14GSA

Glutathione s-transferase p1-1 apo form 1
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
194
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVYQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Evidence for an induced-fit mechanism operating in pi class glutathione transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 194
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 14gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 14gsA01
1FW1A 2VCVA 1F3BA 3ZIJA 2VL2A 1GNWA 1F2EA 3S9FA 2GSQA 2OACA 3RPNA 1WP0A 1THXA 1U88A 4PXOA 3A2XA 1QQ2A 2CVKA 1Z7PA 3APSA 3KP9A 2ES7A 1YZXA 4OD7A 1G7EA 3CYNA 3LXTA 3PINA 2DC5A 2OE3A 1M2BA 5CO3A 2H76A 5ECSA 2JL4A 4HJMA 5LCZA 3IR4A 1T3BA 2WCIA 1M0UA 5ABRA 1SU9A 4XRAA 4BL7A 1IYIA 2DSAA 2VCXA 2HNLA 5D9TA 3WGXA 1EP8A 2VL9A 1TDIA 1ZMAA 3D5JA 3N5OA 1T7PB 3F4RA 4EL1A 5EY6A 2HSYA 2YWOA 3ZITA 19GSA 1V2AA 4IW9A 1X0RA 5KN1A 1W89A 2DJJA 1XWBA 3GIXA 3FY7A 2FUG2 4IBPA 4BVXA 2LQQA 3UVTA 5B6NA 2K8SA 1U87A 4EXJA 2CX4A 1M2DA 5COHA 1GLQA 3LFLA 2K9FA 5GAPD 1JLVA 5FT3A 5L71A 2AJQB 3FZAA 5LD0A 1EOHA 2GLRA 1F6MC 4IGJA 1OC8A 5B6MA 2LQOA 4H86A 2H6XA 2XBIA 3IRAA 5C04A 5AIXA 3IAM2 1HD2A 2V41A 2MBTA 3FZ9A 3C7MA 1T4YA 4XTSA 3BBYA 3WD6A 1SYXA 6GSTA 3KZQA 3PR8A 3TOUA 2DMMA 4TR4A 5JCGA 3MWHA 3WT1A 2GVPA 4POMA 4J56E 1UC7A 3KTBA 2O8VB 2KOKA 4JZQA 3TUEA 3F9UA 1OC9A 2KUCA 1B8XA 1F37A 5DDLA 2F8FA 4WF4A 5H5RA 3G7JA 4NHWA 4TR1A 1A24A 2PMTA 2E0QA 3F8UA 3IPZA 3D6IA 1GSFA 10GSA 2CVDA 2L6CA 3H1NA 3EVIA 4F2IA 1MD3A 2K18A 2WFCA 2YN1A 3LORA 5D73A 5ID2A 2MMOA 2E2GA 4GQFA 4JR4A 4XIHA 4EUYA 1A2LA 3RDWA 3GURA 4KAEA 3F6FA 1X5CA 2PU9C 4I2TA 3IV4A 1PL2A 2YZHA 4IELA 1PN9A 2OA7A 4XHMA 1HQOA 4OFNA 1ZOFA 1Y25A 1GSDA 3A2WA 4HU7A 1GP1A 3FR6A 4WF5A 1GLPA 1AAZA 1H75A 3EC3A 22GSA 2REMA 3CSJA 4RQXA 2VM2A 3KMOA 1TI1A 2C8UA 4YAPA 2C1YA 3F3RA 3UIWA 1YEXA 3APOA 4K0NA 3VWXA 4TW5A 4N30A 5IMAA 2IMEA 3LYPA 1X9MB 3ZLPA 3FKFA 2VLVA 1USBA 1MEKA 1MDJA 3CMIA 3KIJA 4Q5RA 4GSTA 4KSOA 5CNWA 1E2YA 5HR2A 2PVOC 2BJXA 3FR9A 3QOUA 1J08A 1AC1A 5HFIA 4F0BA 1TOFA 4FH8A 2MMZA 1M99A 2H0HA 4WEYA 4OMVA 1SKRB 1Y6EA 4MP4A 5ELGA 5JCWA 4E8HA 4TN8A 1EP7A 4QL9A 2YPMA 1SJ6A 3GSSA 5AGYA 3HYPA 1DBYA 6GSVA 3ZRDA 2VIMA 4K7NA 2B5EA 3G7YA 3EYTA 5ECNB 1Z9HA 2NPBA 5KN3A 4AJ6A 4XRDA 2OBIA 1EGOA 1TXXA 3WYWA 4MCUA 2C3TA 5HR3A 1T1VA 4NV2A 3RHBA 5F05A 2G2QA 4X43A 4BVYB 2FGXA 5FHIA 1T00A 4J57E 3P2AA 5CRDA 4KW6A 2H72A 5KN2A 3MAKA 2YCDA 3TGZA 5ENUA 1J9BA 2IIYA 2X8CA 4TXOB 2HFDA 3TKPA 2F51A 2NTOA 2HRNA 3F4SA 3TRXA 1SKWB 5ECPB 2H66A 4ZBDA 1H4OA 1K0MA 4POBA 2VD1A 4IQ1A 5DQYA 3L9SA 3DIEA 4JE1A 2H0IA 2H0GA 3DVWA 1BJXA 3W8JA 1LBKA 1PMTA 4XS4B 4KDYA 5HR1A 3JCML 3GX8A 1XVWA 4IHUA 4KX4A 3IE3A 3EMPA 2HI7A 1ZGNA 3G7IA 3GKKA 1UVZA 4GSSA 1PKZA 3UBLA 5IOWA 4PNFA 1XPVA 1LU4A 4ZL9A 3RHCA 3IOSA 3ME8A 3AY8A 3O6TA 2P5RA 3GX0A 5ECOB 1AQXA 1XOAA 1ACVA 3BOAA 2WS2A 3PGTA 4JRRA 2DJ2A 5HQPA 2WZ9A 4MLYA 3LSZA 9GSSA 3FHKA 2VL3A 1FG4A 3LXZA 3TOTA 2R4VA 2UZ8A 1FHEA 1AUCA 4OO4A 5G30A 1SD8A 1TK8B 3GKNA 2VCQA 17GSA 4I5QA 3TCOA 2C4JA 1A23A 1XOBA 2FWHA 1EEJA 1Z6NA 1WE0A 1OAZA 3PPUA 5DAKB 2D2ZA 1EZKA 1R5AA 5J5NA 4TOPA 4MZWA 5D9VA 2H8LA 4KF9A 3F0IA 3HHVA 4IVFA 2VOCA 4Q5FA 2LJAA 2LRTA 5DCGA 4ZB8A 3QAVA 1EGRA 3DYRA 5IMFA 4GSNA 3Q19A 2K6VA 4LMVA 1G6YA 1WOUA 4IS0A 1NW2A 3KM6A 5B8AA 3LQ7A 2CAQA 3QPMA 2PERA 5G31A 1A8LA 1O73A 4K9ZA 1XXUA 2JZRA 3MSZA 4TR3A 3VK9A 3TRQA 3TRPA 1E6BA 3ZMKA 1I9DA 1GSYA 2HYXA 4KB3A 2GSRA 4MJBA 4WETA 1JZDA 4EO3A 3EINA 2R2JA 5IO0A 5G5EA 2GSSA 4BVYA 4G0IA 3ERWA 14GSA 2H19A 2R37A 1ZYEA 4ECJA 1PL1A 3LGCA 1BEDA 2IPAA 3GA4A 2O85A 5F06A 3VFIA 1MTCA 4LMWA 4TXOA 1XWAA 3IA1A 4POLA 1K0NA 2IFQB 2L59A 4MPGA 4K2DA 4V1Ap 1N2AA 3QR6A 2WULA 4I6XA 3ZREA 1TTZA 1KBNA 5GSSA 3CSIA 1JLWA 2MMNA 2HZEB 2YJHA 5DVBA 4G0KA 3N9JA 2VAFA 2GQLA 1GSQA 2AUVA 3UJ1A 2AHEA 1SK0A 4HUAA 1VF2A 4MF7A 1OKDA 3TJGA 4XS4A 3ERFA 2LRCA 1AW9A 2AB6A 1GRXA 2OADA 1EWXA 2CA8A 3PH9A 1CQGA 2MBSA 4ZL8A 3Q18A 4BWSA 2R6KA 4NV5A 4I97A 1S3DA 5J41A 1XWKA 4MPFA 2I1UA 2C0GA 5G2ZA 1Q4JA 5ECQB 4MZBA 1FO5A 5G1LA 2LEGA 2L5LA 3DMLA 1GSSA 5CYYA 3C1RA 4ZBBA 3UBKA 4PGTA 3GRXA 3HJMA 2NVLA 4OCEA 5A4WA 2DJ1A 4HU9A 4HOJA 1WRYA 20GSA 2B1LA 1SK2A 2WJUA 4N0VA 2X8GA 3HKRA 3GN3A 3EMXA 2MZCA 1M9BA 3DKSA 4MJAA 5ECIB 4E8EA 1B4QA 2H30A 1XWGA 5DAKA 3KP8A 2YWIA 3Q6OA 3HJOA 3ZFLA 2N5BA 3L4NA 3UMAA 2OJLA 4DSSB 2X99A 2IMIA 2YOIA 4IP1A 5HFKA 1Q98A 2E7PA 3QAGA 2YWMA 5E4WA 2JSYA 2CQ9A 2H1DA 3TB2A 2E2MA 5DJLA 3CTGA 1O7UA 2H70A 1X9WB 1ST9A 2RM5A 2YZUA 1QXHA 4KE3A 2C0DA 3TKSC 4FIWA 3SBCA 3WT2A 1MD4A 2C3QA 2GSTA 3DGQA 3VI5A 2YP6A 1A2JA 3D4MA 11GSA 3F63A 2KP2A 2GT5A 1TRWA 2EIOA 1QUWA 1F9MA 4ACSA 2DIYA 4MF5A 3VWUA 4HI7A 1EOGA 2HT9A 1J0FA 3UEMA 1XIYA 2GQKA 3HY2A 3NIVA 2H6YA 1AQVA 1B48A 3UOMA 5IMVA 4QQ7A 2B3SA 1B9YC 2EIQA 4KNDA 2CX3A 2TRCP 1M7TA 4N0ZA 2QGVA 2L5OA 3IHQA 3V1WA 4KGIA 3WGEA 4FO5A 5IIZA 2XHFA 1TRUA 2HZEA 4DSQA 2H74A 1A2MA 4G0LA 1S3CA 3L9VA 1TU8A 3U6VA 3I9V2 2FWEA 1UN2A 1XW9A 5CAXA 1OKTA 5DBQA 3FR3A 4L5LA 4PURA 4HQZA 3Q74A 2X64A 3M1GA 2PGTA 1TW9A 4AJ8A 3DRNA 2VLUA 3FZ4A 4ECCA 3APQA 3LYKA 4I8BA 3VPQA 4HZ2A 4LL4B 1A8YA 4ML1A 3M9KA 4KDUA 1Z3EA 1WPIA 2DIZA 4ECBA 5F07A 2IWTA 2PPTA 1XBSA 2FNOA 1YY7A 3CRTA 4PTSA 2JU5A 4LA1A 2I4AA 2VUPA 3BCIA 5IPGA 2M80A 3GHAA 3GKMA 2I81A 4HJ2A 2HSHA 5IMDA 2GTUA 3LEFA 1I5GA 3OR5A 4PX1A 4GF0A 4PQHA 3D22A 4RI6A 2IMFA 1QGVA 6GSYA 4DSSA 4I2UA 1GUHA 4JBBA 4ULXA 1BX9A 2PVQA 2HXKA 2L4QA 3HCZA 1XW5A 1FAAA 1K3OA 1O81A 1WWJA 2GGTA 3GL3A 3FRCA 5AIVA 1TP9A 2KLXA 3GKXA 1ZCPA 3U5RE 5CREA 4G9HA 4RI7A 3DD3A 3GYKA 4WR4A 3IK7A 1XW6A 1SL0B 3GNJA 4PQIA 3E0UA 1QMVA 4EDYA 2OBKA 2YNXA 1PD21 1AIUA 3HJPA 4HQSA 4P3YB 2B7JA 3BCKA 1EV4A 2TIRA 3UL3A 1G6WA 2B5YA 2FA8A 5IQYA 4K1FA 1PRXA 3M0FA 3KH9A 3QFAC 4ZILA 5EPFA 4BPYA 4IN0A 1B9XC 5IO2A 4MF6A 5D93A 1SJZA 3F6DA 3R3EA 5D9XA 1GSUA 4AF2A 2RLIA 5C00A 4IQAA 1DSBA 4YQMA 3C73A 2HLSA 2NDOA 2G0FA 5D96A 2HE3A 4MZCA 3EU3A 1THOA 1M9AA 1U3AA 1OVNA 12GSA 3EWLA 4EC0A 2IJYA 2H6ZA 3IK9A 1ON4A 4TKYA 3KJYA 4IJIA 4EF0A 1XVQA 2HZFA 3EU4A 1RW1A 3ZVJD 1QK8A 4GLTA 5KN0A 4KCEA 3F4TA 1O85A 1DUGA 2V6OA 2CV4A 2AAWA 4Z7XA 3UARA 3VWVA 2F8AA 3H4KA 1V58A 4O32A 4GCIA 5IMZA 1SKSB 1PQNA 4HS1A 4MJCA 2VM1A 2YJ7A 2HRKB 4AGSA 5DCHA 4KH7A 5ELAA 2AYTA 3RPPA 1X9SB 3M8NA 4XCSA 1PSQA 3HA9A 2KP1A 3D0ZA 2I3YA 3ZZXA 2NBSA 4JU5A 3QD9A 3FK8A 3P90A 4ECIA 4XS6A 4L0UA 3TKRA 3IC4A 6GSWA 2QKEA 5JWQB 1GULA 4X1UA 4IP6A 3G9BA 1DE2A 2QSIA 1Z5YE 2CT6A 1ZYQB 2PBJA 1WJKA 4F0CA 1TRSA 3GL5A 1TJDA 1V57A 4K7OA 4Q5QA 2LNSA 4PQ1A 5CRGA 1X5EA 1ERWA 5IMCA 2CAIA 1N8JA 2P5QA 4OFMA 2JADA 2CZ2A 2DBCA 4WKWA 5H5QA 3TDGA 3K8NA 3TJBA 2H75A 2PWJA 1U3IA 4O7HA 2EIRA 3L78A 2H1GA 5DJMA 1LJRA 5DALB 1DE1A 1PA3A 3GMFA 2DMLA 3KEBA 8GSSA 4V2MA 1C72A 3VWWA 2GZPA 2JZTA 4O92A 4F9ZA 4KA0A 4MJEA 4MMMA 1VF1A 2EC4A 3IXRA 2A2RA 4J2FA 3ERGA 2DLXA 3ZYWA 5A4VA 4LL1B 4K8MA 2ZNMA 3KCMA 2B1KA 2ALBA 4IKHA 4PUAA 5H5SA 2LRNA 1JHBA 1YQ1A 1YJ6A 5ECKB 2PUKC 3NZNA 4ISDA 2LJRA 3EE2A 3A2VA 2FY6A 3ZL5A 3P8WA 1YF1A 5AISA 1ZZYA 3GTUB 2WRTA 2XC2A 3L9UA 5J4UA 4CW9A 4HDEA 16GSA 5JWRB 3H79A 2YV7A 3L0HA 3TKSA 1JZOA 4D73B 5F8BA 2LV3A 1YKCA 4YH2A 2H1BA 3TKQA 6GSUA 4MA9A 3MNGA 3HDCA 1EV9A 4NMUA 5B7CA 2M72A 3UAPA 2V2GA 2GQMA 2TRXA 2GZZA 3BD2A 1YEPA 3A3TA 2X8HA 2HRKA 3QMXA 3J7Yk 4N10A 3ME7A 3QDNA 4IJ3A 1GTIA 1OYJA 2M46A 3ZTLA 2JZSA 2YV9A 3IBHA 2VL2C 2VCTA 1GTBA 2IN3A 1PX6A 3HZ8A 4MK3A 1GH2A 2KHPA 3R2QA 3HVSA 4JR6A 3UVHA 1A0FA 3TJKA 3DXBA 1SL2B 2VCZA 1U6TA 3VI7A 2ON7A 4ML6A 1MDIA 3DEXA 3CXGA 2LUSA 2FA4A 3E3EA 1AXDA 4ZB6A 2RUEA 2B6MA 3I43A 4TRXA 3IDVA 3LWAA 1O6JA 13GSA 1AQWA 4YQVA 3HVXA 3KMNA 1S3AA 2LTKA 2V32A 1JZWA 1UA5A 4GQCA 3NOFA 5ECRB 1FOVA 4BA7A 1TKDB 1R7HA 1FB0A 1VF3A 4MDCA 3MDKA 2XBQA 4ZXGA 4CDOA 1TU7A 4G2EA 2IFQA 1K0BA 4ZL7A 4NAXA 4JEDA 1ZL9A 2XPDA 4GXZA 5EL8A 5DALA 1WIKA 2VLTA 4F03A 4DVCA 2VO4A 3RBTA 3KTLA 5GZZB 4WBJA 2GS3A 3IAS2 6GSXA 4OCFA 4HZ4A 5LNKe 1K3YA 3CBUA 4OFTA 1T4ZA 3O3TA 5IPHA 1XZOA 2RM6A 3GH9A 2LNTA 2F9SA 3HXSA 4KUNA 3ZIVA 1BAYA 4L0WA 3HD5A 2L4CA 2P31A 1BQ7A 3H8QA 5J9CA 1GSEA 1QFNA 2R5GA 1YDKA 3QFBC 2WB9A 4GWRA 4K0GA 3GTUA 4USSA 3VURA 2N5AA 1ERVA 2HSNB 1Z7RA 5KEJA 4KCAA 1W4VA 4BWQA 5A4UA 1IYHA 2K8VA 2O89A 4D73A 4YQUA 2OE0A 2N5FA 2QC7A 1OE7A 4ZIJA 5GAND 2IMKA 1F3AA 1JFUA 1K3LA 3FW2A 4KDXA 4G10A 1GWCA 1PX7A 5E59A 3KH7A 2L57A 4FYUA 5GSTA 2DJKA 3SWLA 1K0AA 1V40A 4K6XA 1WMJA 2DJ3A 4FQUA 7GSSA 5IM9A 2JSZA 5ECLB 4GTUA 4EKZA 1FVJA 5IOXA 2IMDA 2HRFA 2BTOT 3C71A 2MYGA 1GNEA 1EEMA 1ABAA 2LSTA 2GZYA 4MABA 2Z9SA 2H1AA 5B8BA 1TI3A 4N11A 3O76A 2VCWA 5D8IA 1TRVA 2FD3A 4OWYA 1NHYA 2LJKA 3M3MA 5HR0A 1KEBA 1RK4A 2FWFA 4EDZA 2F3MA 1NM3A 6GSSA 2RIIA 4YAVA 2YWNA 1A0RP 2I9HA 2C3NA 1X5DA 1GUKA 2FWGA 4NXIA 4WBRD 1SENA 3C1SA 2HSMB 4AJ7A 3W8SA 4V1Ag 4FYBA 5JWOB 3VLNA 1RQMA 2MMAA 1G0TA 1BG5A 3HVVA 2L6DA 1SK1A 3KGKA 4POKA 2JACA 2A4VA 1B4PA 1TK5B 4WXTA 2B5XA 1R4WA 3RAZA 4ZBAA 4GRFA 3VPTA 4Q5NA 4MH3A 1Z6MA 2IL3A 1JZRA 3W6GA 5INYA 5CP1A 4V2LA 4WR5A 1FVKA 3GV1A 4NWYA 1SL1B 1YF0A 4K7IA 3GFKA 5AN1A 4NHZA 4TVEA 2WGRA 1XFLA 1PKWA 5A5KA 4PUFC 1ERUA 1PGTA 2ZUPA 4TR0A 4HEA2 1NHOA 2B7KA 5EVOA 2CZ3A 1K0OA 4LLRA 1CQHA 1HYUA 3CRUA 3I69A 1SD9A 5G1KA 1G7OA 1OC3A 1ILOA 2O7KA 3FZ5A 1M2AA 4BL7B 2R3XA 2H73A 1ERTA 5J3RA 1T8EB 3ZVJA 5FWGA 4L8EA 4CHSA 3ZFBA 3ISOA 3DVXA 2ON5A 5CRWA 4QL7A 2HQTA 1BYEA 3DWVA 5BMUA 4XS1A 2PN8A 2ZCTA 2WDUA 2J9HA 3KXOA 3LG6A 3ED3A 5CRHA 2A2SA 1TK0B 2CVBA 1GTUA 4PNGA 4O5RA 2OKAA 1O8WA 3EURA 3QAWA 18GSA 4G19A 4BVXB 5ECHB 2H01A 4NPBA 1GUMA 3GUSA 3FYGA 2YANA 3US3A 2OE1A 3M9JA 4RQRA 3CSHA 1HNAA 1URMA 3QCPA 4V2NA 2LKUA 1SYRA 2BMXA 2GT6A 1MDKA 2C80A 3ZMLA 4DSRA 4X0XA 2FCHA 1YKAA 3A5WA 1V98A 3D21A 2FLSA 3KD0A 4ILFA 2GDRA 1GL8A 1XWCA 1VF4A 1VGLA 5HFGA 2C0FA 3F3QA 5DQSA 3WGDA 1FB6A 1KNGA 3TKSE 1V9WA 1O8XA 4MH2A 1SJIA 1K0DA 3TJJA 4RUVA 4FYCA 2HSMA 3C8EA 1HNCA 1VRSD 3HZ4A 4OO5A 2P0GA 3E9JB 3J7Yb 2AV4A 4DEJA 1XCCA 1R5PA 1OE8A 1OC9B 5G5FA 1GTAA 4ZB9A 1ML6A 3I6AA 5J9BA 2V6KA 3FEUA 4EE0A 2C0EA 1R26A 2HRAA 4TR1B 3IC8A 1NSWA 2H71A 5JCUA 3LJRA 2LS5A 4F82A 2DJ0A 2FHEA 3GSTA 1KTEA 2O87A 2V1MA 3CTFA 4TXVA 3BJ5A 3P7XA 5ID2B 5F0GA 2RUFA 1K0CA 2XPEA 3TJFA 4ID0A 5D9WA 3GH6A 4L5OA 4KSMA 2J23A 5ECMB 3H93A 2VD0A 3D4TA 1HNBA 4EVMA
