5JWOB

Crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic from thermosynechococcus elongatus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
TAVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Circadian clock protein kinase KaiC
publication title Structural basis of the day-night transition in a bacterial circadian clock.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5jwoB00
4XS4B 4FYCA 3EE2A 1OKDA 3OR5A 1BG5A 3D4MA 2GSQA 1NSWA 5F06A 2RM5A 2XPDA 3UEMA 5DBQA 1G7OA 1K0DA 5G31A 4N0VA 3WD6A 2FA8A 2CT6A 4POKA 2VLVA 1TRWA 2EIOA 4MPFA 5DCHA 5G30A 3DWVA 1M9BA 3W8JA 1AQWA 2Z9SA 4RI7A 1G7EA 2H75A 3GTUB 3Q18A 2HRNA 1IYHA 3TB2A 1W4VA 3IRAA 3W6GA 4O5RA 3DXBA 1FB0A 2D2ZA 12GSA 5IMDA 3IDVA 3F6DA 4ZBDA 1MDIA 3F4RA 1GSSA 1SKRB 2KP2A 4XIHA 4MJCA 2IMKA 4K0GA 2HT9A 1K3LA 5B8AA 3IPZA 2C0EA 4HZ4A 2H1GA 5COHA 3PGTA 1Y6EA 3ZTLA 1WRYA 2NPBA 3HYPA 5ECOB 3CSHA 3HCZA 4K7OA 1SJ6A 3HVSA 4OO4A 3F4TA 5FWGA 16GSA 1GTIA 3BOAA 2FWGA 3BCKA 5IMAA 1Z6NA 4RI6A 2XHFA 4Q5QA 1B9YC 3BJ5A 5HFIA 4O92A 2F51A 1X9WB 3CXGA 1AQVA 3VI7A 1GSQA 1OC9B 1U87A 3C71A 3IR4A 4NMUA 5ECQB 5C00A 3WT2A 4TVEA 3G7JA 2V41A 3UARA 13GSA 2H71A 2R3XA 3TRQA 3QDNA 2LSTA 1SK1A 3NIVA 2YWMA 1K0OA 1XZOA 1UA5A 3QFAC 2M72A 2PPTA 2R37A 4ZL8A 3ZITA 2C0FA 2RUEA 3M3MA 2X8CA 2OKAA 1Q98A 3LSZA 5CRDA 1UC7A 4PQIA 2C0GA 5DDLA 1TI3A 4KSMA 2PWJA 1GH2A 3KH9A 1SL2B 4G10A 2FWEA 2JZSA 1SYXA 1PN9A 2V1MA 4MZWA 4IS0A 2OADA 2KP1A 1YZXA 3UAPA 3ZYWA 4QL9A 2CX3A 4PX1A 1THXA 4GF0A 1BQ7A 5A4VA 3GKNA 1XPVA 1XWGA 2VCWA 3DVXA 1V98A 3ZFBA 1OYJA 2IL3A 4NHWA 2GZYA 4AJ8A 2HZEB 8GSSA 4KUNA 2AHEA 1FHEA 3WGDA 2CAQA 3FKFA 4MZBA 5EPFA 5CYYA 2JL4A 2JZRA 4GSTA 2GGTA 4YQUA 4EE0A 5ECHB 3AY8A 4KNDA 3TOTA 5F07A 2H19A 1H4OA 4OO5A 4LLRA 3D22A 3EURA 4NXIA 3DRNA 1GSDA 3KD0A 3O76A 2CVBA 2YV9A 2A2RA 1VF2A 4JU5A 4QQ7A 3N5OA 1TRUA 4I97A 1FVJA 2IFQA 2LKUA 1ERUA 2VOCA 6GSWA 3IV4A 5JWQB 4MPGA 4P3YB 4KE3A 5J9BA 2B1LA 5ECSA 4D73B 19GSA 4DSRA 2KHPA 1KTEA 3TGZA 2DBCA 4Q5FA 2L6CA 3GIXA 3KEBA 5KN0A 3N9JA 4POLA 3MDKA 2B7KA 4BVYA 2C8UA 2OA7A 3EU4A 1JHBA 2QGVA 2FGXA 3NZNA 1BAYA 1JLVA 3GV1A 1U88A 3HVXA 4EC0A 3O6TA 4BVXA 3GH6A 1GULA 2WJUA 5G5FA 2LNSA 4QL7A 1A8LA 4EUYA 3LYPA 3M0FA 2FUG2 3KP9A 2H73A 5D96A 1ACVA 5G2ZA 3BCIA 2DLXA 4K1FA 1MTCA 2VL2C 3EINA 4HZ2A 4FIWA 3MSZA 6GSSA 2F3MA 4IVFA 4KB3A 1MD3A 2YZHA 3HY2A 4GQFA 2DJJA 5IOWA 4Q5NA 2YN1A 5ENUA 4IP6A 3W8SA 1JZRA 2R4VA 3BD2A 1TKDB 1SL0B 1DUGA 1R4WA 2MBTA 2RLIA 1AW9A 1TP9A 3PH9A 4YH2A 3QCPA 2O87A 2ON5A 3ZIVA 4ZL7A 1OAZA 3IA1A 2K6VA 4ZXGA 2PU9C 3D0ZA 3DGQA 2WRTA 1O73A 1GUHA 1XBSA 2O85A 2GDRA 2HYXA 3ED3A 4ZBBA 3J7Yk 1Y25A 3C1RA 5DALB 3CSJA 4TKYA 2WGRA 3TKRA 1OC8A 2AAWA 3H4KA 4G2EA 5C04A 4AGSA 3M9KA 3FZ5A 4MK3A 2O8VB 2GLRA 2FWFA 3QMXA 2TRXA 2WULA 3GUSA 4EF0A 1T00A 1UVZA 4N11A 5JCWA 3DMLA 1AC1A 5DJLA 5FHIA 1OE7A 4JZQA 2JSZA 3VWVA 3FR9A 1AQXA 2A2SA 2CQ9A 5CAXA 1ST9A 3GSSA 4KGIA 3WT1A 1N8JA 5IO2A 1M9AA 3D21A 4ML6A 5H5SA 2LRCA 3KCMA 2VM2A 1SL1B 4MF5A 3UL3A 4BL7A 4GSSA 5D93A 2H6XA 4OFNA 4IGJA 4KSOA 4TR4A 3LG6A 2I9HA 1ML6A 1ZCPA 5LCZA 2GSTA 4K6XA 2H8LA 5ID2A 2PUKC 1A2LA 4O32A 2NTOA 1WE0A 2DC5A 2LQOA 1YQ1A 1GUMA 2EIQA 2CZ2A 4ILFA 4NPBA 4IW9A 3A2XA 2H6YA 3HZ4A 5ECRB 1BYEA 2B3SA 2B5YA 3IOSA 2HZFA 1V9WA 2VLTA 5DCGA 4JEDA 4RQXA 1O85A 1WOUA 1EP7A 5IMFA 4OD7A 4ZB9A 2I3YA 2X8GA 2DSAA 1GUKA 2VCQA 5FT3A 2IMDA 1KEBA 1XW5A 4MZCA 2V6KA 1USBA 2LRNA 4K7IA 2VCZA 2P5RA 2WCIA 1M2DA 2I1UA 2AUVA 3FZ4A 4ISDA 3FZ9A 1A23A 3HDCA 1K0NA 5DVBA 5CRWA 3LXZA 2AV4A 3RPNA 2HI7A 3MWHA 3CTFA 4H86A 5AIXA 1EOHA 2HSYA 1HYUA 2K8VA 4E8HA 4F9ZA 1WMJA 2LNTA 3ZMKA 2R6KA 2VL9A 2GSSA 4XS1A 1TK5B 1GLPA 5ELAA 1E6BA 1XXUA 2FY6A 5DAKA 2BTOT 3G9BA 1PX7A 2DJKA 1Q4JA 4MDCA 4N30A 1MDKA 2DMMA 14GSA 3VFIA 1LJRA 3RBTA 3UBLA 1M99A 4XS6A 3LFLA 1XCCA 1F2EA 1A2JA 2KLXA 1T4ZA 1U3AA 2F8FA 2J23A 3EMPA 3FHKA 3F6FA 2B5EA 1XVWA 2HE3A 2L4CA 2AJQB 1S3AA 10GSA 3APSA 4ECBA 4AJ7A 2TIRA 1DSBA 3H8QA 1R26A 2JSYA 3UMAA 1X5DA 2YV7A 1UN2A 3L0HA 5IMVA 5ELGA 4HQSA 2C1YA 3DKSA 2BMXA 2OE0A 2OJLA 3J7Yb 3F3QA 2MMOA 3L4NA 4O7HA 3Q74A 2RIIA 3ZRDA 1YF1A 3F0IA 2YJ7A 3R2QA 5IO0A 2XBQA 3H79A 4WR5A 5JWRB 2BJXA 1Z3EA 5F0GA 2OE3A 4TXOA 1A8YA 3GNJA 4NHZA 2PGTA 4TR3A 4WXTA 1GTUA 1T8EB 5L71A 1QFNA 2X99A 2LRTA 2HRFA 5D9VA 1EEMA 3JCML 5A5KA 4TR0A 1AXDA 1B8XA 2K8SA 5GZZB 3UVTA 1J9BA 2C80A 1XWBA 2GT5A 2GVPA 5HFGA 3TKSC 1W89A 1SK2A 1NW2A 3K8NA 4WR4A 3GHAA 4BWSA 2QSIA 2C0DA 5F8BA 1BJXA 5DJMA 5ECMB 4KCAA 2YWNA 2L59A 3FRCA 4ZL9A 4TXVA 3GKKA 5G5EA 3US3A 1ZGNA 4K9ZA 4JE1A 5LNKe 3L9VA 2H6ZA 1SD8A 4F0BA 5D9WA 4MLYA 3KP8A 3UIWA 1JZWA 1K0CA 5KN3A 4HU7A 9GSSA 1Z7RA 2JU5A 4EDZA 2HLSA 3KTBA 5IQYA 6GSTA 3LXTA 5A4WA 4JRRA 1K3OA 3IAS2 1X9MB 3CBUA 5CRGA 1V40A 2VCTA 2IFQB 2IMEA 2C4JA 2LV3A 5J3RA 4WF5A 5F05A 4K0NA 4TOPA 1GNEA 2HSHA 2YPMA 2VL2A 5GAPD 1YKAA 1XOAA 3LEFA 1OE8A 4HU9A 5CNWA 2JZTA 1SKWB 1PMTA 3ME8A 5LD0A 3DVWA 2H0GA 5HR1A 4MJBA 5DQYA 2WFCA 5AGYA 4MJAA 4I8BA 2P31A 4MF7A 2LTKA 4PNGA 2MMNA 1WWJA 2B7JA 1SU9A 1QGVA 3M8NA 3MNGA 2VL3A 4V1Ap 1FVKA 1FW1A 2CX4A 3VI5A 1DBYA 1A0RP 4RUVA 1LBKA 2E2MA 2NBSA 4ZBAA 1FAAA 2WB9A 1V58A 4BPYA 3QAVA 4DSSA 4IKHA 4PGTA 3TJKA 3IK9A 2RUFA 3HKRA 1ERWA 1QQ2A 1WPIA 1JZDA 4IELA 3TOUA 4KCEA 4PURA 2H74A 11GSA 3RAZA 1Z9HA 1ZZYA 1BX9A 4MMMA 3UJ1A 4GRFA 4JR4A 3EMXA 3FK8A 4XHMA 3EC3A 1U3IA 1X0RA 3TKSE 1XOBA 2L5OA 2J9HA 4KDUA 4DEJA 4RQRA 3KIJA 4IJ3A 2H70A 1FOVA 3GKMA 4I5QA 1GLQA 5D73A 2B5XA 4HJMA 1TU7A 2FWHA 3WYWA 1PKZA 5CREA 5IOXA 1FB6A 5E59A 1GL8A 5CRHA 2LQQA 4N10A 4TR1B 3KMNA 2H1BA 1THOA 3FR3A 5HR2A 1IYIA 4TW5A 4FH8A 3IHQA 1A24A 1T4YA 4IQAA 3ZL5A 4L0WA 1YDKA 2ZUPA 4MA9A 4X1UA 3VK9A 1EGRA 1XFLA 3GMFA 3HHVA 4V2LA 1S3CA 4WETA 1OKTA 1MD4A 1EV4A 3UOMA 1VF1A 1U6TA 5J5NA 4ULXA 4PUFC 5IIZA 3EVIA 1TI1A 3CMIA 4GCIA 2LJKA 1SK0A 3GRXA 5GSSA 4HI7A 2GQMA 1TDIA 3KJYA 1V57A 3CRTA 2JADA 3H1NA 3WGEA 3L9SA 4NWYA 2L57A 3QPMA 2FHEA 4ZB6A 1URMA 2GQLA 2XBIA 5ECKB 1DE1A 4D73A 1B4QA 3GKXA 2YJHA 4YAVA 3FZAA 1HNAA 4F2IA 1SD9A 5A4UA 5H5QA 3QAGA 4IHUA 2H0HA 1SKSB 5ECNB 4AF2A 1GP1A 1GTBA 1RW1A 3KXOA 6GSYA 2TRCP 2E2GA 3APOA 5EVOA 3APQA 2DMLA 3S9FA 2F8AA 3EU3A 22GSA 2YOIA 4V1Ag 2CZ3A 2YANA 5G1KA 2C3TA 2YP6A 1B9XC 2K18A 3UBKA 2DIYA 3IXRA 4MP4A 1RK4A 3E3EA 2E0QA 4PNFA 4POBA 3GX0A 4EO3A 3O3TA 1WJKA 2OBKA 2CAIA 2QC7A 1GWCA 2GSRA 4HOJA 5JWOB 20GSA 1YEPA 4HEA2 3CTGA 5AN1A 1YKCA 1G6WA 1CQGA 1M2AA 1K0MA 2DJ1A 1E2YA 1I9DA 3LQ7A 4MH3A 2R5GA 4ID0A 4HJ2A 1XW6A 2V2GA 3ERGA 3HJMA 3BBYA 4N0ZA 3TUEA 4PQ1A 2FCHA 4OFTA 1XVQA 4POMA 2JACA 3ZFLA 4ML1A 5IPHA 1F3AA 4NV2A 4KH7A 2YNXA 5DAKB 3TKPA 5GAND 5DALA 5CO3A 3IE3A 5CP1A 3FY7A 4XCSA 5INYA 1ZOFA 1ZYQB 5D8IA 3LWAA 2GS3A 2DJ0A 1AAZA 5HFKA 1FO5A 5DQSA 2GZPA 1J08A 3RPPA 1ILOA 3HJOA 1T3BA 4LMWA 2VD0A 3ZVJA 2V6OA 4F0CA 3L9UA 4L8EA 3IK7A 3CYNA 4K8MA 3NOFA 4Z7XA 1TOFA 2YCDA 3G7IA 4JBBA 4G19A 4F82A 1GSUA 4KW6A 1ZMAA 2H1DA 1HNBA 5D9XA 4X43A 2VM1A 6GSXA 4PXOA 2FNOA 3FW2A 1PL2A 1BEDA 1VGLA 5J4UA 3VLNA 1G0TA 2CVDA 1A2MA 1TJDA 3TKQA 3TKSA 1F6MC 1ABAA 2O89A 1YEXA 2VCVA 4X0XA 2QKEA 1TW9A 4TXOB 2E7PA 1GRXA 2IMIA 3RHBA 1XIYA 18GSA 2GT6A 4J56E 4XRDA 2AYTA 4ZIJA 1F3BA 2DIZA 1ZYEA 3P8WA 1OC3A 2GZZA 1TU8A 3RDWA 5KN1A 1RQMA 3HVVA 1Z6MA 4CW9A 1EP8A 2G2QA 2MBSA 4ECIA 2VD1A 5B6NA 3F9UA 5B6MA 3GH9A 4KDXA 4EL1A 1F9MA 1TTZA 1EWXA 5H5RA 1WIKA 4MF6A 3A3TA 3G7YA 1G6YA 3P7XA 4LL1B 4ECJA 4LMVA 2H72A 4LL4B 1ZL9A 2CVKA 1EOGA 2RM6A 4L5LA 4BWQA 1VF4A 3ME7A 3KTLA 2EC4A 1SJZA 4XS4A 4TN8A 3HJPA 1GTAA 3ERFA 2YWOA 1PD21 4AJ6A 1YF0A 3GYKA 2KOKA 3HZ8A 1FG4A 2MZCA 3IC4A 3IAM2 4MJEA 5AISA 4GXZA 4CHSA 1PL1A 4NV5A 1ON4A 4V2MA 5JCUA 4I6XA 2MMZA 4GSNA 2XPEA 4Q5RA 3MAKA 4HDEA 3I9V2 1X5CA 1XWKA 1T7PB 5B8BA 3TJGA 2I4AA 1B4PA 4F03A 3GTUA 1JLWA 4ZB8A 1C72A 4OWYA 1VF3A 2MYGA 2FLSA 3GL3A 5J9CA 3TJBA 2VUPA 2H01A 2GQKA 1ERVA 1XWCA 3ZREA 5IMCA 5E4WA 3VURA 1I5GA 4IBPA 4BA7A 1HD2A 4L0UA 2FA4A 3HXSA 1LU4A 3F8UA 1JFUA 3WGXA 5HR3A 4TRXA 6GSVA 5G1LA 3IBHA 1QXHA 4IQ1A 2OBIA 3GSTA 2PBJA 4KDYA 3TCOA 3ZMLA 4DSSB 2L4QA 4FO5A 1M0UA 2IIYA 2C3NA 3TJFA 3ZLPA 1MEKA 1GNWA 1GSYA 3Q19A 3I69A 1OVNA 1EGOA 1O7UA 5ABRA 1XW9A 2AB6A 1K3YA 5JCGA 3KH7A 5EL8A 2PVOC 1V2AA 2M46A 2HNLA 2F9SA 3GFKA 3SWLA 3KMOA 1OC9A 1PA3A 2OE1A 2C3QA 2REMA 3QFBC 6GSUA 2PMTA 2ES7A 2YWIA 1ERTA 4MCUA 2NVLA 4HS1A 1TXXA 2H0IA 4NAXA 2WZ9A 3F3RA 3TRXA 3D4TA 4HUAA 2N5BA 2L5LA 2X64A 4WKWA 4OFMA 1R5AA 1TK8B 2ZCTA 3A2VA 3U6VA 1O6JA 1Z7PA 3LGCA 2KUCA 17GSA 2K9FA 2VAFA 1SYRA 1M7TA 2LJRA 2X8HA 3EWLA 4GQCA 3HD5A 2O7KA 1NM3A 2H66A 4EXJA 1XWAA 2PERA 3VWWA 2B6MA 3C1SA 2L6DA 4PUAA 2GTUA 2PN8A 2YZUA 5GSTA 2N5FA 2PVQA 2NDOA 4CDOA 3PR8A 1JZOA 1PGTA 4K7NA 2LEGA 3F63A 1VRSD 4YAPA 1GSEA 1SENA 1M2BA 2I81A 3M9JA 4FYUA 2WS2A 3Q6OA 3EYTA 1S3DA 2B1KA 1NHYA 1AUCA 1O8WA 1O8XA 3ZIJA 3VPTA 3VWUA 1YJ6A 3KM6A 4EDYA 3QR6A 2HZEA 3D6IA 4EKZA 1PKWA 3L78A 3UVHA 4ECCA 3E9JB 3QD9A 3C7MA 4J2FA 4DVCA 4YQVA 2DJ2A 1T1VA 4I2TA 4OMVA 4YQMA 3PINA 2FD3A 1SJIA 4KAEA 1B48A 3LORA 1PSQA 4J57E 2P0GA 1O81A 4IP1A 7GSSA 2IPAA 4I2UA 3A5WA 4G9HA 1HQOA 3C8EA 3C73A 3QAWA 4IJIA 1X9SB 1H75A 2VCXA 2ZNMA 2G0FA 3HA9A 3F4SA 3DIEA 3ZVJD 1QUWA 3A2WA 3LYKA 1R7HA 1PRXA 1KNGA 1KBNA 2CA8A 4ACSA 3E0UA 3DEXA 2IN3A 1WP0A 3I6AA 4MH2A 3RHCA 2LS5A 2V32A 2LUSA 5ID2B 3VPQA 4KA0A 3ZZXA 3GL5A 4KX4A 1YY7A 3ISOA 5KEJA 1F37A 2IMFA 1EV9A 3P90A 3ERWA 3TJJA 5HR0A 3D5JA 1NHOA 5D9TA 4JR6A 5EY6A 4PQHA 4XRAA 3V1WA 3FR6A 3DYRA 1PQNA 2WDUA 3TRPA 1MDJA 4TR1A 1QMVA 1EZKA 4ZILA 3DD3A 1DE2A 1X5EA 4OCEA 4IN0A 2LJAA 3KZQA 5AIVA 5IM9A 2IWTA 1PX6A 1CQHA 4WBJA 4LA1A 1TK0B 4EVMA 5ECLB 2XC2A 1N2AA 1AIUA 2R2JA 4L5OA 3GA4A 5B7CA 1QK8A 4K2DA 3H93A 2VO4A 3GN3A 4WF4A 2A4VA 1TRVA 3CSIA 2VLUA 3SBCA 3I43A 3CRUA 4GTUA 5ECPB 2CV4A 2N5AA 2IJYA 4FYBA 2OACA 2HFDA 3M1GA 2M80A 2HXKA 4E8EA 1HNCA 1R5PA 3KGKA 3VWXA 1Z5YE 5IMZA 3P2AA 1J0FA 2H1AA 2DJ3A 1EEJA 4V2NA 3GURA 3GX8A 1K0BA 4WBRD 4GLTA 4OCFA 3LJRA 4DSQA 4XTSA 2ALBA 2VIMA 1K0AA 5ECIB 1TRSA 5HQPA 5IPGA 5J41A 2H76A 4HQZA 2ON7A 2P5QA 3TDGA 4WEYA 2EIRA 3U5RE 4MABA 2H30A 3FYGA 2MMAA 5KN2A 1GSFA 3FEUA 3QOUA 4GWRA 1A0FA
