1G7OA

Nmr solution structure of reduced e. coli glutaredoxin 2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
b'MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN 2
publication title Solution structure of Escherichia coli glutaredoxin-2 shows similarity to mammalian glutathione-S-transferases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 84
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1g7oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g7oA01
1J9BA 1FHEA 2OE1A 1LJRA 1Z7RA 2MMAA 2IFQB 5C04A 1PQNA 2L4CA 4MZCA 3KTLA 1F3AA 2HNLA 1CQHA 1ILOA 3TKRA 4MPGA 1ERUA 1I5GA 1XOBA 2AHEA 3BBYA 4OWYA 1QGVA 3PH9A 2DLXA 2GQMA 4N11A 4DEJA 1YEXA 3GSSA 2L5OA 1ERTA 4CDOA 4QQ7A 4PQ1A 4YQMA 5JCUA 2N5AA 1JLWA 3HVSA 4WR5A 5DQYA 1AQWA 3QAVA 2OE0A 2F8AA 3IK7A 4POMA 4OO5A 2C3QA 3WYWA 2WS2A 4AJ7A 3P7XA 1GSUA 4RUVA 2LJRA 3D22A 5HR0A 4IP6A 4PURA 3RAZA 4DSSB 3VI7A 2RUFA 1XWCA 5J5NA 4X1UA 4ZXGA 4MJEA 1S3AA 1TK8B 1GTIA 1OE8A 2DBCA 3ZVJD 1BQ7A 3TOUA 4K8MA 4YAVA 1WJKA 2KP2A 4J57E 4V2NA 2IIYA 3LXTA 4TRXA 3KMOA 1PRXA 1TI1A 5JCGA 1BX9A 4ML1A 2V32A 1X0RA 5AIVA 5L71A 1O73A 5HR2A 4LMWA 1K0BA 1ST9A 1R7HA 2GGTA 2HRFA 1WOUA 5G1KA 1ERWA 1O6JA 1G7OA 4QL9A 1T4YA 4L0WA 2KP1A 4RQXA 4IBPA 5IOXA 4IKHA 1HD2A 2IN3A 1A0RP 4H86A 3FHKA 5D9WA 2C0DA 3EU3A 5H5RA 5A4UA 1SL0B 4OCEA 2K18A 2CAIA 6GSYA 3DEXA 3Q18A 2FA4A 5IQYA 2H66A 3F9UA 3UARA 2OE3A 1H75A 2LEGA 5IMZA 4K0GA 5GAND 6GSUA 4OFMA 3GHAA 5D9TA 1HNAA 4XRDA 4N0VA 1WPIA 2LJKA 2ALBA 3IAS2 5IMDA 1UN2A 2QKEA 4KDUA 2V6KA 1GNWA 3KGKA 3F0IA 3CSJA 5J9CA 4MJCA 1XW5A 2H01A 2JZRA 3JCML 3DMLA 1IYIA 1LBKA 3FR3A 3D0ZA 1B4QA 5GZZB 2H6ZA 1GTUA 2H19A 2R5GA 4L5OA 3CSIA 1QFNA 2MMNA 1M9AA 2CX4A 1XCCA 1THXA 1XIYA 3UMAA 5KN3A 2H6YA 1O81A 3V1WA 3MDKA 4O92A 4ML6A 5CNWA 1YF1A 1HNCA 3VWUA 2JL4A 4ACSA 3DWVA 1EP7A 2CV4A 1G6YA 4AF2A 3GL5A 4ZBAA 1OKDA 3I69A 3BCIA 4IJ3A 2BMXA 3TRQA 4K0NA 3W6GA 3DKSA 1HQOA 2CVDA 1DBYA 2RUEA 4Q5QA 3ERGA 2LNTA 4EO3A 2L5LA 3HVXA 1WE0A 4XS6A 3ZFBA 1KBNA 3G7IA 3HZ8A 2GT5A 1TRSA 4BL7A 2JACA 1U88A 4D73B 1MDKA 4GLTA 2CZ2A 4OCFA 5IMCA 4F0BA 1PX6A 1N8JA 2B7JA 4MPFA 2X8HA 1B8XA 2AB6A 1SJZA 4MCUA 3W8JA 4V1Ap 4L5LA 1M99A 1IYHA 3CTFA 4TXOA 1T7PB 3C73A 5D73A 2BTOT 5DJMA 1AQVA 4IQAA 1QXHA 1EEJA 2B7KA 4IW9A 1Q98A 4V2LA 5AIXA 4POLA 