLH 1PQ8A 4FUCA 1SGNE 2BMGB 1VR1H 1QJ6B 3M36A 1P2QA 2BD9A 1TIOA 1JIRA 2PKSB 1ARBA 3NWUA 1TA6A 2ASUB 4I32A 1CBWB 3EAJA 2BDCA 1TGCA 1QGFA 5K7RA 1GJ6A 3QTVH 2W5EA 1QB1A 2D1JA 4GLYA 1MBQA 2FX6A 2ZTZA 2PWXA 3RXBA 5C67A 3NKKA 3TNSA 2FDAA 2XC0A 4VGCB 1MD7A 1BJVA 4DGJA 2AH4X 2ZPQA 3MYWA 1GHZA 1SLUB 3TITA 4IS5A 3V3MA 3SGAE 1JBUH 3ZZ6A 2G4TA 1C2FA 4UFFH 2FESH 1EQ9A 3B9FH 2LNCA 2PKSC 1O5AB 1SFIA 1W0YH 1GDNA 2QXGA 1L1JA 2XCFA 1UCYE 2ZFSA 4TY6A 1UHBA 1GJ8B 4IN1A 2B0FA 2ZCLP 3UOUA 1O2RA 1O0DH 4JZIA 5T6DA 4AFUA 1EPTA 2Y7XA 1GBCA 3A7XA 2A4RA 1DXPA 1SOZA 1P12E 4FUFA 3A7YA 3HATH 4JZDH 1O2IA 2ANKH 4CRAA 3PROA 1P09A 1P3EA 3JZ2B 1F5LA 4YLQH 1NY22 3D62A 1K22H 1ZTJA 4OGXA 2ESTE 1J9CH 1OWJA 3C27B 1EZQA 1BTHH 1WU1A 1TPSA 2AYWA 6ESTA 3N7OA 5HMAA 4INLA 1FUJA 1C5WB 3MU1A 4NGAH 3SJ9A 1G3EA 2GGVB 1SGFG 6GCHF 4BNRA 2AGIX 1S81A 4YOGA 1O2GH 3SV2H 1TNJA 4CR5A 4AOQA 1O3LA 4AZ2B 3P6ZB 1HJ9A 3PWCA 1SGTA 5L6NH 1THSH 5LPRA 2TRMA 1S0RA 1BUIA 1J8AA 3A83A 2FI3E 5G4BA 4BXWA 4AB8A 2GCHF 4JZFH 4A1VA 1YGCH 1N1LA 4DG4A 2UUKB 2BQWB 1BTWA 3RM0H 1QRXA 3EA9A 2KAIB 1LHGH 3PMAB 1LHDH 3QTOH 2A7JA 1P2NA 1VJ9U 1Z8GA 4WF8A 2HNTF 4I33A 4TPYA 2VWMA 3GOVB 3VB3A 4RN6A 2H5CA 1GI5A 3E0PB 2AMDA 1YCPM 1V6DA 1QA0A 2FZZA 4F49A 5L30H 3I78A 5GCHG 3TVJB 1D6WA 4ZHAA 1UVOA 4H6SB 1ZMJA 1NU9A 3V0XA 1P11E 1HJ8A 1AD8H 1WTHD 4NFEA 1SLWB 2ZFFH 2PSXA 2ZGJA 2VB0A 1THPB 2UUFB 3MH5A 2XTTB 4Y71A 1GBFA 3BTQE 1C5TA 1EKBB 5F8ZA 3TK5A 3RLYH 2FWWA 2FM2A 3UTUH 2CHAB 3O8CA 3SW2B 1DWCH 1A0LA 1O5FH 1GBTA 3QX5H 1O3CA 1S5SA 4YM9A 1O3KA 1DXWA 1G3BA 2NU1E 5DP5A 1C5ZB 4O3TA 2AS9A 4U01A 2CXVA 1EAXA 3LPRA 4O9VA 2A1DB 1V2ST 1UCYK 3PLPA 1UK2A 2F9UA 3SV9A 2PTCE 1TX8A 5A2MH 2IN2A 2BLVA 2TIOA 1GG6B 3QN7A 1FNIA 2CHAC 4UD9H 3P17H 1AE8H 1DANH 2ZG0H 3MNXA 1O3EA 1HYLA 5AHGH 1C1OA 4UONA 1BRCE 1DY8A 2FPZA 4R8TB 3TH2H 3EDXB 1LHFH 1IQEA 2F9PA 3GY2A 1B7XB 4ZAEA 4BAQB 4NSVA 2ZCHP 1ZRKA 4BXSA 1C1RA 3ZVFA 5SGAE 4NZLA 1SMFE 1XUHA 3A7TA 2ZFTA 2XBVA 1VITH 1GG6C 1O2LA 1MAXA 5HM2A 4CH2B 1QA7A 1BCUH 1GBEA 2F9VA 1XUJA 2XBWA 1RTFB 1W12U 1S84A 1QCPA 3ITIA 1P9UA 3LC5A 3CP7A 2ZA5A 3IWMA 1ELCA 4X2VA 3RXPA 8GCHG 3KN2A 1HAVA 1D6RA 1BRBE 1ZOMA 1OSSA 2GX4A 2VH0A 2ZDNA 1YCPK 4AN7A 3SORA 1V2WT 3UQVA 2R3YA 3T2NA 2C90B 1K1JA 2H9EH 1MCTA 1GDQA 1FY8E 4XBDA 3K6YA 3FP7E 2V6NA 3RXLA 3K6ZA 3KEEA 4GUXA 2ODQA 2R0LA 2GT8A 2PGBB 3LGYA 1JIMA 4Q7XA 3BG4B 5F03A 1A1RA 4X8UH 1HAYB 1ZPCA 3QGNB 1BTPA 1Z8RA 1GBDA 3B8JA 4K5ZA 1MU8B 1EAWA 1KIGH 1P2OA 1Q31A 4AYVB 4DIHH 2FO9A 1BHXB 2RG3A 5DP7A 1AIXH 1UVSH 1RFNA 1G3CA 1GJAB 3SBKA 4YLUA 1SLXB 1H9LB 3SU1A 1CA0B 2H6MA 2QXHA 3BG4C 1TQ7B 3ZYDA 3CENA 1ZHRA 2BLQA 2VIVA 5LH8A 1VCQA 3CS0A 1GBIA 3SNAA 1KTTB 2FOGA 1YKTA 1W7XH 9LPRA 3DD2H 3TGJE 2J34A 2C8WB 5E0GA 2PR3A 3AAUA 1W8BH 1AFEH 7KMEH 1O3GA 1ZSLA 1W7GH 3GCTG 3M5MA 2D26C 2EI6A 4BTIB 1CA0C 1Q3XA 2BOKA 1O3HA 1KTSB 1LHEH 1ABIH 3VXFH 3RC6A 3SU3A 3QK1A 4HZHA 3VGCC 4ZKRU 1WQVH 3Q3KA 3MU4A 3SJKA 4MNXA 3SUDA 3RXUA 1NTPA 2HVXA 2P8OC 1GVZA 3SNCA 3O8RA 1Y3VA 2G5VA 2BY6X 1TALA 3ODDA 2OBQA 1BA8B 4UEHH 3SV8A 1ESBA 2BDYA 4CRGA 5K0HA 3PO1B 1XMNB 4RSPA 2O8TA 1TX6A 8LPRA 2ZF0H 1HAOH 3RXQA 5DP8A 4K1SA 2QXJA 4DW2U 3ATKA 7ESTE 1WBGB 1HAPH 2QGRA 1QJ1B 1TRNA 3FP8E 1CO7E 2QCYA 2FOMB 2F9NA 5FHTA 1A46H 2QIQA 2ZHQH 1QNJA 1YPGH 3S7HB 1NN6A 3R3GB 1N6XA 1NO9H 1U6QA 3UQOA 5TCAA 3VFEA 3ZZ5A 2NU0E 3LU9B 4JMYA 1BIOA 2ZNKH 3Q00A 1MKWK 2A4GA 1F2SE 1GDUA 1O5CB 2PV9B 3U69H 1HAIH 1E0FD 2Z3CA 2XC5A 3QLPH 3GYLB 4ZXYH 1YLCA 5CHAB 3VB6A 4AB9A 4YTAA 3RXJA 1LMWB 1UVPA 1OWKA 1GMDG 2H5DA 1ID5H 1JRSA 1VGCC 2VGCC 5PTPA 1QBNA 1BMLA 3VB5A 3SJ8A 1F0RA 1EB2A 1KDQA 1CT2E 3P8OA 1K1PA 1NFXA 4D9QA 1P8VC 4FUIA 1GI4A 3A88A 2Y7ZA 3EGKH 