chains in the Genus database with same CATH superfamily
1FW1A 2VCVA 1F3BA 3ZIJA 2VL2A 1GNWA 1F2EA 3S9FA 2GSQA 2OACA 3CHXC 3RPNA 1WP0A 1THXA 1U88A 4CY8A 4PXOA 3A2XA 1QQ2A 4EIPA 2CVKA 1Z7PA 3APSA 3KP9A 2ES7A 1YZXA 4OD7A 1G7EA 2EFDA 3CYNA 3LXTA 3PINA 2DC5A 2OE3A 1M2BA 5CO3A 2H76A 5ECSA 2JL4A 4HJMA 5LCZA 3IR4A 1T3BA 2WCIA 1M0UA 5ABRA 1SU9A 4XRAA 4BL7A 1IYIA 2DSAA 2VCXA 2HNLA 2O36A 5D9TA 3WGXA 1EP8A 2VL9A 1TDIA 1ZMAA 3D5JA 1SVOA 3N5OA 1T7PB 3F4RA 4EL1A 1I1IP 5EY6A 2HSYA 2YWOA 3ZITA 19GSA 1V2AA 4IW9A 1X0RA 5KN1A 1W89A 2DJJA 2R0PA 1XWBA 3GIXA 3FY7A 2FUG2 4IBPA 4BVXA 2LQQA 3UVTA 5B6NA 2K8SA 1U87A 4EXJA 1M3JA 2CX4A 1M2DA 5COHA 1GLQA 3LFLA 2K9FA 5GAPD 1JLVA 5FT3A 5L71A 2AJQB 3FZAA 5LD0A 1EOHA 2GLRA 1F6MC 1BF5A 4IGJA 1SVMA 1OC8A 5B6MA 2LQOA 4H86A 2H6XA 2XBIA 3IRAA 5C04A 5AIXA 3IAM2 1HD2A 2V41A 2MBTA 3FZ9A 3C7MA 1T4YA 4XTSA 3BBYA 3WD6A 1SYXA 1S4BP 6GSTA 3KZQA 3PR8A 3TOUA 2DMMA 1SVLA 4TR4A 5JCGA 3MWHA 3WT1A 2GVPA 4POMA 4J56E 1UC7A 3KTBA 2O8VB 2KOKA 4JZQA 3TUEA 3F9UA 1OC9A 2KUCA 1B8XA 1F37A 5DDLA 2F8FA 4WF4A 5H5RA 3G7JA 4NHWA 4TR1A 1A24A 2PMTA 2E0QA 3F8UA 3IPZA 3D6IA 1GSFA 10GSA 2CVDA 2L6CA 3H1NA 3EVIA 4F2IA 1MD3A 2K18A 2WFCA 1PN0A 2YN1A 3LORA 5D73A 5ID2A 2MMOA 2E2GA 4GQFA 4JR4A 4XIHA 4EUYA 1A2LA 3RDWA 3GURA 4KAEA 3F6FA 1X5CA 2PU9C 4I2TA 3IV4A 1PL2A 2YZHA 4IELA 1PN9A 2OA7A 4XHMA 1HQOA 4OFNA 1ZOFA 1Y25A 1GSDA 3A2WA 4HU7A 2WW3A 1GP1A 3FR6A 4WF5A 1GLPA 1AAZA 1H75A 3EC3A 22GSA 2REMA 3CSJA 4RQXA 2VM2A 3KMOA 1TI1A 2C8UA 4YAPA 2C1YA 3F3RA 3UIWA 1YEXA 3APOA 4K0NA 3VWXA 4TW5A 4N30A 5IMAA 2IMEA 3LYPA 1X9MB 3ZLPA 2WVYA 3FKFA 2VLVA 1USBA 1MEKA 1MDJA 3CMIA 3KIJA 4Q5RA 4GSTA 4KSOA 5CNWA 2OT3A 4YKGA 1E2YA 5HR2A 2PVOC 2BJXA 3FR9A 3QOUA 1J08A 1AC1A 5HFIA 4F0BA 1TOFA 4FH8A 2MMZA 1YEWC 1M99A 2H0HA 4WEYA 4OMVA 3MIXA 1SKRB 1Y6EA 4MP4A 5ELGA 5JCWA 4E8HA 4TN8A 1EP7A 4QL9A 5J4YA 2YPMA 1SJ6A 3GSSA 5AGYA 3HYPA 1DBYA 6GSVA 3ZRDA 2VIMA 4K7NA 2B5EA 3G7YA 3EYTA 5ECNB 4HSCX 1Z9HA 2NPBA 5KN3A 4AJ6A 4XRDA 2OBIA 1EGOA 1TXXA 3WYWA 4MCUA 2C3TA 1S3RA 5HR3A 1T1VA 4NV2A 3RHBA 5F05A 2G2QA 4X43A 4BVYB 2FGXA 4A5PA 5FHIA 1T00A 4J57E 3P2AA 5CRDA 4KW6A 2H72A 5KN2A 3MAKA 2YCDA 3TGZA 5ENUA 1J9BA 2IIYA 2X8CA 4TXOB 2HFDA 3TKPA 2F51A 2NTOA 2HRNA 3F4SA 3TRXA 5KOWA 1SKWB 5ECPB 2H66A 4ZBDA 1H4OA 1K0MA 4POBA 2VD1A 4IQ1A 5DQYA 3L9SA 3FMWA 3DIEA 4JE1A 2H0IA 2H0GA 3DVWA 1BJXA 3W8JA 1LBKA 1PMTA 4XS4B 4KDYA 5HR1A 3JCML 3GX8A 1XVWA 2X49A 4IHUA 4KX4A 3IE3A 3EMPA 2HI7A 1ZGNA 3G7IA 3GKKA 1UVZA 4GSSA 1PKZA 3UBLA 5IOWA 4PNFA 1XPVA 1LU4A 4ZL9A 3RHCA 3IOSA 3ME8A 3AY8A 3O6TA 2P5RA 3GX0A 5ECOB 1AQXA 1XOAA 1ACVA 3BOAA 2WS2A 3PGTA 4JRRA 2DJ2A 5HQPA 2WZ9A 4MLYA 3LSZA 9GSSA 3FHKA 2VL3A 1FG4A 3LXZA 3TOTA 2R4VA 2UZ8A 1FHEA 1AUCA 4OO4A 5G30A 1SD8A 1TK8B 3GKNA 2VCQA 17GSA 4I5QA 3TCOA 2C4JA 1A23A 1XOBA 2FWHA 1EEJA 1Z6NA 4FXYP 1WE0A 2VKZG 1OAZA 3PPUA 5DAKB 2D2ZA 1EZKA 1R5AA 5J5NA 4TOPA 4MZWA 5D9VA 2H8LA 4KF9A 3F0IA 3HHVA 4IVFA 2VOCA 4Q5FA 2DKIA 2LJAA 2LRTA 5DCGA 4ZB8A 3QAVA 1EGRA 3DYRA 5IMFA 4GSNA 3Q19A 2K6VA 4LMVA 1G6YA 1WOUA 4IS0A 1NW2A 3KM6A 5B8AA 3LQ7A 2CAQA 3QPMA 1Y1UA 2PERA 5G31A 1A8LA 1O73A 1BG1A 4K9ZA 1XXUA 2JZRA 3MSZA 4TR3A 3VK9A 3TRQA 3TRPA 1E6BA 3ZMKA 1I9DA 1GSYA 2HYXA 4KB3A 2GSRA 2QA1A 4MJBA 4WETA 1JZDA 4EO3A 3EINA 2R2JA 5IO0A 5G5EA 2GSSA 4BVYA 4G0IA 3ERWA 5BRTA 14GSA 2H19A 2R37A 1ZYEA 4ECJA 1PL1A 3LGCA 1BEDA 2IPAA 3GA4A 2O85A 5F06A 3VFIA 1MTCA 4LMWA 4TXOA 1XWAA 3IA1A 4POLA 1K0NA 2IFQB 2L59A 4MPGA 4K2DA 4V1Ap 1N2AA 3QR6A 2WULA 4I6XA 3ZREA 1TTZA 1KBNA 5GSSA 3CSIA 5A5HB 1JLWA 2MMNA 4BIKA 2HZEB 2YJHA 5DVBA 4G0KA 3N9JA 2VAFA 4MNNA 2WW1A 2R0GA 2GQLA 1GSQA 2AUVA 3UJ1A 2AHEA 1SK0A 4HUAA 1VF2A 4MF7A 1OKDA 3TJGA 4XS4A 3ERFA 2LRCA 1AW9A 2AB6A 1GRXA 2OADA 1EWXA 2CA8A 3PH9A 1CQGA 2MBSA 2EFEA 4ZL8A 3Q18A 4BWSA 2R6KA 4NV5A 4I97A 1S3DA 5J41A 1XWKA 4MPFA 2I1UA 2C0GA 5G2ZA 1Q4JA 5ECQB 4MZBA 1FO5A 5G1LA 2LEGA 2L5LA 3DMLA 1GSSA 5CYYA 3C1RA 4ZBBA 3UBKA 4PGTA 3GRXA 3HJMA 2NVLA 4OCEA 5A4WA 2DJ1A 4HU9A 4HOJA 1WRYA 20GSA 2B1LA 1SK2A 2WJUA 4N0VA 2X8GA 3HKRA 3GN3A 3EMXA 2MZCA 1M9BA 3DKSA 4MJAA 5ECIB 4EIQA 4E8EA 1B4QA 2H30A 1XWGA 5DAKA 3KP8A 2YWIA 3Q6OA 3HJOA 3ZFLA 2N5BA 4K2XA 3L4NA 3UMAA 2OJLA 4DSSB 4E68A 2IMIA 2X99A 2YOIA 4IP1A 5HFKA 1Q98A 2E7PA 3QAGA 2YWMA 5E4WA 2JSYA 2CQ9A 2H1DA 3TB2A 2E2MA 5DJLA 3CTGA 1O7UA 2H70A 1X9WB 1ST9A 3HMJG 2RM5A 2YZUA 1QXHA 4KE3A 2C0DA 3TKSC 4FIWA 3SBCA 3WT2A 1MD4A 2C3QA 2GSTA 3DGQA 3VI5A 2YP6A 1A2JA 3D4MA 11GSA 3F63A 2KP2A 2GT5A 1TRWA 2EIOA 1QUWA 1F9MA 4ACSA 2DIYA 4MF5A 3VWUA 4HI7A 1EOGA 2DKHA 2HT9A 1J0FA 3UEMA 1XIYA 2GQKA 3HY2A 3NIVA 2H6YA 1AQVA 1B48A 3UOMA 5IMVA 4QQ7A 2B3SA 1B9YC 2EIQA 4KNDA 2CX3A 2TRCP 1M7TA 4N0ZA 2QGVA 2L5OA 3IHQA 3V1WA 4KGIA 3WGEA 2R0CA 4FO5A 5A5HA 5IIZA 2XHFA 4AKGA 1TRUA 2HZEA 4PI2C 4DSQA 2WVXB 2H74A 1A2MA 4G0LA 1S3CA 3L9VA 1TU8A 3U6VA 3I9V2 2WW2A 2FWEA 1UN2A 3HVNA 1XW9A 5CAXA 1OKTA 1PFOA 5DBQA 3FR3A 4L5LA 4PURA 4HQZA 3Q74A 2X64A 3M1GA 2PGTA 1TW9A 4AJ8A 3DRNA 4AKIA 2VLUA 3FZ4A 4ECCA 3APQA 3LYKA 4I8BA 3VPQA 1FOHA 4HZ2A 4LL4B 1A8YA 2WW0A 4ML1A 3M9KA 4KDUA 1Z3EA 1WPIA 2DIZA 4ECBA 5F07A 2IWTA 2PPTA 1XBSA 2FNOA 1YY7A 3CRTA 4PTSA 2JU5A 4LA1A 2I4AA 2VUPA 3BCIA 5IPGA 2M80A 3GHAA 3GKMA 2I81A 4HJ2A 2HSHA 5IMDA 2GTUA 3LEFA 1I5GA 3OR5A 4PX1A 4GF0A 4PQHA 3D22A 4RI6A 2IMFA 1QGVA 6GSYA 4DSSA 4I2UA 1GUHA 4JBBA 4ULXA 1BX9A 2PVQA 2HXKA 2L4QA 3HCZA 1XW5A 1FAAA 3IHGA 1K3OA 1O81A 1WWJA 4ZB7A 2GGTA 3GL3A 3FRCA 4QMKA 5AIVA 1TP9A 2KLXA 3GKXA 1ZCPA 3U5RE 5CREA 4G9HA 4RI7A 3DD3A 3GYKA 4WR4A 3IK7A 1XW6A 1SL0B 3GNJA 4PQIA 3E0UA 1QMVA 4EDYA 2OBKA 2YNXA 1PD21 1AIUA 3HJPA 4HQSA 4P3YB 2B7JA 3BCKA 5J47A 1EV4A 4AKHA 2TIRA 3UL3A 1G6WA 2B5YA 2FA8A 5IQYA 4K1FA 3RFRC 1PRXA 3M0FA 3KH9A 3QFAC 4ZILA 5EPFA 4BPYA 4IN0A 1B9XC 5IO2A 4MF6A 5D93A 1SJZA 2WVXA 3F6DA 3R3EA 4N3ZA 5D9XA 1GSUA 4AF2A 2RLIA 5C00A 4IQAA 1DSBA 4YQMA 3C73A 2HLSA 2NDOA 2G0FA 5D96A 4AI6A 2HE3A 4MZCA 3EU3A 1THOA 1M9AA 1U3AA 1OVNA 12GSA 5A34B 3EWLA 4EC0A 2IJYA 3LW9A 2A4HA 4K5SA 2H6ZA 3IK9A 1ON4A 4TKYA 3KJYA 4IJIA 4EF0A 4GDFA 1XVQA 2HZFA 3EU4A 1RW1A 2QA2A 3ZVJD 1QK8A 4GLTA 5KN0A 4KCEA 3F4TA 1O85A 1DUGA 2V6OA 2CV4A 2AAWA 4Z7XA 3UARA 3VWVA 2F8AA 3H4KA 1V58A 4O32A 4GCIA 5IMZA 1SKSB 1PQNA 4HS1A 4MJCA 2VM1A 2YJ7A 2HRKB 4AGSA 5DCHA 4KH7A 5ELAA 2AYTA 3RPPA 1X9SB 3M8NA 4XCSA 1PSQA 3HA9A 2KP1A 3D0ZA 2I3YA 3ZZXA 2NBSA 4JU5A 3QD9A 3FK8A 3P90A 2UV8G 4ECIA 4XS6A 4L0UA 3TKRA 3IC4A 6GSWA 2QKEA 5JWQB 1GULA 4X1UA 4IP6A 3G9BA 1DE2A 2QSIA 1Z5YE 1TXUA 2CT6A 1ZYQB 2PBJA 1WJKA 4F0CA 1TRSA 3GL5A 1TJDA 5KOXA 3RGBC 1V57A 4K7OA 4Q5QA 2LNSA 4PQ1A 5CRGA 1X5EA 1ERWA 5IMCA 2CAIA 1N8JA 2P5QA 4OFMA 3TU3B 1N25A 2JADA 2CZ2A 2DBCA 4WKWA 5H5QA 3TDGA 3K8NA 3TJBA 2H75A 2PWJA 1U3IA 4O7HA 2EIRA 3L78A 2H1GA 5DJMA 4Z2TA 1LJRA 5DALB 1DE1A 1PA3A 3GMFA 2DMLA 2WVZA 3KEBA 8GSSA 4V2MA 1C72A 3VWWA 2GZPA 2JZTA 4O92A 4F9ZA 4KA0A 4MJEA 4MMMA 1VF1A 2EC4A 3IXRA 2A2RA 4J2FA 3ERGA 2DLXA 3ZYWA 5A4VA 4LL1B 2O3EA 4K8MA 2ZNMA 3KCMA 2B1KA 2ALBA 4IKHA 4PUAA 4PHZC 5H5SA 2LRNA 4O5UA 1JHBA 1YQ1A 1YJ6A 5ECKB 3CWGA 2PUKC 3NZNA 4ISDA 2LJRA 3EE2A 3A2VA 2FY6A 3ZL5A 3P8WA 5A34A 1YF1A 4YKFA 5AISA 1ZZYA 3GTUB 2WRTA 2XC2A 3L9UA 5J4UA 4CW9A 4CY6A 4HDEA 16GSA 5JWRB 3H79A 2YV7A 3L0HA 3TKSA 1JZOA 3A5IA 4D73B 5F8BA 2LV3A 1YKCA 4YH2A 2H1BA 3TKQA 6GSUA 4MA9A 3MNGA 3HDCA 1EV9A 4NMUA 5B7CA 2M72A 3UAPA 2V2GA 2GQMA 2TRXA 2GZZA 3BD2A 1YEPA 3A3TA 2X8HA 2HRKA 3QMXA 3J7Yk 4N10A 3ME7A 3CQFA 3QDNA 4IJ3A 1GTIA 1OYJA 2M46A 3ZTLA 2JZSA 2YV9A 3IBHA 2VL2C 2VCTA 1GTBA 2IN3A 1PX6A 3HZ8A 2EFCA 4MK3A 1GH2A 2KHPA 3R2QA 3HVSA 4JR6A 3UVHA 2H1LA 1A0FA 3TJKA 3DXBA 1SL2B 2VCZA 1U6TA 3VI7A 2ON7A 4ML6A 1MDIA 3MYDA 3DEXA 5A1NB 3CXGA 2LUSA 2FA4A 3E3EA 1AXDA 4ZB6A 2RUEA 2B6MA 3I43A 4TRXA 3IDVA 3LWAA 1O6JA 13GSA 1AQWA 4YQVA 3HVXA 3KMNA 1S3AA 2LTKA 2V32A 1JZWA 1UA5A 4GQCA 3NOFA 5ECRB 1FOVA 4BA7A 1TKDB 1R7HA 1FB0A 1VF3A 2A2PA 4MDCA 3MDKA 2XBQA 4ZXGA 4CDOA 1TU7A 4G2EA 2IFQA 1K0BA 1M3IA 4ZL7A 4NAXA 4JEDA 1ZL9A 2XPDA 4GXZA 5EL8A 5DALA 1WIKA 2VLTA 4F03A 4DVCA 2VO4A 3RBTA 3KTLA 5GZZB 4WBJA 4Z2RA 4G01A 2GS3A 3IAS2 6GSXA 4OCFA 4HZ4A 5LNKe 1K3YA 3CBUA 4OFTA 1T4ZA 3O3TA 5IPHA 1XZOA 2RM6A 3GH9A 2LNTA 2F9SA 3HXSA 4KUNA 3ZIVA 1BAYA 4L0WA 3HD5A 2L4CA 2P31A 1BQ7A 3H8QA 5J9CA 1GSEA 2X4AA 1QFNA 2R5GA 1YDKA 3QFBC 2WB9A 4GWRA 4K0GA 3GTUA 4USSA 3VURA 2N5AA 1ERVA 2HSNB 1Z7RA 5KEJA 4KCAA 1W4VA 4BWQA 5A4UA 1IYHA 2K8VA 2O89A 4D73A 5J4VA 4YQUA 2OE0A 2N5FA 2QC7A 1OE7A 4ZIJA 5GAND 2IMKA 5J40A 1F3AA 1JFUA 1K3LA 3FW2A 2EFHA 4KDXA 4G10A 1GWCA 1PX7A 5BMUB 5E59A 3KH7A 2L57A 4FYUA 5GSTA 2DJKA 3SWLA 1K0AA 1V40A 4K6XA 1WMJA 2DJ3A 4FQUA 7GSSA 5IM9A 2JSZA 5ECLB 4GTUA 4EKZA 1FVJA 5IOXA 2IMDA 2HRFA 2BTOT 3C71A 2MYGA 1GNEA 1EEMA 1ABAA 2LSTA 2GZYA 4MABA 2Z9SA 2H1AA 5B8BA 1TI3A 4AKXB 4N11A 3O76A 2VCWA 5D8IA 1TRVA 2FD3A 4OWYA 5A1NA 1NHYA 2LJKA 3M3MA 5HR0A 1KEBA 1RK4A 2FWFA 4O5QA 4EDZA 2F3MA 1NM3A 6GSSA 2RIIA 4YAVA 2YWNA 1A0RP 2I9HA 2C3NA 4PI0C 1GUKA 1X5DA 2FWGA 1ZYNA 4NXIA 4WBRD 1SENA 3C1SA 2HSMB 4AJ7A 3W8SA 4V1Ag 4FYBA 5JWOB 3VLNA 1RQMA 2MMAA 1G0TA 1BG5A 