1ABAA 3GX0A 2HZEB 4WF5A 3QFBC 2FHEA 4ULXA 2H8LA 4XRAA 1ZL9A 1K3OA 2DJ2A 1MDJA 3ZMKA 4WETA 4TKYA 4QL7A 5CREA 3ZL5A 3BD2A 2H0HA 3CRUA 1YDKA 5A5KA 1ON4A 5HR1A 5BMUA 2YWOA 1T4ZA 4G0KA 3ZFLA 1A23A 2K9FA 3GNJA 5LD0A 5FHIA 3NIVA 2JU5A 4DSRA 1RQMA 2HQTA 1ZYQB 2A2RA 2IL3A 2LQOA 2YANA 4G2EA 3ZVJA 3FY7A 3TUEA 3RHCA 2JZSA 3ERWA 5CRDA 2PVQA 2E0QA 4XTSA 1AAZA 5ENUA 5F06A 1GSDA 5D9XA 3F4TA 3IR4A 3RPNA 3GTUB 3QAWA 5F8BA 1B9XC 3D4TA 3R3EA 3WGXA 4O7HA 5ECKB 3PINA 1QK8A 1T8EB 2RM6A 4OD7A 4K7OA 2JSZA 1NW2A 5IO0A 3ZYWA 4LL4B 4ZB9A 4HZ2A 2CT6A 4HDEA 3Q19A 3LXZA 4K6XA 1AXDA 4GSTA 3IK9A 3C1RA 3ZZXA 3EVIA 2YN1A 2CAQA 4HU7A 1U3AA 1UVZA 4LL1B 5DDLA 2B3SA 3LWAA 5D93A 5A4VA 3PPUA 1EZKA 3LYKA 4LMVA 2P31A 2X64A 1X5CA 2HYXA 3DD3A 5JWOB 3KM6A 2H1AA 1U6TA 5EPFA 1X5DA 1M0UA 2GQKA 4G9HA 3ZRDA 4N10A 2O85A 3K8NA 4WF4A 2WRTA 3IRAA 2VL9A 2VL3A 3KCMA 4OO4A 1FOVA 1TW9A 3GH6A 3IV4A 2IPAA 3ZLPA 1U3IA 2H76A 2I9HA 2MBTA 3DYRA 3F6DA 3CSHA 5DCHA 1OVNA 3A2XA 4XS4A 2R2JA 1FAAA 4HI7A 4XHMA 3L9UA 1XVQA 2LRNA 1BEDA 3L9VA 3EC3A 1M2BA 2YP6A 4PX1A 3VI5A 3CXGA 4ILFA 4KSMA 2GDRA 3HJPA 3EMXA 10GSA 1MEKA 3KIJA 2B5EA 1PA3A 3OR5A 4EL1A 2K8VA 3M9KA 2C8UA 3C7MA 4EKZA 2TRXA 1TJDA 4OFTA 1YEPA 1SKWB 4HZ4A 2OBIA 3ME7A 1SKSB 4MH2A 13GSA 2M46A 4TR4A 1X9WB 4GQFA 1TDIA 4WEYA 2WFCA 3MAKA 3UAPA 1LU4A 4JBBA 1TRUA 3GH9A 1SK2A 3GSTA 1K3LA 5AGYA 4BVXB 2GT6A 2GLRA 1TP9A 2H74A 1XBSA 5IM9A 1ZMAA 5ECMB 2OKAA 2H6XA 4IGJA 4EE0A 2DJJA 1JZRA 1R5PA 3KP8A 4NHZA 1F6MC 1EEMA 5FT3A 3HHVA 2VCQA 1Q4JA 2CA8A 2L6CA 2WULA 2LRCA 2HE3A 3TGZA 2PBJA 3KH7A 1XXUA 2VD1A 4FQUA 4EDZA 4F9ZA 5DALA 5EY6A 1XPVA 2LS5A 3QMXA 4DSSA 3APQA 4YAPA 1TU7A 2I1UA 4E8HA 3HCZA 3TRXA 4N0ZA 5ELGA 4J56E 3ZIVA 3MNGA 4BPYA 3LJRA 5ECQB 2P0GA 5DBQA 2IJYA 4HUAA 3L9SA 4OMVA 5DALB 1JFUA 3TJFA 1W4VA 3M3MA 2C1YA 2HT9A 2AAWA 4ID0A 3J7Yb 4ECJA 1ZGNA 3TKSE 2HSHA 4FH8A 3TJJA 3UVHA 1YJ6A 3IHQA 2JZTA 5GSSA 1B48A 4MA9A 3P2AA 3ERFA 2EC4A 1F3BA 1BAYA 1EGRA 2FWEA 3VFIA 2VL2C 3WT1A 2VCXA 1X9MB 4RI7A 5DJLA 3FZAA 1DE2A 2ON5A 2XC2A 1GSSA 5GSTA 2I4AA 1OE7A 3WT2A 1A2JA 1YZXA 2NDOA 3H1NA 3VURA 2YWIA 4F2IA 4YQUA 1VRSD 3D5JA 2DJ0A 1VF3A 2IMKA 4EC0A 1RK4A 2HSNB 2NTOA 3KTBA 2DIYA 1XWBA 4NAXA 2GZPA 1VGLA 2OBKA 2RM5A 5DAKA 1GP1A 3VWVA 1ML6A 3FRCA 3EINA 2VL2A 2HSMB 3GX8A 1TXXA 4EVMA 3HD5A 1ZZYA 3GV1A 