1OWIA 1AN1E 3DHKH 4Q7ZA 5T6GA 3GYMA 3Q3XA 3LJOA 3GY8A 3LGUA 4IMZA 3OY6U 3VB4A 1RJXB 1ELEE 1O3FA 2FODA 3M7UA 3NK8A 2ZU5A 3TIUA 1O5GH 2OC1A 1K1OA 1S82A 1G37A 1HXEH 1ZHPA 5EXNA 1IQIA 1HDTH 1TAWA 1ACBE 2CV3A 4TWWA 1ETTH 4OGYA 1SB1H 3BTWE 3CS7A 1TPAE 1FONA 4B2BA 4MPUA 4UFDH 2KAIA 1BTUA 4K1EA 1O2ZA 2P93A 1GI3A 1UCYH 2ALPA 3UREA 1HV7A 3QGJA 2FLBH 2WV5A 1O3DA 2ZHFH 1HNEE 1QB6A 1SI5H 3A85A 1A5GH 1A7SA 2A4OA 1DWDH 4ISNA 2OINA 1MH0A 1C1PA 1K28D 3MOCA 1DICA 1Y3XA 2ZU3A 2XXLA 4JK6A 5J4SA 4CHAC 1AZZA 1NRSH 4RKJB 4M7GA 2RCEA 4IC5A 4IMQA 1S6FA 4FVDA 1ELAA 5T3HA 1HB0B 5I25A 2UWLA 5EPNA 1XX9A 1CU1A 1KXCA 2ZIQH 1FN8A 1VZQH 1O30A 2BDAA 4YESB 3TJNA 5FCKA 1RGQA 3K9XB 4INHA 5EOKA 1OYQA 2C8ZB 2FOAA 3SU0A 1TOMH 1RIWC 1SGRE 5AF9H 1BZXE 4ZHLU 2SGQE 3T27A 1N8OC 1NFYA 4BANB 1T8MA 2VJ1A 5AVDA 1GL0E 3ESTA 4AX9H 3TK6A 1O3OA 1O2TA 1KXAA 3SU5A 3GY6A 4ZROA 2BD7A 1IQFA 1YP9A 2QY0B 3FANA 1YCPH 4XBBA 3UWJH 1CGHA 1GPZA 3M61U 4MQAA 4ABBA 1IQHA 1UTNA 3SV6A 4I8KA 3VPKA 3GDUA
chains in the Genus database with same CATH superfamily
1K21H 2VVUA 3QWCH 4MTBA 2O9QA 2UUJB 2ZI2H 1H1BA 1HAHH 2O8WA 2UUYA 1NFWA 1GGDB 3M5OA 2J5UA 2BY8X 3DT0H 4K3JA 1LO6A 4ABIA 1W10U 2ALVA 3PMJA 3F2FA 4NIYA 3ZZAA 2ODPA 1C2EA 2BDBA 5EJZA 3A8BA 4B2CA 1V2NT 3SUEA 1K9OE 2LELA 1S6LA 2JH6D 4SGAE 1BT7A 2BLOA 3P8FA 1GHAF 1C4Y2 1FIZA 2GZ7A 1A0JA 2A4QA 2G00A 5LPFA 3ZVCA 2BVRH 3ZZ4A 2M5TA 3AASA 3SN8A 3U98H 2EI7A 3KQBA 1AB9C 4AC9A 5L2YH 3A87A 1GGDC 6GCHG 1H8ED 5FCRA 3TH3H 3DSPA 4X2XA 1LQEA 4WMDA 4NSYA 5EU8A 3RMLH 2BX4A 1T4UH 1ZJKA 1Y3YA 3F9GA 3EA7A 3UNQA 2A45B 3RMMH 2GCHG 1C9PA 4KELA 1DS2E 2O8MA 3HKIB 1TA2A 1S83A 3S7KB 5B6OA 1AWHB 2VIWA 1RTLA 2ZWLH 3WY8A 2XCNA 5E8EH 4O03A 1DITH 1JOUB 1SQTA 3CNRA 1H8IH 3ATWA 2SNWA 3UY9A 1HGTH 1FPHH 2BDIA 3SJOA 2A7HA 1ESTA 1ZSKA 1OWEA 1TMBH 2Z3EA 3MQKC 4JYUH 2LPRA 4WXIA 1TNIA 1LPZB 4H42U 2VWNA 1O2XA 3SI4H 4ABDA 4AFSA 5FAHA 1IHSH 2VIDA 3SU4A 2ZPRA 3VEQB 3M3TA 3UOPA 3PM3A 1ETRH 2OC0A 2WPHS 1OP8A 1DPOA 1GI0A 1SGQE 2W26A 3FZZA 3QO6A 1AI8H 1CBWC 2YOLA 1NU7B 3FO8D 4WMFA 1TOCB 4J1YA 3SZEA 3QDZB 2ZFPH 1FJSA 2ZDLA 3U1JB 3E16B 4IBLH 5DO4H 4X1RU 2GT7A 1HJAB 2G51A 4X1QU 4VGCC 4ABJA 1P06A 2A7CA 1AKSB 4IW4E 5FBIA 3NZIA 1GHYH 4D76A 3GCNA 2C93B 1QBVH 2PLXA 1N6YA 3F1SB 4FUGA 1Z1JA 1Q2WA 5DJ7A 1MKWH 3VB7A 2JJ2D 3FFGA 4CRFA 5A8ZA 2CJIA 1BTYA 2Y5HA 2J38A 1QL7A 1MCVA 3ZVEA 4WH6A 1L2EA 2FMJA 1YC0A 5DK1A 5I46H 3SGBE 1J16A 2THFB 3E0NB 3BTKE 2RDLA 4OM9A 1SSXA 2OP9A 4MLFB 3NUMA 4Y6DA 2QXIA 3SU2A 1HCGA 2OQ5A 3LH3A 1AFQB 2VINA 1WOFA 1FIWA 3SYJA 5EG4A 1IQGA 1HAGE 1CVWH 1C2HA 1C5YB 1X7AC 2ZGHA 5IDKA 4J2YB 3V7TA 3ATIA 3H09A 2AFQB 1LVBA 1JXPA 3P92A 1KLJH 4MG3A 3QZQA 4Y7BA 3VG8A 5ABWA 3FN8A 1Z7KA 4NA7A 1P2IA 1GBBA 2F91A 4FUBA 5C1YA 1Z6EA 1ELGA 2P94A 2GZ9A 4HFPB 1LQDB 1GMHG 2PHBA 3TLOA 1J15A 1J17T 1D3PB 1FX0B 1C9TA 5GPIB 3ZV9A 1F0SA 1RTKA 1YPJH 3A81A 3D23A 4X0WU 7GCHF 2HPPH 1QJ7B 2FS9A 3HK3B 3PWBA 3F9HA 5C1XA 2EC9H 3PTBA 1ELDE 2Y5GA 3RDZA 1G3DA 1H9HE 1AQ7A 3H5CB 3EA8A 2VIOA 3BIVH 5DG6A 1T7CA 5EODA 1F0UA 1C2MA 1GCTB 1DVAH 1HAXB 4GCHF 1EFRD 2M2AA 4GSOA 2A5AA 2VWLA 5GDSH 5EGMA 1AO5A 1C1UH 2BOHB 3UIRA 1FY4A 2KCYA 4PROA 1K1MA 4ZKSU 4AFZA 4D9RA 2OLGA 3M5NA 3P8NA 3GY5A 4Q63A 1FN6A 2STBE 2WYGA 1AUJA 1LPKB 2A2XH 3S9AA 4FXGH 2D8WA 2YMSC 1O2QA 4A92A 1E37B 2Z9IA 1ZHMA 4MPWA 3OSYA 4Y10E 1SQAA 4ZHMU 2F3CE 2NU3E 5EW1H 1AVGH 1MU6B 2J98A 4BAKB 1F5KU 3BEFB 1TNHA 3WWBA 3RXIA 4FUEA 3UUZA 1V2TT 2SNVA 1A5HA 2TGPZ 5E2OA 3IG6B 3ZZDA 4NZQA 1LCYA 1FAXA 3KL6A 1QQ4A 1P02A 1DE7H 1OHHD 1AHTH 1ZYOA 1H8DH 4CREA 4GHQA 2HGTH 3OE7D 2F43B 5C0UA 3LT3A 1HLTH 3UNSA 2JJ1D 1B0EA 2W7UA 5DSFA 3W95A 3MO3A 3S0NA 5KECA 3F2GA 3Q77A 1K1NA 1C2DA 