3HVVA 2L6DA 1SK1A 3KGKA 4POKA 2JACA 2A4VA 1B4PA 1TK5B 4WXTA 2B5XA 1R4WA 3RAZA 4ZBAA 4GRFA 3VPTA 1XG8A 4Q5NA 4MH3A 1Z6MA 2IL3A 1JZRA 3W6GA 5INYA 5CP1A 4V2LA 4WR5A 1FVKA 4ICYA 3GV1A 4NWYA 4X4JA 1SL1B 1YF0A 4K7IA 3GFKA 5AN1A 4Z2UA 4NHZA 4TVEA 2WGRA 1XFLA 1PKWA 5A5KA 4PUFC 1ERUA 1PGTA 2ZUPA 4TR0A 4HEA2 1NHOA 2B7KA 5EVOA 2CZ3A 1K0OA 4LLRA 2HSNA 1CQHA 1HYUA 3CRUA 3I69A 1SD9A 5G1KA 4K5RA 1G7OA 1OC3A 1ILOA 2O7KA 3FZ5A 1M2AA 4BL7B 2R3XA 2WZSA 2H73A 1ERTA 5J3RA 1T8EB 3ZVJA 5FWGA 4L8EA 2O5VA 4CHSA 3ZFBA 3ISOA 3DVXA 2ON5A 5CRWA 4QL7A 2HQTA 1BYEA 3DWVA 5BMUA 4XS1A 2PN8A 2ZCTA 2WDUA 2J9HA 3KXOA 3LG6A 3ED3A 5CRHA 2A2SA 1TK0B 2CVBA 1GTUA 4PNGA 4O5RA 2OKAA 1O8WA 3EURA 3QAWA 18GSA 4G19A 4BVXB 5ECHB 2H01A 4NPBA 1GUMA 3GUSA 3FYGA 2YANA 3US3A 2OE1A 3M9JA 1ZYPA 4RQRA 3CSHA 1HNAA 1URMA 3QCPA 4V2NA 2LKUA 1SYRA 2BMXA 2GT6A 1MDKA 2C80A 3ZMLA 4DSRA 4X0XA 2FCHA 1YKAA 3A5WA 1V98A 3D21A 2FLSA 3KD0A 4ILFA 2GDRA 1GL8A 1XWCA 1VF4A 1VGLA 5HFGA 2C0FA 3F3QA 5DQSA 3WGDA 1FB6A 1KNGA 3TKSE 1V9WA 4W66A 1O8XA 4MH2A 1SJIA 1K0DA 3TJJA 4RUVA 4FYCA 2HSMA 3C8EA 1HNCA 1VRSD 3HZ4A 4OO5A 2P0GA 3E9JB 3J7Yb 2AV4A 4DEJA 1XCCA 1R5PA 1OE8A 1OC9B 5G5FA 1GTAA 4ZB9A 1ML6A 3I6AA 5J9BA 2V6KA 3FEUA 4EE0A 2C0EA 1R26A 2HRAA 4TR1B 3IC8A 1NSWA 2H71A 5JCUA 3LJRA 2LS5A 4F82A 2DJ0A 2FHEA 3GSTA 1KTEA 2O87A 2V1MA 3EPTA 3CTFA 4TXVA 3BJ5A 3P7XA 5ID2B 5F0GA 2RUFA 1K0CA 2XPEA 3TJFA 4ID0A 5D9WA 3GH6A 4L5OA 4KSMA 2J23A 5ECMB 3H93A 1YVLA 2VD0A 3D4TA 1HNBA 4EVMA
chains in the Genus database with same CATH topology
1FW1A 2VCVA 1F3BA 3ZIJA 2VL2A 1GNWA 1F2EA 3S9FA 2GSQA 2OACA 3RPNA 1WP0A 1THXA 1U88A 4CY8A 4PXOA 3A2XA 1QQ2A 4EIPA 2CVKA 1Z7PA 3APSA 3KP9A 2ES7A 1YZXA 4OD7A 1G7EA 2EFDA 3CYNA 3LXTA 3PINA 2DC5A 2OE3A 1M2BA 5CO3A 2H76A 5ECSA 2JL4A 4HJMA 5LCZA 3IR4A 1T3BA 2WCIA 1M0UA 5ABRA 1SU9A 4XRAA 4BL7A 1IYIA 2DSAA 2VCXA 2HNLA 5D9TA 3WGXA 1EP8A 2VL9A 1TDIA 1ZMAA 3D5JA 1SVOA 3N5OA 1T7PB 3F4RA 4EL1A 5EY6A 2HSYA 2YWOA 3ZITA 19GSA 1V2AA 4IW9A 1X0RA 5KN1A 1W89A 2DJJA 2R0PA 1XWBA 3GIXA 3FY7A 2FUG2 4IBPA 4BVXA 2LQQA 3UVTA 5B6NA 2K8SA 1U87A 4EXJA 2CX4A 1M2DA 5COHA 1GLQA 3LFLA 2K9FA 5GAPD 1JLVA 5FT3A 5L71A 2AJQB 3FZAA 5LD0A 1EOHA 2GLRA 1F6MC 1BF5A 4IGJA 1SVMA 1OC8A 5B6MA 2LQOA 4H86A 2H6XA 2XBIA 3IRAA 5C04A 5AIXA 3IAM2 1HD2A 2V41A 2MBTA 3FZ9A 3C7MA 1T4YA 4XTSA 3BBYA 3WD6A 1SYXA 6GSTA 3KZQA 3PR8A 3TOUA 2DMMA 1SVLA 4TR4A 5JCGA 3MWHA 3WT1A 2GVPA 4POMA 4J56E 1UC7A 3KTBA 2O8VB 2KOKA 4JZQA 3TUEA 3F9UA 1OC9A 2KUCA 1B8XA 1F37A 5DDLA 2F8FA 4WF4A 5H5RA 3G7JA 4NHWA 4TR1A 1A24A 2PMTA 2E0QA 3F8UA 3IPZA 3D6IA 1GSFA 10GSA 2CVDA 2L6CA 3H1NA 3EVIA 4F2IA 1MD3A 2K18A 2WFCA 1PN0A 2YN1A 3LORA 5D73A 5ID2A 2MMOA 2E2GA 4GQFA 4JR4A 4XIHA 4EUYA 1A2LA 3RDWA 3GURA 4KAEA 3F6FA 1X5CA 2PU9C 4I2TA 3IV4A 1PL2A 2YZHA 4IELA 1PN9A 2OA7A 4XHMA 1HQOA 4OFNA 1ZOFA 1Y25A 1GSDA 3A2WA 4HU7A 1GP1A 3FR6A 4WF5A 1GLPA 1AAZA 1H75A 3EC3A 22GSA 2REMA 3CSJA 4RQXA 2VM2A 3KMOA 1TI1A 2C8UA 4YAPA 2C1YA 3F3RA 3UIWA 1YEXA 3APOA 4K0NA 3VWXA 4TW5A 4N30A 5IMAA 2IMEA 3LYPA 1X9MB 3ZLPA 3FKFA 2VLVA 1USBA 1MEKA 1MDJA 3CMIA 3KIJA 4Q5RA 4GSTA 4KSOA 5CNWA 2OT3A 4YKGA 1E2YA 5HR2A 2PVOC 2BJXA 3FR9A 3QOUA 1J08A 1AC1A 5HFIA 4F0BA 1TOFA 4FH8A 2MMZA 1M99A 2H0HA 4WEYA 4OMVA 3MIXA 1SKRB 1Y6EA 4MP4A 5ELGA 5JCWA 4E8HA 4TN8A 1EP7A 4QL9A 5J4YA 2YPMA 1SJ6A 3GSSA 5AGYA 3HYPA 1DBYA 6GSVA 3ZRDA 2VIMA 4K7NA 2B5EA 3G7YA 3EYTA 5ECNB 1Z9HA 2NPBA 5KN3A 4AJ6A 4XRDA 2OBIA 1EGOA 1TXXA 3WYWA 4MCUA 2C3TA 5HR3A 1T1VA 4NV2A 3RHBA 5F05A 2G2QA 4X43A 4BVYB 2FGXA 4A5PA 5FHIA 1T00A 4J57E 3P2AA 5CRDA 4KW6A 2H72A 5KN2A 3MAKA 2YCDA 3TGZA 5ENUA 1J9BA 2IIYA 2X8CA 4TXOB 2HFDA 3TKPA 2F51A 2NTOA 2HRNA 3F4SA 3TRXA 5KOWA 1SKWB 5ECPB 2H66A 4ZBDA 1H4OA 1K0MA 4POBA 2VD1A 4IQ1A 5DQYA 3L9SA 3FMWA 3DIEA 4JE1A 2H0IA 2H0GA 3DVWA 1BJXA 3W8JA 1LBKA 1PMTA 4XS4B 4KDYA 5HR1A 3JCML 3GX8A 1XVWA 2X49A 4IHUA 4KX4A 3IE3A 3EMPA 2HI7A 1ZGNA 3G7IA 3GKKA 1UVZA 4GSSA 1PKZA 3UBLA 5IOWA 4PNFA 1XPVA 1LU4A 4ZL9A 3RHCA 3IOSA 3ME8A 3AY8A 3O6TA 2P5RA 3GX0A 5ECOB 1AQXA 1XOAA 1ACVA 3BOAA 2WS2A 3PGTA 4JRRA 2DJ2A 5HQPA 2WZ9A 4MLYA 3LSZA 9GSSA 3FHKA 2VL3A 1FG4A 3LXZA 3TOTA 2R4VA 2UZ8A 1FHEA 1AUCA 4OO4A 5G30A 1SD8A 1TK8B 3GKNA 2VCQA 17GSA 4I5QA 3TCOA 2C4JA 1A23A 1XOBA 2FWHA 1EEJA 1Z6NA 1WE0A 2VKZG 1OAZA 3PPUA 5DAKB 2D2ZA 1EZKA 1R5AA 5J5NA 4TOPA 4MZWA 5D9VA 2H8LA 4KF9A 3F0IA 3HHVA 4IVFA 2VOCA 4Q5FA 2DKIA 2LJAA 2LRTA 5DCGA 4ZB8A 3QAVA 1EGRA 3DYRA 5IMFA 4GSNA 3Q19A 2K6VA 4LMVA 1G6YA 1WOUA 4IS0A 1NW2A 3KM6A 5B8AA 3LQ7A 2CAQA 3QPMA 1Y1UA 2PERA 5G31A 1A8LA 1O73A 1BG1A 4K9ZA 1XXUA 2JZRA 3MSZA 4TR3A 3VK9A 3TRQA 3TRPA 1E6BA 3ZMKA 1I9DA 1GSYA 2HYXA 4KB3A 2GSRA 2QA1A 4MJBA 4WETA 1JZDA 4EO3A 3EINA 2R2JA 5IO0A 5G5EA 2GSSA 4BVYA 4G0IA 3ERWA 5BRTA 14GSA 2H19A 2R37A 1ZYEA 4ECJA 1PL1A 3LGCA 1BEDA 2IPAA 3GA4A 2O85A 5F06A 3VFIA 1MTCA 4LMWA 4TXOA 1XWAA 3IA1A 4POLA 1K0NA 2IFQB 2L59A 4MPGA 4K2DA 4V1Ap 1N2AA 3QR6A 2WULA 4I6XA 3ZREA 1TTZA 1KBNA 5GSSA 3CSIA 5A5HB 1JLWA 2MMNA 2HZEB 2YJHA 5DVBA 4G0KA 3N9JA 2VAFA 4MNNA 2R0GA 2GQLA 1GSQA 2AUVA 3UJ1A 2AHEA 1SK0A 4HUAA 1VF2A 4MF7A 1OKDA 3TJGA 4XS4A 3ERFA 2LRCA 1AW9A 2AB6A 1GRXA 2OADA 1EWXA 2CA8A 3PH9A 1CQGA 2MBSA 2EFEA 4ZL8A 3Q18A 4BWSA 2R6KA 4NV5A 4I97A 1S3DA 5J41A 1XWKA 4MPFA 2I1UA 2C0GA 5G2ZA 1Q4JA 5ECQB 4MZBA 1FO5A 5G1LA 2LEGA 2L5LA 3DMLA 1GSSA 5CYYA 3C1RA 4ZBBA 3UBKA 4PGTA 3GRXA 3HJMA 2NVLA 4OCEA 5A4WA 2DJ1A 4HU9A 4HOJA 1WRYA 20GSA 2B1LA 1SK2A 2WJUA 4N0VA 2X8GA 3HKRA 3GN3A 3EMXA 2MZCA 1M9BA 3DKSA 4MJAA 5ECIB 4EIQA 4E8EA 1B4QA 2H30A 1XWGA 5DAKA 3KP8A 2YWIA 3Q6OA 3HJOA 3ZFLA 2N5BA 4K2XA 3L4NA 3UMAA 2OJLA 4DSSB 4E68A 2IMIA 2X99A 2YOIA 4IP1A 5HFKA 1Q98A 2E7PA 3QAGA 2YWMA 5E4WA 2JSYA 2CQ9A 2H1DA 3TB2A 2E2MA 5DJLA 3CTGA 1O7UA 2H70A 1X9WB 1ST9A 3HMJG 2RM5A 2YZUA 1QXHA 4KE3A 2C0DA 3TKSC 4FIWA 3SBCA 3WT2A 1MD4A 2C3QA 2GSTA 3DGQA 3VI5A 2YP6A 1A2JA 3D4MA 11GSA 3F63A 2KP2A 2GT5A 1TRWA 2EIOA 1QUWA 1F9MA 4ACSA 2DIYA 4MF5A 3VWUA 4HI7A 1EOGA 2DKHA 2HT9A 1J0FA 3UEMA 1XIYA 2GQKA 3HY2A 3NIVA 2H6YA 1AQVA 1B48A 3UOMA 5IMVA 4QQ7A 2B3SA 1B9YC 2EIQA 4KNDA 2CX3A 2TRCP 1M7TA 4N0ZA 2QGVA 2L5OA 3IHQA 3V1WA 4KGIA 3WGEA 2R0CA 4FO5A 5A5HA 5IIZA 2XHFA 4AKGA 1TRUA 2HZEA 4DSQA 2H74A 1A2MA 4G0LA 1S3CA 3L9VA 1TU8A 3U6VA 3I9V2 2FWEA 1UN2A 1XW9A 5CAXA 1OKTA 5DBQA 3FR3A 4L5LA 4PURA 4HQZA 3Q74A 2X64A 3M1GA 2PGTA 1TW9A 4AJ8A 3DRNA 4AKIA 2VLUA 3FZ4A 4ECCA 3APQA 3LYKA 4I8BA 3VPQA 1FOHA 4HZ2A 4LL4B 1A8YA 4ML1A 3M9KA 4KDUA 1Z3EA 1WPIA 2DIZA 4ECBA 5F07A 2IWTA 2PPTA 1XBSA 2FNOA 1YY7A 3CRTA 4PTSA 2JU5A 4LA1A 2I4AA 2VUPA 3BCIA 5IPGA 2M80A 3GHAA 3GKMA 2I81A 4HJ2A 2HSHA 5IMDA 2GTUA 3LEFA 1I5GA 3OR5A 4PX1A 4GF0A 4PQHA 3D22A 4RI6A 2IMFA 1QGVA 6GSYA 4DSSA 4I2UA 1GUHA 4JBBA 4ULXA 1BX9A 2PVQA 2HXKA 2L4QA 3HCZA 1XW5A 1FAAA 3IHGA 1K3OA 1O81A 1WWJA 4ZB7A 2GGTA 3GL3A 3FRCA 4QMKA 5AIVA 1TP9A 2KLXA 3GKXA 1ZCPA 3U5RE 5CREA 4G9HA 4RI7A 3DD3A 3GYKA 4WR4A 3IK7A 1XW6A 1SL0B 3GNJA 4PQIA 3E0UA 1QMVA 4EDYA 2OBKA 2YNXA 1PD21 1AIUA 3HJPA 4HQSA 4P3YB 2B7JA 3BCKA 5J47A 1EV4A 4AKHA 2TIRA 3UL3A 1G6WA 2B5YA 2FA8A 5IQYA 4K1FA 1PRXA 3M0FA 3KH9A 3QFAC 4ZILA 5EPFA 4BPYA 4IN0A 1B9XC 5IO2A 4MF6A 5D93A 1SJZA 3F6DA 3R3EA 4N3ZA 5D9XA 1GSUA 4AF2A 2RLIA 5C00A 4IQAA 1DSBA 4YQMA 3C73A 2HLSA 2NDOA 2G0FA 5D96A 4AI6A 2HE3A 4MZCA 3EU3A 1THOA 1M9AA 1U3AA 1OVNA 12GSA 5A34B 3EWLA 4EC0A 2IJYA 3LW9A 2A4HA 4K5SA 2H6ZA 3IK9A 1ON4A 4TKYA 3KJYA 4IJIA 4EF0A 4GDFA 1XVQA 2HZFA 3EU4A 1RW1A 2QA2A 3ZVJD 1QK8A 4GLTA 5KN0A 4KCEA 3F4TA 1O85A 1DUGA 2V6OA 2CV4A 2AAWA 4Z7XA 3UARA 3VWVA 2F8AA 3H4KA 1V58A 4O32A 4GCIA 5IMZA 1SKSB 1PQNA 4HS1A 4MJCA 2VM1A 2YJ7A 2HRKB 4AGSA 5DCHA 4KH7A 5ELAA 2AYTA 3RPPA 1X9SB 3M8NA 4XCSA 1PSQA 3HA9A 2KP1A 3D0ZA 2I3YA 3ZZXA 2NBSA 4JU5A 3QD9A 3FK8A 3P90A 2UV8G 4ECIA 4XS6A 4L0UA 3TKRA 3IC4A 6GSWA 2QKEA 5JWQB 1GULA 4X1UA 4IP6A 3G9BA 1DE2A 2QSIA 1Z5YE 1TXUA 2CT6A 1ZYQB 2PBJA 1WJKA 4F0CA 1TRSA 3GL5A 1TJDA 5KOXA 1V57A 4K7OA 4Q5QA 2LNSA 4PQ1A 5CRGA 1X5EA 1ERWA 5IMCA 2CAIA 1N8JA 2P5QA 4OFMA 3TU3B 1N25A 2JADA 2CZ2A 2DBCA 4WKWA 5H5QA 3TDGA 3K8NA 3TJBA 2H75A 2PWJA 1U3IA 4O7HA 2EIRA 3L78A 2H1GA 5DJMA 4Z2TA 1LJRA 5DALB 1DE1A 1PA3A 3GMFA 2DMLA 3KEBA 8GSSA 4V2MA 1C72A 3VWWA 2GZPA 2JZTA 4O92A 4F9ZA 4KA0A 4MJEA 4MMMA 1VF1A 2EC4A 3IXRA 2A2RA 4J2FA 3ERGA 2DLXA 3ZYWA 5A4VA 4LL1B 4K8MA 2ZNMA 3KCMA 2B1KA 2ALBA 4IKHA 4PUAA 5H5SA 2LRNA 4O5UA 1JHBA 1YQ1A 1YJ6A 5ECKB 3CWGA 2PUKC 3NZNA 4ISDA 2LJRA 3EE2A 3A2VA 2FY6A 3ZL5A 3P8WA 5A34A 1YF1A 4YKFA 5AISA 1ZZYA 3GTUB 2WRTA 2XC2A 3L9UA 5J4UA 4CW9A 4CY6A 4HDEA 16GSA 5JWRB 3H79A 2YV7A 3L0HA 3TKSA 1JZOA 3A5IA 4D73B 5F8BA 2LV3A 1YKCA 4YH2A 2H1BA 3TKQA 6GSUA 4MA9A 3MNGA 3HDCA 1EV9A 4NMUA 5B7CA 2M72A 3UAPA 2V2GA 2GQMA 2TRXA 2GZZA 3BD2A 1YEPA 3A3TA 2X8HA 2HRKA 3QMXA 3J7Yk 4N10A 3ME7A 3QDNA 4IJ3A 1GTIA 1OYJA 2M46A 3ZTLA 2JZSA 2YV9A 3IBHA 2VL2C 2VCTA 1GTBA 2IN3A 1PX6A 3HZ8A 2EFCA 4MK3A 1GH2A 2KHPA 3R2QA 3HVSA 4JR6A 3UVHA 2H1LA 1A0FA 3TJKA 3DXBA 1SL2B 2VCZA 1U6TA 3VI7A 2ON7A 4ML6A 3MYDA 1MDIA 3DEXA 5A1NB 3CXGA 2LUSA 2FA4A 3E3EA 1AXDA 4ZB6A 2RUEA 2B6MA 3I43A 4TRXA 3IDVA 3LWAA 1O6JA 13GSA 1AQWA 4YQVA 3HVXA 3KMNA 1S3AA 2LTKA 2V32A 1JZWA 1UA5A 4GQCA 3NOFA 5ECRB 1FOVA 4BA7A 1TKDB 1R7HA 1FB0A 1VF3A 2A2PA 4MDCA 3MDKA 2XBQA 4ZXGA 4CDOA 1TU7A 4G2EA 2IFQA 1K0BA 4ZL7A 4NAXA 4JEDA 1ZL9A 2XPDA 4GXZA 5EL8A 5DALA 1WIKA 2VLTA 4F03A 4DVCA 2VO4A 3RBTA 3KTLA 5GZZB 4WBJA 4Z2RA 4G01A 2GS3A 3IAS2 6GSXA 4OCFA 4HZ4A 5LNKe 1K3YA 3CBUA 4OFTA 1T4ZA 3O3TA 5IPHA 1XZOA 2RM6A 3GH9A 2LNTA 2F9SA 3HXSA 4KUNA 3ZIVA 1BAYA 4L0WA 3HD5A 2L4CA 2P31A 1BQ7A 3H8QA 5J9CA 1GSEA 2X4AA 1QFNA 2R5GA 1YDKA 3QFBC 2WB9A 4GWRA 4K0GA 3GTUA 4USSA 3VURA 2N5AA 