chains in the Genus database with same CATH superfamily
4XS4B 4FYCA 4HSCX 3EE2A 1OKDA 3OR5A 1BG5A 3D4MA 2GSQA 1NSWA 5F06A 2RM5A 2XPDA 3UEMA 5DBQA 1G7OA 1K0DA 5G31A 4N0VA 3WD6A 2FA8A 2UZ8A 2CT6A 4POKA 2VLVA 1TRWA 2EIOA 4MPFA 5DCHA 5G30A 3DWVA 1M9BA 3W8JA 1AQWA 2Z9SA 4RI7A 1G7EA 2H75A 3GTUB 3Q18A 2HRNA 1IYHA 3TB2A 1W4VA 3IRAA 3W6GA 4O5RA 3DXBA 2HRAA 1FB0A 2D2ZA 12GSA 5IMDA 3IDVA 3F6DA 4ZBDA 1MDIA 3F4RA 1GSSA 1SKRB 2KP2A 4XIHA 4MJCA 2IMKA 4K0GA 2HT9A 1K3LA 5B8AA 3IPZA 2C0EA 4HZ4A 2H1GA 5COHA 3PGTA 1Y6EA 3ZTLA 1WRYA 2NPBA 3HYPA 5ECOB 3CSHA 3HCZA 4K7OA 1SJ6A 3HVSA 4OO4A 3F4TA 5FWGA 16GSA 1GTIA 3BOAA 2FWGA 3BCKA 5IMAA 1Z6NA 4RI6A 2XHFA 4Q5QA 1B9YC 3BJ5A 5HFIA 4O92A 2F51A 1X9WB 3CXGA 1AQVA 3VI7A 1GSQA 1OC9B 1U87A 3C71A 3IR4A 4NMUA 5ECQB 5C00A 3WT2A 4TVEA 3G7JA 2V41A 3UARA 13GSA 2H71A 2R3XA 3TRQA 3QDNA 2LSTA 1SK1A 3NIVA 2YWMA 1K0OA 1XZOA 1UA5A 3QFAC 4K2XA 2M72A 4A5PA 2PPTA 2R37A 4ZL8A 3ZITA 2C0FA 2RUEA 3M3MA 2X8CA 2OKAA 1Q98A 3LSZA 5CRDA 1UC7A 4PQIA 2C0GA 5DDLA 1TI3A 4KSMA 2PWJA 1GH2A 3KH9A 1SL2B 4G10A 2FWEA 2JZSA 1SYXA 1PN9A 2V1MA 4MZWA 4IS0A 2OADA 2KP1A 1YZXA 3UAPA 3ZYWA 4QL9A 2CX3A 4PX1A 1THXA 4GF0A 1BQ7A 5A4VA 3GKNA 1XPVA 1XWGA 2VCWA 3DVXA 1V98A 3ZFBA 1OYJA 2IL3A 4NHWA 4K5SA 2GZYA 4AJ8A 2HZEB 8GSSA 4KUNA 2AHEA 1FHEA 3WGDA 2CAQA 3FKFA 4MZBA 5EPFA 5CYYA 2JL4A 2JZRA 4GSTA 2GGTA 4YQUA 4EE0A 5ECHB 3AY8A 4KNDA 3TOTA 5F07A 2H19A 1H4OA 4OO5A 4LLRA 4G0KA 3D22A 3EURA 4NXIA 3DRNA 1GSDA 3KD0A 3O76A 2CVBA 2YV9A 2A2RA 1VF2A 4JU5A 4QQ7A 3N5OA 1TRUA 4I97A 1FVJA 2IFQA 2LKUA 1ERUA 2VOCA 6GSWA 3IV4A 5JWQB 4MPGA 4P3YB 4KE3A 5J9BA 2B1LA 5ECSA 4D73B 19GSA 4DSRA 2KHPA 1KTEA 3TGZA 2DBCA 4Q5FA 2L6CA 3GIXA 3KEBA 5KN0A 3N9JA 4POLA 3MDKA 2B7KA 4BVYA 2C8UA 2OA7A 3EU4A 1JHBA 2QGVA 2FGXA 3NZNA 1M3IA 1BAYA 1JLVA 3GV1A 1U88A 3HVXA 4EC0A 3O6TA 4BVXA 3GH6A 1GULA 2WJUA 5G5FA 2DKHA 2LNSA 4QL7A 1A8LA 4EUYA 3LYPA 3M0FA 2FUG2 3KP9A 2H73A 5D96A 1ACVA 5G2ZA 3BCIA 2DLXA 4K1FA 1MTCA 2VL2C 3EINA 4HZ2A 4FIWA 3MSZA 6GSSA 2F3MA 4IVFA 4KB3A 1MD3A 2YZHA 3HY2A 4GQFA 2DJJA 5IOWA 1ZYPA 4Q5NA 2YN1A 5ENUA 4IP6A 3W8SA 1JZRA 2R4VA 3BD2A 1TKDB 1SL0B 1DUGA 1R4WA 2MBTA 2RLIA 1AW9A 1TP9A 3PH9A 4YH2A 3QCPA 2O87A 2R0CA 2ON5A 3ZIVA 4ZL7A 1OAZA 3IA1A 2K6VA 4ZXGA 2PU9C 3D0ZA 3DGQA 2WRTA 1O73A 1GUHA 1XBSA 2O85A 2GDRA 2HYXA 3ED3A 4ZBBA 3J7Yk 1Y25A 3C1RA 5DALB 3CSJA 4TKYA 2WGRA 3TKRA 1OC8A 2AAWA 3H4KA 4G2EA 5C04A 4AGSA 3M9KA 3FZ5A 4MK3A 2O8VB 2GLRA 2FWFA 3QMXA 2TRXA 2WULA 3GUSA 4EF0A 1T00A 1UVZA 4N11A 5JCWA 3DMLA 1AC1A 5DJLA 5FHIA 1OE7A 4JZQA 2JSZA 3VWVA 3FR9A 1AQXA 2A2SA 2CQ9A 5CAXA 4CY6A 1ST9A 3GSSA 4KGIA 3WT1A 1N8JA 5IO2A 1M9AA 3D21A 4ML6A 5H5SA 2LRCA 3KCMA 2VM2A 1SL1B 4MF5A 4EIQA 5KOXA 3UL3A 4BL7A 4GSSA 5D93A 2H6XA 4OFNA 4IGJA 4KSOA 4TR4A 3LG6A 2I9HA 1ML6A 1ZCPA 5LCZA 2GSTA 4K6XA 2H8LA 5ID2A 2PUKC 1A2LA 4O32A 2NTOA 1WE0A 3CQFA 2DC5A 2LQOA 1YQ1A 1GUMA 2EIQA 2CZ2A 4ILFA 4NPBA 4IW9A 3A2XA 2H6YA 3HZ4A 5ECRB 1BYEA 2B3SA 1XG8A 2B5YA 2HZFA 3IOSA 1V9WA 2VLTA 5DCGA 4JEDA 4RQXA 1O85A 1WOUA 1EP7A 5IMFA 4OD7A 4ZB9A 2I3YA 2X49A 2X8GA 2DSAA 1GUKA 2VCQA 5FT3A 2IMDA 1KEBA 1XW5A 4MZCA 2V6KA 1USBA 2LRNA 4K7IA 2VCZA 2P5RA 2WCIA 1M2DA 2I1UA 2AUVA 3FZ4A 4ISDA 3FZ9A 1A23A 3HDCA 3R3EA 1K0NA 5DVBA 5CRWA 3LXZA 2AV4A 3RPNA 2HI7A 3MWHA 3CTFA 4H86A 5AIXA 1EOHA 2HSYA 1HYUA 2K8VA 4E8HA 4F9ZA 1WMJA 2LNTA 3ZMKA 2R6KA 2VL9A 2GSSA 4XS1A 1TK5B 1GLPA 5ELAA 1E6BA 1XXUA 2FY6A 5DAKA 2BTOT 3G9BA 1PX7A 2DJKA 1Q4JA 4MDCA 4N30A 1MDKA 2DMMA 14GSA 3VFIA 1LJRA 3RBTA 3UBLA 1M99A 4XS6A 3LFLA 1XCCA 1F2EA 1A2JA 2KLXA 1T4ZA 1U3AA 2F8FA 2J23A 3EMPA 3FHKA 3F6FA 2B5EA 1XVWA 2HE3A 2L4CA 2AJQB 1S3AA 10GSA 3APSA 4ECBA 4AJ7A 2TIRA 1DSBA 3H8QA 1R26A 2JSYA 3UMAA 1X5DA 2YV7A 1UN2A 3L0HA 5IMVA 5ELGA 4HQSA 2C1YA 3DKSA 2BMXA 2OE0A 2OJLA 3J7Yb 3F3QA 2MMOA 3L4NA 4O7HA 3Q74A 2RIIA 3ZRDA 1YF1A 3F0IA 2YJ7A 3R2QA 5IO0A 2XBQA 3H79A 3IC8A 4WR5A 5BRTA 5JWRB 2BJXA 1Z3EA 5F0GA 2OE3A 4TXOA 1A8YA 3GNJA 4NHZA 4EIPA 2PGTA 4TR3A 4WXTA 1GTUA 1T8EB 5L71A 1QFNA 2X99A 2LRTA 2HRFA 5D9VA 1EEMA 3JCML 5A5KA 4TR0A 1AXDA 1B8XA 2K8SA 1FOHA 4O5UA 5GZZB 3UVTA 1J9BA 2C80A 1XWBA 2GT5A 2GVPA 5HFGA 3TKSC 1W89A 1SK2A 1NW2A 3K8NA 4WR4A 4O5QA 5KOWA 3GHAA 4BWSA 2QSIA 2C0DA 5F8BA 1BJXA 4KCAA 5DJMA 5ECMB 2YWNA 2L59A 3FRCA 4ZL9A 4TXVA 3GKKA 5G5EA 3US3A 1ZGNA 4K9ZA 4JE1A 5LNKe 3L9VA 2H6ZA 1SD8A 4F0BA 5D9WA 4MLYA 3KP8A 3UIWA 1JZWA 4Z2TA 1K0CA 5KN3A 3A5IA 4HU7A 9GSSA 1Z7RA 2JU5A 4EDZA 2HLSA 3KTBA 5IQYA 6GSTA 3LXTA 5A4WA 4JRRA 1K3OA 3IAS2 1X9MB 3CBUA 5CRGA 1V40A 2VCTA 2IFQB 2IMEA 2C4JA 2LV3A 5J3RA 4WF5A 5F05A 4K0NA 4TOPA 1GNEA 2HSHA 2YPMA 2VL2A 5GAPD 1YKAA 1XOAA 3LEFA 1OE8A 1PN0A 4HU9A 5CNWA 2JZTA 1SKWB 1PMTA 3ME8A 5LD0A 3DVWA 2H0GA 5HR1A 4MJBA 5DQYA 4BVYB 2WFCA 5AGYA 4MJAA 4I8BA 2P31A 4MF7A 2LTKA 4PNGA 2MMNA 1WWJA 2B7JA 1SU9A 4BVXB 1QGVA 3M8NA 3MNGA 2VL3A 4V1Ap 1FVKA 1FW1A 2CX4A 3VI5A 1DBYA 1A0RP 4RUVA 1LBKA 2E2MA 2NBSA 4ZBAA 1FAAA 2WB9A 1V58A 4BPYA 3QAVA 4DSSA 4IKHA 4PGTA 3TJKA 3IK9A 2RUFA 3HKRA 1ERWA 1QQ2A 1WPIA 1JZDA 4IELA 3TOUA 4KCEA 4PURA 2H74A 11GSA 3RAZA 1Z9HA 1ZZYA 1BX9A 4MMMA 3UJ1A 4GRFA 4JR4A 3EMXA 3FK8A 4XHMA 3EC3A 3LW9A 1U3IA 1X0RA 3TKSE 1XOBA 2L5OA 2J9HA 4KDUA 4DEJA 4RQRA 3KIJA 1M3JA 4IJ3A 2H70A 1FOVA 3GKMA 4I5QA 3EPTA 4MNNA 1GLQA 5D73A 2B5XA 4HJMA 1TU7A 2FWHA 3WYWA 1PKZA 5CREA 5IOXA 1FB6A 5E59A 1GL8A 5CRHA 2LQQA 4N10A 4TR1B 3KMNA 2H1BA 1THOA 3FR3A 5HR2A 1IYIA 4TW5A 4FH8A 3IHQA 1A24A 1T4YA 4IQAA 3ZL5A 4L0WA 1YDKA 2ZUPA 4MA9A 4X1UA 3VK9A 1EGRA 1XFLA 1ZYNA 3GMFA 3HHVA 4V2LA 1S3CA 4WETA 1OKTA 1MD4A 1EV4A 3UOMA 1VF1A 1U6TA 5J5NA 4ULXA 4PUFC 5IIZA 3EVIA 2R0GA 1TI1A 3CMIA 4GCIA 2LJKA 1SK0A 3GRXA 5GSSA 4HI7A 2GQMA 1TDIA 3KJYA 1V57A 3CRTA 2JADA 3H1NA 3WGEA 4PTSA 3L9SA 4NWYA 2L57A 3QPMA 2FHEA 4ZB6A 1URMA 4BL7B 2GQLA 2XBIA 5ECKB 1DE1A 4D73A 1B4QA 3GKXA 2YJHA 4YAVA 3FZAA 1HNAA 4F2IA 1SD9A 5A4UA 5H5QA 3QAGA 4IHUA 2H0HA 4YKGA 1SKSB 5ECNB 4AF2A 1GP1A 1GTBA 1RW1A 3KXOA 6GSYA 2TRCP 2E2GA 3APOA 5EVOA 3APQA 2DMLA 3S9FA 2F8AA 3EU3A 22GSA 2YOIA 4V1Ag 2CZ3A 2YANA 5G1KA 2C3TA 2YP6A 1B9XC 2K18A 3UBKA 2DIYA 3IXRA 4MP4A 1RK4A 3E3EA 2E0QA 4PNFA 4POBA 3GX0A 4EO3A 3O3TA 1WJKA 2OBKA 2CAIA 2QC7A 1GWCA 2GSRA 4HOJA 5JWOB 20GSA 1YEPA 4HEA2 3CTGA 5AN1A 1YKCA 2R0PA 1G6WA 1CQGA 1M2AA 1K0MA 2DJ1A 1E2YA 5BMUA 1I9DA 3LQ7A 4MH3A 2R5GA 4ID0A 4HJ2A 1XW6A 2V2GA 3ERGA 3HJMA 3BBYA 4N0ZA 3TUEA 4PQ1A 2FCHA 4OFTA 1XVQA 4POMA 2JACA 3ZFLA 4ML1A 5IPHA 1F3AA 4NV2A 4KH7A 2YNXA 5DAKB 3TKPA 5GAND 5DALA 5CO3A 3IE3A 5CP1A 3FY7A 4XCSA 5INYA 1ZOFA 1ZYQB 5D8IA 3LWAA 2GS3A 2DJ0A 1AAZA 4CY8A 5HFKA 1FO5A 2A4HA 5DQSA 2GZPA 1J08A 3RPPA 1ILOA 3HJOA 1T3BA 4LMWA 2VD0A 3ZVJA 2V6OA 4F0CA 3L9UA 4L8EA 3IK7A 3CYNA 4K8MA 3NOFA 4Z7XA 1TOFA 4BIKA 2YCDA 3G7IA 4JBBA 4G19A 4F82A 1GSUA 4KW6A 1ZMAA 2H1DA 1HNBA 5D9XA 4X43A 2VM1A 6GSXA 4PXOA 2HRKA 2FNOA 3FW2A 1PL2A 1BEDA 1VGLA 5J4UA 3VLNA 1G0TA 2CVDA 1A2MA 1TJDA 3TKQA 3TKSA 1F6MC 1ABAA 2O89A 1YEXA 2VCVA 4X0XA 2QKEA 1TW9A 4TXOB 2E7PA 1GRXA 2IMIA 3RHBA 1XIYA 18GSA 2GT6A 4J56E 4XRDA 2AYTA 4ZIJA 1F3BA 2DIZA 1ZYEA 3P8WA 1OC3A 2GZZA 1TU8A 3RDWA 5KN1A 1RQMA 3HVVA 1Z6MA 4CW9A 1EP8A 2G2QA 2MBSA 4ECIA 2VD1A 5B6NA 3F9UA 5B6MA 3GH9A 4KDXA 4EL1A 1F9MA 1TTZA 1EWXA 5H5RA 1WIKA 4MF6A 3A3TA 4YKFA 3G7YA 1G6YA 3P7XA 4LL1B 4ECJA 4LMVA 2H72A 4LL4B 1ZL9A 2CVKA 1EOGA 2RM6A 4L5LA 4BWQA 1VF4A 3ME7A 3KTLA 2EC4A 1SJZA 4XS4A 4TN8A 3HJPA 1GTAA 3ERFA 2YWOA 1PD21 4AJ6A 1YF0A 3GYKA 2KOKA 3HZ8A 1FG4A 2MZCA 3IC4A 3IAM2 4MJEA 5AISA 4GXZA 4CHSA 1PL1A 4NV5A 1ON4A 4V2MA 5JCUA 4I6XA 4GSNA 2MMZA 4G0IA 2XPEA 4Q5RA 3MAKA 4HDEA 3I9V2 1X5CA 4Z2UA 1XWKA 1T7PB 5B8BA 3TJGA 2I4AA 4ICYA 1B4PA 4F03A 3GTUA 1JLWA 4ZB8A 1C72A 4OWYA 1VF3A 2MYGA 2FLSA 3GL3A 5J9CA 3TJBA 2VUPA 2H01A 2GQKA 1ERVA 1XWCA 3ZREA 5IMCA 5E4WA 3VURA 1I5GA 4IBPA 4BA7A 1HD2A 4L0UA 2FA4A 3HXSA 1LU4A 3F8UA 1JFUA 2HSMA 4Z2RA 3WGXA 5HR3A 4TRXA 6GSVA 5G1LA 3IBHA 1QXHA 4IQ1A 2OBIA 3GSTA 2PBJA 4KDYA 3TCOA 3ZMLA 4DSSB 2L4QA 4FO5A 1M0UA 2IIYA 2DKIA 2C3NA 3TJFA 3ZLPA 1MEKA 1GNWA 1GSYA 3Q19A 3I69A 1OVNA 1EGOA 1O7UA 5ABRA 1XW9A 2AB6A 1K3YA 5JCGA 3KH7A 5EL8A 2PVOC 1V2AA 2M46A 2HNLA 2F9SA 3GFKA 3SWLA 3KMOA 1OC9A 1PA3A 2OE1A 2C3QA 2REMA 3QFBC 6GSUA 2PMTA 2ES7A 2YWIA 1ERTA 4MCUA 2NVLA 4HS1A 1TXXA 2H0IA 4NAXA 2WZ9A 3F3RA 3TRXA 3D4TA 4HUAA 2N5BA 2L5LA 2X64A 4WKWA 4OFMA 1R5AA 1TK8B 2ZCTA 3A2VA 3U6VA 1O6JA 1Z7PA 3LGCA 2KUCA 17GSA 2A2PA 2K9FA 2VAFA 1SYRA 1M7TA 2LJRA 2X8HA 3EWLA 4GQCA 3HD5A 2O7KA 1NM3A 2H66A 4EXJA 1XWAA 2PERA 3VWWA 2B6MA 3C1SA 2L6DA 4PUAA 2GTUA 2PN8A 2YZUA 5GSTA 2N5FA 2PVQA 2NDOA 4CDOA 3PR8A 1JZOA 3FMWA 1PGTA 4K7NA 2LEGA 3F63A 1VRSD 4YAPA 1GSEA 1SENA 1M2BA 2QA1A 2I81A 3M9JA 4FYUA 2WS2A 3Q6OA 3EYTA 1S3DA 2B1KA 