1HFDA 1P03A 2G8TA 5FX6A 2H9HA 3GY3A 4INKA 1QFKH 2H2ZA 5IK2D 4KTUA 1GMHF 2JH5D 3P95A 4XRNA 3T25A 1D9IA 1DX5M 3LGVA 5A8XA 2J97A 3H7TA 2Q6FA 1E79D 2ZGXH 1HIAB 2P3UB 3W1EA 1K1IA 3E3TA 1O2UA 3TGIE 1T8LA 1BDAA 2XBYA 1O31A 4KGAA 2ZDVH 3MI4A 3KNXA 1GBLA 1OKXA 1KLTA 1ZMNA 1NESE 3U9AH 1QTFA 4XBCA 3T29A 1ZSJA 4NG9H 1ZJDA 1ZGIA 2HALA 2GV7A 1C5SA 4P02A 1JWTA 1CHGA 4I8GA 1BMMH 3SUFA 1GHWH 2B7DH 1Z8JB 2FXRA 1D3DB 3KIDU 4K2YA 2CF9H 3D65E 2JH0D 5KEDA 3AW1A 1W2KH 1BOQA 2AERH 3A86A 3KGPA 3UPEA 3SQHE 5ETXA 2A32A 4MPXA 2Z7FE 1UTOA 1B0FA 2L74A 1GMCF 1O3MA 3KQCA 4Y8ZA 4E7RG 4A6LA 1G36A 1D3TB 4X2YA 3KQDA 1E1QD 4ABGA 4CBNA 1LVMA 3RXVA 1INCA 1SOTA 2FOBA 5JBTA 1NZQH 1QL9A 3BEUA 1MQ5A 3MMGA 3F68H 3TK9A 3RXFA 1PQ7A 1TMTH 4QT8C 3AVZA 5JPMH 5IYTA 4BTUB 3E1XB 4A7IB 2GZ8A 5FL7D 1TPOA 1AZ8A 2I6QA 2WPIS 1S0QA 4Y11E 1GBAA 1TGBA 1ZPZA 2F83A 3P70B 1GJDB 4O97A 3DFJA 1IQJA 4MNVA 4CRDA 5DGJA 2WV9A 1NPMA 3MO6A 2BDHA 1GHBF 1IQLA 1EPTB 3RXSA 3EE7A 3M7TA 1EAUA 1DSUA 3WWFA 1YPKH 1SGPE 3AAVA 3A8DA 1PQ5A 3KYFA 3KQ5A 1FY1A 4WWYA 1O35A 3GDSA 2AMQA 1SG8B 5CE1A 1Y5BT 5FPSA 1FY3A 4B2AA 1O5BB 4UE7H 1J14A 5F8TA 6CHAB 3RM2H 1XVMA 2A5KA 4NIXA 1DY9A 2QF3A 2HLCA 1C1SA 1EZUC 4X1NU 4U30A 3IITA 1Z1IA 1GWAA 1P0SH 1SGFA 1PFXC 3RXKA 1AMHA 2PFEA 1SLVB 4HTCH 2UWOA 2C8XB 3MH6A 4X2WA 2FOCA 1EP5A 1DSTA 4DIIH 3PV4A 1HXFH 2SGPE 3SHCH 1AVXA 1VITF 2Z9GA 1EX3A 1GL1A 3HGPA 3KF2A 3R0FA 1XM1A 5C2ZA 1F7ZA 1C2LA 3K65B 1C1NA 1KXDA 3ZIAD 1QRZA 2OCVB 1AUTC 2ZHDA 1LVYA 4IGDA 2B8OH 4IC6A 2Z3DA 1A3EH 3PO1C 2BB4A 4OS4A 3RP2A 1GJBB 2Z6BD 2ZECA 4X8TH 3RXAA 3MU5A 1GCDA 1SC8U 2FTLE 2FI4E 1ZMLA 1O39A 2BLWA 2AIQA 1PQAA 2PP6A 1AKSA 3HK6B 4AORA 3V13A 1HAZB 1LTOA 3KCGH 1HPGA 4DJZB 1D4PB 1NM6A 1DWBH 1P04A 1O2JA 2JIZD 4UFGH 1AU8A 3G01A 1FXYA 1NBME 5LPEA 5T6FA 5GIBA 2Q6GA 4H6TA 5HGGA 2CF8H 1H8HD 1BITA 1ANDA 4WY3A 1K1LA 2F9BH 3ZZ3A 1GBMA 1W0KD 2C8YB 4ZH8A 2ZEBA 4ABHA 2C4FH 1TNKA 1CHOF 5CHAC 1Y3UA 1RS0A 2TGAA 1MD8A 3HGNA 1UK3A 2Z9JA 1LVOA 3ODFA 4XOJA 2EQNA 1PYTD 2RA3A 4JYTA 3MH4A 3E8LA 3PMHB 2O8LA 3NXPA 2FTMA 3FOAA 2GCTB 3T26A 5HKKD 1WSSH 2OK5A 1C2IA 2Y82A 4JYVH 4A1XA 4B73A 4D7GA 4TY7A 2VBCA 3DUXH 1DUEA 1TBRH 1B5GH 2V3HH 1GHAG 2J95A 2BD3A 4UFEH 2R2MB 2ZTXA 4GAWA 4I8LA 1C5UA 2H9TH 3O8DA 2VH6A 3MNCA 3MH7A 1H4WA 4CBOA 2GP9B 2ZHEH 3ZZ9A 3ZVDA 1O2NA 4E05H 1GI7B 2A0QB 1E35B 4IN2A 1W0ZU 1MKXK 1FAKH 1FV9A 1ZZZA 2JKHA 4K60A 1SHHB 3DFLA 1BHXF 1KXFA 3MNSA 2JDID 1C1WH 5FPTA 2IPHA 3NPSA 1UK4A 2OQUA 2P59A 4FU8A 3ENSB 1TWXB 1O3PB 2G5NA 3LOXA 3BTGE 4E7NA 1ZTLA 1ORFA 3ATMA 1LPGB 1SGEE 2FYQA 3K2UA 1V2LT 1MTNB 2J92A 1DWEH 3N99A 1C1VH 3Q3YA 3L3TA 1AWFH 1FLEE 3BTFE 4B75A 4X1SU 4JCNA 1FY5A 3EYDA 3DA9B 3B23B 3RUOA 3U1IB 1TNLA 2OXSA 2PW8H 4Y0YE 1K2I1 1GHXH 2A31A 1G9IE 2VIPA 5FX5A 3MU8A 2BM2A 1YBWA 2P16A 5GXPA 1GBJA 2ZZUH 5DP9A 2ANMH 2W3IA 2WPJS 4AFQA 3SGQE 1C5OH 1Y5UT 2FOEA 3RXGA 2UWPA 1MTNC 1TFXA 5C0TA 1IHTH 1YF4A 3KQEA 3TJUA 5B6LA 2ZGBH 1PJPA 1MQ6A 2WUCA 3MTYA 1UTJA 1LDTT 1M9UA 2R3UA 2BY5X 3STJA 4OS5A 5F53A 1DDJA 4CRBA 1O36A 3A82A 3LGIA 2HOBA 2SFAA 4DY7B 1GJ7B 2VNTA 1QL8A 2ZU2A 5EXMA 5JBAS 1WAYB 2G4UA 5JB9S 1ETSH 2XNDD 4MPVA 2I6SA 3VXEH 2HWLB 4Y7AA 6LPRA 1A3BH 1C5NH 1MTUA 1QQUA 1T8NA 4ZKNU 4GHTA 1C5PA 1BBRK 4D7FA 5F6MA 3A80A 1C4U2 1P3CA 2HPQH 4ZUHA 1TRMA 2XRCA 2ZFRH 4JK5A 1A61H 2QF5A 2GD4B 2AGEX 3FKSD 2EEKA 2HNTC 4HG6A 1MAYA 2OD3B 4GPGA 5C3NA 5HXFA 5FPYA 3RU4T 4LXBH 1T31A 1O2VA 3QUMP 1GI9B 1THRH 5C5OA 1O37A 4ZKOU 5EJLA 1WTGH 2DE9A 2IJOB 1QY6A 2OUAA 1OX1A 1XKBC 1O2YA 4NA8A 3NCLA 3TNTA 1OS8A 3F9FA 1QR3E 1WQSA 1F92A 2FX4A 1UW7A 1G2LA 8KME2 3F0OA 1C5QA 1MZDA 1PPFE 1HRTH 1O5DH 2BXUH 3MFJA 2BQ7B 1YLNA 3UR9A 1V2JT 2R0KA 4DVAU 3FVFB 1Z6JH 