1ERVA 2HSNB 1Z7RA 5KEJA 4KCAA 1W4VA 4BWQA 5A4UA 1IYHA 2K8VA 2O89A 4D73A 5J4VA 4YQUA 2OE0A 2N5FA 2QC7A 1OE7A 4ZIJA 5GAND 2IMKA 5J40A 1F3AA 1JFUA 1K3LA 3FW2A 2EFHA 4KDXA 4G10A 1GWCA 1PX7A 5BMUB 5E59A 3KH7A 2L57A 4FYUA 5GSTA 2DJKA 3SWLA 1K0AA 1V40A 4K6XA 1WMJA 2DJ3A 4FQUA 7GSSA 5IM9A 2JSZA 5ECLB 4GTUA 4EKZA 1FVJA 5IOXA 2IMDA 2HRFA 2BTOT 3C71A 2MYGA 1GNEA 1EEMA 1ABAA 2LSTA 2GZYA 4MABA 2Z9SA 2H1AA 5B8BA 1TI3A 4AKXB 4N11A 3O76A 2VCWA 5D8IA 1TRVA 2FD3A 4OWYA 5A1NA 1NHYA 2LJKA 3M3MA 5HR0A 1KEBA 1RK4A 2FWFA 4O5QA 4EDZA 2F3MA 1NM3A 6GSSA 2RIIA 4YAVA 2YWNA 1A0RP 2I9HA 2C3NA 1X5DA 1GUKA 2FWGA 1ZYNA 4NXIA 4WBRD 1SENA 3C1SA 2HSMB 4AJ7A 3W8SA 4V1Ag 4FYBA 5JWOB 3VLNA 1RQMA 2MMAA 1G0TA 1BG5A 3HVVA 2L6DA 1SK1A 3KGKA 4POKA 2JACA 2A4VA 1B4PA 1TK5B 4WXTA 2B5XA 1R4WA 3RAZA 4ZBAA 4GRFA 3VPTA 4Q5NA 4MH3A 1Z6MA 2IL3A 1JZRA 3W6GA 5INYA 5CP1A 4V2LA 4WR5A 1FVKA 4ICYA 3GV1A 4NWYA 4X4JA 1SL1B 1YF0A 4K7IA 3GFKA 5AN1A 4Z2UA 4NHZA 4TVEA 2WGRA 1XFLA 1PKWA 5A5KA 4PUFC 1ERUA 1PGTA 2ZUPA 4TR0A 4HEA2 1NHOA 2B7KA 5EVOA 2CZ3A 1K0OA 4LLRA 2HSNA 1CQHA 1HYUA 3CRUA 3I69A 1SD9A 5G1KA 4K5RA 1G7OA 1OC3A 1ILOA 2O7KA 3FZ5A 1M2AA 4BL7B 2R3XA 2H73A 1ERTA 5J3RA 1T8EB 3ZVJA 5FWGA 4L8EA 2O5VA 4CHSA 3ZFBA 3ISOA 3DVXA 2ON5A 5CRWA 4QL7A 2HQTA 1BYEA 3DWVA 5BMUA 4XS1A 2PN8A 2ZCTA 2WDUA 2J9HA 3KXOA 3LG6A 3ED3A 5CRHA 2A2SA 1TK0B 2CVBA 1GTUA 4PNGA 4O5RA 2OKAA 1O8WA 3EURA 3QAWA 18GSA 4G19A 4BVXB 5ECHB 2H01A 4NPBA 1GUMA 3GUSA 3FYGA 2YANA 3US3A 2OE1A 3M9JA 1ZYPA 4RQRA 3CSHA 1HNAA 1URMA 3QCPA 4V2NA 2LKUA 1SYRA 2BMXA 2GT6A 1MDKA 2C80A 3ZMLA 4DSRA 4X0XA 2FCHA 1YKAA 3A5WA 1V98A 3D21A 2FLSA 3KD0A 4ILFA 2GDRA 1GL8A 1XWCA 1VF4A 1VGLA 5HFGA 2C0FA 3F3QA 5DQSA 3WGDA 1FB6A 1KNGA 3TKSE 1V9WA 4W66A 1O8XA 4MH2A 1SJIA 1K0DA 3TJJA 4RUVA 4FYCA 2HSMA 3C8EA 1HNCA 1VRSD 3HZ4A 4OO5A 2P0GA 3E9JB 3J7Yb 2AV4A 4DEJA 1XCCA 1R5PA 1OE8A 1OC9B 5G5FA 1GTAA 4ZB9A 1ML6A 3I6AA 5J9BA 2V6KA 3FEUA 4EE0A 2C0EA 1R26A 2HRAA 4TR1B 3IC8A 1NSWA 2H71A 5JCUA 3LJRA 2LS5A 4F82A 2DJ0A 2FHEA 3GSTA 1KTEA 2O87A 2V1MA 3EPTA 3CTFA 4TXVA 3BJ5A 3P7XA 5ID2B 5F0GA 2RUFA 1K0CA 2XPEA 3TJFA 4ID0A 5D9WA 3GH6A 4L5OA 4KSMA 2J23A 5ECMB 3H93A 1YVLA 2VD0A 3D4TA 1HNBA 4EVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW1 A;  2VCV A;  1F3B A;  3ZIJ A;  2VL2 A;  1GNW A;  1F2E A;  3S9F A;  2GSQ A;  2OAC A;  3RPN A;  1WP0 A;  1THX A;  1U88 A;  4PXO A;  3A2X A;  1QQ2 A;  2CVK A;  1Z7P A;  3APS A;  3KP9 A;  2ES7 A;  1YZX A;  4OD7 A;  1G7E A;  3CYN A;  3LXT A;  3PIN A;  2DC5 A;  2OE3 A;  1M2B A;  5CO3 A;  2H76 A;  5ECS A;  2JL4 A;  4HJM A;  5LCZ A;  3IR4 A;  1T3B A;  2WCI A;  1M0U A;  5ABR A;  1SU9 A;  4XRA A;  4BL7 A;  1IYI A;  2DSA A;  2VCX A;  2HNL A;  5D9T A;  3WGX A;  1EP8 A;  2VL9 A;  1TDI A;  1ZMA A;  3D5J A;  3N5O A;  1T7P B;  3F4R A;  4EL1 A;  5EY6 A;  2HSY A;  2YWO A;  3ZIT A;  19GS A;  1V2A A;  4IW9 A;  1X0R A;  5KN1 A;  1W89 A;  2DJJ A;  1XWB A;  3GIX A;  3FY7 A;  2FUG 2;  4IBP A;  4BVX A;  2LQQ A;  3UVT A;  5B6N A;  2K8S A;  1U87 A;  4EXJ A;  2CX4 A;  1M2D A;  5COH A;  1GLQ A;  3LFL A;  2K9F A;  5GAP D;  1JLV A;  5FT3 A;  5L71 A;  2AJQ B;  3FZA A;  5LD0 A;  1EOH A;  2GLR A;  1F6M C;  4IGJ A;  1OC8 A;  5B6M A;  2LQO A;  4H86 A;  2H6X A;  2XBI A;  3IRA A;  5C04 A;  5AIX A;  3IAM 2;  1HD2 A;  2V41 A;  2MBT A;  3FZ9 A;  3C7M A;  1T4Y A;  4XTS A;  3BBY A;  3WD6 A;  1SYX A;  6GST A;  3KZQ A;  3PR8 A;  3TOU A;  2DMM A;  4TR4 A;  5JCG A;  3MWH A;  3WT1 A;  2GVP A;  4POM A;  4J56 E;  1UC7 A;  3KTB A;  2O8V B;  2KOK A;  4JZQ A;  3TUE A;  3F9U A;  1OC9 A;  2KUC A;  1B8X A;  1F37 A;  5DDL A;  2F8F A;  4WF4 A;  5H5R A;  3G7J A;  4NHW A;  4TR1 A;  1A24 A;  2PMT A;  2E0Q A;  3F8U A;  3IPZ A;  3D6I A;  1GSF A;  10GS A;  2CVD A;  2L6C A;  3H1N A;  3EVI A;  4F2I A;  1MD3 A;  2K18 A;  2WFC A;  2YN1 A;  3LOR A;  5D73 A;  5ID2 A;  2MMO A;  2E2G A;  4GQF A;  4JR4 A;  4XIH A;  4EUY A;  1A2L A;  3RDW A;  3GUR A;  4KAE A;  3F6F A;  1X5C A;  2PU9 C;  4I2T A;  3IV4 A;  1PL2 A;  2YZH A;  4IEL A;  1PN9 A;  2OA7 A;  4XHM A;  1HQO A;  4OFN A;  1ZOF A;  1Y25 A;  1GSD A;  3A2W A;  4HU7 A;  1GP1 A;  3FR6 A;  4WF5 A;  1GLP A;  1AAZ A;  1H75 A;  3EC3 A;  22GS A;  2REM A;  3CSJ A;  4RQX A;  2VM2 A;  3KMO A;  1TI1 A;  2C8U A;  4YAP A;  2C1Y A;  3F3R A;  3UIW A;  1YEX A;  3APO A;  4K0N A;  3VWX A;  4TW5 A;  4N30 A;  5IMA A;  2IME A;  3LYP A;  1X9M B;  3ZLP A;  3FKF A;  2VLV A;  1USB A;  1MEK A;  1MDJ A;  3CMI A;  3KIJ A;  4Q5R A;  4GST A;  4KSO A;  5CNW A;  1E2Y A;  5HR2 A;  2PVO C;  2BJX A;  3FR9 A;  3QOU A;  1J08 A;  1AC1 A;  5HFI A;  4F0B A;  1TOF A;  4FH8 A;  2MMZ A;  1M99 A;  2H0H A;  4WEY A;  4OMV A;  1SKR B;  1Y6E A;  4MP4 A;  5ELG A;  5JCW A;  4E8H A;  4TN8 A;  1EP7 A;  4QL9 A;  2YPM A;  1SJ6 A;  3GSS A;  5AGY A;  3HYP A;  1DBY A;  6GSV A;  3ZRD A;  2VIM A;  4K7N A;  2B5E A;  3G7Y A;  3EYT A;  5ECN B;  1Z9H A;  2NPB A;  5KN3 A;  4AJ6 A;  4XRD A;  2OBI A;  1EGO A;  1TXX A;  3WYW A;  4MCU A;  2C3T A;  5HR3 A;  1T1V A;  4NV2 A;  3RHB A;  5F05 A;  2G2Q A;  4X43 A;  4BVY B;  2FGX A;  5FHI A;  1T00 A;  4J57 E;  3P2A A;  5CRD A;  4KW6 A;  2H72 A;  5KN2 A;  3MAK A;  2YCD A;  3TGZ A;  5ENU A;  1J9B A;  2IIY A;  2X8C A;  4TXO B;  2HFD A;  3TKP A;  2F51 A;  2NTO A;  2HRN A;  3F4S A;  3TRX A;  1SKW B;  5ECP B;  2H66 A;  4ZBD A;  1H4O A;  1K0M A;  4POB A;  2VD1 A;  4IQ1 A;  5DQY A;  3L9S A;  3DIE A;  4JE1 A;  2H0I A;  2H0G A;  3DVW A;  1BJX A;  3W8J A;  1LBK A;  1PMT A;  4XS4 B;  4KDY A;  5HR1 A;  3JCM L;  3GX8 A;  1XVW A;  4IHU A;  4KX4 A;  3IE3 A;  3EMP A;  2HI7 A;  1ZGN A;  3G7I A;  3GKK A;  1UVZ A;  4GSS A;  1PKZ A;  3UBL A;  5IOW A;  4PNF A;  1XPV A;  1LU4 A;  4ZL9 A;  3RHC A;  3IOS A;  3ME8 A;  3AY8 A;  3O6T A;  2P5R A;  3GX0 A;  5ECO B;  1AQX A;  1XOA A;  1ACV A;  3BOA A;  2WS2 A;  3PGT A;  4JRR A;  2DJ2 A;  5HQP A;  2WZ9 A;  4MLY A;  3LSZ A;  9GSS A;  3FHK A;  2VL3 A;  1FG4 A;  3LXZ A;  3TOT A;  2R4V A;  2UZ8 A;  1FHE A;  1AUC A;  4OO4 A;  5G30 A;  1SD8 A;  1TK8 B;  3GKN A;  2VCQ A;  17GS A;  4I5Q A;  3TCO A;  2C4J A;  1A23 A;  1XOB A;  2FWH A;  1EEJ A;  1Z6N A;  1WE0 A;  1OAZ A;  3PPU A;  5DAK B;  2D2Z A;  1EZK A;  1R5A A;  5J5N A;  4TOP A;  4MZW A;  5D9V A;  2H8L A;  4KF9 A;  3F0I A;  3HHV A;  4IVF A;  2VOC A;  4Q5F A;  2LJA A;  2LRT A;  5DCG A;  4ZB8 A;  3QAV A;  1EGR A;  3DYR A;  5IMF A;  4GSN A;  3Q19 A;  2K6V A;  4LMV A;  1G6Y A;  1WOU A;  4IS0 A;  1NW2 A;  3KM6 A;  5B8A A;  3LQ7 A;  2CAQ A;  3QPM A;  2PER A;  5G31 A;  1A8L A;  1O73 A;  4K9Z A;  1XXU A;  2JZR A;  3MSZ A;  4TR3 A;  3VK9 A;  3TRQ A;  3TRP A;  1E6B A;  3ZMK A;  1I9D A;  1GSY A;  2HYX A;  4KB3 A;  2GSR A;  4MJB A;  4WET A;  1JZD A;  4EO3 A;  3EIN A;  2R2J A;  5IO0 A;  5G5E A;  2GSS A;  4BVY A;  4G0I A;  3ERW A;  14GS A;  2H19 A;  2R37 A;  1ZYE A;  4ECJ A;  1PL1 A;  3LGC A;  1BED A;  2IPA A;  3GA4 A;  2O85 A;  5F06 A;  3VFI A;  1MTC A;  4LMW A;  4TXO A;  1XWA A;  3IA1 A;  4POL A;  1K0N A;  2IFQ B;  2L59 A;  4MPG A;  4K2D A;  4V1A p;  1N2A A;  3QR6 A;  2WUL A;  4I6X A;  3ZRE A;  1TTZ A;  1KBN A;  5GSS A;  3CSI A;  1JLW A;  2MMN A;  2HZE B;  2YJH A;  5DVB A;  4G0K A;  3N9J A;  2VAF A;  2GQL A;  1GSQ A;  2AUV A;  3UJ1 A;  2AHE A;  1SK0 A;  4HUA A;  1VF2 A;  4MF7 A;  1OKD A;  3TJG A;  4XS4 A;  3ERF A;  2LRC A;  1AW9 A;  2AB6 A;  1GRX A;  2OAD A;  1EWX A;  2CA8 A;  3PH9 A;  1CQG A;  2MBS A;  4ZL8 A;  3Q18 A;  4BWS A;  2R6K A;  4NV5 A;  4I97 A;  1S3D A;  5J41 A;  1XWK A;  4MPF A;  2I1U A;  2C0G A;  5G2Z A;  1Q4J A;  5ECQ B;  4MZB A;  1FO5 A;  5G1L A;  2LEG A;  2L5L A;  3DML A;  1GSS A;  5CYY A;  3C1R A;  4ZBB A;  3UBK A;  4PGT A;  3GRX A;  3HJM A;  2NVL A;  4OCE A;  5A4W A;  2DJ1 A;  4HU9 A;  4HOJ A;  1WRY A;  20GS A;  2B1L A;  1SK2 A;  2WJU A;  4N0V A;  2X8G A;  3HKR A;  3GN3 A;  3EMX A;  2MZC A;  1M9B A;  3DKS A;  4MJA A;  5ECI B;  4E8E A;  1B4Q A;  2H30 A;  1XWG A;  5DAK A;  3KP8 A;  2YWI A;  3Q6O A;  3HJO A;  3ZFL A;  2N5B A;  3L4N A;  3UMA A;  2OJL A;  4DSS B;  2X99 A;  2IMI A;  2YOI A;  4IP1 A;  5HFK A;  1Q98 A;  2E7P A;  3QAG A;  2YWM A;  5E4W A;  2JSY A;  2CQ9 A;  2H1D A;  3TB2 A;  2E2M A;  5DJL A;  3CTG A;  1O7U A;  2H70 A;  1X9W B;  1ST9 A;  2RM5 A;  2YZU A;  1QXH A;  4KE3 A;  2C0D A;  3TKS C;  4FIW A;  3SBC A;  3WT2 A;  1MD4 A;  2C3Q A;  2GST A;  3DGQ A;  3VI5 A;  2YP6 A;  1A2J A;  3D4M A;  11GS A;  3F63 A;  2KP2 A;  2GT5 A;  1TRW A;  2EIO A;  1QUW A;  1F9M A;  4ACS A;  2DIY A;  4MF5 A;  3VWU A;  4HI7 A;  1EOG A;  2HT9 A;  1J0F A;  3UEM A;  1XIY A;  2GQK A;  3HY2 A;  3NIV A;  2H6Y A;  1AQV A;  1B48 A;  3UOM A;  5IMV A;  4QQ7 A;  2B3S A;  1B9Y C;  2EIQ A;  4KND A;  2CX3 A;  2TRC P;  1M7T A;  4N0Z A;  2QGV A;  2L5O A;  3IHQ A;  3V1W A;  4KGI A;  3WGE A;  4FO5 A;  5IIZ A;  2XHF A;  1TRU A;  2HZE A;  4DSQ A;  2H74 A;  1A2M A;  4G0L A;  1S3C A;  3L9V A;  1TU8 A;  3U6V A;  3I9V 2;  2FWE A;  1UN2 A;  1XW9 A;  5CAX A;  1OKT A;  5DBQ A;  3FR3 A;  4L5L A;  4PUR A;  4HQZ A;  3Q74 A;  2X64 A;  3M1G A;  2PGT A;  1TW9 A;  4AJ8 A;  3DRN A;  2VLU A;  3FZ4 A;  4ECC A;  3APQ A;  3LYK A;  4I8B A;  3VPQ A;  4HZ2 A;  4LL4 B;  1A8Y A;  4ML1 A;  3M9K A;  4KDU A;  1Z3E A;  1WPI A;  2DIZ A;  4ECB A;  5F07 A;  2IWT A;  2PPT A;  1XBS A;  2FNO A;  1YY7 A;  3CRT A;  4PTS A;  2JU5 A;  4LA1 A;  2I4A A;  2VUP A;  3BCI A;  5IPG A;  2M80 A;  3GHA A;  3GKM A;  2I81 A;  4HJ2 A;  2HSH A;  5IMD A;  2GTU A;  3LEF A;  1I5G A;  3OR5 A;  4PX1 A;  4GF0 A;  4PQH A;  3D22 A;  4RI6 A;  2IMF A;  1QGV A;  6GSY A;  4DSS A;  4I2U A;  1GUH A;  4JBB