3GUSA 4HQSA 2C0FA 4G10A 5KEJA 2O87A 5DAKB 4NMUA 1TI3A 3EMPA 4G19A 3HZ4A 4V1Ag 1YF0A 2MMZA 1OKTA 1Z5YE 3DIEA 2K6VA 3L0HA 4PNGA 3ZIJA 2YZHA 1BJXA 4Q5NA 3RDWA 1GUMA 1V57A 4MP4A 4PTSA 3DXBA 5AISA 3KH9A 4MJBA 3ISOA 1B9YC 3FYGA 1V40A 3O3TA 4PXOA 3ZITA 5E59A 3C71A 2O7KA 4KDYA 1TTZA 1PGTA 3TJGA 3EU4A 3H4KA 2HSYA 1JHBA 1SKRB 2I81A 3ME8A 3UVTA 3PGTA 1GLQA 2GQLA 2VM1A 1XW6A 4KUNA 2OADA 1ZYEA 4KF9A 4RQRA 3KP9A 4Q5RA 1EOGA 2VCVA 3O6TA 4D73A 2VUPA 3CYNA 5CO3A 1AIUA 1THOA 1MTCA 4BVYB 5B8AA 2LV3A 3DVXA 1FG4A 4ZBBA 4J2FA 1UC7A 3HXSA 2MYGA 2DJKA 2YCDA 11GSA 4IELA 2EIOA 1GNEA 1TOFA 3EWLA 2FWFA 3GURA 3A2VA 1W89A 3H79A 5EL8A 4EUYA 3LFLA 3CMIA 3D21A 1GUHA 4MZWA 2FGXA 1GSEA 4ZBDA 3F8UA 2P5QA 1A2MA 3VK9A 2XHFA 2RLIA 4IN0A 4V2MA 4YH2A 3APOA 2HZEA 2VLUA 1Y6EA 2PERA 3HA9A 4K2DA 2EIRA 4MMMA 1R5AA 2J9HA 1SL1B 2VCTA 3I6AA 3ZTLA 12GSA 5IO2A 1SYRA 1GULA 2DJ1A 2A4VA 5F05A 2V1MA 3UBKA 4X43A 16GSA 1A8YA 3FKFA 3QCPA 2M80A 2RIIA 3SBCA 2I3YA 3TJKA 2LRTA 1PSQA 4LLRA 17GSA 2M72A 3UL3A 4ZIJA 2IMIA 2DIZA 2XPEA 4N30A 3ED3A 1F37A 1A24A 2PU9C 1K0CA 2O89A 1M9BA 5ECHB 4CW9A 2CQ9A 4KGIA 4OFNA 3LSZA 2H0GA 2YWNA 2X99A 3KZQA 1G7EA 1EWXA 3IXRA 4MABA 1QQ2A 4KNDA 5KN1A 4GQCA 4PQHA 2ZNMA 1OC8A 3FR9A 5B7CA 3QD9A 2VIMA 3NOFA 3F4RA 3GTUA 2P5RA 1KTEA 4IP1A 1SD8A 3A5WA 4K7IA 3L4NA 1DE1A 5IMVA 1Z3EA 3MWHA 4I2UA 3TKSC 1VF4A 3GRXA 2E2MA 3C1SA 1TKDB 4EF0A 4DSQA 2VLTA 1GRXA 3QFAC 2WCIA 4KCEA 1SL2B 1T3BA 5J9BA 4L0UA 4KW6A 3US3A 2OJLA 1MD3A 1GWCA 4IHUA 3IAM2 2QC7A 1T00A 1PL2A 2EIQA 2LUSA 5CP1A 3N5OA 4HJ2A 3HVVA 1XOAA 3ZREA 5DCGA 3FK8A 4NPBA 5ELAA 2JADA 3A2WA 4GSNA 2VAFA 3IA1A 1YKAA 4Z7XA 3TKSA 4TOPA 3G7JA 2AV4A 4TR3A 3IBHA 2H75A 2NVLA 3ZMLA 3UBLA 3LEFA 1SK0A 1E6BA 1BG5A 3F4SA 3O76A 2F9SA 1K0NA 2GSSA 3QR6A 2LNSA 4X0XA 4K9ZA 4F82A 3DGQA 1VF2A 5D8IA 5CYYA 4IS0A 1J0FA 3LYPA 3KMNA 2H0IA 2E2GA 4WKWA 1ZCPA 2VLVA 2KLXA 1AC1A 2YNXA 2MBSA 1QMVA 1FVKA 3SWLA 1E2YA 2KUCA 2F3MA 1WWJA 2IMFA 2HRKB 4TXVA 5IMFA 1PD21 2F51A 1O7UA 2H71A 3LQ7A 3Q74A 2C3TA 4F0CA 1J08A 2CX3A 2GSTA 2WZ9A 2H1DA 5ID2B 3VWWA 2L6DA 4LA1A 5IMAA 2DMLA 1Y25A 1GUKA 1S3CA 5ECRB 1O8XA 1OC9B 2E7PA 4P3YB 4BVXA 4KCAA 1EP8A 3KXOA 3P8WA 4EXJA 1FB6A 2B5YA 1SD9A 3UOMA 1SJIA 4MH3A 4WR4A 4GF0A 3KD0A 4O32A 2L4QA 4I8BA 3FR6A 1WRYA 5ECLB 3TKPA 1F2EA 1PMTA 3GKNA 3LORA 