4DOQA 1YM0A 1RXPA 3KHVA 4B1TA 5J4QA 2GDEH 2C3SA 1G32B 4MNYA 3OYPA 4ZXXH 3RC5A 4LZ4B 4K69A 1EATA 2ZCKP 3SI3H 2FYRA 2XWAA 4NWLA 3PMBB 1PPBH 2EA3A 3E90B 1PPEE 2K0QA 2NU2E 1V2RT 5HM9A 1MTWA 4B71A 5DP4A 2ODYB 5JBBS 1UTLM 1FDPA 4NA9H 4ABAA 7GCHG 3UNRA 3A7WA 1UTPA 4DT7B 4Z6AH 1UTQA 1A4WH 2FOHA 2PTNA 4ZMAH 4X6MA 1ELVA 3KYGA 2XYAA 2A2QH 4LOYH 2W7SA 3STIA 2AHME 3RXMA 1C1TA 1F5RA 2STAE 3GY7A 1XUIA 3N7DA 4GCHG 2ANYA 1GI8B 1P05A 1OOKB 1T8OA 2FS8A 2Z9LA 3TGKE 2J4IA 3GDVA 1TX7A 4P00A 4Z0KA 1G2MA 2QC2A 4Q7YA 5A0AE 4B74A 5BPEA 4OS1A 1O2WA 1NRRH 2VU8E 1PPCE 1UVUH 2SGFE 1SVPA 3LGWA 1DFPA 1LHCH 1EJMA 3DCLA 3M5LA 1HJAC 2EI8A 2GJGA 1KDQB 1TGTA 5ESTE 1CE5A 5A8YA 1AY6H 1P2MA 4ACAA 2CGAA 1S85A 1C1QA 4I8JA 1NFUA 3SNDA 1ZR0A 1BJUA 2TBSA 1GJ5H 2GVFA 1SQOA 5TJXA 2BQ6B 2ANWA 2FLRH 2VVVA 4O3UA 2BHGA 1FQ3A 2PKAB 1SGIB 1YPEH 2SGEE 1EASA 2GV6A 1PPHE 4NIVA 1YPHC 1UO6A 1P9SA 1T32A 5AFYH 2TGDA 3LC3A 3RMOH 4JZ1A 3HPTB 1IQMA 3JZ1B 1BMNH 4MVNA 1OWHA 4X6OA 1KYNA 1AFQC 2RA0A 1TABE 3SV7A 4ABEA 4XSKU 1EOJA 3H7OA 3V12A 4D8NA 4M9FA 4BAMB 1NS3A 4K8YA 2AIPA 4NCYA 3S9BA 1WYKA 2WPKS 4FU7A 1GI6A 1E38B 1EB1H 2BY9X 2W6JD 1G30B 1VCWA 2BD2A 4X8VH 3URCA 1OP2A 2AGGX 4WVPE 2Z94A 5TCCA 5CHBA 4F48B 3A89A 3MWIU 4TYDA 1O3JA 1MKXH 2YNAA 2CMYA 3SO3A 3M35A 1SBWA 3U8OH 1C1MA 1TLDA 4B6EA 3RU4D 5GJ4B 5E0JA 4TT3D 2XOKD 1EXFA 3EQ0H 2W6ID 2KCOA 4K8BA 2HNTE 1XUKA 1CQQA 2XW9A 1EUFA 1KLIH 2HLDD 2FP7B 1ELFA 1MUEB 1XVOA 3LONA 1SHYA 1Y3WA 4WH8A 5H4IB 1W14U 3OX7U 1O2MA 2QF0A 1NRPH 1MABB 2GKVE 1GMCG 2OBOA 3RU4E 3S69A 4FETA 4UDWH 1LKAA 3EE0B 2H1UA 3PV2A 3BN9A 4OS2A 2OC7A 2BY7X 1KXBA 2W3KA 3RXHA 1GCTC 2ZDAH 1TMUH 2J9NA 1C5LH 5L2ZH 2F9OA 1BRAA 1BTXA 1SGYE 4ISOA 1WXRA 5C1UA 2QE7D 1PPZA 3T28A 1OXGA 4FOUC 4HGCA 1BMAA 1CA8B 2BZ6H 4K1TA 4X6NA 1UMAH 1MMJN 1Y59T 3PLKA 1EOLA 2BVXH 1LKBA 1Z71A 4FUJA 3PTNA 5EPYA 3PRBA 4FU9A 1L1GA 3SZNA 3OEED 1BTZA 1TGNA 2BZAA 2QYIA 3ZZ8A 1GHBG 1VKYA 3O8BA 1L4ZA 3A84A 5LGOA 1FZZA 2VWOA 5E2PA 3UR6A 3SNEA 1DLEA 1V2QT 3BTDE 4Y8YA 1FI8A 1BB0B 4WJG2 3OTJE 1O34A 1GI1A 5AFZH 3RXRA 4Q2KA 1BBRH 2WHXA 2R2WU 1O2SA 4AYYB 4DCDA 4KTCA 1IQNA 2FIRH 2WINI 1A0HB 2KR7A 2IOTA 1GBKA 2V3MA 1VCPA 4TPIZ 3TJOA 2OC8A 1TB6H 4YOIA 5GCHF 3SUGA 1SPJA 1E34B 4WXVA 1FPCH 1C5MD 4Y0ZE 3BEIB 2XNIA 3FZDA 3PYHA 1VITG 1PYTC 1FMGA 1KXEA 5C5NA 1CGJE 5EQQA 3LGTA 1ZLRA 2GMTB 1WUNH 1O3IA 3Q76A 1UJ1A 1V2KT 1CSOE 1O5EH 2AMPA 2R9PA 3SHAH 1L0ZA 1Y8TA 1DM4B 4HI3A 2XC4A 5E0HA 3LIWA 2AEIH 4NFFA 2BD5A 4YOJA 2P3FH 3C1KA 4Y76A 1F0TA 1O2OA 2FI5E 3I29A 3ZV8A 2BXTH 3SJIA 4ASHA 2FOFA 1EZXC 1EJNA 2PUQH 1C4V2 1YPHE 5C20A 2WV4A 1JRTA 2V35A 2GMTC 3RXCA 1GJ4H 1HBTH 1TYNA 4BOHA 2ZP0H 5CDFE 1QURH 1ELBA 1QB9A 1RD3B 1UHBB 1YLDA 2JETB 4Q80A 3ATLA 5C94A 3HKJB 1CHOG 3E6PH 2Y6TA 3MNBA 1V2MT 4FUHA 4JZEH 1GVLA 5DKMA 3VGCB 1DUAA 1O3NA 2WSSD 1MTSA 3A8CA 2G81E 4AG1A 3N7EA 3RLWH 2P8OB 3M37A 3ZZCA 3WW7A 1V2VT 4MDSA 3MO9A 4BAHB 3GICB 2GTBA 4CH8B 3ZVAA 2WPLS 1TPPA 4X6PA 3URDA 3RMNH 2BTCE 1YPMH 1JMOH 1XXFA 2JETC 3BTHE 4YT6H 3T62A 4XDEA 1AE5A 3A8AA 4SGBE 2B5TB 1V2UT 3W94A 1ZPBA 2J94A 3QZRA 1NC6A 1O33A 4YZUA 3BF6H 1C5VA 5ESBA 1OWDA 4LK4A 2ZKSA 3BTEE 5FXLA 8GCHF 5JBCS 1IQKA 1UTKA 1OPHB 1EPTC 3ZZBA 1XUFA 2ZQ1A 2G55A 1QIXB 2V3OH 2XWBI 3OY5U 4X1PU 1EZSC 2YMSD 1TONA 1T4VH 4AG2A 1KY9A 1UVTH 2J2UA 3TJVA 1O38A 1OYTH 1P57B 4BAOB 1CT4E 1DLKB 1ANBA 6CHAC 1BRUP 2DE8A 1TBQH 5A0CA 8ESTE 1ABJH 4A1TA 1OP0A 2ZU1A 3PB1E 3ZZ7A 2SGDE 3RXEA 3SOSA 3ZVBA 2VGCB 1VGCB 3OU0A 1C5XB 2V0BA 1SGDE 4ISLA 2QN5T 4MNWA 1O3BA 1TE0A 1O2PA 4AGKA 2ZDMA 4OS7A 5A0BA 2VIQA 2WPDD 9ESTA 2BDGA 3DSOA 1NROH 5F8XA 2BYAX 3GY4A 2CK3D 2EY4C 1O32A 1C5RA 3MHWU 1WV7H 3RC4A 2ZO3H 1TBZH 1XUGA 1BBRE 1P10A 