A;  4ULX A;  1BX9 A;  2PVQ A;  2HXK A;  2L4Q A;  3HCZ A;  1XW5 A;  1FAA A;  1K3O A;  1O81 A;  1WWJ A;  2GGT A;  3GL3 A;  3FRC A;  5AIV A;  1TP9 A;  2KLX A;  3GKX A;  1ZCP A;  3U5R E;  5CRE A;  4G9H A;  4RI7 A;  3DD3 A;  3GYK A;  4WR4 A;  3IK7 A;  1XW6 A;  1SL0 B;  3GNJ A;  4PQI A;  3E0U A;  1QMV A;  4EDY A;  2OBK A;  2YNX A;  1PD2 1;  1AIU A;  3HJP A;  4HQS A;  4P3Y B;  2B7J A;  3BCK A;  1EV4 A;  2TIR A;  3UL3 A;  1G6W A;  2B5Y A;  2FA8 A;  5IQY A;  4K1F A;  1PRX A;  3M0F A;  3KH9 A;  3QFA C;  4ZIL A;  5EPF A;  4BPY A;  4IN0 A;  1B9X C;  5IO2 A;  4MF6 A;  5D93 A;  1SJZ A;  3F6D A;  3R3E A;  5D9X A;  1GSU A;  4AF2 A;  2RLI A;  5C00 A;  4IQA A;  1DSB A;  4YQM A;  3C73 A;  2HLS A;  2NDO A;  2G0F A;  5D96 A;  2HE3 A;  4MZC A;  3EU3 A;  1THO A;  1M9A A;  1U3A A;  1OVN A;  12GS A;  3EWL A;  4EC0 A;  2IJY A;  2H6Z A;  3IK9 A;  1ON4 A;  4TKY A;  3KJY A;  4IJI A;  4EF0 A;  1XVQ A;  2HZF A;  3EU4 A;  1RW1 A;  3ZVJ D;  1QK8 A;  4GLT A;  5KN0 A;  4KCE A;  3F4T A;  1O85 A;  1DUG A;  2V6O A;  2CV4 A;  2AAW A;  4Z7X A;  3UAR A;  3VWV A;  2F8A A;  3H4K A;  1V58 A;  4O32 A;  4GCI A;  5IMZ A;  1SKS B;  1PQN A;  4HS1 A;  4MJC A;  2VM1 A;  2YJ7 A;  2HRK B;  4AGS A;  5DCH A;  4KH7 A;  5ELA A;  2AYT A;  3RPP A;  1X9S B;  3M8N A;  4XCS A;  1PSQ A;  3HA9 A;  2KP1 A;  3D0Z A;  2I3Y A;  3ZZX A;  2NBS A;  4JU5 A;  3QD9 A;  3FK8 A;  3P90 A;  4ECI A;  4XS6 A;  4L0U A;  3TKR A;  3IC4 A;  6GSW A;  2QKE A;  5JWQ B;  1GUL A;  4X1U A;  4IP6 A;  3G9B A;  1DE2 A;  2QSI A;  1Z5Y E;  2CT6 A;  1ZYQ B;  2PBJ A;  1WJK A;  4F0C A;  1TRS A;  3GL5 A;  1TJD A;  1V57 A;  4K7O A;  4Q5Q A;  2LNS A;  4PQ1 A;  5CRG A;  1X5E A;  1ERW A;  5IMC A;  2CAI A;  1N8J A;  2P5Q A;  4OFM A;  2JAD A;  2CZ2 A;  2DBC A;  4WKW A;  5H5Q A;  3TDG A;  3K8N A;  3TJB A;  2H75 A;  2PWJ A;  1U3I A;  4O7H A;  2EIR A;  3L78 A;  2H1G A;  5DJM A;  1LJR A;  5DAL B;  1DE1 A;  1PA3 A;  3GMF A;  2DML A;  3KEB A;  8GSS A;  4V2M A;  1C72 A;  3VWW A;  2GZP A;  2JZT A;  4O92 A;  4F9Z A;  4KA0 A;  4MJE A;  4MMM A;  1VF1 A;  2EC4 A;  3IXR A;  2A2R A;  4J2F A;  3ERG A;  2DLX A;  3ZYW A;  5A4V A;  4LL1 B;  4K8M A;  2ZNM A;  3KCM A;  2B1K A;  2ALB A;  4IKH A;  4PUA A;  5H5S A;  2LRN A;  1JHB A;  1YQ1 A;  1YJ6 A;  5ECK B;  2PUK C;  3NZN A;  4ISD A;  2LJR A;  3EE2 A;  3A2V A;  2FY6 A;  3ZL5 A;  3P8W A;  1YF1 A;  5AIS A;  1ZZY A;  3GTU B;  2WRT A;  2XC2 A;  3L9U A;  5J4U A;  4CW9 A;  4HDE A;  16GS A;  5JWR B;  3H79 A;  2YV7 A;  3L0H A;  3TKS A;  1JZO A;  4D73 B;  5F8B A;  2LV3 A;  1YKC A;  4YH2 A;  2H1B A;  3TKQ A;  6GSU A;  4MA9 A;  3MNG A;  3HDC A;  1EV9 A;  4NMU A;  5B7C A;  2M72 A;  3UAP A;  2V2G A;  2GQM A;  2TRX A;  2GZZ A;  3BD2 A;  1YEP A;  3A3T A;  2X8H A;  2HRK A;  3QMX A;  3J7Y k;  4N10 A;  3ME7 A;  3QDN A;  4IJ3 A;  1GTI A;  1OYJ A;  2M46 A;  3ZTL A;  2JZS A;  2YV9 A;  3IBH A;  2VL2 C;  2VCT A;  1GTB A;  2IN3 A;  1PX6 A;  3HZ8 A;  4MK3 A;  1GH2 A;  2KHP A;  3R2Q A;  3HVS A;  4JR6 A;  3UVH A;  1A0F A;  3TJK A;  3DXB A;  1SL2 B;  2VCZ A;  1U6T A;  3VI7 A;  2ON7 A;  4ML6 A;  1MDI A;  3DEX A;  3CXG A;  2LUS A;  2FA4 A;  3E3E A;  1AXD A;  4ZB6 A;  2RUE A;  2B6M A;  3I43 A;  4TRX A;  3IDV A;  3LWA A;  1O6J A;  13GS A;  1AQW A;  4YQV A;  3HVX A;  3KMN A;  1S3A A;  2LTK A;  2V32 A;  1JZW A;  1UA5 A;  4GQC A;  3NOF A;  5ECR B;  1FOV A;  4BA7 A;  1TKD B;  1R7H A;  1FB0 A;  1VF3 A;  4MDC A;  3MDK A;  2XBQ A;  4ZXG A;  4CDO A;  1TU7 A;  4G2E A;  2IFQ A;  1K0B A;  4ZL7 A;  4NAX A;  4JED A;  1ZL9 A;  2XPD A;  4GXZ A;  5EL8 A;  5DAL A;  1WIK A;  2VLT A;  4F03 A;  4DVC A;  2VO4 A;  3RBT A;  3KTL A;  5GZZ B;  4WBJ A;  2GS3 A;  3IAS 2;  6GSX A;  4OCF A;  4HZ4 A;  5LNK e;  1K3Y A;  3CBU A;  4OFT A;  1T4Z A;  3O3T A;  5IPH A;  1XZO A;  2RM6 A;  3GH9 A;  2LNT A;  2F9S A;  3HXS A;  4KUN A;  3ZIV A;  1BAY A;  4L0W A;  3HD5 A;  2L4C A;  2P31 A;  1BQ7 A;  3H8Q A;  5J9C A;  1GSE A;  1QFN A;  2R5G A;  1YDK A;  3QFB C;  2WB9 A;  4GWR A;  4K0G A;  3GTU A;  4USS A;  3VUR A;  2N5A A;  1ERV A;  2HSN B;  1Z7R A;  5KEJ A;  4KCA A;  1W4V A;  4BWQ A;  5A4U A;  1IYH A;  2K8V A;  2O89 A;  4D73 A;  4YQU A;  2OE0 A;  2N5F A;  2QC7 A;  1OE7 A;  4ZIJ A;  5GAN D;  2IMK A;  1F3A A;  1JFU A;  1K3L A;  3FW2 A;  4KDX A;  4G10 A;  1GWC A;  1PX7 A;  5E59 A;  3KH7 A;  2L57 A;  4FYU A;  5GST A;  2DJK A;  3SWL A;  1K0A A;  1V40 A;  4K6X A;  1WMJ A;  2DJ3 A;  4FQU A;  7GSS A;  5IM9 A;  2JSZ A;  5ECL B;  4GTU A;  4EKZ A;  1FVJ A;  5IOX A;  2IMD A;  2HRF A;  2BTO T;  3C71 A;  2MYG A;  1GNE A;  1EEM A;  1ABA A;  2LST A;  2GZY A;  4MAB A;  2Z9S A;  2H1A A;  5B8B A;  1TI3 A;  4N11 A;  3O76 A;  2VCW A;  5D8I A;  1TRV A;  2FD3 A;  4OWY A;  1NHY A;  2LJK A;  3M3M A;  5HR0 A;  1KEB A;  1RK4 A;  2FWF A;  4EDZ A;  2F3M A;  1NM3 A;  6GSS A;  2RII A;  4YAV A;  2YWN A;  1A0R P;  2I9H A;  2C3N A;  1X5D A;  1GUK A;  2FWG A;  4NXI A;  4WBR D;  1SEN A;  3C1S A;  2HSM B;  4AJ7 A;  3W8S A;  4V1A g;  4FYB A;  5JWO B;  3VLN A;  1RQM A;  2MMA A;  1G0T A;  1BG5 A;  3HVV A;  2L6D A;  1SK1 A;  3KGK A;  4POK A;  2JAC A;  2A4V A;  1B4P A;  1TK5 B;  4WXT A;  2B5X A;  1R4W A;  3RAZ A;  4ZBA A;  4GRF A;  3VPT A;  4Q5N A;  4MH3 A;  1Z6M A;  2IL3 A;  1JZR A;  3W6G A;  5INY A;  5CP1 A;  4V2L A;  4WR5 A;  1FVK A;  3GV1 A;  4NWY A;  1SL1 B;  1YF0 A;  4K7I A;  3GFK A;  5AN1 A;  4NHZ A;  4TVE A;  2WGR A;  1XFL A;  1PKW A;  5A5K A;  4PUF C;  1ERU A;  1PGT A;  2ZUP A;  4TR0 A;  4HEA 2;  1NHO A;  2B7K A;  5EVO A;  2CZ3 A;  1K0O A;  4LLR A;  1CQH A;  1HYU A;  3CRU A;  3I69 A;  1SD9 A;  5G1K A;  1G7O A;  1OC3 A;  1ILO A;  2O7K A;  3FZ5 A;  1M2A A;  4BL7 B;  2R3X A;  2H73 A;  1ERT A;  5J3R A;  1T8E B;  3ZVJ A;  5FWG A;  4L8E A;  4CHS A;  3ZFB A;  3ISO A;  3DVX A;  2ON5 A;  5CRW A;  4QL7 A;  2HQT A;  1BYE A;  3DWV A;  5BMU A;  4XS1 A;  2PN8 A;  2ZCT A;  2WDU A;  2J9H A;  3KXO A;  3LG6 A;  3ED3 A;  5CRH A;  2A2S A;  1TK0 B;  2CVB A;  1GTU A;  4PNG A;  4O5R A;  2OKA A;  1O8W A;  3EUR A;  3QAW A;  18GS A;  4G19 A;  4BVX B;  5ECH B;  2H01 A;  4NPB A;  1GUM A;  3GUS A;  3FYG A;  2YAN A;  3US3 A;  2OE1 A;  3M9J A;  4RQR A;  3CSH A;  1HNA A;  1URM A;  3QCP A;  4V2N A;  2LKU A;  1SYR A;  2BMX A;  2GT6 A;  1MDK A;  2C80 A;  3ZML A;  4DSR A;  4X0X A;  2FCH A;  1YKA A;  3A5W A;  1V98 A;  3D21 A;  2FLS A;  3KD0 A;  4ILF A;  2GDR A;  1GL8 A;  1XWC A;  1VF4 A;  1VGL A;  5HFG A;  2C0F A;  3F3Q A;  5DQS A;  3WGD A;  1FB6 A;  1KNG A;  3TKS E;  1V9W A;  1O8X A;  4MH2 A;  1SJI A;  1K0D A;  3TJJ A;  4RUV A;  4FYC A;  2HSM A;  3C8E A;  1HNC A;  1VRS D;  3HZ4 A;  4OO5 A;  2P0G A;  3E9J B;  3J7Y b;  2AV4 A;  4DEJ A;  1XCC A;  1R5P A;  1OE8 A;  1OC9 B;  5G5F A;  1GTA A;  4ZB9 A;  1ML6 A;  3I6A A;  5J9B A;  2V6K A;  3FEU A;  4EE0 A;  2C0E A;  1R26 A;  2HRA A;  4TR1 B;  3IC8 A;  1NSW A;  2H71 A;  5JCU A;  3LJR A;  2LS5 A;  4F82 A;  2DJ0 A;  2FHE A;  3GST A;  1KTE A;  2O87 A;  2V1M A;  3CTF A;  4TXV A;  3BJ5 A;  3P7X A;  5ID2 B;  5F0G A;  2RUF A;  1K0C A;  2XPE A;  3TJF A;  4ID0 A;  5D9W A;  3GH6 A;  4L5O A;  4KSM A;  2J23 A;  5ECM B;  3H93 A;  2VD0 A;  3D4T A;  1HNB A;  4EVM A; 
#chains in the Genus database with same CATH topology
 1FW1 A;  2VCV A;  1F3B A;  3ZIJ A;  2VL2 A;  1GNW A;  1F2E A;  3S9F A;  2GSQ A;  2OAC A;  3CHX C;  3RPN A;  1WP0 A;  1THX A;  1U88 A;  4CY8 A;  4PXO A;  3A2X A;  1QQ2 A;  4EIP A;  2CVK A;  1Z7P A;  3APS A;  3KP9 A;  2ES7 A;  1YZX A;  4OD7 A;  1G7E A;  2EFD A;  3CYN A;  3LXT A;  3PIN A;  2DC5 A;  2OE3 A;  1M2B A;  5CO3 A;  2H76 A;  5ECS A;  2JL4 A;  4HJM A;  5LCZ A;  3IR4 A;  1T3B A;  2WCI A;  1M0U A;  5ABR A;  1SU9 A;  4XRA A;  4BL7 A;  1IYI A;  2DSA A;  2VCX A;  2HNL A;  2O36 A;  5D9T A;  3WGX A;  1EP8 A;  2VL9 A;  1TDI A;  1ZMA A;  3D5J A;  1SVO A;  3N5O A;  1T7P B;  3F4R A;  4EL1 A;  1I1I P;  5EY6 A;  2HSY A;  2YWO A;  3ZIT A;  19GS A;  1V2A A;  4IW9 A;  1X0R A;  5KN1 A;  1W89 A;  2DJJ A;  2R0P A;  1XWB A;  3GIX A;  3FY7 A;  2FUG 2;  4IBP A;  4BVX A;  2LQQ A;  3UVT A;  5B6N A;  2K8S A;  1U87 A;  4EXJ A;  1M3J A;  2CX4 A;  1M2D A;  5COH A;  1GLQ A;  3LFL A;  2K9F A;  5GAP D;  1JLV A;  5FT3 A;  5L71 A;  2AJQ B;  3FZA A;  5LD0 A;  1EOH A;  2GLR A;  1F6M C;  1BF5 A;  4IGJ A;  1SVM A;  1OC8 A;  5B6M A;  2LQO A;  4H86 A;  2H6X A;  2XBI A;  3IRA A;  5C04 A;  5AIX A;  3IAM 2;  1HD2 A;  2V41 A;  2MBT A;  3FZ9 A;  3C7M A;  1T4Y A;  4XTS A;  3BBY A;  3WD6 A;  1SYX A;  1S4B P;  6GST A;  3KZQ A;  3PR8 A;  3TOU A;  2DMM A;  1SVL A;  4TR4 A;  5JCG A;  3MWH A;  3WT1 A;  2GVP A;  4POM A;  4J56 E;  1UC7 A;  3KTB A;  2O8V B;  2KOK A;  4JZQ A;  3TUE A;  3F9U A;  1OC9 A;  2KUC A;  1B8X A;  1F37 A;  5DDL A;  2F8F A;  4WF4 A;  5H5R A;  3G7J A;  4NHW A;  4TR1 A;  1A24 A;  2PMT A;  2E0Q A;  3F8U A;  3IPZ A;  3D6I A;  1GSF A;  10GS A;  2CVD A;  2L6C A;  3H1N A;  3EVI A;  4F2I A;  1MD3 A;  2K18 A;  2WFC A;  1PN0 A;  2YN1 A;  3LOR A;  5D73 A;  5ID2 A;  2MMO A;  2E2G A;  4GQF A;  4JR4 A;  4XIH A;  4EUY A;  1A2L A;  3RDW A;  3GUR A;  4KAE A;  3F6F A;  1X5C A;  2PU9 C;  4I2T A;  3IV4 A;  1PL2 A;  2YZH A;  4IEL A;  1PN9 A;  2OA7 A;  4XHM A;  1HQO A;  4OFN A;  1ZOF A;  1Y25 A;  1GSD A;  3A2W A;  4HU7 A;  2WW3 A;  1GP1 A;  3FR6 A;  4WF5 A;  1GLP A;  1AAZ A;  1H75 A;  3EC3 A;  22GS A;  2REM A;  3CSJ A;  4RQX A;  2VM2 A;  3KMO A;  1TI1 A;  2C8U A;  4YAP A;  2C1Y A;  3F3R A;  3UIW A;  1YEX A;  3APO A;  4K0N A;  3VWX A;  4TW5 A;  4N30 A;  5IMA A;  2IME A;  3LYP A;  1X9M B;  3ZLP A;  2WVY A;  3FKF A;  2VLV A;  1USB A;  1MEK