7GSSA 1UA5A 5G5EA 3GMFA 4G0LA 3NZNA 2V6OA 1FO5A 5H5QA 5JWQB 4AJ8A 1FVJA 4KH7A 1GTAA 4ECCA 3FZ4A 2HFDA 3PR8A 3M1GA 4BWSA 4K7NA 5D9VA 4POBA 1AW9A 2VM2A 2H1GA 2YV7A 1TRVA 3DRNA 2GZZA 3D4MA 3GL3A 2C80A 5CRHA 2B6MA 3CRTA 3HJMA 2MMOA 2HRNA 4F03A 4TR0A 4HOJA 3E0UA 5H5SA 3F3RA 3VPTA 4ZB6A 1DUGA 20GSA 5J41A 3GYKA 2FNOA 3I9V2 1TK0B 4MJAA 3VLNA 4WXTA 1YY7A 3HY2A 3EURA 1WMJA 2UZ8A 5D96A 2OACA 1K0DA 4EDYA 2CVBA 4FIWA 2FWGA 1GSQA 3CBUA 2GTUA 1SU9A 4JZQA 2C4JA 3N9JA 1HYUA 1V58A 4IJIA 1A0FA 1SJ6A 2QGVA 2L57A 2GZYA 4L8EA 5G2ZA 2WJUA 4IQ1A 2FCHA 2IWTA 1TRWA 5G31A 1V98A 3MSZA 2LTKA 2LQQA 2V41A 5A4WA 1M7TA 4NV5A 4NXIA 3UIWA 2HSMA 5ECNB 2R3XA 4KDXA 4PUFC 2J23A 3GFKA 2HI7A 4TN8A 5LNKe 2GSQA 3FW2A 2A2SA 5ECSA 1XZOA 3BOAA 4KAEA 1Z7PA 1BYEA 5HFKA 3GKKA 3L78A 2C0EA 2G0FA 1AQXA 4HJMA 5J3RA 1CQGA 4XS1A 3GIXA 4K1FA 4JRRA 5JWRB 1JZDA 1NHYA 1XFLA 22GSA 3J7Yk 5ECIB 1FW1A 1U87A 3CTGA 4PQIA 3BJ5A 3Q6OA 2B5XA 4PNFA 3WD6A 4FYUA 3M0FA 3F6FA 8GSSA 2B1LA 2ZCTA 2PPTA 1TU8A 2LJAA 5IPHA 3DVWA 1WP0A 4ZILA 4MF6A 4ECBA 1K0OA 3QAGA 9GSSA 3QPMA 3W8SA 3F63A 5FWGA 3TCOA 6GSVA 4ISDA 2XBIA 4JE1A 2KHPA 1DSBA 5CRWA 3I43A 3A3TA 1Z9HA 1PKWA 3IE3A 4DVCA 5COHA 2FA8A 2TIRA 1MDIA 4BVYA 3P90A 4JR6A 1R4WA 3APSA 1YQ1A 1OC3A 2FD3A 4JR4A 4KA0A 4USSA 5HFIA 4ZL7A 3QOUA 3GA4A 2WB9A 4MF5A 1GSYA 2R37A 2D2ZA 1KNGA 3TRPA 3TJBA 4RI6A 2CVKA 5G5FA 1S3DA 3U6VA 2IMDA 3IC8A 2PN8A 2VO4A 2YWMA 5AN1A 1XWGA 3HKRA 3TOTA 2C0GA 5DQSA 2YPMA 4ECIA 2ON7A 4HEA2 3UJ1A 4BA7A 3GKXA 2DMMA 1XWAA 1EGOA 2H30A 6GSTA 1EV9A 2FY6A 4O5RA 1GL8A 3TB2A 3WGEA 3KEBA 4PGTA 3M8NA 5DVBA 2IMEA 2PVOC 1M2DA 3EYTA 1ERVA 3IPZA 4FYCA 1SENA 2QSIA 1F9MA 5GAPD 1K3YA 3HYPA 5HQPA 1N2AA 1SYXA 5E4WA 4GWRA 4Q5FA 4XIHA 1GLPA 1NHOA 5INYA 4BL7B 1T1VA 3E3EA 4G0IA 6GSSA 3GKMA 5C00A 5KN0A 1Z6NA 2YZUA 2CZ3A 2LSTA 3FEUA 1A2LA 1GH2A 5F0GA 1OYJA 4GXZA 4MZBA 1HNBA 4BWQA 2VOCA 5HR3A 4NHWA 2REMA 1PKZA 1M2AA 4MF7A 4AJ6A 3C8EA 4GCIA 1O85A 4KE3A 3FZ5A 19GSA 2L59A 2YV9A 4YQVA 1G6WA 3WGDA 1NSWA 2YOIA 1QUWA 4TXOB 1JLVA 2KOKA 2MZCA 3M9JA 1X9SB 5G30A 4TR1A 1ACVA 2PWJA 4CHSA 2Z9SA 1G0TA 1MD4A 2H72A 4I97A 1A8LA 18GSA 2HLSA 4PUAA 2GVPA 2F8FA 4TR1B 5IPGA 3TDGA 4AGSA 2PGTA 1ZOFA 2LKUA 4ZB8A 4HS1A 2V2GA 5IIZA 6GSXA 5B6NA 4I2TA 2AYTA 1AUCA 4HQZA 2HRAA 1H4OA 2XBQA 2FLSA 3HDCA 2YJHA 4NV2A 