1SGCA 4NIWA 3ZYEA 1GJCB 4ACBA 2WYJA 1A5IA 5GWZA 2YNBA 1NRNH 2KCPA 2ZQ2A 4KKDA 4Y79A 4YT7H 4FVBA 3UFAA 1W11U 3T5FH 1C2GA 1BMFD 4YO9A 1IAUA 2Z9KA 4WMEA 1ESAA 1NT1A 3F0PA 4Y8XA 3GCHB 2BVSH 1TQ0B 3L33A 4NWKA 5EXLA 1SL3A 2TGTA 3GCTF 1COWD 5A09A 3M3SA 2PKAA 3S9CA 3F9EA 1BQYA 4RKOB 1VJAU 1ZGVA 1AGJA 2CN0H 3LDXH 1TRYA 1EJAA 3BTME 2BX3A 4U32A 3P8GA 4CHAB 4KTSA 1QBOA 2GCTC 4CRCA 1EAIA 2FEQH 2WPMS 1IOEA 4F4OC 4FUDA 3GCHC 4I86A 4THNH 5EQSA 2DUCA 3RXDA 2Q6DA 1RRKA 1W3CA 1DT2A 2RFKC 3A7ZA 2Y5FA 4ZCNA 1GI2A 2P95A 4E06H 4ASUD 1SFQB 5DP3A 1TGSZ 1KSNA 2Y80A 2NU4E 2OTVA 2XBXA 1RIWB 1W13U 2ULLA 4XE4A 2WZQA 3U8TH 3BV9B 1CT0E 1N8OB 3LKWA 1ANEA 3SQEE 4BTTB 2PUXB 1DOJA 3BIUH 1L1NA 3ELAH 4A5TS 2O8UA 3BTTE 4H4FA 3M7QA 2ZDKA 5FBEA 1AVWA 1P2JA 1TNGA 1XKAC 2QA9E 1HAVB 4X8SH 4ESTE 1H9IE 4I31A 3TU7H 5JYIA 1XXDA 3LJJA 3PLBA 4I7YH 3OAAD 1QRWA 5JB8S 3RXTA 1P01A 3ZVGA 2V7QD 1ELTA 3I77A 2P3TB 4GVUA 1MTVA 4U2WA 1ARCA 5DP6A 1GBHA 1ANCA 2WUBA 1MBMA 1GMDF 4XFQA 3L6PA 1O3AA 1SR5C 1Z8IB 2VVCA 2ZFQH 4ISIH 4TWYA 3E91A 5DPAA 1Y5AT 3TH4H 2F4LA 2ZTYA 4DT4A 2ZGCA 7LPRA 4AGJA 3GCOA 1P2KA 3RXOA 5JDUB 3M3VA 2B9LA 2ZU4A 3TPIZ 4LZ1H 4R0IA 1EP6A 3GISB 3A7VA 4TSFD 5CMXH 2QAAA 4OS6A 1GJ9B 1WCZA 1QHRB 1UTMA 4CR9A 1L4DA 1V3XA 1AB9B 2GDDA 1C2KA 3SNBA 1CGIE 1C2JA 2NWNA 2ZHWH 2PGQB 2QV1A 4ISHH 2ILNA 3LH1A 1HUTH 2BD8A 4DURA 3F6UH 5EW2H 1S6HA 2D2DA 3UWIA 1O2HA 2TPIZ 1GHVH 4RT1A 1NRQH 1SQRA 5BRRE 3BG8A 1V2PT 2ZC9H 3AW0A 1D3QB 4KP0A 1HIAA 1MZAA 1WDIA 2Y81A 4ABFA 2HRVA 2BD4A 5HYOA 1ZRBA 1O2KA 2PSYA 1YYY1 3FAOA 4I8HA 2Q1JA 3MU0A 3FP6E 2K1QA 5EQRA 1A2CH 4B76A 2A5IA 1E36B 2G52A 1PPGE 3BSQA 1V2OT 2ZPSA 1ZTKA 1GVKB 3U8RH 2SGAA 3D49H 3SU6A 1YPLH 1PQ8A 4FUCA 1SGNE 2BMGB 1VR1H 1QJ6B 3M36A 1P2QA 2BD9A 1TIOA 1JIRA 2PKSB 1ARBA 3NWUA 1TA6A 2ASUB 4I32A 1CBWB 3EAJA 2BDCA 1TGCA 1QGFA 5K7RA 1GJ6A 3QTVH 2W5EA 1QB1A 2D1JA 4GLYA 1MBQA 2FX6A 2ZTZA 2PWXA 3RXBA 5C67A 3NKKA 3TNSA 2FDAA 2XC0A 4VGCB 1MD7A 1BJVA 3UB0A 4DGJA 2AH4X 2ZPQA 3MYWA 1GHZA 1SLUB 3TITA 4IS5A 3V3MA 3SGAE 1JBUH 3ZZ6A 2G4TA 1C2FA 4UFFH 2FESH 1EQ9A 4Z1MD 3B9FH 2LNCA 2PKSC 1O5AB 1SFIA 1W0YH 3DSGA 1GDNA 3GS9A 2QXGA 1L1JA 2XCFA 1UCYE 2ZFSA 4TY6A 1UHBA 1GJ8B 4IN1A 2B0FA 2ZCLP 3UOUA 1O2RA 1O0DH 4JZIA 5T6DA 4AFUA 1K0HA 1EPTA 2Y7XA 1GBCA 3A7XA 2A4RA 1DXPA 1SOZA 1P12E 5HIZA 4FUFA 3A7YA 3HATH 4JZDH 1O2IA 2ANKH 4CRAA 5EJ1A 3PROA 1P09A 1P3EA 3JZ2B 1F5LA 4YLQH 1NY22 3D62A 1K22H 1ZTJA 4OGXA 2ESTE 1J9CH 1OWJA 3C27B 1EZQA 1BTHH 1WU1A 1TPSA 2AYWA 6ESTA 3N7OA 5HMAA 4INLA 2KX4A 1FUJA 1C5WB 3MU1A 4NGAH 3SJ9A 1G3EA 2GGVB 1SGFG 6GCHF 4BNRA 2AGIX 1S81A 4YOGA 1O2GH 3SV2H 1TNJA 4CR5A 4AOQA 1O3LA 4AZ2B 3P6ZB 1HJ9A 3PWCA 1SGTA 5L6NH 1THSH 5LPRA 2TRMA 1S0RA 1BUIA 1J8AA 3A83A 2FI3E 5G4BA 4BXWA 4AB8A 2GCHF 4JZFH 4A1VA 1YGCH 1N1LA 4DG4A 1E1RD 2UUKB 2BQWB 1BTWA 3RM0H 1QRXA 3EA9A 2KAIB 1LHGH 3PMAB 1LHDH 3QTOH 2A7JA 1P2NA 1VJ9U 1Z8GA 4WF8A 2HNTF 4I33A 3NRLA 5HIYA 4TPYA 2VWMA 3GOVB 3VB3A 4RN6A 2H5CA 1GI5A 3E0PB 2AMDA 1YCPM 1V6DA 1QA0A 2FZZA 4F49A 2IJD1 5L30H 3I78A 5GCHG 3TVJB 1D6WA 4ZHAA 1UVOA 4H6SB 2QF4A 1ZMJA 1NU9A 3V0XA 1P11E 1HJ8A 1AD8H 1WTHD 4NFEA 1SLWB 2ZFFH 3OTPA 2PSXA 2ZGJA 2VB0A 1THPB 2UUFB 3MH5A 2XTTB 4Y71A 2YMSB 1GBFA 3BTQE 1C5TA 1EKBB 5F8ZA 3TK5A 3RLYH 2FWWA 2FM2A 3UTUH 2CHAB 3O8CA 3SW2B 1DWCH 1A0LA 1O5FH 1GBTA 3QX5H 1O3CA 1S5SA 4YM9A 1O3KA 1DXWA 1G3BA 2NU1E 5DP5A 1C5ZB 4O3TA 2AS9A 4U01A 2K8IA 2CXVA 1EAXA 3LPRA 4O9VA 2A1DB 1V2ST 1UCYK 3PLPA 1UK2A 2F9UA 3SV9A 2PTCE 1TX8A 5A2MH 2IN2A 2BLVA 2TIOA 1GG6B 3QN7A 1FNIA 2CHAC 4UD9H 3P17H 1AE8H 1DANH 2ZG0H 3MNXA 1O3EA 1HYLA 5AHGH 1C1OA 4UONA 1BRCE 3OEHD 1DY8A 2FPZA 4R8TB 3TH2H 3EDXB 1LHFH 1IQEA 2F9PA 3GY2A 1B7XB 