A;  1MDJ A;  3CMI A;  3KIJ A;  4Q5R A;  4GST A;  4KSO A;  5CNW A;  2OT3 A;  4YKG A;  1E2Y A;  5HR2 A;  2PVO C;  2BJX A;  3FR9 A;  3QOU A;  1J08 A;  1AC1 A;  5HFI A;  4F0B A;  1TOF A;  4FH8 A;  2MMZ A;  1YEW C;  1M99 A;  2H0H A;  4WEY A;  4OMV A;  3MIX A;  1SKR B;  1Y6E A;  4MP4 A;  5ELG A;  5JCW A;  4E8H A;  4TN8 A;  1EP7 A;  4QL9 A;  5J4Y A;  2YPM A;  1SJ6 A;  3GSS A;  5AGY A;  3HYP A;  1DBY A;  6GSV A;  3ZRD A;  2VIM A;  4K7N A;  2B5E A;  3G7Y A;  3EYT A;  5ECN B;  4HSC X;  1Z9H A;  2NPB A;  5KN3 A;  4AJ6 A;  4XRD A;  2OBI A;  1EGO A;  1TXX A;  3WYW A;  4MCU A;  2C3T A;  1S3R A;  5HR3 A;  1T1V A;  4NV2 A;  3RHB A;  5F05 A;  2G2Q A;  4X43 A;  4BVY B;  2FGX A;  4A5P A;  5FHI A;  1T00 A;  4J57 E;  3P2A A;  5CRD A;  4KW6 A;  2H72 A;  5KN2 A;  3MAK A;  2YCD A;  3TGZ A;  5ENU A;  1J9B A;  2IIY A;  2X8C A;  4TXO B;  2HFD A;  3TKP A;  2F51 A;  2NTO A;  2HRN A;  3F4S A;  3TRX A;  5KOW A;  1SKW B;  5ECP B;  2H66 A;  4ZBD A;  1H4O A;  1K0M A;  4POB A;  2VD1 A;  4IQ1 A;  5DQY A;  3L9S A;  3FMW A;  3DIE A;  4JE1 A;  2H0I A;  2H0G A;  3DVW A;  1BJX A;  3W8J A;  1LBK A;  1PMT A;  4XS4 B;  4KDY A;  5HR1 A;  3JCM L;  3GX8 A;  1XVW A;  2X49 A;  4IHU A;  4KX4 A;  3IE3 A;  3EMP A;  2HI7 A;  1ZGN A;  3G7I A;  3GKK A;  1UVZ A;  4GSS A;  1PKZ A;  3UBL A;  5IOW A;  4PNF A;  1XPV A;  1LU4 A;  4ZL9 A;  3RHC A;  3IOS A;  3ME8 A;  3AY8 A;  3O6T A;  2P5R A;  3GX0 A;  5ECO B;  1AQX A;  1XOA A;  1ACV A;  3BOA A;  2WS2 A;  3PGT A;  4JRR A;  2DJ2 A;  5HQP A;  2WZ9 A;  4MLY A;  3LSZ A;  9GSS A;  3FHK A;  2VL3 A;  1FG4 A;  3LXZ A;  3TOT A;  2R4V A;  2UZ8 A;  1FHE A;  1AUC A;  4OO4 A;  5G30 A;  1SD8 A;  1TK8 B;  3GKN A;  2VCQ A;  17GS A;  4I5Q A;  3TCO A;  2C4J A;  1A23 A;  1XOB A;  2FWH A;  1EEJ A;  1Z6N A;  4FXY P;  1WE0 A;  2VKZ G;  1OAZ A;  3PPU A;  5DAK B;  2D2Z A;  1EZK A;  1R5A A;  5J5N A;  4TOP A;  4MZW A;  5D9V A;  2H8L A;  4KF9 A;  3F0I A;  3HHV A;  4IVF A;  2VOC A;  4Q5F A;  2DKI A;  2LJA A;  2LRT A;  5DCG A;  4ZB8 A;  3QAV A;  1EGR A;  3DYR A;  5IMF A;  4GSN A;  3Q19 A;  2K6V A;  4LMV A;  1G6Y A;  1WOU A;  4IS0 A;  1NW2 A;  3KM6 A;  5B8A A;  3LQ7 A;  2CAQ A;  3QPM A;  1Y1U A;  2PER A;  5G31 A;  1A8L A;  1O73 A;  1BG1 A;  4K9Z A;  1XXU A;  2JZR A;  3MSZ A;  4TR3 A;  3VK9 A;  3TRQ A;  3TRP A;  1E6B A;  3ZMK A;  1I9D A;  1GSY A;  2HYX A;  4KB3 A;  2GSR A;  2QA1 A;  4MJB A;  4WET A;  1JZD A;  4EO3 A;  3EIN A;  2R2J A;  5IO0 A;  5G5E A;  2GSS A;  4BVY A;  4G0I A;  3ERW A;  5BRT A;  14GS A;  2H19 A;  2R37 A;  1ZYE A;  4ECJ A;  1PL1 A;  3LGC A;  1BED A;  2IPA A;  3GA4 A;  2O85 A;  5F06 A;  3VFI A;  1MTC A;  4LMW A;  4TXO A;  1XWA A;  3IA1 A;  4POL A;  1K0N A;  2IFQ B;  2L59 A;  4MPG A;  4K2D A;  4V1A p;  1N2A A;  3QR6 A;  2WUL A;  4I6X A;  3ZRE A;  1TTZ A;  1KBN A;  5GSS A;  3CSI A;  5A5H B;  1JLW A;  2MMN A;  4BIK A;  2HZE B;  2YJH A;  5DVB A;  4G0K A;  3N9J A;  2VAF A;  4MNN A;  2WW1 A;  2R0G A;  2GQL A;  1GSQ A;  2AUV A;  3UJ1 A;  2AHE A;  1SK0 A;  4HUA A;  1VF2 A;  4MF7 A;  1OKD A;  3TJG A;  4XS4 A;  3ERF A;  2LRC A;  1AW9 A;  2AB6 A;  1GRX A;  2OAD A;  1EWX A;  2CA8 A;  3PH9 A;  1CQG A;  2MBS A;  2EFE A;  4ZL8 A;  3Q18 A;  4BWS A;  2R6K A;  4NV5 A;  4I97 A;  1S3D A;  5J41 A;  1XWK A;  4MPF A;  2I1U A;  2C0G A;  5G2Z A;  1Q4J A;  5ECQ B;  4MZB A;  1FO5 A;  5G1L A;  2LEG A;  2L5L A;  3DML A;  1GSS A;  5CYY A;  3C1R A;  4ZBB A;  3UBK A;  4PGT A;  3GRX A;  3HJM A;  2NVL A;  4OCE A;  5A4W A;  2DJ1 A;  4HU9 A;  4HOJ A;  1WRY A;  20GS A;  2B1L A;  1SK2 A;  2WJU A;  4N0V A;  2X8G A;  3HKR A;  3GN3 A;  3EMX A;  2MZC A;  1M9B A;  3DKS A;  4MJA A;  5ECI B;  4EIQ A;  4E8E A;  1B4Q A;  2H30 A;  1XWG A;  5DAK A;  3KP8 A;  2YWI A;  3Q6O A;  3HJO A;  3ZFL A;  2N5B A;  4K2X A;  3L4N A;  3UMA A;  2OJL A;  4DSS B;  4E68 A;  2IMI A;  2X99 A;  2YOI A;  4IP1 A;  5HFK A;  1Q98 A;  2E7P A;  3QAG A;  2YWM A;  5E4W A;  2JSY A;  2CQ9 A;  2H1D A;  3TB2 A;  2E2M A;  5DJL A;  3CTG A;  1O7U A;  2H70 A;  1X9W B;  1ST9 A;  3HMJ G;  2RM5 A;  2YZU A;  1QXH A;  4KE3 A;  2C0D A;  3TKS C;  4FIW A;  3SBC A;  3WT2 A;  1MD4 A;  2C3Q A;  2GST A;  3DGQ A;  3VI5 A;  2YP6 A;  1A2J A;  3D4M A;  11GS A;  3F63 A;  2KP2 A;  2GT5 A;  1TRW A;  2EIO A;  1QUW A;  1F9M A;  4ACS A;  2DIY A;  4MF5 A;  3VWU A;  4HI7 A;  1EOG A;  2DKH A;  2HT9 A;  1J0F A;  3UEM A;  1XIY A;  2GQK A;  3HY2 A;  3NIV A;  2H6Y A;  1AQV A;  1B48 A;  3UOM A;  5IMV A;  4QQ7 A;  2B3S A;  1B9Y C;  2EIQ A;  4KND A;  2CX3 A;  2TRC P;  1M7T A;  4N0Z A;  2QGV A;  2L5O A;  3IHQ A;  3V1W A;  4KGI A;  3WGE A;  2R0C A;  4FO5 A;  5A5H A;  5IIZ A;  2XHF A;  4AKG A;  1TRU A;  2HZE A;  4PI2 C;  4DSQ A;  2WVX B;  2H74 A;  1A2M A;  4G0L A;  1S3C A;  3L9V A;  1TU8 A;  3U6V A;  3I9V 2;  2WW2 A;  2FWE A;  1UN2 A;  3HVN A;  1XW9 A;  5CAX A;  1OKT A;  1PFO A;  5DBQ A;  3FR3 A;  4L5L A;  4PUR A;  4HQZ A;  3Q74 A;  2X64 A;  3M1G A;  2PGT A;  1TW9 A;  4AJ8 A;  3DRN A;  4AKI A;  2VLU A;  3FZ4 A;  4ECC A;  3APQ A;  3LYK A;  4I8B A;  3VPQ A;  1FOH A;  4HZ2 A;  4LL4 B;  1A8Y A;  2WW0 A;  4ML1 A;  3M9K A;  4KDU A;  1Z3E A;  1WPI A;  2DIZ A;  4ECB A;  5F07 A;  2IWT A;  2PPT A;  1XBS A;  2FNO A;  1YY7 A;  3CRT A;  4PTS A;  2JU5 A;  4LA1 A;  2I4A A;  2VUP A;  3BCI A;  5IPG A;  2M80 A;  3GHA A;  3GKM A;  2I81 A;  4HJ2 A;  2HSH A;  5IMD A;  2GTU A;  3LEF A;  1I5G A;  3OR5 A;  4PX1 A;  4GF0 A;  4PQH A;  3D22 A;  4RI6 A;  2IMF A;  1QGV A;  6GSY A;  4DSS A;  4I2U A;  1GUH A;  4JBB A;  4ULX A;  1BX9 A;  2PVQ A;  2HXK A;  2L4Q A;  3HCZ A;  1XW5 A;  1FAA A;  3IHG A;  1K3O A;  1O81 A;  1WWJ A;  4ZB7 A;  2GGT A;  3GL3 A;  3FRC A;  4QMK A;  5AIV A;  1TP9 A;  2KLX A;  3GKX A;  1ZCP A;  3U5R E;  5CRE A;  4G9H A;  4RI7 A;  3DD3 A;  3GYK A;  4WR4 A;  3IK7 A;  1XW6 A;  1SL0 B;  3GNJ A;  4PQI A;  3E0U A;  1QMV A;  4EDY A;  2OBK A;  2YNX A;  1PD2 1;  1AIU A;  3HJP A;  4HQS A;  4P3Y B;  2B7J A;  3BCK A;  5J47 A;  1EV4 A;  4AKH A;  2TIR A;  3UL3 A;  1G6W A;  2B5Y A;  2FA8 A;  5IQY A;  4K1F A;  3RFR C;  1PRX A;  3M0F A;  3KH9 A;  3QFA C;  4ZIL A;  5EPF A;  4BPY A;  4IN0 A;  1B9X C;  5IO2 A;  4MF6 A;  5D93 A;  1SJZ A;  2WVX A;  3F6D A;  3R3E A;  4N3Z A;  5D9X A;  1GSU A;  4AF2 A;  2RLI A;  5C00 A;  4IQA A;  1DSB A;  4YQM A;  3C73 A;  2HLS A;  2NDO A;  2G0F A;  5D96 A;  4AI6 A;  2HE3 A;  4MZC A;  3EU3 A;  1THO A;  1M9A A;  1U3A A;  1OVN A;  12GS A;  5A34 B;  3EWL A;  4EC0 A;  2IJY A;  3LW9 A;  2A4H A;  4K5S A;  2H6Z A;  3IK9 A;  1ON4 A;  4TKY A;  3KJY A;  4IJI A;  4EF0 A;  4GDF A;  1XVQ A;  2HZF A;  3EU4 A;  1RW1 A;  2QA2 A;  3ZVJ D;  1QK8 A;  4GLT A;  5KN0 A;  4KCE A;  3F4T A;  1O85 A;  1DUG A;  2V6O A;  2CV4 A;  2AAW A;  4Z7X A;  3UAR A;  3VWV A;  2F8A A;  3H4K A;  1V58 A;  4O32 A;  4GCI A;  5IMZ A;  1SKS B;  1PQN A;  4HS1 A;  4MJC A;  2VM1 A;  2YJ7 A;  2HRK B;  4AGS A;  5DCH A;  4KH7 A;  5ELA A;  2AYT A;  3RPP A;  1X9S B;  3M8N A;  4XCS A;  1PSQ A;  3HA9 A;  2KP1 A;  3D0Z A;  2I3Y A;  3ZZX A;  2NBS A;  4JU5 A;  3QD9 A;  3FK8 A;  3P90 A;  2UV8 G;  4ECI A;  4XS6 A;  4L0U A;  3TKR A;  3IC4 A;  6GSW A;  2QKE A;  5JWQ B;  1GUL A;  4X1U A;  4IP6 A;  3G9B A;  1DE2 A;  2QSI A;  1Z5Y E;  1TXU A;  2CT6 A;  1ZYQ B;  2PBJ A;  1WJK A;  4F0C A;  1TRS A;  3GL5 A;  1TJD A;  5KOX A;  3RGB C;  1V57 A;  4K7O A;  4Q5Q A;  2LNS A;  4PQ1 A;  5CRG A;  1X5E A;  1ERW A;  5IMC A;  2CAI A;  1N8J A;  2P5Q A;  4OFM A;  3TU3 B;  1N25 A;  2JAD A;  2CZ2 A;  2DBC A;  4WKW A;  5H5Q A;  3TDG A;  3K8N A;  3TJB A;  2H75 A;  2PWJ A;  1U3I A;  4O7H A;  2EIR A;  3L78 A;  2H1G A;  5DJM A;  4Z2T A;  1LJR A;  5DAL B;  1DE1 A;  1PA3 A;  3GMF A;  2DML A;  2WVZ A;  3KEB A;  8GSS A;  4V2M A;  1C72 A;  3VWW A;  2GZP A;  2JZT A;  4O92 A;  4F9Z A;  4KA0 A;  4MJE A;  4MMM A;  1VF1 A;  2EC4 A;  3IXR A;  2A2R A;  4J2F A;  3ERG A;  2DLX A;  3ZYW A;  5A4V A;  4LL1 B;  2O3E A;  4K8M A;  2ZNM A;  3KCM A;  2B1K A;  2ALB A;  4IKH A;  4PUA A;  4PHZ C;  5H5S A;  2LRN A;  4O5U A;  1JHB A;  1YQ1 A;  1YJ6 A;  5ECK B;  3CWG A;  2PUK C;  3NZN A;  4ISD A;  2LJR A;  3EE2 A;  3A2V A;  2FY6 A;  3ZL5 A;  3P8W A;  5A34 A;  1YF1 A;  4YKF A;  5AIS A;  1ZZY A;  3GTU B;  2WRT A;  2XC2 A;  3L9U A;  5J4U A;  4CW9 A;  4CY6 A;  4HDE A;  16GS A;  5JWR B;  3H79 A;  2YV7 A;  3L0H A;  3TKS A;  1JZO A;  3A5I A;  4D73 B;  5F8B A;  2LV3 A;  1YKC A;  4YH2 A;  2H1B A;  3TKQ A;  6GSU A;  4MA9 A;  3MNG A;  3HDC A;  1EV9 A;  4NMU A;  5B7C A;  2M72 A;  3UAP A;  2V2G A;  2GQM A;  2TRX A;  2GZZ A;  3BD2 A;  1YEP A;  3A3T A;  2X8H A;  2HRK A;  3QMX A;  3J7Y k;  4N10 A;  3ME7 A;  3CQF A;  3QDN A;  4IJ3 A;  1GTI A;  1OYJ A;  2M46 A;  3ZTL A;  2JZS A;  2YV9 A;  3IBH A;  2VL2 C;  2VCT A;  1GTB A;  2IN3 A;  1PX6 A;  3HZ8 A;  2EFC A;  4MK3 A;  1GH2 A;  2KHP A;  3R2Q A;  3HVS A;  4JR6 A;  3UVH A;  2H1L A;  1A0F A;  3TJK A;  3DXB A;  1SL2 B;  2VCZ A;  1U6T A;  3VI7 A;  2ON7 A;  4ML6 A;  1MDI A;  3MYD A;  3DEX A;  5A1N B;  3CXG A;  2LUS A;  2FA4 A;  3E3E A;  1AXD A;  4ZB6 A;  2RUE A;  2B6M A;  3I43 A;  4TRX A;  3IDV A;  3LWA A;  1O6J A;  13GS A;  1AQW A;  4YQV A;  3HVX A;  3KMN A;  1S3A A;  2LTK A;  2V32 A;  1JZW A;  1UA5 A;  4GQC A;  3NOF A;  5ECR B;  1FOV A;  4BA7 A;  1TKD B;  1R7H A;  1FB0 A;  1VF3 A;  2A2P A;  4MDC A;  3MDK A;  2XBQ A;  4ZXG A;  4CDO A;  1TU7 A;  4G2E A;  2IFQ A;  1K0B A;  1M3I A;  4ZL7 A;  4NAX A;  4JED A;  1ZL9 A;  2XPD A;  4GXZ A;  5EL8 A;  5DAL A;  1WIK A;  2VLT A;  4F03 A;  4DVC A;  2VO4 A;  3RBT A;  3KTL A;  5GZZ B;  4WBJ A;  4Z2R A;  4G01 A;  2GS3 