4KX4A 5CAXA 2H70A 4NWYA 2FUG2 3QDNA 1FB0A 3IC4A 4KB3A 3RBTA 2VCWA 4I6XA 2G2QA 5B6MA 2N5FA 2C3NA 2AUVA 1TK5B 2VCZA 1NM3A 1GSFA 3RPPA 2B1KA 3RHBA 1K0AA 5ECPB 5JCWA 5EVOA 2BJXA 1XW9A 2X8CA 3VPQA 5G1LA 3HJOA 4IVFA 1WIKA 5HFGA 5B8BA 3R2QA 1I9DA 4ZL9A 3EE2A 1K0MA 3G9BA 4JEDA 1C72A 2DC5A 4WBRD 4TW5A 3FZ9A 3GN3A 2ES7A 3F3QA 1RW1A 5IOWA 4MK3A 3TKQA 1V2AA 2HRKA 3LG6A 4I5QA 4MLYA 5F07A 5KN2A 4XCSA 4HU9A 2OA7A 2O8VB 4FO5A 1VF1A 2R4VA 2HZFA 5ABRA 4GSSA 3LGCA 2ZUPA 3E9JB 3UEMA 2JSYA 4ZL8A 2DJ3A 5ID2A 1OAZA 2XPDA 5LCZA 3H8QA 2WDUA 2H73A 1EOHA 2NBSA 2TRCP 1PL1A 1OC9A 3VWXA 2PUKC 1JZWA 5CRGA 1YKCA 2NPBA 1V9WA 2HXKA 2GS3A 2R6KA 4JU5A 3AY8A 2K8SA 3D6IA 3IOSA 3S9FA 2AJQB 1GTBA 1X5EA 2PMTA 2DSAA 3H93A 6GSWA 4WBJA 1B4PA 1O8WA 4GRFA 4KSOA 3IDVA 1SK1A 5ECOB 2X8GA 2N5BA 1KEBA 3G7YA 4XS4B 1JZOA 1PX7A 1USBA 3U5RE 1R26A 2H1BA 2GSRA 4POKA 14GSA 4E8EA 2FWHA 4TVEA 4MDCA 1PN9A 1XVWA 2YJ7A 3BCKA 4FYBA 5J4UA 1Z6MA 1XWKA 2IFQA 1URMA 2WGRA 1EV4A 2VD0A 4GTUA 3KJYA
chains in the Genus database with same CATH superfamily
1J9BA 1FHEA 2OE1A 1LJRA 1Z7RA 2MMAA 2IFQB 5C04A 1PQNA 2L4CA 4MZCA 3KTLA 1F3AA 2HNLA 1CQHA 1ILOA 3TKRA 4MPGA 1ERUA 1I5GA 1XOBA 2AHEA 3BBYA 4OWYA 1QGVA 3PH9A 2DLXA 2GQMA 4N11A 4DEJA 1YEXA 3GSSA 2L5OA 1ERTA 4CDOA 4QQ7A 2OT3A 4PQ1A 4YQMA 5JCUA 2X49A 2N5AA 1JLWA 3HVSA 4WR5A 1M3JA 5DQYA 1AQWA 3QAVA 2OE0A 2F8AA 3IK7A 4POMA 4OO5A 2C3QA 3WYWA 2WS2A 4AJ7A 3P7XA 1GSUA 4RUVA 2LJRA 3D22A 5HR0A 4IP6A 4PURA 3RAZA 1Y1UA 4DSSB 3VI7A 2RUFA 1XWCA 5J5NA 4X1UA 4ZXGA 4MJEA 1S3AA 1TK8B 1GTIA 1OE8A 2DBCA 3ZVJD 1BQ7A 3TOUA 4K8MA 4YAVA 1WJKA 5J47A 2KP2A 4J57E 4V2NA 2IIYA 3LXTA 4TRXA 3KMOA 1PRXA 1TI1A 5JCGA 1BX9A 4ML1A 2V32A 1X0RA 5AIVA 5L71A 1O73A 5HR2A 4LMWA 1K0BA 1ST9A 1R7HA 2GGTA 2HRFA 1WOUA 5G1KA 4EIPA 1ERWA 1O6JA 1G7OA 4QL9A 2R0GA 1T4YA 1M3IA 4L0WA 2KP1A 4RQXA 4IBPA 5IOXA 4IKHA 1HD2A 2IN3A 1A0RP 4H86A 3FHKA 5D9WA 2C0DA 2WW1A 3EU3A 5H5RA 5A4UA 1SL0B 4OCEA 2K18A 2CAIA 6GSYA 3DEXA 3Q18A 2FA4A 5IQYA 2H66A 3F9UA 3UARA 2OE3A 1H75A 2LEGA 5IMZA 4K0GA 5GAND 6GSUA 4OFMA 3GHAA 5D9TA 1HNAA 4W66A 4XRDA 4N0VA 1WPIA 2LJKA 2ALBA 3IAS2 5A5HB 5IMDA 4K2XA 1UN2A 2QKEA 4A5PA 4KDUA 4GDFA 3HMJG 2V6KA 1GNWA 3KGKA 3F0IA 3CSJA 4AKHA 5J9CA 4MJCA 1XW5A 2H01A 2JZRA 3JCML 3DMLA 1IYIA 1XG8A 1LBKA 3FR3A 3D0ZA 1B4QA 