1NHYA 1AUCA 1O8WA 4K5RA 1O8XA 3ZIJA 3IHGA 3VPTA 3VWUA 1YJ6A 3KM6A 4EDYA 3QR6A 2HZEA 3D6IA 4EKZA 1PKWA 3L78A 3UVHA 4ECCA 3E9JB 3QD9A 3C7MA 4J2FA 4DVCA 4YQVA 2DJ2A 1T1VA 4I2TA 4OMVA 2X4AA 4YQMA 3PINA 2FD3A 1SJIA 4KAEA 1B48A 3HVNA 4G0LA 3LORA 1PSQA 4J57E 2P0GA 1O81A 4IP1A 7GSSA 2IPAA 4I2UA 4USSA 3A5WA 4G9HA 1HQOA 3C8EA 3C73A 3QAWA 4IJIA 1X9SB 1H75A 2VCXA 2ZNMA 2G0FA 3HA9A 3F4SA 3DIEA 3ZVJD 1QUWA 3A2WA 3LYKA 1R7HA 1PRXA 1KNGA 1KBNA 2CA8A 4ACSA 3E0UA 3DEXA 2QA2A 2IN3A 1WP0A 3I6AA 4MH2A 3RHCA 2LS5A 2V32A 2LUSA 5ID2B 3VPQA 4X4JA 4KA0A 3ZZXA 3GL5A 4KX4A 1YY7A 3ISOA 5KEJA 1F37A 2IMFA 1EV9A 3P90A 3ERWA 3TJJA 5HR0A 3D5JA 1NHOA 5D9TA 1PFOA 4JR6A 5EY6A 4PQHA 4FQUA 4XRAA 3V1WA 3FR6A 3PPUA 3DYRA 1PQNA 2WDUA 3TRPA 1MDJA 4TR1A 1QMVA 1EZKA 4ZILA 3DD3A 1DE2A 1X5EA 4OCEA 4IN0A 2LJAA 3KZQA 5AIVA 5IM9A 2IWTA 1PX6A 1CQHA 4WBJA 4LA1A 1TK0B 4EVMA 1S3RA 5ECLB 2XC2A 1N2AA 1AIUA 2R2JA 4L5OA 3GA4A 5B7CA 1QK8A 4K2DA 3H93A 2VO4A 3GN3A 4WF4A 2A4VA 1TRVA 3CSIA 2VLUA 3SBCA 3I43A 3CRUA 4GTUA 2CV4A 5ECPB 2N5AA 2IJYA 4FYBA 2OACA 2HFDA 4KF9A 3M1GA 2M80A 2HXKA 4E8EA 1HNCA 1R5PA 3KGKA 3VWXA 1Z5YE 5IMZA 3P2AA 1J0FA 2H1AA 2DJ3A 1EEJA 4V2NA 3GURA 3GX8A 1K0BA 3MIXA 4WBRD 4GLTA 4OCFA 3LJRA 4DSQA 4XTSA 2ALBA 2VIMA 1K0AA 5ECIB 1TRSA 5HQPA 5IPGA 5J41A 2H76A 4HQZA 2ON7A 2P5QA 3TDGA 4WEYA 2EIRA 3U5RE 4MABA 2H30A 3FYGA 3MYDA 2MMAA 5KN2A 1GSFA 3FEUA 3QOUA 4GWRA 1A0FA
chains in the Genus database with same CATH topology
4XS4B 4FYCA 3EE2A 1OKDA 3OR5A 1BG5A 3D4MA 2GSQA 1NSWA 5F06A 2RM5A 2XPDA 3UEMA 5DBQA 1G7OA 1K0DA 5G31A 4N0VA 3WD6A 2FA8A 2UZ8A 2CT6A 4POKA 2VLVA 1TRWA 2EIOA 4MPFA 5DCHA 5G30A 3DWVA 1M9BA 3W8JA 1AQWA 2Z9SA 4RI7A 1G7EA 2H75A 3GTUB 3Q18A 2HRNA 1IYHA 3TB2A 1W4VA 3IRAA 3W6GA 4O5RA 3DXBA 2HRAA 1FB0A 2D2ZA 12GSA 5IMDA 3IDVA 3F6DA 4ZBDA 1MDIA 3F4RA 1GSSA 1SKRB 2KP2A 4XIHA 4MJCA 2IMKA 4K0GA 2HT9A 1K3LA 5B8AA 3IPZA 2C0EA 4HZ4A 2H1GA 5COHA 3PGTA 1Y6EA 3ZTLA 1WRYA 2NPBA 3HYPA 5ECOB 3CSHA 3HCZA 4K7OA 1SJ6A 3HVSA 4OO4A 3F4TA 5FWGA 16GSA 1GTIA 3BOAA 2FWGA 3BCKA 5IMAA 1Z6NA 4RI6A 2XHFA 4Q5QA 1B9YC 3BJ5A 5HFIA 4O92A 2F51A 1X9WB 3CXGA 1AQVA 3VI7A 1GSQA 1OC9B 1U87A 3C71A 3IR4A 4NMUA 5ECQB 5C00A 3WT2A 4TVEA 3G7JA 2V41A 3UARA 13GSA 2H71A 2R3XA 3TRQA 3QDNA 2LSTA 1SK1A 3NIVA 2YWMA 1K0OA 1XZOA 1UA5A 3QFAC 4K2XA 2M72A 4A5PA 2PPTA 2R37A 4ZL8A 3ZITA 2C0FA 2RUEA 3M3MA 2X8CA 2OKAA 1Q98A 3LSZA 5CRDA 1UC7A 4PQIA 2C0GA 5DDLA 1TI3A 4KSMA 2PWJA 1GH2A 3KH9A 1SL2B 4G10A 2FWEA 2JZSA 1SYXA 1PN9A 2V1MA 4MZWA 4IS0A 2OADA 2KP1A 1YZXA 3UAPA 3ZYWA 4QL9A 2CX3A 4PX1A 1THXA 4GF0A 1BQ7A 5A4VA 3GKNA 1XPVA 1XWGA 2VCWA 3DVXA 1V98A 3ZFBA 1OYJA 2IL3A 4NHWA 4K5SA 2GZYA 4AJ8A 2HZEB 8GSSA 4KUNA 2AHEA 1FHEA 3WGDA 2CAQA 3FKFA 4MZBA 5EPFA 5CYYA 2JL4A 2JZRA 4GSTA 2GGTA 4YQUA 4EE0A 5ECHB 3AY8A 4KNDA 3TOTA 5F07A 2H19A 1H4OA 4OO5A 4LLRA 4G0KA 3D22A 3EURA 4NXIA 3DRNA 1GSDA 3KD0A 3O76A 2CVBA 2YV9A 2A2RA 1VF2A 4JU5A 4QQ7A 3N5OA 1TRUA 4I97A 1FVJA 2IFQA 2LKUA 1ERUA 2VOCA 6GSWA 3IV4A 5JWQB 4MPGA 4P3YB 4KE3A 5J9BA 2B1LA 5ECSA 4D73B 19GSA 4DSRA 2KHPA 1KTEA 3TGZA 2DBCA 4Q5FA 2L6CA 3GIXA 3KEBA 5KN0A 3N9JA 4POLA 3MDKA 2B7KA 4BVYA 2C8UA 2OA7A 3EU4A 1JHBA 2QGVA 2FGXA 3NZNA 1BAYA 1JLVA 3GV1A 1U88A 3HVXA 4EC0A 3O6TA 4BVXA 3GH6A 1GULA 2WJUA 5G5FA 2DKHA 2LNSA 4QL7A 1A8LA 4EUYA 3LYPA 3M0FA 2FUG2 3KP9A 2H73A 5D96A 1ACVA 5G2ZA 3BCIA 2DLXA 4K1FA 1MTCA 2VL2C 3EINA 4HZ2A 4FIWA 3MSZA 6GSSA 2F3MA 4IVFA 4KB3A 1MD3A 2YZHA 3HY2A 4GQFA 2DJJA 5IOWA 1ZYPA 4Q5NA 2YN1A 5ENUA 4IP6A 3W8SA 1JZRA 2R4VA 3BD2A 1TKDB 1SL0B 1DUGA 1R4WA 2MBTA 2RLIA 1AW9A 1TP9A 3PH9A 4YH2A 3QCPA 2O87A 2R0CA 2ON5A 3ZIVA 4ZL7A 1OAZA 3IA1A 2K6VA 4ZXGA 2PU9C 3D0ZA 3DGQA 2WRTA 1O73A 1GUHA 1XBSA 2O85A 2GDRA 2HYXA 3ED3A 4ZBBA 3J7Yk 1Y25A 3C1RA 5DALB 3CSJA 4TKYA 2WGRA 3TKRA 1OC8A 2AAWA 3H4KA 4G2EA 5C04A 4AGSA 3M9KA 3FZ5A 4MK3A 2O8VB 2GLRA 2FWFA 3QMXA 2TRXA 2WULA 3GUSA 4EF0A 1T00A 1UVZA 4N11A 5JCWA 3DMLA 1AC1A 5DJLA 5FHIA 1OE7A 4JZQA 2JSZA 3VWVA 3FR9A 1AQXA 2A2SA 2CQ9A 5CAXA 4CY6A 1ST9A 3GSSA 4KGIA 3WT1A 1N8JA 5IO2A 1M9AA 3D21A 4ML6A 5H5SA 2LRCA 3KCMA 2VM2A 1SL1B 4MF5A 4EIQA 5KOXA 3UL3A 4BL7A 4GSSA 5D93A 2H6XA 4OFNA 4IGJA 4KSOA 4TR4A 3LG6A 2I9HA 1ML6A 1ZCPA 5LCZA 2GSTA 4K6XA 2H8LA 5ID2A 2PUKC 1A2LA 4O32A 2NTOA 1WE0A 2DC5A 2LQOA 1YQ1A 1GUMA 2EIQA 2CZ2A 4ILFA 4NPBA 4IW9A 3A2XA 2H6YA 3HZ4A 5ECRB 1BYEA 2B3SA 2B5YA 3IOSA 2HZFA 1V9WA 2VLTA 5DCGA 4JEDA 4RQXA 1O85A 1WOUA 1EP7A 5IMFA 4OD7A 4ZB9A 2I3YA 2X49A 2X8GA 2DSAA 1GUKA 2VCQA 5FT3A 2IMDA 1KEBA 1XW5A 4MZCA 2V6KA 1USBA 2LRNA 4K7IA 2VCZA 2P5RA 2WCIA 1M2DA 2I1UA 2AUVA 3FZ4A 4ISDA 3FZ9A 1A23A 3HDCA 3R3EA 1K0NA 5DVBA 5CRWA 3LXZA 2AV4A 3RPNA 2HI7A 3MWHA 3CTFA 4H86A 5AIXA 1EOHA 2HSYA 1HYUA 2K8VA 4E8HA 4F9ZA 1WMJA 2LNTA 3ZMKA 2R6KA 2VL9A 2GSSA 4XS1A 1TK5B 1GLPA 5ELAA 1E6BA 1XXUA 2FY6A 5DAKA 2BTOT 3G9BA 1PX7A 2DJKA 1Q4JA 4MDCA 4N30A 1MDKA 2DMMA 14GSA 3VFIA 1LJRA 3RBTA 3UBLA 1M99A 4XS6A 3LFLA 1XCCA 1F2EA 1A2JA 2KLXA 1T4ZA 1U3AA 2F8FA 2J23A 3EMPA 3FHKA 3F6FA 2B5EA 1XVWA 2HE3A 2L4CA 2AJQB 1S3AA 10GSA 3APSA 4ECBA 4AJ7A 2TIRA 1DSBA 3H8QA 1R26A 2JSYA 3UMAA 1X5DA 2YV7A 1UN2A 3L0HA 5IMVA 5ELGA 4HQSA 2C1YA 3DKSA 2BMXA 2OE0A 2OJLA 3J7Yb 3F3QA 2MMOA 3L4NA 4O7HA 3Q74A 2RIIA 3ZRDA 1YF1A 3F0IA 2YJ7A 3R2QA 5IO0A 2XBQA 3H79A 3IC8A 4WR5A 5BRTA 5JWRB 2BJXA 1Z3EA 5F0GA 2OE3A 4TXOA 1A8YA 3GNJA 4NHZA 4EIPA 2PGTA 4TR3A 4WXTA 1GTUA 1T8EB 5L71A 1QFNA 2X99A 2LRTA 2HRFA 5D9VA 1EEMA 3JCML 5A5KA 4TR0A 1AXDA 1B8XA 2K8SA 1FOHA 4O5UA 5GZZB 3UVTA 1J9BA 2C80A 1XWBA 2GT5A 2GVPA 5HFGA 3TKSC 1W89A 1SK2A 1NW2A 3K8NA 4WR4A 4O5QA 5KOWA 3GHAA 4BWSA 2QSIA 2C0DA 5F8BA 1BJXA 4KCAA 5DJMA 5ECMB 2YWNA 2L59A 3FRCA 4ZL9A 4TXVA 3GKKA 5G5EA 3US3A 1ZGNA 4K9ZA 4JE1A 5LNKe 3L9VA 2H6ZA 1SD8A 4F0BA 5D9WA 4MLYA 3KP8A 3UIWA 1JZWA 4Z2TA 1K0CA 5KN3A 3A5IA 4HU7A 9GSSA 1Z7RA 2JU5A 4EDZA 2HLSA 3KTBA 5IQYA 6GSTA 3LXTA 5A4WA 4JRRA 1K3OA 3IAS2 1X9MB 3CBUA 5CRGA 1V40A 2VCTA 2IFQB 2IMEA 2C4JA 2LV3A 5J3RA 4WF5A 5F05A 4K0NA 4TOPA 1GNEA 2HSHA 2YPMA 2VL2A 5GAPD 1YKAA 1XOAA 3LEFA 1OE8A 1PN0A 4HU9A 5CNWA 2JZTA 1SKWB 1PMTA 3ME8A 5LD0A 3DVWA 2H0GA 5HR1A 4MJBA 5DQYA 4BVYB 2WFCA 5AGYA 4MJAA 4I8BA 2P31A 4MF7A 2LTKA 4PNGA 2MMNA 1WWJA 2B7JA 1SU9A 4BVXB 1QGVA 3M8NA 3MNGA 2VL3A 4V1Ap 1FVKA 1FW1A 2CX4A 3VI5A 1DBYA 1A0RP 4RUVA 1LBKA 2E2MA 2NBSA 4ZBAA 1FAAA 2WB9A 1V58A 4BPYA 3QAVA 4DSSA 4IKHA 4PGTA 3TJKA 3IK9A 2RUFA 3HKRA 1ERWA 1QQ2A 1WPIA 1JZDA 4IELA 3TOUA 4KCEA 4PURA 2H74A 11GSA 3RAZA 1Z9HA 1ZZYA 1BX9A 4MMMA 3UJ1A 4GRFA 4JR4A 3EMXA 3FK8A 4XHMA 3EC3A 3LW9A 1U3IA 1X0RA 3TKSE 1XOBA 2L5OA 2J9HA 4KDUA 4DEJA 4RQRA 3KIJA 4IJ3A 2H70A 1FOVA 3GKMA 4I5QA 3EPTA 4MNNA 1GLQA 5D73A 2B5XA 4HJMA 1TU7A 2FWHA 3WYWA 1PKZA 5CREA 5IOXA 1FB6A 5E59A 1GL8A 5CRHA 2LQQA 4N10A 4TR1B 3KMNA 2H1BA 1THOA 3FR3A 5HR2A 1IYIA 4TW5A 4FH8A 3IHQA 1A24A 1T4YA 4IQAA 3ZL5A 4L0WA 1YDKA 2ZUPA 4MA9A 4X1UA 3VK9A 1EGRA 1XFLA 1ZYNA 3GMFA 3HHVA 4V2LA 1S3CA 4WETA 1OKTA 1MD4A 1EV4A 3UOMA 1VF1A 1U6TA 5J5NA 4ULXA 4PUFC 5IIZA 3EVIA 2R0GA 1TI1A 3CMIA 4GCIA 2LJKA 1SK0A 3GRXA 5GSSA 4HI7A 2GQMA 1TDIA 3KJYA 1V57A 3CRTA 2JADA 3H1NA 3WGEA 4PTSA 3L9SA 4NWYA 2L57A 3QPMA 2FHEA 4ZB6A 1URMA 4BL7B 2GQLA 2XBIA 5ECKB 1DE1A 4D73A 1B4QA 3GKXA 2YJHA 4YAVA 3FZAA 1HNAA 4F2IA 1SD9A 5A4UA 5H5QA 3QAGA 4IHUA 2H0HA 4YKGA 1SKSB 5ECNB 4AF2A 1GP1A 1GTBA 1RW1A 3KXOA 6GSYA 2TRCP 2E2GA 3APOA 5EVOA 3APQA 2DMLA 3S9FA 2F8AA 3EU3A 22GSA 2YOIA 4V1Ag 2CZ3A 2YANA 5G1KA 2C3TA 2YP6A 1B9XC 2K18A 3UBKA 2DIYA 3IXRA 4MP4A 1RK4A 3E3EA 2E0QA 4PNFA 4POBA 3GX0A 4EO3A 3O3TA 1WJKA 2OBKA 2CAIA 2QC7A 1GWCA 2GSRA 4HOJA 5JWOB 20GSA 1YEPA 4HEA2 3CTGA 5AN1A 1YKCA 2R0PA 1G6WA 1CQGA 1M2AA 1K0MA 2DJ1A 1E2YA 5BMUA 1I9DA 3LQ7A 4MH3A 2R5GA 4ID0A 4HJ2A 1XW6A 2V2GA 3ERGA 3HJMA 3BBYA 4N0ZA 3TUEA 4PQ1A 2FCHA 4OFTA 1XVQA 4POMA 2JACA 3ZFLA 4ML1A 5IPHA 1F3AA 4NV2A 4KH7A 2YNXA 5DAKB 3TKPA 5GAND 5DALA 5CO3A 3IE3A 5CP1A 3FY7A 4XCSA 5INYA 1ZOFA 1ZYQB 5D8IA 3LWAA 2GS3A 2DJ0A 1AAZA 4CY8A 5HFKA 1FO5A 2A4HA 5DQSA 2GZPA 1J08A 3RPPA 1ILOA 3HJOA 1T3BA 4LMWA 2VD0A 3ZVJA 2V6OA 4F0CA 3L9UA 4L8EA 3IK7A 3CYNA 4K8MA 3NOFA 4Z7XA 1TOFA 2YCDA 3G7IA 4JBBA 4G19A 4F82A 1GSUA 4KW6A 1ZMAA 2H1DA 1HNBA 5D9XA 4X43A 2VM1A 6GSXA 4PXOA 2HRKA 2FNOA 3FW2A 1PL2A 1BEDA 1VGLA 5J4UA 3VLNA 1G0TA 2CVDA 1A2MA 1TJDA 3TKQA 3TKSA 1F6MC 1ABAA 2O89A 1YEXA 2VCVA 4X0XA 2QKEA 1TW9A 4TXOB 2E7PA 1GRXA 2IMIA 3RHBA 1XIYA 18GSA 2GT6A 4J56E 4XRDA 2AYTA 4ZIJA 1F3BA 2DIZA 1ZYEA 3P8WA 1OC3A 2GZZA 1TU8A 3RDWA 5KN1A 1RQMA 3HVVA 1Z6MA 4CW9A 1EP8A 2G2QA 2MBSA 4ECIA 2VD1A 5B6NA 3F9UA 5B6MA 3GH9A 4KDXA 4EL1A 1F9MA 1TTZA 1EWXA 5H5RA 1WIKA 4MF6A 3A3TA 4YKFA 3G7YA 1G6YA 3P7XA 4LL1B 4ECJA 4LMVA 2H72A 4LL4B 1ZL9A 2CVKA 1EOGA 2RM6A 4L5LA 4BWQA 1VF4A 3ME7A 3KTLA 2EC4A 1SJZA 4XS4A 4TN8A 3HJPA 1GTAA 3ERFA 2YWOA 1PD21 4AJ6A 1YF0A 3GYKA 2KOKA 3HZ8A 1FG4A 2MZCA 3IC4A 3IAM2 4MJEA 5AISA 4GXZA 4CHSA 1PL1A 4NV5A 1ON4A 4V2MA 5JCUA 4I6XA 4GSNA 2MMZA 4G0IA 2XPEA 4Q5RA 3MAKA 4HDEA 3I9V2 1X5CA 4Z2UA 1XWKA 1T7PB 5B8BA 3TJGA 2I4AA 4ICYA 1B4PA 4F03A 3GTUA 1JLWA 4ZB8A 1C72A 4OWYA 1VF3A 2MYGA 2FLSA 3GL3A 5J9CA 3TJBA 2VUPA 2H01A 2GQKA 1ERVA 1XWCA 3ZREA 5IMCA 5E4WA 3VURA 1I5GA 4IBPA 4BA7A 1HD2A 4L0UA 2FA4A 3HXSA 1LU4A 3F8UA 1JFUA 2HSMA 4Z2RA 3WGXA 5HR3A 4TRXA 6GSVA 5G1LA 3IBHA 1QXHA 4IQ1A 2OBIA 3GSTA 2PBJA 4KDYA 3TCOA 3ZMLA 4DSSB 2L4QA 4FO5A 1M0UA 2IIYA 2DKIA 2C3NA 3TJFA 