A;  3IAS 2;  6GSX A;  4OCF A;  4HZ4 A;  5LNK e;  1K3Y A;  3CBU A;  4OFT A;  1T4Z A;  3O3T A;  5IPH A;  1XZO A;  2RM6 A;  3GH9 A;  2LNT A;  2F9S A;  3HXS A;  4KUN A;  3ZIV A;  1BAY A;  4L0W A;  3HD5 A;  2L4C A;  2P31 A;  1BQ7 A;  3H8Q A;  5J9C A;  1GSE A;  2X4A A;  1QFN A;  2R5G A;  1YDK A;  3QFB C;  2WB9 A;  4GWR A;  4K0G A;  3GTU A;  4USS A;  3VUR A;  2N5A A;  1ERV A;  2HSN B;  1Z7R A;  5KEJ A;  4KCA A;  1W4V A;  4BWQ A;  5A4U A;  1IYH A;  2K8V A;  2O89 A;  4D73 A;  5J4V A;  4YQU A;  2OE0 A;  2N5F A;  2QC7 A;  1OE7 A;  4ZIJ A;  5GAN D;  2IMK A;  5J40 A;  1F3A A;  1JFU A;  1K3L A;  3FW2 A;  2EFH A;  4KDX A;  4G10 A;  1GWC A;  1PX7 A;  5BMU B;  5E59 A;  3KH7 A;  2L57 A;  4FYU A;  5GST A;  2DJK A;  3SWL A;  1K0A A;  1V40 A;  4K6X A;  1WMJ A;  2DJ3 A;  4FQU A;  7GSS A;  5IM9 A;  2JSZ A;  5ECL B;  4GTU A;  4EKZ A;  1FVJ A;  5IOX A;  2IMD A;  2HRF A;  2BTO T;  3C71 A;  2MYG A;  1GNE A;  1EEM A;  1ABA A;  2LST A;  2GZY A;  4MAB A;  2Z9S A;  2H1A A;  5B8B A;  1TI3 A;  4AKX B;  4N11 A;  3O76 A;  2VCW A;  5D8I A;  1TRV A;  2FD3 A;  4OWY A;  5A1N A;  1NHY A;  2LJK A;  3M3M A;  5HR0 A;  1KEB A;  1RK4 A;  2FWF A;  4O5Q A;  4EDZ A;  2F3M A;  1NM3 A;  6GSS A;  2RII A;  4YAV A;  2YWN A;  1A0R P;  2I9H A;  2C3N A;  4PI0 C;  1GUK A;  1X5D A;  2FWG A;  1ZYN A;  4NXI A;  4WBR D;  1SEN A;  3C1S A;  2HSM B;  4AJ7 A;  3W8S A;  4V1A g;  4FYB A;  5JWO B;  3VLN A;  1RQM A;  2MMA A;  1G0T A;  1BG5 A;  3HVV A;  2L6D A;  1SK1 A;  3KGK A;  4POK A;  2JAC A;  2A4V A;  1B4P A;  1TK5 B;  4WXT A;  2B5X A;  1R4W A;  3RAZ A;  4ZBA A;  4GRF A;  3VPT A;  1XG8 A;  4Q5N A;  4MH3 A;  1Z6M A;  2IL3 A;  1JZR A;  3W6G A;  5INY A;  5CP1 A;  4V2L A;  4WR5 A;  1FVK A;  4ICY A;  3GV1 A;  4NWY A;  4X4J A;  1SL1 B;  1YF0 A;  4K7I A;  3GFK A;  5AN1 A;  4Z2U A;  4NHZ A;  4TVE A;  2WGR A;  1XFL A;  1PKW A;  5A5K A;  4PUF C;  1ERU A;  1PGT A;  2ZUP A;  4TR0 A;  4HEA 2;  1NHO A;  2B7K A;  5EVO A;  2CZ3 A;  1K0O A;  4LLR A;  2HSN A;  1CQH A;  1HYU A;  3CRU A;  3I69 A;  1SD9 A;  5G1K A;  4K5R A;  1G7O A;  1OC3 A;  1ILO A;  2O7K A;  3FZ5 A;  1M2A A;  4BL7 B;  2R3X A;  2WZS A;  2H73 A;  1ERT A;  5J3R A;  1T8E B;  3ZVJ A;  5FWG A;  4L8E A;  2O5V A;  4CHS A;  3ZFB A;  3ISO A;  3DVX A;  2ON5 A;  5CRW A;  4QL7 A;  2HQT A;  1BYE A;  3DWV A;  5BMU A;  4XS1 A;  2PN8 A;  2ZCT A;  2WDU A;  2J9H A;  3KXO A;  3LG6 A;  3ED3 A;  5CRH A;  2A2S A;  1TK0 B;  2CVB A;  1GTU A;  4PNG A;  4O5R A;  2OKA A;  1O8W A;  3EUR A;  3QAW A;  18GS A;  4G19 A;  4BVX B;  5ECH B;  2H01 A;  4NPB A;  1GUM A;  3GUS A;  3FYG A;  2YAN A;  3US3 A;  2OE1 A;  3M9J A;  1ZYP A;  4RQR A;  3CSH A;  1HNA A;  1URM A;  3QCP A;  4V2N A;  2LKU A;  1SYR A;  2BMX A;  2GT6 A;  1MDK A;  2C80 A;  3ZML A;  4DSR A;  4X0X A;  2FCH A;  1YKA A;  3A5W A;  1V98 A;  3D21 A;  2FLS A;  3KD0 A;  4ILF A;  2GDR A;  1GL8 A;  1XWC A;  1VF4 A;  1VGL A;  5HFG A;  2C0F A;  3F3Q A;  5DQS A;  3WGD A;  1FB6 A;  1KNG A;  3TKS E;  1V9W A;  4W66 A;  1O8X A;  4MH2 A;  1SJI A;  1K0D A;  3TJJ A;  4RUV A;  4FYC A;  2HSM A;  3C8E A;  1HNC A;  1VRS D;  3HZ4 A;  4OO5 A;  2P0G A;  3E9J B;  3J7Y b;  2AV4 A;  4DEJ A;  1XCC A;  1R5P A;  1OE8 A;  1OC9 B;  5G5F A;  1GTA A;  4ZB9 A;  1ML6 A;  3I6A A;  5J9B A;  2V6K A;  3FEU A;  4EE0 A;  2C0E A;  1R26 A;  2HRA A;  4TR1 B;  3IC8 A;  1NSW A;  2H71 A;  5JCU A;  3LJR A;  2LS5 A;  4F82 A;  2DJ0 A;  2FHE A;  3GST A;  1KTE A;  2O87 A;  2V1M A;  3EPT A;  3CTF A;  4TXV A;  3BJ5 A;  3P7X A;  5ID2 B;  5F0G A;  2RUF A;  1K0C A;  2XPE A;  3TJF A;  4ID0 A;  5D9W A;  3GH6 A;  4L5O A;  4KSM A;  2J23 A;  5ECM B;  3H93 A;  1YVL A;  2VD0 A;  3D4T A;  1HNB A;  4EVM A; 
#chains in the Genus database with same CATH homology
 1FW1 A;  2VCV A;  1F3B A;  3ZIJ A;  2VL2 A;  1GNW A;  1F2E A;  3S9F A;  2GSQ A;  2OAC A;  3RPN A;  1WP0 A;  1THX A;  1U88 A;  4CY8 A;  4PXO A;  3A2X A;  1QQ2 A;  4EIP A;  2CVK A;  1Z7P A;  3APS A;  3KP9 A;  2ES7 A;  1YZX A;  4OD7 A;  1G7E A;  2EFD A;  3CYN A;  3LXT A;  3PIN A;  2DC5 A;  2OE3 A;  1M2B A;  5CO3 A;  2H76 A;  5ECS A;  2JL4 A;  4HJM A;  5LCZ A;  3IR4 A;  1T3B A;  2WCI A;  1M0U A;  5ABR A;  1SU9 A;  4XRA A;  4BL7 A;  1IYI A;  2DSA A;  2VCX A;  2HNL A;  5D9T A;  3WGX A;  1EP8 A;  2VL9 A;  1TDI A;  1ZMA A;  3D5J A;  1SVO A;  3N5O A;  1T7P B;  3F4R A;  4EL1 A;  5EY6 A;  2HSY A;  2YWO A;  3ZIT A;  19GS A;  1V2A A;  4IW9 A;  1X0R A;  5KN1 A;  1W89 A;  2DJJ A;  2R0P A;  1XWB A;  3GIX A;  3FY7 A;  2FUG 2;  4IBP A;  4BVX A;  2LQQ A;  3UVT A;  5B6N A;  2K8S A;  1U87 A;  4EXJ A;  2CX4 A;  1M2D A;  5COH A;  1GLQ A;  3LFL A;  2K9F A;  5GAP D;  1JLV A;  5FT3 A;  5L71 A;  2AJQ B;  3FZA A;  5LD0 A;  1EOH A;  2GLR A;  1F6M C;  1BF5 A;  4IGJ A;  1SVM A;  1OC8 A;  5B6M A;  2LQO A;  4H86 A;  2H6X A;  2XBI A;  3IRA A;  5C04 A;  5AIX A;  3IAM 2;  1HD2 A;  2V41 A;  2MBT A;  3FZ9 A;  3C7M A;  1T4Y A;  4XTS A;  3BBY A;  3WD6 A;  1SYX A;  6GST A;  3KZQ A;  3PR8 A;  3TOU A;  2DMM A;  1SVL A;  4TR4 A;  5JCG A;  3MWH A;  3WT1 A;  2GVP A;  4POM A;  4J56 E;  1UC7 A;  3KTB A;  2O8V B;  2KOK A;  4JZQ A;  3TUE A;  3F9U A;  1OC9 A;  2KUC A;  1B8X A;  1F37 A;  5DDL A;  2F8F A;  4WF4 A;  5H5R A;  3G7J A;  4NHW A;  4TR1 A;  1A24 A;  2PMT A;  2E0Q A;  3F8U A;  3IPZ A;  3D6I A;  1GSF A;  10GS A;  2CVD A;  2L6C A;  3H1N A;  3EVI A;  4F2I A;  1MD3 A;  2K18 A;  2WFC A;  1PN0 A;  2YN1 A;  3LOR A;  5D73 A;  5ID2 A;  2MMO A;  2E2G A;  4GQF A;  4JR4 A;  4XIH A;  4EUY A;  1A2L A;  3RDW A;  3GUR A;  4KAE A;  3F6F A;  1X5C A;  2PU9 C;  4I2T A;  3IV4 A;  1PL2 A;  2YZH A;  4IEL A;  1PN9 A;  2OA7 A;  4XHM A;  1HQO A;  4OFN A;  1ZOF A;  1Y25 A;  1GSD A;  3A2W A;  4HU7 A;  1GP1 A;  3FR6 A;  4WF5 A;  1GLP A;  1AAZ A;  1H75 A;  3EC3 A;  22GS A;  2REM A;  3CSJ A;  4RQX A;  2VM2 A;  3KMO A;  1TI1 A;  2C8U A;  4YAP A;  2C1Y A;  3F3R A;  3UIW A;  1YEX A;  3APO A;  4K0N A;  3VWX A;  4TW5 A;  4N30 A;  5IMA A;  2IME A;  3LYP A;  1X9M B;  3ZLP A;  3FKF A;  2VLV A;  1USB A;  1MEK A;  1MDJ A;  3CMI A;  3KIJ A;  4Q5R A;  4GST A;  4KSO A;  5CNW A;  2OT3 A;  4YKG A;  1E2Y A;  5HR2 A;  2PVO C;  2BJX A;  3FR9 A;  3QOU A;  1J08 A;  1AC1 A;  5HFI A;  4F0B A;  1TOF A;  4FH8 A;  2MMZ A;  1M99 A;  2H0H A;  4WEY A;  4OMV A;  3MIX A;  1SKR B;  1Y6E A;  4MP4 A;  5ELG A;  5JCW A;  4E8H A;  4TN8 A;  1EP7 A;  4QL9 A;  5J4Y A;  2YPM A;  1SJ6 A;  3GSS A;  5AGY A;  3HYP A;  1DBY A;  6GSV A;  3ZRD A;  2VIM A;  4K7N A;  2B5E A;  3G7Y A;  3EYT A;  5ECN B;  1Z9H A;  2NPB A;  5KN3 A;  4AJ6 A;  4XRD A;  2OBI A;  1EGO A;  1TXX A;  3WYW A;  4MCU A;  2C3T A;  5HR3 A;  1T1V A;  4NV2 A;  3RHB A;  5F05 A;  2G2Q A;  4X43 A;  4BVY B;  2FGX A;  4A5P A;  5FHI A;  1T00 A;  4J57 E;  3P2A A;  5CRD A;  4KW6 A;  2H72 A;  5KN2 A;  3MAK A;  2YCD A;  3TGZ A;  5ENU A;  1J9B A;  2IIY A;  2X8C A;  4TXO B;  2HFD A;  3TKP A;  2F51 A;  2NTO A;  2HRN A;  3F4S A;  3TRX A;  5KOW A;  1SKW B;  5ECP B;  2H66 A;  4ZBD A;  1H4O A;  1K0M A;  4POB A;  2VD1 A;  4IQ1 A;  5DQY A;  3L9S A;  3FMW A;  3DIE A;  4JE1 A;  2H0I A;  2H0G A;  3DVW A;  1BJX A;  3W8J A;  1LBK A;  1PMT A;  4XS4 B;  4KDY A;  5HR1 A;  3JCM L;  3GX8 A;  1XVW A;  2X49 A;  4IHU A;  4KX4 A;  3IE3 A;  3EMP A;  2HI7 A;  1ZGN A;  3G7I A;  3GKK A;  1UVZ A;  4GSS A;  1PKZ A;  3UBL A;  5IOW A;  4PNF A;  1XPV A;  1LU4 A;  4ZL9 A;  3RHC A;  3IOS A;  3ME8 A;  3AY8 A;  3O6T A;  2P5R A;  3GX0 A;  5ECO B;  1AQX A;  1XOA A;  1ACV A;  3BOA A;  2WS2 A;  3PGT A;  4JRR A;  2DJ2 A;  5HQP A;  2WZ9 A;  4MLY A;  3LSZ A;  9GSS A;  3FHK A;  2VL3 A;  1FG4 A;  3LXZ A;  3TOT A;  2R4V A;  2UZ8 A;  1FHE A;  1AUC A;  4OO4 A;  5G30 A;  1SD8 A;  1TK8 B;  3GKN A;  2VCQ A;  17GS A;  4I5Q A;  3TCO A;  2C4J A;  1A23 A;  1XOB A;  2FWH A;  1EEJ A;  1Z6N A;  1WE0 A;  2VKZ G;  1OAZ A;  3PPU A;  5DAK B;  2D2Z A;  1EZK A;  1R5A A;  5J5N A;  4TOP A;  4MZW A;  5D9V A;  2H8L A;  4KF9 A;  3F0I A;  3HHV A;  4IVF A;  2VOC A;  4Q5F A;  2DKI A;  2LJA A;  2LRT A;  5DCG A;  4ZB8 A;  3QAV A;  1EGR A;  3DYR A;  5IMF A;  4GSN A;  3Q19 A;  2K6V A;  4LMV A;  1G6Y A;  1WOU A;  4IS0 A;  1NW2 A;  3KM6 A;  5B8A A;  3LQ7 A;  2CAQ A;  3QPM A;  1Y1U A;  2PER A;  5G31 A;  1A8L A;  1O73 A;  1BG1 A;  4K9Z A;  1XXU A;  2JZR A;  3MSZ A;  4TR3 A;  3VK9 A;  3TRQ A;  3TRP A;  1E6B A;  3ZMK A;  1I9D A;  1GSY A;  2HYX A;  4KB3 A;  2GSR A;  2QA1 A;  4MJB A;  4WET A;  1JZD A;  4EO3 A;  3EIN A;  2R2J A;  5IO0 A;  5G5E A;  2GSS A;  4BVY A;  4G0I A;  3ERW A;  5BRT A;  14GS A;  2H19 A;  2R37 A;  1ZYE A;  4ECJ A;  1PL1 A;  3LGC A;  1BED A;  2IPA A;  3GA4 A;  2O85 A;  5F06 A;  3VFI A;  1MTC A;  4LMW A;  4TXO A;  1XWA A;  3IA1 A;  4POL A;  1K0N A;  2IFQ B;  2L59 A;  4MPG A;  4K2D A;  4V1A p;  1N2A A;  3QR6 A;  2WUL A;  4I6X A;  3ZRE A;  1TTZ A;  1KBN A;  5GSS A;  3CSI A;  5A5H B;  1JLW A;  2MMN A;  2HZE B;  2YJH A;  5DVB A;  4G0K A;  3N9J A;  2VAF A;  4MNN A;  2R0G A;  2GQL A;  1GSQ A;  2AUV A;  3UJ1 A;  2AHE A;  1SK0 A;  4HUA A;  1VF2 A;  4MF7 A;  1OKD A;  3TJG A;  4XS4 A;  3ERF A;  2LRC A;  1AW9 A;  2AB6 A;  1GRX A;  2OAD A;  1EWX A;  2CA8 A;  3PH9 A;  1CQG A;  2MBS A;  2EFE A;  4ZL8 A;  3Q18 A;  4BWS A;  2R6K A;  4NV5 A;  4I97 A;  1S3D A;  5J41 A;  1XWK A;  4MPF A;  2I1U A;  2C0G A;  5G2Z A;  1Q4J A;  5ECQ B;  4MZB A;  1FO5 A;  5G1L A;  2LEG A;  2L5L A;  3DML A;  1GSS A;  5CYY A;  3C1R A;  4ZBB A;  3UBK A;  4PGT A;  3GRX A;  3HJM A;  2NVL A;  4OCE A;  5A4W A;  2DJ1 A;  4HU9 A;  4HOJ A;  1WRY A;  20GS A;  2B1L A;  1SK2 A;  2WJU A;  4N0V A;  2X8G