5GZZB 2H6ZA 1GTUA 2H19A 2R5GA 4L5OA 3CSIA 1QFNA 2MMNA 1M9AA 2CX4A 1XCCA 1THXA 1XIYA 4N3ZA 3UMAA 5KN3A 2H6YA 1O81A 3V1WA 3MDKA 4O92A 4ML6A 5CNWA 1YF1A 1HNCA 3VWUA 2JL4A 4ACSA 3DWVA 1EP7A 2CV4A 1G6YA 4YKFA 4AF2A 3GL5A 4ZBAA 1OKDA 3I69A 2O36A 2A2PA 3BCIA 4IJ3A 2BMXA 3TRQA 4K0NA 3W6GA 3DKSA 1HQOA 2CVDA 1DBYA 2RUEA 4Q5QA 3ERGA 2LNTA 4EO3A 2L5LA 3HVXA 1WE0A 4XS6A 2EFCA 3ZFBA 1KBNA 3G7IA 3HZ8A 2GT5A 1TRSA 4BL7A 2JACA 1U88A 4D73B 1MDKA 4GLTA 2CZ2A 4OCFA 5IMCA 4F0BA 1PX6A 1N8JA 2B7JA 2DKIA 4MPFA 2X8HA 1B8XA 2AB6A 1SJZA 4MCUA 3W8JA 4V1Ap 4L5LA 1M99A 1IYHA 3CTFA 4TXOA 1T7PB 3C73A 5D73A 2BTOT 5DJMA 1AQVA 4IQAA 1QXHA 5J4YA 1EEJA 2B7KA 4IW9A 1Q98A 4V2LA 5AIXA 4POLA 1ABAA 3GX0A 2HZEB 4WF5A 3QFBC 2FHEA 4ULXA 2H8LA 4XRAA 1ZL9A 1K3OA 2DJ2A 4MNNA 1MDJA 3ZMKA 4WETA 4TKYA 4QL7A 5CREA 3ZL5A 3BD2A 2H0HA 3CRUA 1YDKA 5A5KA 1ON4A 5HR1A 5BMUA 1S3RA 2YWOA 1T4ZA 4G0KA 3ZFLA 1A23A 2K9FA 3GNJA 5LD0A 5FHIA 3NIVA 2JU5A 4DSRA 1RQMA 2HQTA 1ZYQB 2A2RA 2IL3A 2QA1A 2LQOA 4Z2UA 2YANA 4G2EA 3ZVJA 3FY7A 3TUEA 3RHCA 2JZSA 3ERWA 3CQFA 5CRDA 2PVQA 2E0QA 4XTSA 1AAZA 5ENUA 5F06A 1GSDA 5D9XA 1I1IP 3F4TA 3IR4A 3RPNA 3GTUB 3QAWA 5F8BA 1B9XC 3D4TA 3R3EA 3WGXA 4O7HA 5ECKB 3PINA 1QK8A 1T8EB 2RM6A 4OD7A 4K7OA 2JSZA 1NW2A 5IO0A 1N25A 3ZYWA 4LL4B 4ZB9A 4HZ2A 2CT6A 4HDEA 3Q19A 3LXZA 4K6XA 1AXDA 4GSTA 3IK9A 3C1RA 3ZZXA 3EVIA 2YN1A 2CAQA 4HU7A 1U3AA 1UVZA 4LL1B 5DDLA 2B3SA 3LWAA 5D93A 5A4VA 3PPUA 1EZKA 3LYKA 4LMVA 2P31A 2X64A 1X5CA 2HYXA 3DD3A 5JWOB 3KM6A 2H1AA 1U6TA 5EPFA 1X5DA 1M0UA 2GQKA 4G9HA 3ZRDA 4N10A 2O85A 3K8NA 4WF4A 2WRTA 3IRAA 2VL9A 2VL3A 3KCMA 4OO4A 1FOVA 1TW9A 3GH6A 3IV4A 2IPAA 3ZLPA 1U3IA 2H76A 2I9HA 2MBTA 3DYRA 3F6DA 3CSHA 5DCHA 1OVNA 3A2XA 4XS4A 2R2JA 1FAAA 4HI7A 4XHMA 3L9UA 1XVQA 2LRNA 1BEDA 3L9VA 3EC3A 1M2BA 2YP6A 4PX1A 3VI5A 3CXGA 4ILFA 4KSMA 2GDRA 3HJPA 3EMXA 10GSA 1MEKA 3KIJA 2B5EA 1PA3A 3OR5A 4EL1A 2X4AA 2K8VA 3M9KA 2C8UA 3C7MA 4EKZA 2TRXA 2H1LA 1TJDA 4OFTA 1YEPA 1SKWB 4HZ4A 2OBIA 3ME7A 1SKSB 4MH2A 13GSA 2M46A 4TR4A 1X9WB 4GQFA 1TDIA 4WEYA 2WFCA 3MAKA 1SVMA 3UAPA 1LU4A 4JBBA 1TRUA 3GH9A 1SK2A 3GSTA 1K3LA 5AGYA 4BVXB 2GT6A 2GLRA 1TP9A 2H74A 1XBSA 5IM9A 4O5UA 1ZMAA 5ECMB 2OKAA 2H6XA 1ZYPA 4IGJA 4EE0A 2DJJA 1JZRA 1R5PA 3KP8A 4NHZA 1F6MC 1EEMA 5FT3A 3HHVA 2WVXB 2VCQA 1Q4JA 2CA8A 