3ZLPA 1MEKA 1GNWA 1GSYA 3Q19A 3I69A 1OVNA 1EGOA 1O7UA 5ABRA 1XW9A 2AB6A 1K3YA 5JCGA 3KH7A 5EL8A 2PVOC 1V2AA 2M46A 2HNLA 2F9SA 3GFKA 3SWLA 3KMOA 1OC9A 1PA3A 2OE1A 2C3QA 2REMA 3QFBC 6GSUA 2PMTA 2ES7A 2YWIA 1ERTA 4MCUA 2NVLA 4HS1A 1TXXA 2H0IA 4NAXA 2WZ9A 3F3RA 3TRXA 3D4TA 4HUAA 2N5BA 2L5LA 2X64A 4WKWA 4OFMA 1R5AA 1TK8B 2ZCTA 3A2VA 3U6VA 1O6JA 1Z7PA 3LGCA 2KUCA 17GSA 2A2PA 2K9FA 2VAFA 1SYRA 1M7TA 2LJRA 2X8HA 3EWLA 4GQCA 3HD5A 2O7KA 1NM3A 2H66A 4EXJA 1XWAA 2PERA 3VWWA 2B6MA 3C1SA 2L6DA 4PUAA 2GTUA 2PN8A 2YZUA 5GSTA 2N5FA 2PVQA 2NDOA 4CDOA 3PR8A 1JZOA 3FMWA 1PGTA 4K7NA 2LEGA 3F63A 1VRSD 4YAPA 1GSEA 1SENA 1M2BA 2QA1A 2I81A 3M9JA 4FYUA 2WS2A 3Q6OA 3EYTA 1S3DA 2B1KA 1NHYA 1AUCA 1O8WA 4K5RA 1O8XA 3ZIJA 3IHGA 3VPTA 3VWUA 1YJ6A 3KM6A 4EDYA 3QR6A 2HZEA 3D6IA 4EKZA 1PKWA 3L78A 3UVHA 4ECCA 3E9JB 3QD9A 3C7MA 4J2FA 4DVCA 4YQVA 2DJ2A 1T1VA 4I2TA 4OMVA 4YQMA 2X4AA 3PINA 2FD3A 1SJIA 4KAEA 1B48A 4G0LA 3LORA 1PSQA 4J57E 2P0GA 1O81A 4IP1A 7GSSA 2IPAA 4I2UA 4USSA 3A5WA 4G9HA 1HQOA 3C8EA 3C73A 3QAWA 4IJIA 1X9SB 1H75A 2VCXA 2ZNMA 2G0FA 3HA9A 3F4SA 3DIEA 3ZVJD 1QUWA 3A2WA 3LYKA 1R7HA 1PRXA 1KNGA 1KBNA 2CA8A 4ACSA 3E0UA 3DEXA 2QA2A 2IN3A 1WP0A 3I6AA 4MH2A 3RHCA 2LS5A 2V32A 2LUSA 5ID2B 3VPQA 4X4JA 4KA0A 3ZZXA 3GL5A 4KX4A 1YY7A 3ISOA 5KEJA 1F37A 2IMFA 1EV9A 3P90A 3ERWA 3TJJA 5HR0A 3D5JA 1NHOA 5D9TA 4JR6A 5EY6A 4PQHA 4FQUA 4XRAA 3V1WA 3FR6A 3PPUA 3DYRA 1PQNA 2WDUA 3TRPA 1MDJA 4TR1A 1QMVA 1EZKA 4ZILA 3DD3A 1DE2A 1X5EA 4OCEA 4IN0A 2LJAA 3KZQA 5AIVA 5IM9A 2IWTA 1PX6A 1CQHA 4WBJA 4LA1A 1TK0B 4EVMA 5ECLB 2XC2A 1N2AA 1AIUA 2R2JA 4L5OA 3GA4A 5B7CA 1QK8A 4K2DA 3H93A 2VO4A 3GN3A 4WF4A 2A4VA 1TRVA 3CSIA 2VLUA 3SBCA 3I43A 3CRUA 4GTUA 2CV4A 5ECPB 2N5AA 2IJYA 4FYBA 2OACA 2HFDA 4KF9A 3M1GA 2M80A 2HXKA 4E8EA 1HNCA 1R5PA 3KGKA 3VWXA 1Z5YE 5IMZA 3P2AA 1J0FA 2H1AA 2DJ3A 1EEJA 4V2NA 3GURA 3GX8A 1K0BA 3MIXA 4WBRD 4GLTA 4OCFA 3LJRA 4DSQA 4XTSA 2ALBA 2VIMA 1K0AA 5ECIB 1TRSA 5HQPA 5IPGA 5J41A 2H76A 4HQZA 2ON7A 2P5QA 3TDGA 4WEYA 2EIRA 3U5RE 4MABA 2H30A 3FYGA 3MYDA 2MMAA 5KN2A 1GSFA 3FEUA 3QOUA 4GWRA 1A0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS4 B;  4FYC A;  3EE2 A;  1OKD A;  3OR5 A;  1BG5 A;  3D4M A;  2GSQ A;  1NSW A;  5F06 A;  2RM5 A;  2XPD A;  3UEM A;  5DBQ A;  1G7O A;  1K0D A;  5G31 A;  4N0V A;  3WD6 A;  2FA8 A;  2CT6 A;  4POK A;  2VLV A;  1TRW A;  2EIO A;  4MPF A;  5DCH A;  5G30 A;  3DWV A;  1M9B A;  3W8J A;  1AQW A;  2Z9S A;  4RI7 A;  1G7E A;  2H75 A;  3GTU B;  3Q18 A;  2HRN A;  1IYH A;  3TB2 A;  1W4V A;  3IRA A;  3W6G A;  4O5R A;  3DXB A;  1FB0 A;  2D2Z A;  12GS A;  5IMD A;  3IDV A;  3F6D A;  4ZBD A;  1MDI A;  3F4R A;  1GSS A;  1SKR B;  2KP2 A;  4XIH A;  4MJC A;  2IMK A;  4K0G A;  2HT9 A;  1K3L A;  5B8A A;  3IPZ A;  2C0E A;  4HZ4 A;  2H1G A;  5COH A;  3PGT A;  1Y6E A;  3ZTL A;  1WRY A;  2NPB A;  3HYP A;  5ECO B;  3CSH A;  3HCZ A;  4K7O A;  1SJ6 A;  3HVS A;  4OO4 A;  3F4T A;  5FWG A;  16GS A;  1GTI A;  3BOA A;  2FWG A;  3BCK A;  5IMA A;  1Z6N A;  4RI6 A;  2XHF A;  4Q5Q A;  1B9Y C;  3BJ5 A;  5HFI A;  4O92 A;  2F51 A;  1X9W B;  3CXG A;  1AQV A;  3VI7 A;  1GSQ A;  1OC9 B;  1U87 A;  3C71 A;  3IR4 A;  4NMU A;  5ECQ B;  5C00 A;  3WT2 A;  4TVE A;  3G7J A;  2V41 A;  3UAR A;  13GS A;  2H71 A;  2R3X A;  3TRQ A;  3QDN A;  2LST A;  1SK1 A;  3NIV A;  2YWM A;  1K0O A;  1XZO A;  1UA5 A;  3QFA C;  2M72 A;  2PPT A;  2R37 A;  4ZL8 A;  3ZIT A;  2C0F A;  2RUE A;  3M3M A;  2X8C A;  2OKA A;  1Q98 A;  3LSZ A;  5CRD A;  1UC7 A;  4PQI A;  2C0G A;  5DDL A;  1TI3 A;  4KSM A;  2PWJ A;  1GH2 A;  3KH9 A;  1SL2 B;  4G10 A;  2FWE A;  2JZS A;  1SYX A;  1PN9 A;  2V1M A;  4MZW A;  4IS0 A;  2OAD A;  2KP1 A;  1YZX A;  3UAP A;  3ZYW A;  4QL9 A;  2CX3 A;  4PX1 A;  1THX A;  4GF0 A;  1BQ7 A;  5A4V A;  3GKN A;  1XPV A;  1XWG A;  2VCW A;  3DVX A;  1V98 A;  3ZFB A;  1OYJ A;  2IL3 A;  4NHW A;  2GZY A;  4AJ8 A;  2HZE B;  8GSS A;  4KUN A;  2AHE A;  1FHE A;  3WGD A;  2CAQ A;  3FKF A;  4MZB A;  5EPF A;  5CYY A;  2JL4 A;  2JZR A;  4GST A;  2GGT A;  4YQU A;  4EE0 A;  5ECH B;  3AY8 A;  4KND A;  3TOT A;  5F07 A;  2H19 A;  1H4O A;  4OO5 A;  4LLR A;  3D22 A;  3EUR A;  4NXI A;  3DRN A;  1GSD A;  3KD0 A;  3O76 A;  2CVB A;  2YV9 A;  2A2R A;  1VF2 A;  4JU5 A;  4QQ7 A;  3N5O A;  1TRU A;  4I97 A;  1FVJ A;  2IFQ A;  2LKU A;  1ERU A;  2VOC A;  6GSW A;  3IV4 A;  5JWQ B;  4MPG A;  4P3Y B;  4KE3 A;  5J9B A;  2B1L A;  5ECS A;  4D73 B;  19GS A;  4DSR A;  2KHP A;  1KTE A;  3TGZ A;  2DBC A;  4Q5F A;  2L6C A;  3GIX A;  3KEB A;  5KN0 A;  3N9J A;  4POL A;  3MDK A;  2B7K A;  4BVY A;  2C8U A;  2OA7 A;  3EU4 A;  1JHB A;  2QGV A;  2FGX A;  3NZN A;  1BAY A;  1JLV A;  3GV1 A;  1U88 A;  3HVX A;  4EC0 A;  3O6T A;  4BVX A;  3GH6 A;  1GUL A;  2WJU A;  5G5F A;  2LNS A;  4QL7 A;  1A8L A;  4EUY A;  3LYP A;  3M0F A;  2FUG 2;  3KP9 A;  2H73 A;  5D96 A;  1ACV A;  5G2Z A;  3BCI A;  2DLX A;  4K1F A;  1MTC A;  2VL2 C;  3EIN A;  4HZ2 A;  4FIW A;  3MSZ A;  6GSS A;  2F3M A;  4IVF A;  4KB3 A;  1MD3 A;  2YZH A;  3HY2 A;  4GQF A;  2DJJ A;  5IOW A;  4Q5N A;  2YN1 A;  5ENU A;  4IP6 A;  3W8S A;  1JZR A;  2R4V A;  3BD2 A;  1TKD B;  1SL0 B;  1DUG A;  1R4W A;  2MBT A;  2RLI A;  1AW9 A;  1TP9 A;  3PH9 A;  4YH2 A;  3QCP A;  2O87 A;  2ON5 A;  3ZIV A;  4ZL7 A;  1OAZ A;  3IA1 A;  2K6V A;  4ZXG A;  2PU9 C;  3D0Z A;  3DGQ A;  2WRT A;  1O73 A;  1GUH A;  1XBS A;  2O85 A;  2GDR A;  2HYX A;  3ED3 A;  4ZBB A;  3J7Y k;  1Y25 A;  3C1R A;  5DAL B;  3CSJ A;  4TKY A;  2WGR A;  3TKR A;  1OC8 A;  2AAW A;  3H4K A;  4G2E A;  5C04 A;  4AGS A;  3M9K A;  3FZ5 A;  4MK3 A;  2O8V B;  2GLR A;  2FWF A;  3QMX A;  2TRX A;  2WUL A;  3GUS A;  4EF0 A;  1T00 A;  1UVZ A;  4N11 A;  5JCW A;  3DML A;  1AC1 A;  5DJL A;  5FHI A;  1OE7 A;  4JZQ A;  2JSZ A;  3VWV A;  3FR9 A;  1AQX A;  2A2S A;  2CQ9 A;  5CAX A;  1ST9 A;  3GSS A;  4KGI A;  3WT1 A;  1N8J A;  5IO2 A;  1M9A A;  3D21 A;  4ML6 A;  5H5S A;  2LRC A;  3KCM A;  2VM2 A;  1SL1 B;  4MF5 A;  3UL3 A;  4BL7 A;  4GSS A;  5D93 A;  2H6X A;  4OFN A;  4IGJ A;  4KSO A;  4TR4 A;  3LG6 A;  2I9H A;  1ML6 A;  1ZCP A;  5LCZ A;  2GST A;  4K6X A;  2H8L A;  5ID2 A;  2PUK C;  1A2L A;  4O32 A;  2NTO A;  1WE0 A;  2DC5 A;  2LQO A;  1YQ1 A;  1GUM A;  2EIQ A;  2CZ2 A;  4ILF A;  4NPB A;  4IW9 A;  3A2X A;  2H6Y A;  3HZ4 A;  5ECR B;  1BYE A;  2B3S A;  2B5Y A;  3IOS A;  2HZF A;  1V9W A;  2VLT A;  5DCG A;  4JED A;  4RQX A;  1O85 A;  1WOU A;  1EP7 A;  5IMF A;  4OD7 A;  4ZB9 A;  2I3Y A;  2X8G A;  2DSA A;  1GUK A;  2VCQ A;  5FT3 A;  2IMD A;  1KEB A;  1XW5 A;  4MZC A;  2V6K A;  1USB A;  2LRN A;  4K7I A;  2VCZ A;  2P5R A;  2WCI A;  1M2D A;  2I1U A;  2AUV A;  3FZ4 A;  4ISD A;  3FZ9 A;  1A23 A;  3HDC A;  1K0N A;  5DVB A;  5CRW A;  3LXZ A;  2AV4 A;  3RPN A;  2HI7 A;  3MWH A;  3CTF A;  4H86 A;  5AIX A;  1EOH A;  2HSY A;  1HYU A;  2K8V A;  4E8H A;  4F9Z A;  1WMJ A;  2LNT A;  3ZMK A;  2R6K A;  2VL9 A;  2GSS A;  4XS1 A;  1TK5 B;  1GLP A;  5ELA A;  1E6B A;  1XXU A;  2FY6 A;  5DAK A;  2BTO T;  3G9B A;  1PX7 A;  2DJK A;  1Q4J A;  4MDC A;  4N30 A;  1MDK A;  2DMM A;  14GS A;  3VFI A;  1LJR A;  3RBT A;  3UBL A;  1M99 A;  4XS6 A;  3LFL A;  1XCC A;  1F2E A;  1A2J A;  2KLX A;  1T4Z A;  1U3A A;  2F8F A;  2J23 A;  3EMP A;  3FHK A;  3F6F A;  2B5E A;  1XVW A;  2HE3 A;  2L4C A;  2AJQ B;  1S3A A;  10GS A;  3APS A;  4ECB A;  4AJ7 A;  2TIR A;  1DSB A;  3H8Q A;  1R26 A;  2JSY A;  3UMA A;  1X5D A;  2YV7 A;  1UN2 A;  3L0H A;  5IMV A;  5ELG A;  4HQS A;  2C1Y A;  3DKS A;  2BMX A;  2OE0 A;  2OJL A;  3J7Y b;  3F3Q A;  2MMO A;  3L4N A;  4O7H A;  3Q74 A;  2RII A;  3ZRD A;  1YF1 A;  3F0I A;  2YJ7 A;  3R2Q A;  5IO0 A;  2XBQ A;  3H79 A;  4WR5 A;  5JWR B;  2BJX A;  1Z3E A;  5F0G A;  2OE3 A;  4TXO A;  1A8Y A;  3GNJ A;  4NHZ A;  2PGT A;  4TR3 A;  4WXT A;  1GTU A;  1T8E B;  5L71 A;  1QFN A;  2X99 A;  2LRT A;  2HRF A;  5D9V A;  1EEM A;  3JCM L;  5A5K A;  4TR0 A;  1AXD A;  1B8X A;  2K8S A;  5GZZ B;  3UVT A;  1J9B A;  2C80 A;  1XWB A;  2GT5 A;  2GVP A;  5HFG A;  3TKS C;  1W89 A;  1SK2 A;  1NW2 A;  3K8N A;  4WR4 A;  3GHA A;  4BWS A;  2QSI A;  2C0D A;  5F8B A;  1BJX A;  5DJM A;  5ECM B;  4KCA A;  2YWN A;  2L59 A;  3FRC A;  4ZL9 A;  4TXV A;  3GKK A;  5G5E A;  3US3 A;  1ZGN A;  4K9Z A;  4JE1 A;  5LNK e;  3L9V A;  2H6Z A;  1SD8 A;  4F0B A;  5D9W A;  4MLY A;  3KP8 A;  3UIW A;  1JZW A;  1K0C A;  5KN3 A;  4HU7 A;  9GSS A;  1Z7R A;  2JU5 A;  4EDZ A;  2HLS A;  3KTB A;  5IQY A;  6GST A;  3LXT A;  5A4W A;  4JRR A;  1K3O A;  3IAS 2;  1X9M B;  3CBU A;  5CRG A;  1V40 A;  2VCT A;  2IFQ B;  2IME A;  2C4J A;  2LV3 A;  5J3R A;  4WF5 A;  5F05 A;  4K0N A;  4TOP A;  1GNE A;  2HSH A;  2YPM A;  2VL2 A;  5GAP D;  1YKA A;  1XOA A;  3LEF A;  1OE8 A;  4HU9 A;  5CNW A;  2JZT A;  1SKW B;  1PMT A;  3ME8 A;  5LD0 A;  3DVW A;  2H0G A;  5HR1 A;  4MJB A;  5DQY A;  2WFC A;  5AGY A;  4MJA A;  4I8B A;  2P31 A;  4MF7 A;  2LTK A;  4PNG A;  2MMN A;  1WWJ A;  2B7J A;  1SU9 A;  1QGV A;  3M8N A;  3MNG A;  2VL3 A;  4V1A p;  1FVK A;  1FW1 A;  2CX4 A;  3VI5 A;  1DBY A;  1A0R P;  4RUV A;  1LBK A;  2E2M A;  2NBS A;  4ZBA A;  1FAA A;  2WB9 A;  1V58 A;  4BPY A;  3QAV A;  4DSS A;  4IKH A;  4PGT A;  3TJK A;  3IK9 A;  2RUF A;  3HKR A;  1ERW A;  1QQ2 A;  1WPI A;  1JZD A;  4IEL A;  3TOU A;  4KCE A;  4PUR