4ZAEA 4BAQB 4NSVA 2ZCHP 2KCAA 5EIYA 1ZRKA 4BXSA 1C1RA 3ZVFA 5SGAE 4NZLA 1SMFE 1XUHA 3A7TA 2ZFTA 2XBVA 1VITH 1GG6C 1O2LA 1MAXA 5HM2A 4CH2B 2RDEA 1QA7A 1BCUH 1GBEA 2F9VA 1XUJA 2XBWA 1RTFB 1W12U 1S84A 1QCPA 3ITIA 1P9UA 3LC5A 3CP7A 2ZA5A 3IWMA 1ELCA 4X2VA 3RXPA 8GCHG 3KN2A 1HAVA 1D6RA 1BRBE 1ZOMA 1OSSA 2GX4A 2VH0A 2ZDNA 1YCPK 4AN7A 3SORA 1V2WT 3UQVA 2R3YA 3T2NA 2C90B 1K1JA 2H9EH 1MCTA 1GDQA 1FY8E 4XBDA 3K6YA 3FP7E 2V6NA 3RXLA 3K6ZA 3KEEA 4GUXA 2ODQA 2R0LA 2GT8A 2PGBB 3LGYA 1JIMA 4Q7XA 3BG4B 5F03A 1A1RA 4X8UH 1HAYB 1ZPCA 3QGNB 1BTPA 1Z8RA 1GBDA 3B8JA 4K5ZA 1MU8B 1EAWA 3F3BA 1KIGH 1P2OA 3AK5A 1Q31A 4AYVB 4DIHH 2FO9A 1BHXB 2RG3A 5DP7A 1AIXH 1UVSH 1RFNA 1G3CA 1GJAB 3SBKA 4YLUA 1SLXB 1H9LB 3SU1A 1CA0B 2H6MA 2QXHA 3BG4C 1TQ7B 3ZYDA 3CENA 1ZHRA 2BLQA 2VIVA 5LH8A 1VCQA 3CS0A 1GBIA 3SNAA 1KTTB 2FOGA 1YKTA 1W7XH 9LPRA 3DD2H 3TGJE 2J34A 2C8WB 5E0GA 2PR3A 3AAUA 1W8BH 1AFEH 7KMEH 1O3GA 1ZSLA 1W7GH 3GCTG 5C17A 3M5MA 2D26C 2HVYB 2EI6A 4BTIB 2LP6A 1CA0C 1Q3XA 2BOKA 1O3HA 1KTSB 1LHEH 1ABIH 3VXFH 3RC6A 3SU3A 4YXWD 3QK1A 4HZHA 3VGCC 4ZKRU 1WQVH 3Q3KA 3MU4A 2IPQX 3SJKA 4MNXA 3SUDA 3RXUA 1NTPA 2HVXA 2P8OC 1GVZA 3SNCA 3O8RA 1Y3VA 2G5VA 2BY6X 1TALA 3ODDA 2OBQA 1BA8B 4UEHH 3SV8A 1ESBA 2BDYA 4CRGA 4Q4LA 5K0HA 3PO1B 1XMNB 4RSPA 2O8TA 1TX6A 8LPRA 2ZF0H 1HAOH 5T1VA 5DP8A 3RXQA 4K1SA 2QXJA 4DW2U 3ATKA 7ESTE 1WBGB 1HAPH 2QGRA 1QJ1B 1TRNA 3FP8E 1CO7E 2QCYA 4XD7D 2FOMB 2F9NA 5FHTA 1A46H 1KMHB 2QIQA 1QNJA 1YPGH 2ZHQH 5DN6D 3S7HB 1NN6A 3R3GB 1N6XA 1NO9H 1U6QA 3UQOA 5TCAA 3VFEA 3ZZ5A 2NU0E 3LU9B 4JMYA 1BIOA 2ZNKH 3Q00A 1MKWK 2A4GA 1F2SE 1GDUA 1O5CB 2PV9B 3U69H 1HAIH 1E0FD 1W0JD 2Z3CA 2XC5A 3QLPH 3GYLB 4ZXYH 3UAIC 1YLCA 1NBMD 3F2HA 5CHAB 3U28C 3VB6A 4AB9A 4YTAA 3RXJA 1LMWB 1UVPA 1OWKA 1GMDG 2H5DA 1ID5H 1JRSA 1VGCC 2VGCC 5PTPA 1QBNA 1BMLA 3VB5A 3SJ8A 1F0RA 1EB2A 1KDQA 1CT2E 3P8OA 1K1PA 1NFXA 4D9QA 1P8VC 4FUIA 1GI4A 1YY3A 3A88A 2Y7ZA 5GNDA 5KGOA 3EGKH 1OWIA 1AN1E 3DHKH 4Q7ZA 2KM0A 3GYMA 5T6GA 3Q3XA 3PV5A 3LJOA 3GY8A 3LGUA 4IMZA 3OY6U 3VB4A 1RJXB 1ELEE 1O3FA 2FODA 3M7UA 3NK8A 2ZU5A 3TIUA 1O5GH 2OC1A 1K1OA 1S82A 1G37A 1HXEH 1ZHPA 5EXNA 1IQIA 1HDTH 1TAWA 1ACBE 2CV3A 4TWWA 1ETTH 4OGYA 1SB1H 3BTWE 3CS7A 1TPAE 1FONA 3PRDA 4B2BA 4MPUA 2J98B 4UFDH 2KAIA 1BTUA 4F55A 4K1EA 1O2ZA 2P93A 1GI3A 1UCYH 2ALPA 3UREA 4RI0A 1HV7A 3QGJA 2FLBH 2WV5A 1O3DA 2ZHFH 1HNEE 1QB6A 1SI5H 3A85A 1A5GH 1A7SA 2A4OA 1DWDH 4ISNA 2OINA 1MH0A 1C1PA 1K28D 3OFND 3MOCA 1DICA 1Y3XA 2ZU3A 2XXLA 4JK6A 5J4SA 1QZ8A 4CHAC 1AZZA 1NRSH 4B6FA 4RKJB 4M7GA 2RCEA 4IC5A 4IMQA 1S6FA 4FVDA 1ELAA 5T3HA 1HB0B 5I25A 2UWLA 5EPNA 1XX9A 1CU1A 1KXCA 2ZIQH 1FN8A 1VZQH 1O30A 2BDAA 4YESB 3TJNA 5FCKA 1RGQA 3K9XB 4INHA 5EOKA 1OYQA 2C8ZB 2FOAA 3SU0A 1TOMH 1SKYE 1RIWC 1SGRE 5AF9H 1BZXE 4ZHLU 2SGQE 3T27A 1N8OC 1NFYA 4BANB 1T8MA 2VJ1A 5AVDA 1GL0E 3ESTA 4AX9H 3TK6A 2KFWA 1O3OA 1O2TA 1KXAA 3SU5A 3GY6A 4ZROA 2BD7A 1IQFA 1YP9A 2QY0B 3FANA 1YCPH 4XBBA 2L6OA 3UWJH 1CGHA 1GPZA 3M61U 4MQAA 4ABBA 1IQHA 1UTNA 1YWUA 3SV6A 4RT0A 2KZ4A 4I8KA 3VPKA 3GDUA
chains in the Genus database with same CATH topology
1K21H 2VVUA 3QWCH 4MTBA 2O9QA 2UUJB 2ZI2H 1H1BA 1HAHH 2O8WA 2UUYA 1NFWA 1GGDB 3M5OA 2BY8X 3DT0H 4K3JA 1LO6A 4ABIA 1W10U 2ALVA 3PMJA 4NIYA 3ZZAA 2ODPA 1C2EA 2BDBA 3A8BA 4B2CA 1V2NT 3SUEA 1K9OE 4SGAE 2JH6D 1BT7A 2BLOA 3P8FA 1GHAF 1C4Y2 1FIZA 2GZ7A 1A0JA 2A4QA 2G00A 5LPFA 3ZVCA 2BVRH 3ZZ4A 2M5TA 3AASA 3SN8A 3U98H 2EI7A 3KQBA 1AB9C 5L2YH 3A87A 1GGDC 6GCHG 5FCRA 3TH3H 4X2XA 1LQEA 4WMDA 4NSYA 5EU8A 3RMLH 2BX4A 1T4UH 1ZJKA 1Y3YA 3F9GA 3EA7A 3UNQA 2A45B 3RMMH 2GCHG 1C9PA 4KELA 1DS2E 2O8MA 3HKIB 1TA2A 1S83A 3S7KB 5B6OA 1AWHB 2VIWA 1RTLA 2ZWLH 