2L6CA 2WULA 2LRCA 5KOXA 2HE3A 3TGZA 2PBJA 3KH7A 1XXUA 2VD1A 4FQUA 4EDZA 4F9ZA 5DALA 5EY6A 1XPVA 2LS5A 3QMXA 4DSSA 3APQA 4YAPA 1TU7A 2I1UA 4E8HA 3HCZA 3TRXA 4N0ZA 5ELGA 4J56E 3ZIVA 3MNGA 4BPYA 3LJRA 5ECQB 2P0GA 5DBQA 2IJYA 4HUAA 3EPTA 4OMVA 3L9SA 3MYDA 5DALB 1JFUA 3TJFA 1W4VA 3M3MA 2C1YA 2HT9A 2AAWA 4ID0A 3J7Yb 4ECJA 1PFOA 3HVNA 1ZGNA 3TKSE 2HSHA 4FH8A 3TJJA 3UVHA 1YJ6A 3IHQA 2JZTA 5GSSA 1B48A 4MA9A 3P2AA 3ERFA 2EC4A 1F3BA 1BAYA 1EGRA 2FWEA 3VFIA 2VL2C 1S4BP 3WT1A 2VCXA 1X9MB 4RI7A 5DJLA 3FZAA 1DE2A 2ON5A 2XC2A 1GSSA 5GSTA 2I4AA 1OE7A 3WT2A 1A2JA 1YZXA 2NDOA 4AKXB 3H1NA 3VURA 2YWIA 4F2IA 4YQUA 1VRSD 3D5JA 2DJ0A 1VF3A 2IMKA 4EC0A 4EIQA 1RK4A 2HSNB 5A5HA 2WW2A 2NTOA 3KTBA 2DIYA 1XWBA 4HSCX 4NAXA 2GZPA 1VGLA 2OBKA 2RM5A 5DAKA 1GP1A 3VWVA 1ML6A 3FRCA 3EINA 2VL2A 2HSMB 3GX8A 1TXXA 4EVMA 3HD5A 1ZZYA 3GV1A 3GUSA 4HQSA 2C0FA 4G10A 5KEJA 2O87A 5DAKB 4NMUA 1TI3A 3EMPA 4G19A 2QA2A 3HZ4A 4V1Ag 1YF0A 2MMZA 1OKTA 1Z5YE 3DIEA 2K6VA 3L0HA 2WVYA 4PNGA 3ZIJA 2O5VA 2YZHA 1BJXA 4Q5NA 3RDWA 1GUMA 1V57A 4MP4A 4PTSA 3DXBA 5AISA 3KH9A 4MJBA 3ISOA 1B9YC 3FYGA 1V40A 3O3TA 4PXOA 3ZITA 5E59A 3C71A 2O7KA 4KDYA 1TTZA 3FMWA 1PGTA 3TJGA 3EU4A 3H4KA 2HSYA 1JHBA 1SKRB 2I81A 3ME8A 3UVTA 3PGTA 1GLQA 2GQLA 2VM1A 1XW6A 4KUNA 2OADA 1ZYEA 4KF9A 4RQRA 3KP9A 4Q5RA 1EOGA 2VCVA 3O6TA 4D73A 2VUPA 3CYNA 5CO3A 1AIUA 1THOA 1MTCA 5A34B 4BVYB 5B8AA 3IHGA 2LV3A 3DVXA 1FG4A 4ZBBA 4J2FA 1UC7A 3HXSA 2MYGA 2DJKA 2YCDA 11GSA 4IELA 2EIOA 1GNEA 1TOFA 3EWLA 2FWFA 3GURA 3A2VA 1W89A 3H79A 5EL8A 4AI6A 4EUYA 3LFLA 3CMIA 3D21A 1GUHA 4MZWA 2FGXA 1GSEA 4ZBDA 3F8UA 2P5QA 1A2MA 3VK9A 2XHFA 2RLIA 4IN0A 4V2MA 4YH2A 1BF5A 3APOA 2HZEA 2VLUA 1Y6EA 2PERA 3HA9A 4K2DA 2EIRA 4PHZC 4MMMA 1R5AA 2J9HA 1SL1B 2VCTA 3I6AA 3ZTLA 12GSA 5IO2A 1SYRA 1GULA 2DJ1A 4CY8A 2A4VA 5F05A 2A4HA 2V1MA 3UBKA 5KOWA 4X43A 16GSA 1A8YA 1FOHA 3FKFA 3QCPA 2M80A 2RIIA 3SBCA 2I3YA 3TJKA 2LRTA 1PSQA 4LLRA 17GSA 2M72A 3UL3A 4ZIJA 2IMIA 2DIZA 2XPEA 4N30A 3ED3A 1F37A 1A24A 2PU9C 1K0CA 2O89A 1M9BA 5ECHB 4CW9A 2CQ9A 4KGIA 4OFNA 3LSZA 2H0GA 2YWNA 2X99A 3KZQA 1G7EA 1EWXA 3IXRA 3CHXC 4MABA 1QQ2A 4KNDA 5KN1A 4GQCA 4PQHA 2ZNMA 1OC8A 3FR9A 5B7CA 4E68A 3QD9A 2VIMA 3NOFA 3F4RA 3GTUA 2P5RA 1KTEA 4IP1A 1SD8A 3A5WA 4K7IA 3L4NA 1DE1A 2O3EA 5IMVA 1Z3EA 3MWHA 4I2UA 