A;  2H74 A;  11GS A;  3RAZ A;  1Z9H A;  1ZZY A;  1BX9 A;  4MMM A;  3UJ1 A;  4GRF A;  4JR4 A;  3EMX A;  3FK8 A;  4XHM A;  3EC3 A;  1U3I A;  1X0R A;  3TKS E;  1XOB A;  2L5O A;  2J9H A;  4KDU A;  4DEJ A;  4RQR A;  3KIJ A;  4IJ3 A;  2H70 A;  1FOV A;  3GKM A;  4I5Q A;  1GLQ A;  5D73 A;  2B5X A;  4HJM A;  1TU7 A;  2FWH A;  3WYW A;  1PKZ A;  5CRE A;  5IOX A;  1FB6 A;  5E59 A;  1GL8 A;  5CRH A;  2LQQ A;  4N10 A;  4TR1 B;  3KMN A;  2H1B A;  1THO A;  3FR3 A;  5HR2 A;  1IYI A;  4TW5 A;  4FH8 A;  3IHQ A;  1A24 A;  1T4Y A;  4IQA A;  3ZL5 A;  4L0W A;  1YDK A;  2ZUP A;  4MA9 A;  4X1U A;  3VK9 A;  1EGR A;  1XFL A;  3GMF A;  3HHV A;  4V2L A;  1S3C A;  4WET A;  1OKT A;  1MD4 A;  1EV4 A;  3UOM A;  1VF1 A;  1U6T A;  5J5N A;  4ULX A;  4PUF C;  5IIZ A;  3EVI A;  1TI1 A;  3CMI A;  4GCI A;  2LJK A;  1SK0 A;  3GRX A;  5GSS A;  4HI7 A;  2GQM A;  1TDI A;  3KJY A;  1V57 A;  3CRT A;  2JAD A;  3H1N A;  3WGE A;  3L9S A;  4NWY A;  2L57 A;  3QPM A;  2FHE A;  4ZB6 A;  1URM A;  2GQL A;  2XBI A;  5ECK B;  1DE1 A;  4D73 A;  1B4Q A;  3GKX A;  2YJH A;  4YAV A;  3FZA A;  1HNA A;  4F2I A;  1SD9 A;  5A4U A;  5H5Q A;  3QAG A;  4IHU A;  2H0H A;  1SKS B;  5ECN B;  4AF2 A;  1GP1 A;  1GTB A;  1RW1 A;  3KXO A;  6GSY A;  2TRC P;  2E2G A;  3APO A;  5EVO A;  3APQ A;  2DML A;  3S9F A;  2F8A A;  3EU3 A;  22GS A;  2YOI A;  4V1A g;  2CZ3 A;  2YAN A;  5G1K A;  2C3T A;  2YP6 A;  1B9X C;  2K18 A;  3UBK A;  2DIY A;  3IXR A;  4MP4 A;  1RK4 A;  3E3E A;  2E0Q A;  4PNF A;  4POB A;  3GX0 A;  4EO3 A;  3O3T A;  1WJK A;  2OBK A;  2CAI A;  2QC7 A;  1GWC A;  2GSR A;  4HOJ A;  5JWO B;  20GS A;  1YEP A;  4HEA 2;  3CTG A;  5AN1 A;  1YKC A;  1G6W A;  1CQG A;  1M2A A;  1K0M A;  2DJ1 A;  1E2Y A;  1I9D A;  3LQ7 A;  4MH3 A;  2R5G A;  4ID0 A;  4HJ2 A;  1XW6 A;  2V2G A;  3ERG A;  3HJM A;  3BBY A;  4N0Z A;  3TUE A;  4PQ1 A;  2FCH A;  4OFT A;  1XVQ A;  4POM A;  2JAC A;  3ZFL A;  4ML1 A;  5IPH A;  1F3A A;  4NV2 A;  4KH7 A;  2YNX A;  5DAK B;  3TKP A;  5GAN D;  5DAL A;  5CO3 A;  3IE3 A;  5CP1 A;  3FY7 A;  4XCS A;  5INY A;  1ZOF A;  1ZYQ B;  5D8I A;  3LWA A;  2GS3 A;  2DJ0 A;  1AAZ A;  5HFK A;  1FO5 A;  5DQS A;  2GZP A;  1J08 A;  3RPP A;  1ILO A;  3HJO A;  1T3B A;  4LMW A;  2VD0 A;  3ZVJ A;  2V6O A;  4F0C A;  3L9U A;  4L8E A;  3IK7 A;  3CYN A;  4K8M A;  3NOF A;  4Z7X A;  1TOF A;  2YCD A;  3G7I A;  4JBB A;  4G19 A;  4F82 A;  1GSU A;  4KW6 A;  1ZMA A;  2H1D A;  1HNB A;  5D9X A;  4X43 A;  2VM1 A;  6GSX A;  4PXO A;  2FNO A;  3FW2 A;  1PL2 A;  1BED A;  1VGL A;  5J4U A;  3VLN A;  1G0T A;  2CVD A;  1A2M A;  1TJD A;  3TKQ A;  3TKS A;  1F6M C;  1ABA A;  2O89 A;  1YEX A;  2VCV A;  4X0X A;  2QKE A;  1TW9 A;  4TXO B;  2E7P A;  1GRX A;  2IMI A;  3RHB A;  1XIY A;  18GS A;  2GT6 A;  4J56 E;  4XRD A;  2AYT A;  4ZIJ A;  1F3B A;  2DIZ A;  1ZYE A;  3P8W A;  1OC3 A;  2GZZ A;  1TU8 A;  3RDW A;  5KN1 A;  1RQM A;  3HVV A;  1Z6M A;  4CW9 A;  1EP8 A;  2G2Q A;  2MBS A;  4ECI A;  2VD1 A;  5B6N A;  3F9U A;  5B6M A;  3GH9 A;  4KDX A;  4EL1 A;  1F9M A;  1TTZ A;  1EWX A;  5H5R A;  1WIK A;  4MF6 A;  3A3T A;  3G7Y A;  1G6Y A;  3P7X A;  4LL1 B;  4ECJ A;  4LMV A;  2H72 A;  4LL4 B;  1ZL9 A;  2CVK A;  1EOG A;  2RM6 A;  4L5L A;  4BWQ A;  1VF4 A;  3ME7 A;  3KTL A;  2EC4 A;  1SJZ A;  4XS4 A;  4TN8 A;  3HJP A;  1GTA A;  3ERF A;  2YWO A;  1PD2 1;  4AJ6 A;  1YF0 A;  3GYK A;  2KOK A;  3HZ8 A;  1FG4 A;  2MZC A;  3IC4 A;  3IAM 2;  4MJE A;  5AIS A;  4GXZ A;  4CHS A;  1PL1 A;  4NV5 A;  1ON4 A;  4V2M A;  5JCU A;  4I6X A;  2MMZ A;  4GSN A;  2XPE A;  4Q5R A;  3MAK A;  4HDE A;  3I9V 2;  1X5C A;  1XWK A;  1T7P B;  5B8B A;  3TJG A;  2I4A A;  1B4P A;  4F03 A;  3GTU A;  1JLW A;  4ZB8 A;  1C72 A;  4OWY A;  1VF3 A;  2MYG A;  2FLS A;  3GL3 A;  5J9C A;  3TJB A;  2VUP A;  2H01 A;  2GQK A;  1ERV A;  1XWC A;  3ZRE A;  5IMC A;  5E4W A;  3VUR A;  1I5G A;  4IBP A;  4BA7 A;  1HD2 A;  4L0U A;  2FA4 A;  3HXS A;  1LU4 A;  3F8U A;  1JFU A;  3WGX A;  5HR3 A;  4TRX A;  6GSV A;  5G1L A;  3IBH A;  1QXH A;  4IQ1 A;  2OBI A;  3GST A;  2PBJ A;  4KDY A;  3TCO A;  3ZML A;  4DSS B;  2L4Q A;  4FO5 A;  1M0U A;  2IIY A;  2C3N A;  3TJF A;  3ZLP A;  1MEK A;  1GNW A;  1GSY A;  3Q19 A;  3I69 A;  1OVN A;  1EGO A;  1O7U A;  5ABR A;  1XW9 A;  2AB6 A;  1K3Y A;  5JCG A;  3KH7 A;  5EL8 A;  2PVO C;  1V2A A;  2M46 A;  2HNL A;  2F9S A;  3GFK A;  3SWL A;  3KMO A;  1OC9 A;  1PA3 A;  2OE1 A;  2C3Q A;  2REM A;  3QFB C;  6GSU A;  2PMT A;  2ES7 A;  2YWI A;  1ERT A;  4MCU A;  2NVL A;  4HS1 A;  1TXX A;  2H0I A;  4NAX A;  2WZ9 A;  3F3R A;  3TRX A;  3D4T A;  4HUA A;  2N5B A;  2L5L A;  2X64 A;  4WKW A;  4OFM A;  1R5A A;  1TK8 B;  2ZCT A;  3A2V A;  3U6V A;  1O6J A;  1Z7P A;  3LGC A;  2KUC A;  17GS A;  2K9F A;  2VAF A;  1SYR A;  1M7T A;  2LJR A;  2X8H A;  3EWL A;  4GQC A;  3HD5 A;  2O7K A;  1NM3 A;  2H66 A;  4EXJ A;  1XWA A;  2PER A;  3VWW A;  2B6M A;  3C1S A;  2L6D A;  4PUA A;  2GTU A;  2PN8 A;  2YZU A;  5GST A;  2N5F A;  2PVQ A;  2NDO A;  4CDO A;  3PR8 A;  1JZO A;  1PGT A;  4K7N A;  2LEG A;  3F63 A;  1VRS D;  4YAP A;  1GSE A;  1SEN A;  1M2B A;  2I81 A;  3M9J A;  4FYU A;  2WS2 A;  3Q6O A;  3EYT A;  1S3D A;  2B1K A;  1NHY A;  1AUC A;  1O8W A;  1O8X A;  3ZIJ A;  3VPT A;  3VWU A;  1YJ6 A;  3KM6 A;  4EDY A;  3QR6 A;  2HZE A;  3D6I A;  4EKZ A;  1PKW A;  3L78 A;  3UVH A;  4ECC A;  3E9J B;  3QD9 A;  3C7M A;  4J2F A;  4DVC A;  4YQV A;  2DJ2 A;  1T1V A;  4I2T A;  4OMV A;  4YQM A;  3PIN A;  2FD3 A;  1SJI A;  4KAE A;  1B48 A;  3LOR A;  1PSQ A;  4J57 E;  2P0G A;  1O81 A;  4IP1 A;  7GSS A;  2IPA A;  4I2U A;  3A5W A;  4G9H A;  1HQO A;  3C8E A;  3C73 A;  3QAW A;  4IJI A;  1X9S B;  1H75 A;  2VCX A;  2ZNM A;  2G0F A;  3HA9 A;  3F4S A;  3DIE A;  3ZVJ D;  1QUW A;  3A2W A;  3LYK A;  1R7H A;  1PRX A;  1KNG A;  1KBN A;  2CA8 A;  4ACS A;  3E0U A;  3DEX A;  2IN3 A;  1WP0 A;  3I6A A;  4MH2 A;  3RHC A;  2LS5 A;  2V32 A;  2LUS A;  5ID2 B;  3VPQ A;  4KA0 A;  3ZZX A;  3GL5 A;  4KX4 A;  1YY7 A;  3ISO A;  5KEJ A;  1F37 A;  2IMF A;  1EV9 A;  3P90 A;  3ERW A;  3TJJ A;  5HR0 A;  3D5J A;  1NHO A;  5D9T A;  4JR6 A;  5EY6 A;  4PQH A;  4XRA A;  3V1W A;  3FR6 A;  3DYR A;  1PQN A;  2WDU A;  3TRP A;  1MDJ A;  4TR1 A;  1QMV A;  1EZK A;  4ZIL A;  3DD3 A;  1DE2 A;  1X5E A;  4OCE A;  4IN0 A;  2LJA A;  3KZQ A;  5AIV A;  5IM9 A;  2IWT A;  1PX6 A;  1CQH A;  4WBJ A;  4LA1 A;  1TK0 B;  4EVM A;  5ECL B;  2XC2 A;  1N2A A;  1AIU A;  2R2J A;  4L5O A;  3GA4 A;  5B7C A;  1QK8 A;  4K2D A;  3H93 A;  2VO4 A;  3GN3 A;  4WF4 A;  2A4V A;  1TRV A;  3CSI A;  2VLU A;  3SBC A;  3I43 A;  3CRU A;  4GTU A;  5ECP B;  2CV4 A;  2N5A A;  2IJY A;  4FYB A;  2OAC A;  2HFD A;  3M1G A;  2M80 A;  2HXK A;  4E8E A;  1HNC A;  1R5P A;  3KGK A;  3VWX A;  1Z5Y E;  5IMZ A;  3P2A A;  1J0F A;  2H1A A;  2DJ3 A;  1EEJ A;  4V2N A;  3GUR A;  3GX8 A;  1K0B A;  4WBR D;  4GLT A;  4OCF A;  3LJR A;  4DSQ A;  4XTS A;  2ALB A;  2VIM A;  1K0A A;  5ECI B;  1TRS A;  5HQP A;  5IPG A;  5J41 A;  2H76 A;  4HQZ A;  2ON7 A;  2P5Q A;  3TDG A;  4WEY A;  2EIR A;  3U5R E;  4MAB A;  2H30 A;  3FYG A;  2MMA A;  5KN2 A;  1GSF A;  3FEU A;  3QOU A;  4GWR A;  1A0F A; 
#chains in the Genus database with same CATH topology
 4XS4 B;  4FYC A;  4HSC X;  3EE2 A;  1OKD A;  3OR5 A;  1BG5 A;  3D4M A;  2GSQ A;  1NSW A;  5F06 A;  2RM5 A;  2XPD A;  3UEM A;  5DBQ A;  1G7O A;  1K0D A;  5G31 A;  4N0V A;  3WD6 A;  2FA8 A;  2UZ8 A;  2CT6 A;  4POK A;  2VLV A;  1TRW A;  2EIO A;  4MPF A;  5DCH A;  5G30 A;  3DWV A;  1M9B A;  3W8J A;  1AQW A;  2Z9S A;  4RI7 A;  1G7E A;  2H75 A;  3GTU B;  3Q18 A;  2HRN A;  1IYH A;  3TB2 A;  1W4V A;  3IRA A;  3W6G A;  4O5R A;  3DXB A;  2HRA A;  1FB0 A;  2D2Z A;  12GS A;  5IMD A;  3IDV A;  3F6D A;  4ZBD A;  1MDI A;  3F4R A;  1GSS A;  1SKR B;  2KP2 A;  4XIH A;  4MJC A;  2IMK A;  4K0G A;  2HT9 A;  1K3L A;  5B8A A;  3IPZ A;  2C0E A;  4HZ4 A;  2H1G A;  5COH A;  3PGT A;  1Y6E A;  3ZTL A;  1WRY A;  2NPB A;  3HYP A;  5ECO B;  3CSH A;  3HCZ A;  4K7O A;  1SJ6 A;  3HVS A;  4OO4 A;  3F4T A;  5FWG A;  16GS A;  1GTI A;  3BOA A;  2FWG A;  3BCK A;  5IMA A;  1Z6N A;  4RI6 A;  2XHF A;  4Q5Q A;  1B9Y C;  3BJ5 A;  5HFI A;  4O92 A;  2F51 A;  1X9W B;  3CXG A;  1AQV A;  3VI7 A;  1GSQ A;  1OC9 B;  1U87 A;  3C71 A;  3IR4 A;  4NMU A;  5ECQ B;  5C00 A;  3WT2 A;  4TVE A;  3G7J A;  2V41 A;  3UAR A;  13GS A;  2H71 A;  2R3X A;  3TRQ A;  3QDN A;  2LST A;  1SK1 A;  3NIV A;  2YWM A;  1K0O A;  1XZO A;  1UA5 A;  3QFA C;  4K2X A;  2M72 A;  4A5P A;  2PPT A;  2R37 A;  4ZL8 A;  3ZIT A;  2C0F A;  2RUE A;  3M3M A;  2X8C A;  2OKA A;  1Q98 A;  3LSZ A;  5CRD A;  1UC7 A;  4PQI A;  2C0G A;  5DDL A;  1TI3 A;  4KSM A;  2PWJ A;  1GH2 A;  3KH9 A;  1SL2 B;  4G10 A;  2FWE A;  2JZS A;  1SYX A;  1PN9 A;  2V1M A;  4MZW A;  4IS0 A;  2OAD A;  2KP1 A;  1YZX A;  3UAP A;  3ZYW A;  4QL9 A;  2CX3 A;  4PX1 A;  1THX A;  4GF0 A;  1BQ7 A;  5A4V A;  3GKN A;  1XPV A;  1XWG A;  2VCW A;  3DVX A;  1V98 A;  3ZFB A;  1OYJ A;  2IL3 A;  4NHW A;  4K5S A;  2GZY A;  4AJ8 A;  2HZE B;  8GSS A;  4KUN A;  2AHE A;  1FHE A;  3WGD A;  2CAQ A;  3FKF A;  4MZB A;  5EPF A;  5CYY A;  2JL4 A;  2JZR A;  4GST A;  2GGT A;  4YQU A;  4EE0 A;  5ECH B;  3AY8 A;  4KND A;  3TOT A;  5F07 A;  2H19 A;  1H4O A;  4OO5 A;  4LLR A;  4G0K A;  3D22 A;  3EUR