3WY8A 2XCNA 5E8EH 4O03A 1DITH 1JOUB 1SQTA 1H8IH 3ATWA 2SNWA 3UY9A 1HGTH 1FPHH 2BDIA 3SJOA 2A7HA 1ESTA 1ZSKA 1OWEA 1TMBH 2Z3EA 4JYUH 2LPRA 4WXIA 1TNIA 1LPZB 4H42U 2VWNA 1O2XA 3SI4H 4ABDA 4AFSA 5FAHA 1IHSH 2VIDA 3SU4A 2ZPRA 3VEQB 3M3TA 3UOPA 3PM3A 1ETRH 2OC0A 2WPHS 1OP8A 1DPOA 1GI0A 1SGQE 2W26A 3FZZA 3QO6A 1AI8H 1CBWC 2YOLA 1NU7B 4WMFA 1TOCB 4J1YA 3QDZB 2ZFPH 1FJSA 2ZDLA 3U1JB 3E16B 4IBLH 5DO4H 4X1RU 2GT7A 1HJAB 2G51A 4X1QU 4VGCC 4ABJA 1P06A 2A7CA 1AKSB 4IW4E 5FBIA 3NZIA 1GHYH 4D76A 3GCNA 2C93B 1QBVH 2PLXA 1N6YA 3F1SB 4FUGA 1Z1JA 1Q2WA 5DJ7A 1MKWH 3VB7A 3FFGA 4CRFA 5A8ZA 2CJIA 1BTYA 2Y5HA 2J38A 1QL7A 1MCVA 3ZVEA 4WH6A 1L2EA 2FMJA 1YC0A 5DK1A 5I46H 3SGBE 1J16A 2THFB 3E0NB 3BTKE 2RDLA 1SSXA 2OP9A 4MLFB 3NUMA 4Y6DA 2QXIA 3SU2A 1HCGA 2OQ5A 3LH3A 1AFQB 2VINA 1WOFA 1FIWA 5EG4A 1IQGA 1HAGE 1CVWH 1C2HA 1C5YB 1X7AC 2ZGHA 5IDKA 4J2YB 3V7TA 3ATIA 2AFQB 1LVBA 1JXPA 3P92A 1KLJH 4MG3A 3QZQA 4Y7BA 5ABWA 1Z7KA 4NA7A 1P2IA 1GBBA 2F91A 4FUBA 5C1YA 1Z6EA 1ELGA 2P94A 2GZ9A 4HFPB 1LQDB 1GMHG 2PHBA 3TLOA 1J15A 1J17T 1D3PB 1C9TA 5GPIB 3ZV9A 1F0SA 1RTKA 1YPJH 3A81A 3D23A 4X0WU 7GCHF 2HPPH 1QJ7B 2FS9A 3HK3B 3PWBA 3F9HA 5C1XA 2EC9H 3PTBA 1ELDE 2Y5GA 3RDZA 1G3DA 1H9HE 1AQ7A 3H5CB 3EA8A 2VIOA 3BIVH 5DG6A 1T7CA 5EODA 1F0UA 1C2MA 1GCTB 1DVAH 1HAXB 4GCHF 4GSOA 2A5AA 2VWLA 5GDSH 5EGMA 1AO5A 1C1UH 2BOHB 3UIRA 1FY4A 4PROA 1K1MA 4ZKSU 4AFZA 4D9RA 2OLGA 3M5NA 3P8NA 3GY5A 1FN6A 2STBE 2WYGA 1AUJA 1LPKB 2A2XH 3S9AA 4FXGH 2D8WA 1O2QA 4A92A 1E37B 2Z9IA 1ZHMA 4MPWA 3OSYA 4Y10E 1SQAA 4ZHMU 2F3CE 2NU3E 5EW1H 1AVGH 1MU6B 4BAKB 1F5KU 3BEFB 1TNHA 3RXIA 4FUEA 3UUZA 1V2TT 2SNVA 1A5HA 2TGPZ 5E2OA 3IG6B 3ZZDA 4NZQA 1LCYA 1FAXA 3KL6A 1QQ4A 1P02A 1DE7H 1ZYOA 1AHTH 1H8DH 4CREA 4GHQA 2HGTH 3LT3A 1HLTH 3UNSA 1B0EA 2W7UA 3W95A 3MO3A 3S0NA 3Q77A 1K1NA 1C2DA 1HFDA 1P03A 2G8TA 5FX6A 2H9HA 3GY3A 4INKA 1QFKH 2H2ZA 4KTUA 1GMHF 2JH5D 3P95A 3T25A 1D9IA 1DX5M 3LGVA 5A8XA 3H7TA 2Q6FA 2ZGXH 1HIAB 2P3UB 1K1IA 3E3TA 1O2UA 3TGIE 1T8LA 1BDAA 2XBYA 1O31A 4KGAA 2ZDVH 3MI4A 3KNXA 1GBLA 1OKXA 1KLTA 1ZMNA 1NESE 3U9AH 1QTFA 4XBCA 3T29A 1ZSJA 4NG9H 1ZJDA 1ZGIA 2HALA 2GV7A 1C5SA 1JWTA 1CHGA 4I8GA 1BMMH 3SUFA 1GHWH 2B7DH 1Z8JB 2FXRA 1D3DB 3KIDU 4K2YA 2CF9H 3D65E 2JH0D 3AW1A 1W2KH 1BOQA 2AERH 3A86A 3KGPA 3UPEA 3SQHE 5ETXA 2A32A 4MPXA 2Z7FE 1UTOA 1B0FA 1GMCF 1O3MA 3KQCA 4Y8ZA 4E7RG 4A6LA 1G36A 1D3TB 4X2YA 3KQDA 4ABGA 4CBNA 1LVMA 3RXVA 1INCA 1SOTA 2FOBA 5JBTA 1NZQH 1QL9A 3BEUA 1MQ5A 3MMGA 3F68H 3TK9A 3RXFA 1PQ7A 1TMTH 4QT8C 3AVZA 5JPMH 5IYTA 4BTUB 3E1XB 4A7IB 2GZ8A 1TPOA 1AZ8A 2I6QA 2WPIS 1S0QA 4Y11E 1GBAA 1TGBA 1ZPZA 2F83A 3P70B 1GJDB 4O97A 3DFJA 1IQJA 4MNVA 4CRDA 5DGJA 1NPMA 3MO6A 2BDHA 1GHBF 1IQLA 1EPTB 3RXSA 3M7TA 1EAUA 1DSUA 1YPKH 1SGPE 3AAVA 3A8DA 1PQ5A 1FY1A 4WWYA 1O35A 3GDSA 2AMQA 1SG8B 5CE1A 1Y5BT 5FPSA 1FY3A 4B2AA 1O5BB 4UE7H 1J14A 5F8TA 6CHAB 3RM2H 1XVMA 2A5KA 4NIXA 1DY9A 2QF3A 2HLCA 1C1SA 1EZUC 4X1NU 4U30A 3IITA 1Z1IA 1GWAA 1P0SH 1SGFA 1PFXC 3RXKA 1AMHA 2PFEA 1SLVB 4HTCH 2UWOA 2C8XB 3MH6A 4X2WA 2FOCA 1EP5A 1DSTA 4DIIH 3PV4A 1HXFH 2SGPE 3SHCH 1AVXA 1VITF 2Z9GA 1EX3A 1GL1A 3HGPA 3KF2A 3R0FA 1XM1A 5C2ZA 1F7ZA 1C2LA 3K65B 1C1NA 1KXDA 2OCVB 1QRZA 1AUTC 2ZHDA 1LVYA 4IGDA 2B8OH 4IC6A 2Z3DA 1A3EH 3PO1C 2BB4A 4OS4A 3RP2A 1GJBB 2Z6BD 2ZECA 4X8TH 3RXAA 3MU5A 1GCDA 1SC8U 2FTLE 2FI4E 1ZMLA 1O39A 2BLWA 2AIQA 1PQAA 1AKSA 3HK6B 4AORA 3V13A 1HAZB 1LTOA 3KCGH 1HPGA 4DJZB 1D4PB 1NM6A 1DWBH 1P04A 1O2JA 4UFGH 1AU8A 3G01A 1FXYA 5LPEA 5T6FA 5GIBA 2Q6GA 4H6TA 5HGGA 2CF8H 1BITA 1ANDA 4WY3A 1K1LA 2F9BH 3ZZ3A 1GBMA 2C8YB 4ZH8A 2ZEBA 4ABHA 2C4FH 1TNKA 1CHOF 5CHAC 1Y3UA 1RS0A 2TGAA 1MD8A 3HGNA 1UK3A 2Z9JA 1LVOA 3ODFA 