A;  3HKR A;  3GN3 A;  3EMX A;  2MZC A;  1M9B A;  3DKS A;  4MJA A;  5ECI B;  4EIQ A;  4E8E A;  1B4Q A;  2H30 A;  1XWG A;  5DAK A;  3KP8 A;  2YWI A;  3Q6O A;  3HJO A;  3ZFL A;  2N5B A;  4K2X A;  3L4N A;  3UMA A;  2OJL A;  4DSS B;  4E68 A;  2IMI A;  2X99 A;  2YOI A;  4IP1 A;  5HFK A;  1Q98 A;  2E7P A;  3QAG A;  2YWM A;  5E4W A;  2JSY A;  2CQ9 A;  2H1D A;  3TB2 A;  2E2M A;  5DJL A;  3CTG A;  1O7U A;  2H70 A;  1X9W B;  1ST9 A;  3HMJ G;  2RM5 A;  2YZU A;  1QXH A;  4KE3 A;  2C0D A;  3TKS C;  4FIW A;  3SBC A;  3WT2 A;  1MD4 A;  2C3Q A;  2GST A;  3DGQ A;  3VI5 A;  2YP6 A;  1A2J A;  3D4M A;  11GS A;  3F63 A;  2KP2 A;  2GT5 A;  1TRW A;  2EIO A;  1QUW A;  1F9M A;  4ACS A;  2DIY A;  4MF5 A;  3VWU A;  4HI7 A;  1EOG A;  2DKH A;  2HT9 A;  1J0F A;  3UEM A;  1XIY A;  2GQK A;  3HY2 A;  3NIV A;  2H6Y A;  1AQV A;  1B48 A;  3UOM A;  5IMV A;  4QQ7 A;  2B3S A;  1B9Y C;  2EIQ A;  4KND A;  2CX3 A;  2TRC P;  1M7T A;  4N0Z A;  2QGV A;  2L5O A;  3IHQ A;  3V1W A;  4KGI A;  3WGE A;  2R0C A;  4FO5 A;  5A5H A;  5IIZ A;  2XHF A;  4AKG A;  1TRU A;  2HZE A;  4DSQ A;  2H74 A;  1A2M A;  4G0L A;  1S3C A;  3L9V A;  1TU8 A;  3U6V A;  3I9V 2;  2FWE A;  1UN2 A;  1XW9 A;  5CAX A;  1OKT A;  5DBQ A;  3FR3 A;  4L5L A;  4PUR A;  4HQZ A;  3Q74 A;  2X64 A;  3M1G A;  2PGT A;  1TW9 A;  4AJ8 A;  3DRN A;  4AKI A;  2VLU A;  3FZ4 A;  4ECC A;  3APQ A;  3LYK A;  4I8B A;  3VPQ A;  1FOH A;  4HZ2 A;  4LL4 B;  1A8Y A;  4ML1 A;  3M9K A;  4KDU A;  1Z3E A;  1WPI A;  2DIZ A;  4ECB A;  5F07 A;  2IWT A;  2PPT A;  1XBS A;  2FNO A;  1YY7 A;  3CRT A;  4PTS A;  2JU5 A;  4LA1 A;  2I4A A;  2VUP A;  3BCI A;  5IPG A;  2M80 A;  3GHA A;  3GKM A;  2I81 A;  4HJ2 A;  2HSH A;  5IMD A;  2GTU A;  3LEF A;  1I5G A;  3OR5 A;  4PX1 A;  4GF0 A;  4PQH A;  3D22 A;  4RI6 A;  2IMF A;  1QGV A;  6GSY A;  4DSS A;  4I2U A;  1GUH A;  4JBB A;  4ULX A;  1BX9 A;  2PVQ A;  2HXK A;  2L4Q A;  3HCZ A;  1XW5 A;  1FAA A;  3IHG A;  1K3O A;  1O81 A;  1WWJ A;  4ZB7 A;  2GGT A;  3GL3 A;  3FRC A;  4QMK A;  5AIV A;  1TP9 A;  2KLX A;  3GKX A;  1ZCP A;  3U5R E;  5CRE A;  4G9H A;  4RI7 A;  3DD3 A;  3GYK A;  4WR4 A;  3IK7 A;  1XW6 A;  1SL0 B;  3GNJ A;  4PQI A;  3E0U A;  1QMV A;  4EDY A;  2OBK A;  2YNX A;  1PD2 1;  1AIU A;  3HJP A;  4HQS A;  4P3Y B;  2B7J A;  3BCK A;  5J47 A;  1EV4 A;  4AKH A;  2TIR A;  3UL3 A;  1G6W A;  2B5Y A;  2FA8 A;  5IQY A;  4K1F A;  1PRX A;  3M0F A;  3KH9 A;  3QFA C;  4ZIL A;  5EPF A;  4BPY A;  4IN0 A;  1B9X C;  5IO2 A;  4MF6 A;  5D93 A;  1SJZ A;  3F6D A;  3R3E A;  4N3Z A;  5D9X A;  1GSU A;  4AF2 A;  2RLI A;  5C00 A;  4IQA A;  1DSB A;  4YQM A;  3C73 A;  2HLS A;  2NDO A;  2G0F A;  5D96 A;  4AI6 A;  2HE3 A;  4MZC A;  3EU3 A;  1THO A;  1M9A A;  1U3A A;  1OVN A;  12GS A;  5A34 B;  3EWL A;  4EC0 A;  2IJY A;  3LW9 A;  2A4H A;  4K5S A;  2H6Z A;  3IK9 A;  1ON4 A;  4TKY A;  3KJY A;  4IJI A;  4EF0 A;  4GDF A;  1XVQ A;  2HZF A;  3EU4 A;  1RW1 A;  2QA2 A;  3ZVJ D;  1QK8 A;  4GLT A;  5KN0 A;  4KCE A;  3F4T A;  1O85 A;  1DUG A;  2V6O A;  2CV4 A;  2AAW A;  4Z7X A;  3UAR A;  3VWV A;  2F8A A;  3H4K A;  1V58 A;  4O32 A;  4GCI A;  5IMZ A;  1SKS B;  1PQN A;  4HS1 A;  4MJC A;  2VM1 A;  2YJ7 A;  2HRK B;  4AGS A;  5DCH A;  4KH7 A;  5ELA A;  2AYT A;  3RPP A;  1X9S B;  3M8N A;  4XCS A;  1PSQ A;  3HA9 A;  2KP1 A;  3D0Z A;  2I3Y A;  3ZZX A;  2NBS A;  4JU5 A;  3QD9 A;  3FK8 A;  3P90 A;  2UV8 G;  4ECI A;  4XS6 A;  4L0U A;  3TKR A;  3IC4 A;  6GSW A;  2QKE A;  5JWQ B;  1GUL A;  4X1U A;  4IP6 A;  3G9B A;  1DE2 A;  2QSI A;  1Z5Y E;  1TXU A;  2CT6 A;  1ZYQ B;  2PBJ A;  1WJK A;  4F0C A;  1TRS A;  3GL5 A;  1TJD A;  5KOX A;  1V57 A;  4K7O A;  4Q5Q A;  2LNS A;  4PQ1 A;  5CRG A;  1X5E A;  1ERW A;  5IMC A;  2CAI A;  1N8J A;  2P5Q A;  4OFM A;  3TU3 B;  1N25 A;  2JAD A;  2CZ2 A;  2DBC A;  4WKW A;  5H5Q A;  3TDG A;  3K8N A;  3TJB A;  2H75 A;  2PWJ A;  1U3I A;  4O7H A;  2EIR A;  3L78 A;  2H1G A;  5DJM A;  4Z2T A;  1LJR A;  5DAL B;  1DE1 A;  1PA3 A;  3GMF A;  2DML A;  3KEB A;  8GSS A;  4V2M A;  1C72 A;  3VWW A;  2GZP A;  2JZT A;  4O92 A;  4F9Z A;  4KA0 A;  4MJE A;  4MMM A;  1VF1 A;  2EC4 A;  3IXR A;  2A2R A;  4J2F A;  3ERG A;  2DLX A;  3ZYW A;  5A4V A;  4LL1 B;  4K8M A;  2ZNM A;  3KCM A;  2B1K A;  2ALB A;  4IKH A;  4PUA A;  5H5S A;  2LRN A;  4O5U A;  1JHB A;  1YQ1 A;  1YJ6 A;  5ECK B;  3CWG A;  2PUK C;  3NZN A;  4ISD A;  2LJR A;  3EE2 A;  3A2V A;  2FY6 A;  3ZL5 A;  3P8W A;  5A34 A;  1YF1 A;  4YKF A;  5AIS A;  1ZZY A;  3GTU B;  2WRT A;  2XC2 A;  3L9U A;  5J4U A;  4CW9 A;  4CY6 A;  4HDE A;  16GS A;  5JWR B;  3H79 A;  2YV7 A;  3L0H A;  3TKS A;  1JZO A;  3A5I A;  4D73 B;  5F8B A;  2LV3 A;  1YKC A;  4YH2 A;  2H1B A;  3TKQ A;  6GSU A;  4MA9 A;  3MNG A;  3HDC A;  1EV9 A;  4NMU A;  5B7C A;  2M72 A;  3UAP A;  2V2G A;  2GQM A;  2TRX A;  2GZZ A;  3BD2 A;  1YEP A;  3A3T A;  2X8H A;  2HRK A;  3QMX A;  3J7Y k;  4N10 A;  3ME7 A;  3QDN A;  4IJ3 A;  1GTI A;  1OYJ A;  2M46 A;  3ZTL A;  2JZS A;  2YV9 A;  3IBH A;  2VL2 C;  2VCT A;  1GTB A;  2IN3 A;  1PX6 A;  3HZ8 A;  2EFC A;  4MK3 A;  1GH2 A;  2KHP A;  3R2Q A;  3HVS A;  4JR6 A;  3UVH A;  2H1L A;  1A0F A;  3TJK A;  3DXB A;  1SL2 B;  2VCZ A;  1U6T A;  3VI7 A;  2ON7 A;  4ML6 A;  3MYD A;  1MDI A;  3DEX A;  5A1N B;  3CXG A;  2LUS A;  2FA4 A;  3E3E A;  1AXD A;  4ZB6 A;  2RUE A;  2B6M A;  3I43 A;  4TRX A;  3IDV A;  3LWA A;  1O6J A;  13GS A;  1AQW A;  4YQV A;  3HVX A;  3KMN A;  1S3A A;  2LTK A;  2V32 A;  1JZW A;  1UA5 A;  4GQC A;  3NOF A;  5ECR B;  1FOV A;  4BA7 A;  1TKD B;  1R7H A;  1FB0 A;  1VF3 A;  2A2P A;  4MDC A;  3MDK A;  2XBQ A;  4ZXG A;  4CDO A;  1TU7 A;  4G2E A;  2IFQ A;  1K0B A;  4ZL7 A;  4NAX A;  4JED A;  1ZL9 A;  2XPD A;  4GXZ A;  5EL8 A;  5DAL A;  1WIK A;  2VLT A;  4F03 A;  4DVC A;  2VO4 A;  3RBT A;  3KTL A;  5GZZ B;  4WBJ A;  4Z2R A;  4G01 A;  2GS3 A;  3IAS 2;  6GSX A;  4OCF A;  4HZ4 A;  5LNK e;  1K3Y A;  3CBU A;  4OFT A;  1T4Z A;  3O3T A;  5IPH A;  1XZO A;  2RM6 A;  3GH9 A;  2LNT A;  2F9S A;  3HXS A;  4KUN A;  3ZIV A;  1BAY A;  4L0W A;  3HD5 A;  2L4C A;  2P31 A;  1BQ7 A;  3H8Q A;  5J9C A;  1GSE A;  2X4A A;  1QFN A;  2R5G A;  1YDK A;  3QFB C;  2WB9 A;  4GWR A;  4K0G A;  3GTU A;  4USS A;  3VUR A;  2N5A A;  1ERV A;  2HSN B;  1Z7R A;  5KEJ A;  4KCA A;  1W4V A;  4BWQ A;  5A4U A;  1IYH A;  2K8V A;  2O89 A;  4D73 A;  5J4V A;  4YQU A;  2OE0 A;  2N5F A;  2QC7 A;  1OE7 A;  4ZIJ A;  5GAN D;  2IMK A;  5J40 A;  1F3A A;  1JFU A;  1K3L A;  3FW2 A;  2EFH A;  4KDX A;  4G10 A;  1GWC A;  1PX7 A;  5BMU B;  5E59 A;  3KH7 A;  2L57 A;  4FYU A;  5GST A;  2DJK A;  3SWL A;  1K0A A;  1V40 A;  4K6X A;  1WMJ A;  2DJ3 A;  4FQU A;  7GSS A;  5IM9 A;  2JSZ A;  5ECL B;  4GTU A;  4EKZ A;  1FVJ A;  5IOX A;  2IMD A;  2HRF A;  2BTO T;  3C71 A;  2MYG A;  1GNE A;  1EEM A;  1ABA A;  2LST A;  2GZY A;  4MAB A;  2Z9S A;  2H1A A;  5B8B A;  1TI3 A;  4AKX B;  4N11 A;  3O76 A;  2VCW A;  5D8I A;  1TRV A;  2FD3 A;  4OWY A;  5A1N A;  1NHY A;  2LJK A;  3M3M A;  5HR0 A;  1KEB A;  1RK4 A;  2FWF A;  4O5Q A;  4EDZ A;  2F3M A;  1NM3 A;  6GSS A;  2RII A;  4YAV A;  2YWN A;  1A0R P;  2I9H A;  2C3N A;  1X5D A;  1GUK A;  2FWG A;  1ZYN A;  4NXI A;  4WBR D;  1SEN A;  3C1S A;  2HSM B;  4AJ7 A;  3W8S A;  4V1A g;  4FYB A;  5JWO B;  3VLN A;  1RQM A;  2MMA A;  1G0T A;  1BG5 A;  3HVV A;  2L6D A;  1SK1 A;  3KGK A;  4POK A;  2JAC A;  2A4V A;  1B4P A;  1TK5 B;  4WXT A;  2B5X A;  1R4W A;  3RAZ A;  4ZBA A;  4GRF A;  3VPT A;  4Q5N A;  4MH3 A;  1Z6M A;  2IL3 A;  1JZR A;  3W6G A;  5INY A;  5CP1 A;  4V2L A;  4WR5 A;  1FVK A;  4ICY A;  3GV1 A;  4NWY A;  4X4J A;  1SL1 B;  1YF0 A;  4K7I A;  3GFK A;  5AN1 A;  4Z2U A;  4NHZ A;  4TVE A;  2WGR A;  1XFL A;  1PKW A;  5A5K A;  4PUF C;  1ERU A;  1PGT A;  2ZUP A;  4TR0 A;  4HEA 2;  1NHO A;  2B7K A;  5EVO A;  2CZ3 A;  1K0O A;  4LLR A;  2HSN A;  1CQH A;  1HYU A;  3CRU A;  3I69 A;  1SD9 A;  5G1K A;  4K5R A;  1G7O A;  1OC3 A;  1ILO A;  2O7K A;  3FZ5 A;  1M2A A;  4BL7 B;  2R3X A;  2H73 A;  1ERT A;  5J3R A;  1T8E B;  3ZVJ A;  5FWG A;  4L8E A;  2O5V A;  4CHS A;  3ZFB A;  3ISO A;  3DVX A;  2ON5 A;  5CRW A;  4QL7 A;  2HQT A;  1BYE A;  3DWV A;  5BMU A;  4XS1 A;  2PN8 A;  2ZCT A;  2WDU A;  2J9H A;  3KXO A;  3LG6 A;  3ED3 A;  5CRH A;  2A2S A;  1TK0 B;  2CVB A;  1GTU A;  4PNG A;  4O5R A;  2OKA A;  1O8W A;  3EUR A;  3QAW A;  18GS A;  4G19 A;  4BVX B;  5ECH B;  2H01 A;  4NPB A;  1GUM A;  3GUS A;  3FYG A;  2YAN A;  3US3 A;  2OE1 A;  3M9J A;  1ZYP A;  4RQR A;  3CSH A;  1HNA A;  1URM A;  3QCP A;  4V2N A;  2LKU A;  1SYR A;  2BMX A;  2GT6 A;  1MDK A;  2C80 A;  3ZML A;  4DSR A;  4X0X A;  2FCH A;  1YKA A;  3A5W A;  1V98 A;  3D21 A;  2FLS A;  3KD0 A;  4ILF A;  2GDR A;  1GL8 A;  1XWC A;  1VF4 A;  1VGL A;  5HFG A;  2C0F A;  3F3Q A;  5DQS A;  3WGD A;  1FB6 A;  1KNG A;  3TKS E;  1V9W A;  4W66 A;  1O8X A;  4MH2 A;  1SJI A;  1K0D A;  3TJJ A;  4RUV A;  4FYC A;  2HSM A;  3C8E A;  1HNC A;  1VRS D;  3HZ4 A;  4OO5 A;  2P0G A;  3E9J B;  3J7Y b;  2AV4 A;  4DEJ A;  1XCC A;  1R5P A;  1OE8 A;  1OC9 B;  5G5F A;  1GTA A;  4ZB9 A;  1ML6 A;  3I6A A;  5J9B A;  2V6K A;  3FEU A;  4EE0 A;  2C0E A;  1R26 A;  2HRA A;  4TR1 B;  3IC8 A;  1NSW A;  2H71 A;  5JCU A;  3LJR A;  2LS5 A;  4F82 A;  2DJ0 A;  2FHE A;  3GST A;  1KTE A;  2O87 A;  2V1M A;  3EPT A;  3CTF A;  4TXV A;  3BJ5 A;  3P7X A;  5ID2 B;  5F0G A;  2RUF A;  1K0C A;  2XPE A;  3TJF A;  4ID0 A;  5D9W A;  3GH6 A;  4L5O A;  4KSM A;  2J23 A;  5ECM B;  3H93 A;  1YVL A;  2VD0 A;  3D4T A;  1HNB A;  4EVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...