A;  4NXI A;  3DRN A;  1GSD A;  3KD0 A;  3O76 A;  2CVB A;  2YV9 A;  2A2R A;  1VF2 A;  4JU5 A;  4QQ7 A;  3N5O A;  1TRU A;  4I97 A;  1FVJ A;  2IFQ A;  2LKU A;  1ERU A;  2VOC A;  6GSW A;  3IV4 A;  5JWQ B;  4MPG A;  4P3Y B;  4KE3 A;  5J9B A;  2B1L A;  5ECS A;  4D73 B;  19GS A;  4DSR A;  2KHP A;  1KTE A;  3TGZ A;  2DBC A;  4Q5F A;  2L6C A;  3GIX A;  3KEB A;  5KN0 A;  3N9J A;  4POL A;  3MDK A;  2B7K A;  4BVY A;  2C8U A;  2OA7 A;  3EU4 A;  1JHB A;  2QGV A;  2FGX A;  3NZN A;  1M3I A;  1BAY A;  1JLV A;  3GV1 A;  1U88 A;  3HVX A;  4EC0 A;  3O6T A;  4BVX A;  3GH6 A;  1GUL A;  2WJU A;  5G5F A;  2DKH A;  2LNS A;  4QL7 A;  1A8L A;  4EUY A;  3LYP A;  3M0F A;  2FUG 2;  3KP9 A;  2H73 A;  5D96 A;  1ACV A;  5G2Z A;  3BCI A;  2DLX A;  4K1F A;  1MTC A;  2VL2 C;  3EIN A;  4HZ2 A;  4FIW A;  3MSZ A;  6GSS A;  2F3M A;  4IVF A;  4KB3 A;  1MD3 A;  2YZH A;  3HY2 A;  4GQF A;  2DJJ A;  5IOW A;  1ZYP A;  4Q5N A;  2YN1 A;  5ENU A;  4IP6 A;  3W8S A;  1JZR A;  2R4V A;  3BD2 A;  1TKD B;  1SL0 B;  1DUG A;  1R4W A;  2MBT A;  2RLI A;  1AW9 A;  1TP9 A;  3PH9 A;  4YH2 A;  3QCP A;  2O87 A;  2R0C A;  2ON5 A;  3ZIV A;  4ZL7 A;  1OAZ A;  3IA1 A;  2K6V A;  4ZXG A;  2PU9 C;  3D0Z A;  3DGQ A;  2WRT A;  1O73 A;  1GUH A;  1XBS A;  2O85 A;  2GDR A;  2HYX A;  3ED3 A;  4ZBB A;  3J7Y k;  1Y25 A;  3C1R A;  5DAL B;  3CSJ A;  4TKY A;  2WGR A;  3TKR A;  1OC8 A;  2AAW A;  3H4K A;  4G2E A;  5C04 A;  4AGS A;  3M9K A;  3FZ5 A;  4MK3 A;  2O8V B;  2GLR A;  2FWF A;  3QMX A;  2TRX A;  2WUL A;  3GUS A;  4EF0 A;  1T00 A;  1UVZ A;  4N11 A;  5JCW A;  3DML A;  1AC1 A;  5DJL A;  5FHI A;  1OE7 A;  4JZQ A;  2JSZ A;  3VWV A;  3FR9 A;  1AQX A;  2A2S A;  2CQ9 A;  5CAX A;  4CY6 A;  1ST9 A;  3GSS A;  4KGI A;  3WT1 A;  1N8J A;  5IO2 A;  1M9A A;  3D21 A;  4ML6 A;  5H5S A;  2LRC A;  3KCM A;  2VM2 A;  1SL1 B;  4MF5 A;  4EIQ A;  5KOX A;  3UL3 A;  4BL7 A;  4GSS A;  5D93 A;  2H6X A;  4OFN A;  4IGJ A;  4KSO A;  4TR4 A;  3LG6 A;  2I9H A;  1ML6 A;  1ZCP A;  5LCZ A;  2GST A;  4K6X A;  2H8L A;  5ID2 A;  2PUK C;  1A2L A;  4O32 A;  2NTO A;  1WE0 A;  3CQF A;  2DC5 A;  2LQO A;  1YQ1 A;  1GUM A;  2EIQ A;  2CZ2 A;  4ILF A;  4NPB A;  4IW9 A;  3A2X A;  2H6Y A;  3HZ4 A;  5ECR B;  1BYE A;  2B3S A;  1XG8 A;  2B5Y A;  2HZF A;  3IOS A;  1V9W A;  2VLT A;  5DCG A;  4JED A;  4RQX A;  1O85 A;  1WOU A;  1EP7 A;  5IMF A;  4OD7 A;  4ZB9 A;  2I3Y A;  2X49 A;  2X8G A;  2DSA A;  1GUK A;  2VCQ A;  5FT3 A;  2IMD A;  1KEB A;  1XW5 A;  4MZC A;  2V6K A;  1USB A;  2LRN A;  4K7I A;  2VCZ A;  2P5R A;  2WCI A;  1M2D A;  2I1U A;  2AUV A;  3FZ4 A;  4ISD A;  3FZ9 A;  1A23 A;  3HDC A;  3R3E A;  1K0N A;  5DVB A;  5CRW A;  3LXZ A;  2AV4 A;  3RPN A;  2HI7 A;  3MWH A;  3CTF A;  4H86 A;  5AIX A;  1EOH A;  2HSY A;  1HYU A;  2K8V A;  4E8H A;  4F9Z A;  1WMJ A;  2LNT A;  3ZMK A;  2R6K A;  2VL9 A;  2GSS A;  4XS1 A;  1TK5 B;  1GLP A;  5ELA A;  1E6B A;  1XXU A;  2FY6 A;  5DAK A;  2BTO T;  3G9B A;  1PX7 A;  2DJK A;  1Q4J A;  4MDC A;  4N30 A;  1MDK A;  2DMM A;  14GS A;  3VFI A;  1LJR A;  3RBT A;  3UBL A;  1M99 A;  4XS6 A;  3LFL A;  1XCC A;  1F2E A;  1A2J A;  2KLX A;  1T4Z A;  1U3A A;  2F8F A;  2J23 A;  3EMP A;  3FHK A;  3F6F A;  2B5E A;  1XVW A;  2HE3 A;  2L4C A;  2AJQ B;  1S3A A;  10GS A;  3APS A;  4ECB A;  4AJ7 A;  2TIR A;  1DSB A;  3H8Q A;  1R26 A;  2JSY A;  3UMA A;  1X5D A;  2YV7 A;  1UN2 A;  3L0H A;  5IMV A;  5ELG A;  4HQS A;  2C1Y A;  3DKS A;  2BMX A;  2OE0 A;  2OJL A;  3J7Y b;  3F3Q A;  2MMO A;  3L4N A;  4O7H A;  3Q74 A;  2RII A;  3ZRD A;  1YF1 A;  3F0I A;  2YJ7 A;  3R2Q A;  5IO0 A;  2XBQ A;  3H79 A;  3IC8 A;  4WR5 A;  5BRT A;  5JWR B;  2BJX A;  1Z3E A;  5F0G A;  2OE3 A;  4TXO A;  1A8Y A;  3GNJ A;  4NHZ A;  4EIP A;  2PGT A;  4TR3 A;  4WXT A;  1GTU A;  1T8E B;  5L71 A;  1QFN A;  2X99 A;  2LRT A;  2HRF A;  5D9V A;  1EEM A;  3JCM L;  5A5K A;  4TR0 A;  1AXD A;  1B8X A;  2K8S A;  1FOH A;  4O5U A;  5GZZ B;  3UVT A;  1J9B A;  2C80 A;  1XWB A;  2GT5 A;  2GVP A;  5HFG A;  3TKS C;  1W89 A;  1SK2 A;  1NW2 A;  3K8N A;  4WR4 A;  4O5Q A;  5KOW A;  3GHA A;  4BWS A;  2QSI A;  2C0D A;  5F8B A;  1BJX A;  4KCA A;  5DJM A;  5ECM B;  2YWN A;  2L59 A;  3FRC A;  4ZL9 A;  4TXV A;  3GKK A;  5G5E A;  3US3 A;  1ZGN A;  4K9Z A;  4JE1 A;  5LNK e;  3L9V A;  2H6Z A;  1SD8 A;  4F0B A;  5D9W A;  4MLY A;  3KP8 A;  3UIW A;  1JZW A;  4Z2T A;  1K0C A;  5KN3 A;  3A5I A;  4HU7 A;  9GSS A;  1Z7R A;  2JU5 A;  4EDZ A;  2HLS A;  3KTB A;  5IQY A;  6GST A;  3LXT A;  5A4W A;  4JRR A;  1K3O A;  3IAS 2;  1X9M B;  3CBU A;  5CRG A;  1V40 A;  2VCT A;  2IFQ B;  2IME A;  2C4J A;  2LV3 A;  5J3R A;  4WF5 A;  5F05 A;  4K0N A;  4TOP A;  1GNE A;  2HSH A;  2YPM A;  2VL2 A;  5GAP D;  1YKA A;  1XOA A;  3LEF A;  1OE8 A;  1PN0 A;  4HU9 A;  5CNW A;  2JZT A;  1SKW B;  1PMT A;  3ME8 A;  5LD0 A;  3DVW A;  2H0G A;  5HR1 A;  4MJB A;  5DQY A;  4BVY B;  2WFC A;  5AGY A;  4MJA A;  4I8B A;  2P31 A;  4MF7 A;  2LTK A;  4PNG A;  2MMN A;  1WWJ A;  2B7J A;  1SU9 A;  4BVX B;  1QGV A;  3M8N A;  3MNG A;  2VL3 A;  4V1A p;  1FVK A;  1FW1 A;  2CX4 A;  3VI5 A;  1DBY A;  1A0R P;  4RUV A;  1LBK A;  2E2M A;  2NBS A;  4ZBA A;  1FAA A;  2WB9 A;  1V58 A;  4BPY A;  3QAV A;  4DSS A;  4IKH A;  4PGT A;  3TJK A;  3IK9 A;  2RUF A;  3HKR A;  1ERW A;  1QQ2 A;  1WPI A;  1JZD A;  4IEL A;  3TOU A;  4KCE A;  4PUR A;  2H74 A;  11GS A;  3RAZ A;  1Z9H A;  1ZZY A;  1BX9 A;  4MMM A;  3UJ1 A;  4GRF A;  4JR4 A;  3EMX A;  3FK8 A;  4XHM A;  3EC3 A;  3LW9 A;  1U3I A;  1X0R A;  3TKS E;  1XOB A;  2L5O A;  2J9H A;  4KDU A;  4DEJ A;  4RQR A;  3KIJ A;  1M3J A;  4IJ3 A;  2H70 A;  1FOV A;  3GKM A;  4I5Q A;  3EPT A;  4MNN A;  1GLQ A;  5D73 A;  2B5X A;  4HJM A;  1TU7 A;  2FWH A;  3WYW A;  1PKZ A;  5CRE A;  5IOX A;  1FB6 A;  5E59 A;  1GL8 A;  5CRH A;  2LQQ A;  4N10 A;  4TR1 B;  3KMN A;  2H1B A;  1THO A;  3FR3 A;  5HR2 A;  1IYI A;  4TW5 A;  4FH8 A;  3IHQ A;  1A24 A;  1T4Y A;  4IQA A;  3ZL5 A;  4L0W A;  1YDK A;  2ZUP A;  4MA9 A;  4X1U A;  3VK9 A;  1EGR A;  1XFL A;  1ZYN A;  3GMF A;  3HHV A;  4V2L A;  1S3C A;  4WET A;  1OKT A;  1MD4 A;  1EV4 A;  3UOM A;  1VF1 A;  1U6T A;  5J5N A;  4ULX A;  4PUF C;  5IIZ A;  3EVI A;  2R0G A;  1TI1 A;  3CMI A;  4GCI A;  2LJK A;  1SK0 A;  3GRX A;  5GSS A;  4HI7 A;  2GQM A;  1TDI A;  3KJY A;  1V57 A;  3CRT A;  2JAD A;  3H1N A;  3WGE A;  4PTS A;  3L9S A;  4NWY A;  2L57 A;  3QPM A;  2FHE A;  4ZB6 A;  1URM A;  4BL7 B;  2GQL A;  2XBI A;  5ECK B;  1DE1 A;  4D73 A;  1B4Q A;  3GKX A;  2YJH A;  4YAV A;  3FZA A;  1HNA A;  4F2I A;  1SD9 A;  5A4U A;  5H5Q A;  3QAG A;  4IHU A;  2H0H A;  4YKG A;  1SKS B;  5ECN B;  4AF2 A;  1GP1 A;  1GTB A;  1RW1 A;  3KXO A;  6GSY A;  2TRC P;  2E2G A;  3APO A;  5EVO A;  3APQ A;  2DML A;  3S9F A;  2F8A A;  3EU3 A;  22GS A;  2YOI A;  4V1A g;  2CZ3 A;  2YAN A;  5G1K A;  2C3T A;  2YP6 A;  1B9X C;  2K18 A;  3UBK A;  2DIY A;  3IXR A;  4MP4 A;  1RK4 A;  3E3E A;  2E0Q A;  4PNF A;  4POB A;  3GX0 A;  4EO3 A;  3O3T A;  1WJK A;  2OBK A;  2CAI A;  2QC7 A;  1GWC A;  2GSR A;  4HOJ A;  5JWO B;  20GS A;  1YEP A;  4HEA 2;  3CTG A;  5AN1 A;  1YKC A;  2R0P A;  1G6W A;  1CQG A;  1M2A A;  1K0M A;  2DJ1 A;  1E2Y A;  5BMU A;  1I9D A;  3LQ7 A;  4MH3 A;  2R5G A;  4ID0 A;  4HJ2 A;  1XW6 A;  2V2G A;  3ERG A;  3HJM A;  3BBY A;  4N0Z A;  3TUE A;  4PQ1 A;  2FCH A;  4OFT A;  1XVQ A;  4POM A;  2JAC A;  3ZFL A;  4ML1 A;  5IPH A;  1F3A A;  4NV2 A;  4KH7 A;  2YNX A;  5DAK B;  3TKP A;  5GAN D;  5DAL A;  5CO3 A;  3IE3 A;  5CP1 A;  3FY7 A;  4XCS A;  5INY A;  1ZOF A;  1ZYQ B;  5D8I A;  3LWA A;  2GS3 A;  2DJ0 A;  1AAZ A;  4CY8 A;  5HFK A;  1FO5 A;  2A4H A;  5DQS A;  2GZP A;  1J08 A;  3RPP A;  1ILO A;  3HJO A;  1T3B A;  4LMW A;  2VD0 A;  3ZVJ A;  2V6O A;  4F0C A;  3L9U A;  4L8E A;  3IK7 A;  3CYN A;  4K8M A;  3NOF A;  4Z7X A;  1TOF A;  4BIK A;  2YCD A;  3G7I A;  4JBB A;  4G19 A;  4F82 A;  1GSU A;  4KW6 A;  1ZMA A;  2H1D A;  1HNB A;  5D9X A;  4X43 A;  2VM1 A;  6GSX A;  4PXO A;  2HRK A;  2FNO A;  3FW2 A;  1PL2 A;  1BED A;  1VGL A;  5J4U A;  3VLN A;  1G0T A;  2CVD A;  1A2M A;  1TJD A;  3TKQ A;  3TKS A;  1F6M C;  1ABA A;  2O89 A;  1YEX A;  2VCV A;  4X0X A;  2QKE A;  1TW9 A;  4TXO B;  2E7P A;  1GRX A;  2IMI A;  3RHB A;  1XIY A;  18GS A;  2GT6 A;  4J56 E;  4XRD A;  2AYT A;  4ZIJ A;  1F3B A;  2DIZ A;  1ZYE A;  3P8W A;  1OC3 A;  2GZZ A;  1TU8 A;  3RDW A;  5KN1 A;  1RQM A;  3HVV A;  1Z6M A;  4CW9 A;  1EP8 A;  2G2Q A;  2MBS A;  4ECI A;  2VD1 A;  5B6N A;  3F9U A;  5B6M A;  3GH9 A;  4KDX A;  4EL1 A;  1F9M A;  1TTZ A;  1EWX A;  5H5R A;  1WIK A;  4MF6 A;  3A3T A;  4YKF A;  3G7Y A;  1G6Y A;  3P7X A;  4LL1 B;  4ECJ A;  4LMV A;  2H72 A;  4LL4 B;  1ZL9 A;  2CVK A;  1EOG A;  2RM6 A;  4L5L A;  4BWQ A;  1VF4 A;  3ME7 A;  3KTL A;  2EC4 A;  1SJZ A;  4XS4 A;  4TN8 A;  3HJP A;  1GTA A;  3ERF A;  2YWO A;  1PD2 1;  4AJ6 A;  1YF0 A;  3GYK A;  2KOK A;  3HZ8 A;  1FG4 A;  2MZC A;  3IC4 A;  3IAM 2;  4MJE A;  5AIS A;  4GXZ A;  4CHS A;  1PL1 A;  4NV5 A;  1ON4 A;  4V2M A;  5JCU A;  4I6X A;  4GSN A;  2MMZ A;  4G0I A;  2XPE A;  4Q5R A;  3MAK A;  4HDE A;  3I9V 2;  1X5C A;  4Z2U A;  1XWK A;  1T7P B;  5B8B A;  3TJG A;  2I4A A;  4ICY A;  1B4P A;  4F03 A;  3GTU A;  1JLW A;  4ZB8 A;  1C72 A;  4OWY A;  1VF3 A;  2MYG A;  2FLS A;  3GL3 A;  