4XOJA 1PYTD 2RA3A 4JYTA 3MH4A 3E8LA 3PMHB 2O8LA 3NXPA 2FTMA 2GCTB 3T26A 1WSSH 1C2IA 2Y82A 4JYVH 4A1XA 4B73A 4D7GA 4TY7A 3DUXH 1DUEA 1TBRH 1B5GH 2V3HH 1GHAG 2J95A 2BD3A 4UFEH 2R2MB 2ZTXA 4GAWA 4I8LA 1C5UA 2H9TH 3O8DA 2VH6A 3MNCA 3MH7A 1H4WA 4CBOA 2GP9B 2ZHEH 3ZZ9A 3ZVDA 1O2NA 4E05H 1GI7B 2A0QB 1E35B 4IN2A 1W0ZU 1MKXK 1FAKH 1FV9A 1ZZZA 2JKHA 4K60A 1SHHB 3DFLA 1BHXF 1KXFA 3MNSA 1C1WH 5FPTA 2IPHA 3NPSA 1UK4A 2OQUA 2P59A 4FU8A 3ENSB 1TWXB 1O3PB 2G5NA 3LOXA 3BTGE 4E7NA 1ZTLA 1ORFA 3ATMA 1LPGB 1SGEE 2FYQA 3K2UA 1V2LT 1MTNB 2J92A 1DWEH 1C1VH 3Q3YA 3L3TA 1AWFH 1FLEE 3BTFE 4B75A 4X1SU 4JCNA 1FY5A 3EYDA 3DA9B 3B23B 3RUOA 3U1IB 1TNLA 2OXSA 2PW8H 4Y0YE 1K2I1 1GHXH 2A31A 1G9IE 2VIPA 5FX5A 3MU8A 2BM2A 1YBWA 2P16A 5GXPA 1GBJA 2ZZUH 5DP9A 2ANMH 2W3IA 2WPJS 4AFQA 3SGQE 1C5OH 1Y5UT 2FOEA 3RXGA 2UWPA 1MTNC 1TFXA 1IHTH 1YF4A 3KQEA 3TJUA 2ZGBH 1PJPA 1MQ6A 2WUCA 3MTYA 1UTJA 1LDTT 1M9UA 2R3UA 2BY5X 3STJA 4OS5A 1DDJA 4CRBA 1O36A 3A82A 3LGIA 2HOBA 2SFAA 4DY7B 1GJ7B 2VNTA 1QL8A 2ZU2A 5EXMA 5JBAS 1WAYB 2G4UA 5JB9S 1ETSH 4MPVA 2I6SA 3VXEH 2HWLB 4Y7AA 6LPRA 1A3BH 1C5NH 1MTUA 1QQUA 1T8NA 4ZKNU 4GHTA 1C5PA 1BBRK 4D7FA 5F6MA 3A80A 1C4U2 1P3CA 2HPQH 4ZUHA 1TRMA 2XRCA 2ZFRH 4JK5A 1A61H 2GD4B 2AGEX 2EEKA 2HNTC 1MAYA 2OD3B 4GPGA 5C3NA 5HXFA 5FPYA 3RU4T 4LXBH 1T31A 1O2VA 3QUMP 1GI9B 1THRH 5C5OA 1O37A 4ZKOU 1WTGH 2DE9A 2IJOB 1QY6A 2OUAA 1OX1A 1XKBC 1O2YA 4NA8A 3NCLA 3TNTA 1OS8A 3F9FA 1QR3E 1WQSA 1F92A 2FX4A 1G2LA 8KME2 1C5QA 1MZDA 1PPFE 1HRTH 1O5DH 2BXUH 3MFJA 2BQ7B 3UR9A 1V2JT 2R0KA 4DVAU 3FVFB 1Z6JH 4DOQA 1YM0A 1RXPA 3KHVA 4B1TA 5J4QA 2GDEH 2C3SA 1G32B 4MNYA 3OYPA 4ZXXH 3RC5A 4LZ4B 4K69A 1EATA 2ZCKP 3SI3H 2FYRA 2XWAA 4NWLA 3PMBB 1PPBH 2EA3A 3E90B 1PPEE 2NU2E 1V2RT 5HM9A 1MTWA 4B71A 5DP4A 2ODYB 5JBBS 1UTLM 1FDPA 4NA9H 4ABAA 7GCHG 3UNRA 3A7WA 1UTPA 4DT7B 4Z6AH 1UTQA 1A4WH 2FOHA 2PTNA 4ZMAH 4X6MA 1ELVA 2XYAA 2A2QH 4LOYH 2W7SA 3STIA 3RXMA 1C1TA 1F5RA 2STAE 3GY7A 1XUIA 4GCHG 2ANYA 1GI8B 1P05A 1OOKB 1T8OA 2FS8A 2Z9LA 3TGKE 2J4IA 3GDVA 1TX7A 4Z0KA 1G2MA 2QC2A 4Q7YA 5A0AE 4B74A 5BPEA 4OS1A 1O2WA 1NRRH 2VU8E 1PPCE 1UVUH 2SGFE 1SVPA 3LGWA 1DFPA 1LHCH 1EJMA 3M5LA 1HJAC 2EI8A 1KDQB 1TGTA 5ESTE 1CE5A 5A8YA 1AY6H 1P2MA 2CGAA 1S85A 1C1QA 4I8JA 1NFUA 3SNDA 1ZR0A 1BJUA 2TBSA 1GJ5H 2GVFA 1SQOA 5TJXA 2BQ6B 2ANWA 2FLRH 2VVVA 4O3UA 2BHGA 1FQ3A 2PKAB 1SGIB 1YPEH 2SGEE 1EASA 2GV6A 1PPHE 4NIVA 1YPHC 1UO6A 1P9SA 1T32A 5AFYH 2TGDA 3LC3A 3RMOH 4JZ1A 3HPTB 1IQMA 3JZ1B 1BMNH 4MVNA 1OWHA 4X6OA 1KYNA 1AFQC 2RA0A 1TABE 3SV7A 4ABEA 4XSKU 1EOJA 3H7OA 3V12A 4D8NA 4BAMB 1NS3A 4K8YA 2AIPA 4NCYA 3S9BA 1WYKA 2WPKS 4FU7A 1GI6A 1E38B 1EB1H 2BY9X 1G30B 1VCWA 2BD2A 4X8VH 3URCA 1OP2A 2AGGX 4WVPE 2Z94A 5TCCA 3A89A 3MWIU 4TYDA 1O3JA 1MKXH 2YNAA 2CMYA 3SO3A 3M35A 1SBWA 3U8OH 1C1MA 1TLDA 3RU4D 5GJ4B 5E0JA 1EXFA 3EQ0H 4K8BA 2HNTE 1XUKA 1CQQA 2XW9A 1EUFA 1KLIH 2FP7B 1ELFA 1MUEB 1XVOA 3LONA 1SHYA 1Y3WA 4WH8A 5H4IB 1W14U 3OX7U 1O2MA 2QF0A 1NRPH 2GKVE 1GMCG 2OBOA 3RU4E 3S69A 4UDWH 1LKAA 3EE0B 2H1UA 3BN9A 4OS2A 2OC7A 2BY7X 1KXBA 2W3KA 3RXHA 1GCTC 2ZDAH 1TMUH 2J9NA 1C5LH 5L2ZH 2F9OA 1BRAA 1BTXA 1SGYE 4ISOA 5C1UA 1PPZA 3T28A 1OXGA 4HGCA 1BMAA 1CA8B 2BZ6H 4K1TA 4X6NA 1UMAH 1MMJN 1Y59T 3PLKA 1EOLA 2BVXH 1LKBA 1Z71A 4FUJA 3PTNA 5EPYA 4FU9A 3SZNA 1L1GA 1BTZA 1TGNA 2BZAA 2QYIA 3ZZ8A 1GHBG 3O8BA 1L4ZA 3A84A 5LGOA 1FZZA 2VWOA 5E2PA 3UR6A 3SNEA 1DLEA 1V2QT 3BTDE 4Y8YA 1FI8A 1BB0B 4WJG2 3OTJE 1O34A 1GI1A 5AFZH 3RXRA 4Q2KA 1BBRH 4DCDA 2R2WU 1O2SA 4AYYB 4KTCA 1IQNA 2FIRH 2WINI 1A0HB 2IOTA 1GBKA 1VCPA 4TPIZ 3TJOA 2OC8A 1TB6H 4YOIA 5GCHF 3SUGA 1SPJA 1E34B 4WXVA 1FPCH 1C5MD 4Y0ZE 3BEIB 2XNIA 3FZDA 3PYHA 1VITG 1PYTC