5J9C A;  3TJB A;  2VUP A;  2H01 A;  2GQK A;  1ERV A;  1XWC A;  3ZRE A;  5IMC A;  5E4W A;  3VUR A;  1I5G A;  4IBP A;  4BA7 A;  1HD2 A;  4L0U A;  2FA4 A;  3HXS A;  1LU4 A;  3F8U A;  1JFU A;  2HSM A;  4Z2R A;  3WGX A;  5HR3 A;  4TRX A;  6GSV A;  5G1L A;  3IBH A;  1QXH A;  4IQ1 A;  2OBI A;  3GST A;  2PBJ A;  4KDY A;  3TCO A;  3ZML A;  4DSS B;  2L4Q A;  4FO5 A;  1M0U A;  2IIY A;  2DKI A;  2C3N A;  3TJF A;  3ZLP A;  1MEK A;  1GNW A;  1GSY A;  3Q19 A;  3I69 A;  1OVN A;  1EGO A;  1O7U A;  5ABR A;  1XW9 A;  2AB6 A;  1K3Y A;  5JCG A;  3KH7 A;  5EL8 A;  2PVO C;  1V2A A;  2M46 A;  2HNL A;  2F9S A;  3GFK A;  3SWL A;  3KMO A;  1OC9 A;  1PA3 A;  2OE1 A;  2C3Q A;  2REM A;  3QFB C;  6GSU A;  2PMT A;  2ES7 A;  2YWI A;  1ERT A;  4MCU A;  2NVL A;  4HS1 A;  1TXX A;  2H0I A;  4NAX A;  2WZ9 A;  3F3R A;  3TRX A;  3D4T A;  4HUA A;  2N5B A;  2L5L A;  2X64 A;  4WKW A;  4OFM A;  1R5A A;  1TK8 B;  2ZCT A;  3A2V A;  3U6V A;  1O6J A;  1Z7P A;  3LGC A;  2KUC A;  17GS A;  2A2P A;  2K9F A;  2VAF A;  1SYR A;  1M7T A;  2LJR A;  2X8H A;  3EWL A;  4GQC A;  3HD5 A;  2O7K A;  1NM3 A;  2H66 A;  4EXJ A;  1XWA A;  2PER A;  3VWW A;  2B6M A;  3C1S A;  2L6D A;  4PUA A;  2GTU A;  2PN8 A;  2YZU A;  5GST A;  2N5F A;  2PVQ A;  2NDO A;  4CDO A;  3PR8 A;  1JZO A;  3FMW A;  1PGT A;  4K7N A;  2LEG A;  3F63 A;  1VRS D;  4YAP A;  1GSE A;  1SEN A;  1M2B A;  2QA1 A;  2I81 A;  3M9J A;  4FYU A;  2WS2 A;  3Q6O A;  3EYT A;  1S3D A;  2B1K A;  1NHY A;  1AUC A;  1O8W A;  4K5R A;  1O8X A;  3ZIJ A;  3IHG A;  3VPT A;  3VWU A;  1YJ6 A;  3KM6 A;  4EDY A;  3QR6 A;  2HZE A;  3D6I A;  4EKZ A;  1PKW A;  3L78 A;  3UVH A;  4ECC A;  3E9J B;  3QD9 A;  3C7M A;  4J2F A;  4DVC A;  4YQV A;  2DJ2 A;  1T1V A;  4I2T A;  4OMV A;  2X4A A;  4YQM A;  3PIN A;  2FD3 A;  1SJI A;  4KAE A;  1B48 A;  3HVN A;  4G0L A;  3LOR A;  1PSQ A;  4J57 E;  2P0G A;  1O81 A;  4IP1 A;  7GSS A;  2IPA A;  4I2U A;  4USS A;  3A5W A;  4G9H A;  1HQO A;  3C8E A;  3C73 A;  3QAW A;  4IJI A;  1X9S B;  1H75 A;  2VCX A;  2ZNM A;  2G0F A;  3HA9 A;  3F4S A;  3DIE A;  3ZVJ D;  1QUW A;  3A2W A;  3LYK A;  1R7H A;  1PRX A;  1KNG A;  1KBN A;  2CA8 A;  4ACS A;  3E0U A;  3DEX A;  2QA2 A;  2IN3 A;  1WP0 A;  3I6A A;  4MH2 A;  3RHC A;  2LS5 A;  2V32 A;  2LUS A;  5ID2 B;  3VPQ A;  4X4J A;  4KA0 A;  3ZZX A;  3GL5 A;  4KX4 A;  1YY7 A;  3ISO A;  5KEJ A;  1F37 A;  2IMF A;  1EV9 A;  3P90 A;  3ERW A;  3TJJ A;  5HR0 A;  3D5J A;  1NHO A;  5D9T A;  1PFO A;  4JR6 A;  5EY6 A;  4PQH A;  4FQU A;  4XRA A;  3V1W A;  3FR6 A;  3PPU A;  3DYR A;  1PQN A;  2WDU A;  3TRP A;  1MDJ A;  4TR1 A;  1QMV A;  1EZK A;  4ZIL A;  3DD3 A;  1DE2 A;  1X5E A;  4OCE A;  4IN0 A;  2LJA A;  3KZQ A;  5AIV A;  5IM9 A;  2IWT A;  1PX6 A;  1CQH A;  4WBJ A;  4LA1 A;  1TK0 B;  4EVM A;  1S3R A;  5ECL B;  2XC2 A;  1N2A A;  1AIU A;  2R2J A;  4L5O A;  3GA4 A;  5B7C A;  1QK8 A;  4K2D A;  3H93 A;  2VO4 A;  3GN3 A;  4WF4 A;  2A4V A;  1TRV A;  3CSI A;  2VLU A;  3SBC A;  3I43 A;  3CRU A;  4GTU A;  2CV4 A;  5ECP B;  2N5A A;  2IJY A;  4FYB A;  2OAC A;  2HFD A;  4KF9 A;  3M1G A;  2M80 A;  2HXK A;  4E8E A;  1HNC A;  1R5P A;  3KGK A;  3VWX A;  1Z5Y E;  5IMZ A;  3P2A A;  1J0F A;  2H1A A;  2DJ3 A;  1EEJ A;  4V2N A;  3GUR A;  3GX8 A;  1K0B A;  3MIX A;  4WBR D;  4GLT A;  4OCF A;  3LJR A;  4DSQ A;  4XTS A;  2ALB A;  2VIM A;  1K0A A;  5ECI B;  1TRS A;  5HQP A;  5IPG A;  5J41 A;  2H76 A;  4HQZ A;  2ON7 A;  2P5Q A;  3TDG A;  4WEY A;  2EIR A;  3U5R E;  4MAB A;  2H30 A;  3FYG A;  3MYD A;  2MMA A;  5KN2 A;  1GSF A;  3FEU A;  3QOU A;  4GWR A;  1A0F A; 
#chains in the Genus database with same CATH homology
 4XS4 B;  4FYC A;  3EE2 A;  1OKD A;  3OR5 A;  1BG5 A;  3D4M A;  2GSQ A;  1NSW A;  5F06 A;  2RM5 A;  2XPD A;  3UEM A;  5DBQ A;  1G7O A;  1K0D A;  5G31 A;  4N0V A;  3WD6 A;  2FA8 A;  2UZ8 A;  2CT6 A;  4POK A;  2VLV A;  1TRW A;  2EIO A;  4MPF A;  5DCH A;  5G30 A;  3DWV A;  1M9B A;  3W8J A;  1AQW A;  2Z9S A;  4RI7 A;  1G7E A;  2H75 A;  3GTU B;  3Q18 A;  2HRN A;  1IYH A;  3TB2 A;  1W4V A;  3IRA A;  3W6G A;  4O5R A;  3DXB A;  2HRA A;  1FB0 A;  2D2Z A;  12GS A;  5IMD A;  3IDV A;  3F6D A;  4ZBD A;  1MDI A;  3F4R A;  1GSS A;  1SKR B;  2KP2 A;  4XIH A;  4MJC A;  2IMK A;  4K0G A;  2HT9 A;  1K3L A;  5B8A A;  3IPZ A;  2C0E A;  4HZ4 A;  2H1G A;  5COH A;  3PGT A;  1Y6E A;  3ZTL A;  1WRY A;  2NPB A;  3HYP A;  5ECO B;  3CSH A;  3HCZ A;  4K7O A;  1SJ6 A;  3HVS A;  4OO4 A;  3F4T A;  5FWG A;  16GS A;  1GTI A;  3BOA A;  2FWG A;  3BCK A;  5IMA A;  1Z6N A;  4RI6 A;  2XHF A;  4Q5Q A;  1B9Y C;  3BJ5 A;  5HFI A;  4O92 A;  2F51 A;  1X9W B;  3CXG A;  1AQV A;  3VI7 A;  1GSQ A;  1OC9 B;  1U87 A;  3C71 A;  3IR4 A;  4NMU A;  5ECQ B;  5C00 A;  3WT2 A;  4TVE A;  3G7J A;  2V41 A;  3UAR A;  13GS A;  2H71 A;  2R3X A;  3TRQ A;  3QDN A;  2LST A;  1SK1 A;  3NIV A;  2YWM A;  1K0O A;  1XZO A;  1UA5 A;  3QFA C;  4K2X A;  2M72 A;  4A5P A;  2PPT A;  2R37 A;  4ZL8 A;  3ZIT A;  2C0F A;  2RUE A;  3M3M A;  2X8C A;  2OKA A;  1Q98 A;  3LSZ A;  5CRD A;  1UC7 A;  4PQI A;  2C0G A;  5DDL A;  1TI3 A;  4KSM A;  2PWJ A;  1GH2 A;  3KH9 A;  1SL2 B;  4G10 A;  2FWE A;  2JZS A;  1SYX A;  1PN9 A;  2V1M A;  4MZW A;  4IS0 A;  2OAD A;  2KP1 A;  1YZX A;  3UAP A;  3ZYW A;  4QL9 A;  2CX3 A;  4PX1 A;  1THX A;  4GF0 A;  1BQ7 A;  5A4V A;  3GKN A;  1XPV A;  1XWG A;  2VCW A;  3DVX A;  1V98 A;  3ZFB A;  1OYJ A;  2IL3 A;  4NHW A;  4K5S A;  2GZY A;  4AJ8 A;  2HZE B;  8GSS A;  4KUN A;  2AHE A;  1FHE A;  3WGD A;  2CAQ A;  3FKF A;  4MZB A;  5EPF A;  5CYY A;  2JL4 A;  2JZR A;  4GST A;  2GGT A;  4YQU A;  4EE0 A;  5ECH B;  3AY8 A;  4KND A;  3TOT A;  5F07 A;  2H19 A;  1H4O A;  4OO5 A;  4LLR A;  4G0K A;  3D22 A;  3EUR A;  4NXI A;  3DRN A;  1GSD A;  3KD0 A;  3O76 A;  2CVB A;  2YV9 A;  2A2R A;  1VF2 A;  4JU5 A;  4QQ7 A;  3N5O A;  1TRU A;  4I97 A;  1FVJ A;  2IFQ A;  2LKU A;  1ERU A;  2VOC A;  6GSW A;  3IV4 A;  5JWQ B;  4MPG A;  4P3Y B;  4KE3 A;  5J9B A;  2B1L A;  5ECS A;  4D73 B;  19GS A;  4DSR A;  2KHP A;  1KTE A;  3TGZ A;  2DBC A;  4Q5F A;  2L6C A;  3GIX A;  3KEB A;  5KN0 A;  3N9J A;  4POL A;  3MDK A;  2B7K A;  4BVY A;  2C8U A;  2OA7 A;  3EU4 A;  1JHB A;  2QGV A;  2FGX A;  3NZN A;  1BAY A;  1JLV A;  3GV1 A;  1U88 A;  3HVX A;  4EC0 A;  3O6T A;  4BVX A;  3GH6 A;  1GUL A;  2WJU A;  5G5F A;  2DKH A;  2LNS A;  4QL7 A;  1A8L A;  4EUY A;  3LYP A;  3M0F A;  2FUG 2;  3KP9 A;  2H73 A;  5D96 A;  1ACV A;  5G2Z A;  3BCI A;  2DLX A;  4K1F A;  1MTC A;  2VL2 C;  3EIN A;  4HZ2 A;  4FIW A;  3MSZ A;  6GSS A;  2F3M A;  4IVF A;  4KB3 A;  1MD3 A;  2YZH A;  3HY2 A;  4GQF A;  2DJJ A;  5IOW A;  1ZYP A;  4Q5N A;  2YN1 A;  5ENU A;  4IP6 A;  3W8S A;  1JZR A;  2R4V A;  3BD2 A;  1TKD B;  1SL0 B;  1DUG A;  1R4W A;  2MBT A;  2RLI A;  1AW9 A;  1TP9 A;  3PH9 A;  4YH2 A;  3QCP A;  2O87 A;  2R0C A;  2ON5 A;  3ZIV A;  4ZL7 A;  1OAZ A;  3IA1 A;  2K6V A;  4ZXG A;  2PU9 C;  3D0Z A;  3DGQ A;  2WRT A;  1O73 A;  1GUH A;  1XBS A;  2O85 A;  2GDR A;  2HYX A;  3ED3 A;  4ZBB A;  3J7Y k;  1Y25 A;  3C1R A;  5DAL B;  3CSJ A;  4TKY A;  2WGR A;  3TKR A;  1OC8 A;  2AAW A;  3H4K A;  4G2E A;  5C04 A;  4AGS A;  3M9K A;  3FZ5 A;  4MK3 A;  2O8V B;  2GLR A;  2FWF A;  3QMX A;  2TRX A;  2WUL A;  3GUS A;  4EF0 A;  1T00 A;  1UVZ A;  4N11 A;  5JCW A;  3DML A;  1AC1 A;  5DJL A;  5FHI A;  1OE7 A;  4JZQ A;  2JSZ A;  3VWV A;  3FR9 A;  1AQX A;  2A2S A;  2CQ9 A;  5CAX A;  4CY6 A;  1ST9 A;  3GSS A;  4KGI A;  3WT1 A;  1N8J A;  5IO2 A;  1M9A A;  3D21 A;  4ML6 A;  5H5S A;  2LRC A;  3KCM A;  2VM2 A;  1SL1 B;  4MF5 A;  4EIQ A;  5KOX A;  3UL3 A;  4BL7 A;  4GSS A;  5D93 A;  2H6X A;  4OFN A;  4IGJ A;  4KSO A;  4TR4 A;  3LG6 A;  2I9H A;  1ML6 A;  1ZCP A;  5LCZ A;  2GST A;  4K6X A;  2H8L A;  5ID2 A;  2PUK C;  1A2L A;  4O32 A;  2NTO A;  1WE0 A;  2DC5 A;  2LQO A;  1YQ1 A;  1GUM A;  2EIQ A;  2CZ2 A;  4ILF A;  4NPB A;  4IW9 A;  3A2X A;  2H6Y A;  3HZ4 A;  5ECR B;  1BYE A;  2B3S A;  2B5Y A;  3IOS A;  2HZF A;  1V9W A;  2VLT A;  5DCG A;  4JED A;  4RQX A;  1O85 A;  1WOU A;  1EP7 A;  5IMF A;  4OD7 A;  4ZB9 A;  2I3Y A;  2X49 A;  2X8G A;  2DSA A;  1GUK A;  2VCQ A;  5FT3 A;  2IMD A;  1KEB A;  1XW5 A;  4MZC A;  2V6K A;  1USB A;  2LRN A;  4K7I A;  2VCZ A;  2P5R A;  2WCI A;  1M2D A;  2I1U A;  2AUV A;  3FZ4 A;  4ISD A;  3FZ9 A;  1A23 A;  3HDC A;  3R3E A;  1K0N A;  5DVB A;  5CRW A;  3LXZ A;  2AV4 A;  3RPN A;  2HI7 A;  3MWH A;  3CTF A;  4H86 A;  5AIX A;  1EOH A;  2HSY A;  1HYU A;  2K8V A;  4E8H A;  4F9Z A;  1WMJ A;  2LNT A;  3ZMK A;  2R6K A;  2VL9 A;  2GSS A;  4XS1 A;  1TK5 B;  1GLP A;  5ELA A;  1E6B A;  1XXU A;  2FY6 A;  5DAK A;  2BTO T;  3G9B A;  1PX7 A;  2DJK A;  1Q4J A;  4MDC A;  4N30 A;  1MDK A;  2DMM A;  14GS A;  3VFI A;  1LJR A;  3RBT A;  3UBL A;  1M99 A;  4XS6 A;  3LFL A;  1XCC A;  1F2E A;  1A2J A;  2KLX A;  1T4Z A;  1U3A A;  2F8F A;  2J23 A;  3EMP A;  3FHK A;  3F6F A;  2B5E A;  1XVW A;  2HE3 A;  2L4C A;  2AJQ B;  1S3A A;  10GS A;  3APS A;  4ECB A;  4AJ7 A;  2TIR A;  1DSB A;  3H8Q A;  1R26 A;  2JSY A;  3UMA A;  1X5D A;  2YV7 A;  1UN2 A;  3L0H A;  5IMV A;  5ELG A;  4HQS A;  2C1Y A;  3DKS A;  2BMX A;  2OE0 A;  2OJL A;  3J7Y b;  3F3Q A;  2MMO A;  3L4N A;  4O7H A;  3Q74 A;  2RII A;  3ZRD A;  1YF1 A;  3F0I A;  2YJ7 A;  3R2Q A;  5IO0 A;  2XBQ A;  3H79 A;  3IC8 A;  4WR5 A;  5BRT A;  5JWR B;  2BJX A;  1Z3E A;  5F0G A;  2OE3 A;  4TXO A;  1A8Y A;  3GNJ A;  4NHZ A;  4EIP A;  2PGT A;  4TR3 A;  4WXT A;  1GTU A;  1T8E B;  5L71 A;  1QFN A;  2X99 A;  2LRT A;  2HRF A;  5D9V A;  1EEM A;  3JCM L;  5A5K A;  4TR0 A;  1AXD A;  1B8X A;  2K8S A;  1FOH A;  4O5U A;  5GZZ B;  3UVT A;  1J9B A;  2C80 A;  1XWB A;  2GT5 A;  2GVP A;  5HFG A;  3TKS C;  1W89 A;  1SK2 A;  1NW2 A;  3K8N A;  4WR4 A;  4O5Q A;  5KOW A;  3GHA A;  4BWS A;  2QSI A;  2C0D A;  5F8B A;  1BJX A;  4KCA A;  5DJM A;  5ECM B;  2YWN A;  2L59 A;  3FRC A;  4ZL9 A;  4TXV A;  3GKK A;  5G5E A;  3US3 A;  1ZGN A;  4K9Z A;  4JE1 A;  5LNK e;  3L9V A;  2H6Z A;  1SD8 A;  4F0B A;  5D9W A;  4MLY A;  3KP8 A;  3UIW A;  1JZW A;  4Z2T A;  1K0C A;  5KN3 A;  3A5I A;  4HU7 A;  9GSS A;  1Z7R A;  2JU5 A;  4EDZ A;  2HLS A;  3KTB A;  5IQY A;  6GST A;  3LXT A;  5A4W A;  4JRR A;  1K3O A;  3IAS 2;  1X9M B;  3CBU A;  5CRG A;  1V40 A;  2VCT A;  2IFQ B;  2IME A;  2C4J A;  2LV3 A;  5J3R A;  4WF5 A;  5F05 A;  4K0N A;  4TOP A;  1GNE A;  2HSH A;  2YPM A;  2VL2 A;  5GAP D;  1YKA A;  1XOA A;  3LEF A;  1OE8 A;  1PN0 A;  4HU9 A;  5CNW A;  2JZT A;  1SKW B;  1PMT A;  3ME8 A;  5LD0 A;  3DVW A;  2H0G A;  5HR1 A;  4MJB A;  5DQY A;  4BVY B;  2WFC A;  5AGY A;  4MJA A;  4I8B A;  2P31 A;  4MF7 A;  2LTK A;  4PNG A;  2MMN A;  1WWJ A;  2B7J A;  1SU9 A;  4BVX B;  1QGV A;  3M8N A;  3MNG A;  2VL3 A;  4V1A p;  1FVK A;  1FW1 A;  2CX4 A;  3VI5 A;  1DBY A;  1A0R P;  4RUV A;  1LBK A;  2E2M A;  2NBS A;  4ZBA A;  1FAA A;  2WB9 A;  1V58 A;  4BPY A;  3QAV A;  4DSS A;  4IKH A;  4PGT A;  3TJK A;  3IK9 A;  2RUF A;  3HKR A;  1ERW A;  1QQ2 A;  1WPI A;  1JZD A;  4IEL A;  3TOU A;  4KCE A;  4PUR A;  2H74 A;  11GS A;  3RAZ A;  1Z9H A;  1ZZY A;  1BX9 A;  4MMM A;  3UJ1 A;  4GRF A;  4JR4 A;  3EMX A;  3FK8 A;  4XHM A;  3EC3 A;  3LW9 A;  1U3I A;  1X0R A;  3TKS E;  1XOB A;  2L5O A;  2J9H A;  4KDU A;  4DEJ A;  4RQR A;  3KIJ A;  4IJ3 A;  2H70 A;  1FOV A;  3GKM A;  4I5Q A;  3EPT A;  4MNN A;  1GLQ A;  5D73 A;  2B5X A;  4HJM A;  1TU7 A;  2FWH A;  3WYW A;  1PKZ A;  5CRE A;  5IOX A;  1FB6 A;  5E59 A;  1GL8 A;  5CRH A;  2LQQ A;  4N10 A;  4TR1 B;  3KMN A;  2H1B A;  1THO A;  3FR3 A;  5HR2 A;  1IYI A;  4TW5 A;  4FH8 A;  3IHQ A;  1A24 A;  1T4Y A;  4IQA A;  3ZL5 A;  4L0W A;  1YDK A;  2ZUP A;  4MA9 A;  4X1U A;  3VK9 A;  1EGR A;  1XFL A;  1ZYN A;  3GMF A;  3HHV A;  4V2L A;  1S3C A;  4WET A;  1OKT A;  1MD4 A;  1EV4 A;  3UOM A;  1VF1 A;  1U6T A;  5J5N A;  4ULX A;  4PUF C;  5IIZ A;  3EVI A;  2R0G A;  1TI1 A;  3CMI A;  4GCI A;  2LJK A;  1SK0 A;  3GRX A;  5GSS A;  4HI7 A;  2GQM A;  1TDI A;  3KJY A;  1V57 A;  3CRT A;  2JAD A;  3H1N A;  3WGE A;  4PTS A;  3L9S A;  4NWY A;  2L57 A;  3QPM A;  2FHE A;  4ZB6 A;  1URM A;  4BL7 B;  2GQL A;  2XBI A;  5ECK B;  1DE1 A;  4D73 A;  1B4Q A;  3GKX A;  2YJH A;  4YAV A;  3FZA A;  1HNA A;  4F2I A;  1SD9 A;  5A4U A;  5H5Q A;  3QAG A;  4IHU A;  2H0H A;  4YKG A;  1SKS B;  5ECN B;  4AF2 A;  1GP1 A;  1GTB A;  1RW1 A;  3KXO A;  6GSY A;  2TRC P;  2E2G A;  3APO A;  5EVO A;  3APQ A;  2DML A;  3S9F A;  2F8A A;  3EU3 A;  22GS A;  2YOI A;  4V1A g;  2CZ3 A;  2YAN A;  5G1K A;  2C3T A;  2YP6 A;  1B9X C;  2K18 A;  3UBK A;  2DIY A;  3IXR A;  4MP4 A;  1RK4 A;  3E3E A;  2E0Q A;  4PNF A;  4POB A;  3GX0 A;  4EO3 A;  3O3T A;  1WJK A;  2OBK A;  2CAI A;  2QC7 A;  1GWC A;  2GSR A;  4HOJ A;  5JWO B;  20GS A;  1YEP A;  4HEA 2;  3CTG A;  5AN1 A;  1YKC A;  2R0P A;  1G6W A;  1CQG A;  1M2A A;  1K0M A;  2DJ1 A;  1E2Y A;  5BMU A;  1I9D A;  3LQ7 A;  4MH3 A;  2R5G A;  4ID0 A;  4HJ2 A;  1XW6 A;  2V2G A;  3ERG A;  3HJM A;  3BBY A;  4N0Z A;  3TUE A;  4PQ1 A;  2FCH A;  4OFT A;  1XVQ A;  4POM A;  2JAC A;  3ZFL A;  4ML1 A;  5IPH A;  1F3A A;  4NV2 A;  4KH7 A;  2YNX A;  5DAK B;  3TKP A;  5GAN D;  5DAL A;  5CO3 A;  3IE3 A;  5CP1 A;  3FY7 A;  4XCS A;  5INY A;  1ZOF A;  1ZYQ B;  5D8I A;  3LWA A;  2GS3 A;  2DJ0 A;  1AAZ A;  4CY8 A;  5HFK A;  1FO5 A;  2A4H A;  5DQS A;  2GZP A;  1J08 A;  3RPP A;  1ILO A;  3HJO A;  1T3B A;  4LMW A;  2VD0 A;  3ZVJ A;  2V6O A;  4F0C A;  3L9U A;  4L8E A;  3IK7 A;  3CYN A;  4K8M A;  3NOF A;  4Z7X A;  1TOF A;  2YCD A;  3G7I A;  4JBB A;  4G19 A;  4F82 A;  1GSU A;  4KW6 A;  1ZMA A;  2H1D A;  1HNB A;  5D9X A;  4X43 A;  2VM1 A;  6GSX A;  4PXO A;  2HRK A;  2FNO A;  3FW2 A;  1PL2 A;  1BED A;  1VGL A;  5J4U A;  3VLN A;  1G0T A;  2CVD A;  1A2M A;  1TJD A;  3TKQ A;  3TKS A;  1F6M C;  1ABA A;  2O89 A;  1YEX A;  2VCV A;  4X0X A;  2QKE A;  1TW9 A;  4TXO B;  2E7P A;  1GRX A;  2IMI A;  3RHB A;  1XIY A;  18GS A;  2GT6 A;  4J56 E;  4XRD A;  2AYT A;  4ZIJ A;  1F3B A;  2DIZ A;  1ZYE A;  3P8W A;  1OC3 A;  2GZZ A;  1TU8 A;  3RDW A;  5KN1 A;  1RQM A;  3HVV A;  1Z6M A;  4CW9 A;  1EP8 A;  2G2Q A;  2MBS A;  4ECI A;  2VD1 A;  5B6N A;  3F9U A;  5B6M A;  3GH9 A;  4KDX A;  4EL1 A;  1F9M A;  1TTZ A;  1EWX A;  5H5R A;  1WIK A;  4MF6 A;  3A3T A;  4YKF A;  3G7Y A;  1G6Y A;  3P7X A;  4LL1 B;  4ECJ A;  4LMV A;  2H72 A;  4LL4 B;  1ZL9 A;  2CVK A;  1EOG A;  2RM6 A;  4L5L A;  4BWQ A;  1VF4 A;  3ME7 A;  3KTL A;  2EC4 A;  1SJZ A;  4XS4 A;  4TN8 A;  3HJP A;  1GTA A;  3ERF A;  2YWO A;  1PD2 1;  4AJ6 A;  1YF0 A;  3GYK A;  2KOK A;  3HZ8 A;  1FG4 A;  2MZC A;  3IC4 A;  3IAM 2;  4MJE A;  5AIS A;  4GXZ A;  4CHS A;  1PL1 A;  4NV5 A;  1ON4 A;  4V2M A;  5JCU A;  4I6X A;  4GSN A;  2MMZ A;  4G0I A;  2XPE A;  4Q5R A;  3MAK A;  4HDE A;  3I9V 2;  1X5C A;  4Z2U A;  1XWK A;  1T7P B;  5B8B A;  3TJG A;  2I4A A;  4ICY A;  1B4P A;  4F03 A;  3GTU A;  1JLW A;  4ZB8 A;  1C72 A;  4OWY A;  1VF3 A;  2MYG A;  2FLS A;  3GL3 A;  5J9C A;  3TJB A;  2VUP A;  2H01 A;  2GQK A;  1ERV A;  1XWC A;  3ZRE A;  5IMC A;  5E4W A;  3VUR A;  1I5G A;  4IBP A;  4BA7 A;  1HD2 A;  4L0U A;  2FA4 A;  3HXS A;  1LU4 A;  3F8U A;  1JFU A;  2HSM A;  4Z2R A;  3WGX A;  5HR3 A;  4TRX A;  6GSV A;  5G1L A;  3IBH A;  1QXH A;  4IQ1 A;  2OBI A;  3GST A;  2PBJ A;  4KDY A;  3TCO A;  3ZML A;  4DSS B;  2L4Q A;  4FO5 A;  1M0U A;  2IIY A;  2DKI A;  2C3N A;  3TJF A;  3ZLP A;  1MEK A;  1GNW A;  1GSY A;  3Q19 A;  3I69 A;  1OVN A;  1EGO A;  1O7U A;  5ABR A;  1XW9 A;  2AB6 A;  1K3Y A;  5JCG A;  3KH7 A;  5EL8 A;  2PVO C;  1V2A A;  2M46 A;  2HNL A;  2F9S A;  3GFK A;  3SWL A;  3KMO A;  1OC9 A;  1PA3 A;  2OE1 A;  2C3Q A;  2REM A;  3QFB C;  6GSU A;  2PMT A;  2ES7 A;  2YWI A;  1ERT A;  4MCU A;  2NVL A;  4HS1 A;  1TXX A;  2H0I A;  4NAX A;  2WZ9 A;  3F3R A;  3TRX A;  3D4T A;  4HUA A;  2N5B A;  2L5L A;  2X64 A;  4WKW A;  4OFM A;  1R5A A;  1TK8 B;  2ZCT A;  3A2V A;  3U6V A;  1O6J A;  1Z7P A;  3LGC A;  2KUC A;  17GS A;  2A2P A;  2K9F A;  2VAF A;  1SYR A;  1M7T A;  2LJR A;  2X8H A;  3EWL A;  4GQC A;  3HD5 A;  2O7K A;  1NM3 A;  2H66 A;  4EXJ A;  1XWA A;  2PER A;  3VWW A;  2B6M A;  3C1S A;  2L6D A;  4PUA A;  2GTU A;  2PN8 A;  2YZU A;  5GST A;  2N5F A;  2PVQ A;  2NDO A;  4CDO A;  3PR8 A;  1JZO A;  3FMW A;  1PGT A;  4K7N A;  2LEG A;  3F63 A;  1VRS D;  4YAP A;  1GSE A;  1SEN A;  1M2B A;  2QA1 A;  2I81 A;  3M9J A;  4FYU A;  2WS2 A;  3Q6O A;  3EYT A;  1S3D A;  2B1K A;  1NHY A;  1AUC A;  1O8W A;  4K5R A;  1O8X A;  3ZIJ A;  3IHG A;  3VPT A;  3VWU A;  1YJ6 A;  3KM6 A;  4EDY A;  3QR6 A;  2HZE A;  3D6I A;  4EKZ A;  1PKW A;  3L78 A;  3UVH A;  4ECC A;  3E9J B;  3QD9 A;  3C7M A;  4J2F A;  4DVC A;  4YQV A;  2DJ2 A;  1T1V A;  4I2T A;  4OMV A;  4YQM A;  2X4A A;  3PIN A;  2FD3 A;  1SJI A;  4KAE A;  1B48 A;  4G0L A;  3LOR A;  1PSQ A;  4J57 E;  2P0G A;  1O81 A;  4IP1 A;  7GSS A;  2IPA A;  4I2U A;  4USS A;  3A5W A;  4G9H A;  1HQO A;  3C8E A;  3C73 A;  3QAW A;  4IJI A;  1X9S B;  1H75 A;  2VCX A;  2ZNM A;  2G0F A;  3HA9 A;  3F4S A;  3DIE A;  3ZVJ D;  1QUW A;  3A2W A;  3LYK A;  1R7H A;  1PRX A;  1KNG A;  1KBN A;  2CA8 A;  4ACS A;  3E0U A;  3DEX A;  2QA2 A;  2IN3 A;  1WP0 A;  3I6A A;  4MH2 A;  3RHC A;  2LS5 A;  2V32 A;  2LUS A;  5ID2 B;  3VPQ A;  4X4J A;  4KA0 A;  3ZZX A;  3GL5 A;  4KX4 A;  1YY7 A;  3ISO A;  5KEJ A;  1F37 A;  2IMF A;  1EV9 A;  3P90 A;  3ERW A;  3TJJ A;  5HR0 A;  3D5J A;  1NHO A;  5D9T A;  4JR6 A;  5EY6 A;  4PQH A;  4FQU A;  4XRA A;  3V1W A;  3FR6 A;  3PPU A;  3DYR A;  1PQN A;  2WDU A;  3TRP A;  1MDJ A;  4TR1 A;  1QMV A;  1EZK A;  4ZIL A;  3DD3 A;  1DE2 A;  1X5E A;  4OCE A;  4IN0 A;  2LJA A;  3KZQ A;  5AIV A;  5IM9 A;  2IWT A;  1PX6 A;  1CQH A;  4WBJ A;  4LA1 A;  1TK0 B;  4EVM A;  5ECL B;  2XC2 A;  1N2A A;  1AIU A;  2R2J A;  4L5O A;  3GA4 A;  5B7C A;  1QK8 A;  4K2D A;  3H93 A;  2VO4 A;  3GN3 A;  4WF4 A;  2A4V A;  1TRV A;  3CSI A;  2VLU A;  3SBC A;  3I43 A;  3CRU A;  4GTU A;  2CV4 A;  5ECP B;  2N5A A;  2IJY A;  4FYB A;  2OAC A;  2HFD A;  4KF9 A;  3M1G A;  2M80 A;  2HXK A;  4E8E A;  1HNC A;  1R5P A;  3KGK A;  3VWX A;  1Z5Y E;  5IMZ A;  3P2A A;  1J0F A;  2H1A A;  2DJ3 A;  1EEJ A;  4V2N A;  3GUR A;  3GX8 A;  1K0B A;  3MIX A;  4WBR D;  4GLT A;  4OCF A;  3LJR A;  4DSQ A;  4XTS A;  2ALB A;  2VIM A;  1K0A A;  5ECI B;  1TRS A;  5HQP A;  5IPG A;  5J41 A;  2H76 A;  4HQZ A;  2ON7 A;  2P5Q A;  3TDG A;  4WEY A;  2EIR A;  3U5R E;  4MAB A;  2H30 A;  3FYG A;  3MYD A;  2MMA A;  5KN2 A;  1GSF A;  3FEU A;  3QOU A;  4GWR A;  1A0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...