3TKSC 1VF4A 3GRXA 2E2MA 3C1SA 1TKDB 4EF0A 4DSQA 2VLTA 1GRXA 3QFAC 2WCIA 4KCEA 1SL2B 1T3BA 5J9BA 4L0UA 4KW6A 3US3A 2OJLA 1MD3A 3CWGA 1GWCA 4IHUA 3IAM2 4YKGA 2QC7A 1T00A 1PL2A 2EIQA 2LUSA 5CP1A 3N5OA 4HJ2A 3HVVA 1XOAA 2R0CA 4K5RA 3ZREA 3LW9A 5DCGA 3FK8A 4NPBA 5ELAA 2JADA 3A2WA 4GSNA 2VAFA 3IA1A 1YKAA 4Z7XA 3TKSA 1YEWC 3RFRC 4TOPA 4PI2C 3G7JA 2AV4A 4TR3A 3IBHA 2H75A 2NVLA 3ZMLA 3UBLA 3LEFA 1SK0A 1E6BA 1BG5A 4CY6A 3F4SA 3O76A 2F9SA 1K0NA 2GSSA 3QR6A 2LNSA 4X0XA 4K9ZA 4F82A 3DGQA 1VF2A 2EFHA 5D8IA 5CYYA 4IS0A 1J0FA 3LYPA 4Z2RA 3KMNA 2H0IA 2E2GA 4WKWA 4X4JA 1ZCPA 2VLVA 2KLXA 1AC1A 2YNXA 4PI0C 1QMVA 2MBSA 1FVKA 3SWLA 1E2YA 2KUCA 2F3MA 4Z2TA 1WWJA 2IMFA 2HRKB 4TXVA 5IMFA 1PD21 2F51A 1O7UA 2H71A 3LQ7A 3Q74A 2C3TA 4F0CA 1J08A 3A5IA 2CX3A 2GSTA 2WZ9A 2H1DA 5ID2B 3VWWA 2L6DA 4LA1A 5IMAA 2DMLA 1Y25A 1GUKA 1S3CA 5ECRB 1O8XA 1OC9B 2E7PA 4P3YB 4BVXA 4KCAA 1EP8A 3KXOA 3P8WA 2WVZA 4EXJA 1FB6A 2B5YA 1SD9A 3UOMA 1SJIA 4MH3A 5A1NB 4WR4A 4GF0A 3MIXA 3KD0A 4O32A 2WVXA 2L4QA 4I8BA 3FR6A 1PN0A 1WRYA 5ECLB 3TKPA 1F2EA 1PMTA 3GKNA 3LORA 7GSSA 1UA5A 5G5EA 3GMFA 4G0LA 3NZNA 2R0PA 2V6OA 1FO5A 5H5QA 5JWQB 4AJ8A 1FVJA 4KH7A 1GTAA 4ECCA 3FZ4A 2HFDA 3PR8A 3M1GA 4BWSA 4K7NA 5D9VA 4POBA 1AW9A 2VM2A 2H1GA 2YV7A 1TRVA 3DRNA 2GZZA 3D4MA 3GL3A 2C80A 5CRHA 2B6MA 3CRTA 3HJMA 2MMOA 2HRNA 4F03A 4TR0A 4HOJA 3E0UA 5H5SA 4G01A 3F3RA 3VPTA 4ZB6A 1DUGA 20GSA 5J41A 3GYKA 2FNOA 3I9V2 1TK0B 4MJAA 3VLNA 4WXTA 1YY7A 3HY2A 3EURA 1WMJA 2UZ8A 5D96A 2OACA 1K0DA 4EDYA 2CVBA 4FIWA 2FWGA 2WW3A 1GSQA 3CBUA 5J40A 2GTUA 1SU9A 4JZQA 2C4JA 3N9JA 1HYUA 1V58A 4IJIA 1A0FA 1SJ6A 2QGVA 2L57A 2GZYA 4L8EA 5G2ZA 2WJUA 4IQ1A 2FCHA 2IWTA 1TRWA 5G31A 2HSNA 1V98A 3MSZA 2LTKA 2LQQA 2V41A 5A4WA 1M7TA 4NV5A 4NXIA 3UIWA 2HSMA 5ECNB 2R3XA 4KDXA 4PUFC 1BG1A 2J23A 3GFKA 2HI7A 2WZSA 4TN8A 5LNKe 2GSQA 3FW2A 2A2SA 5ECSA 1XZOA 3BOAA 4KAEA 1Z7PA 1SVOA 1BYEA 5HFKA 3RGBC 3GKKA 3L78A 2C0EA 2G0FA 1AQXA 4HJMA 5J3RA 1CQGA 4XS1A 3GIXA 4K1FA 4JRRA 5JWRB 1JZDA 1NHYA 1XFLA 22GSA 3J7Yk 5ECIB 1FW1A 1U87A 3CTGA 4PQIA 3BJ5A 3Q6OA 2B5XA 4PNFA 3WD6A 4FYUA 3M0FA 3F6FA 8GSSA 2B1LA 2ZCTA 2PPTA 1TU8A 2LJAA 5IPHA 3DVWA 1WP0A 4ZILA 4MF6A 4ECBA 1K0OA 3QAGA 9GSSA 3QPMA 3W8SA 3F63A 5FWGA 3TCOA 6GSVA 4ISDA 2XBIA 4JE1A 2KHPA 1DSBA 5CRWA 3I43A 3A3TA 1Z9HA 1PKWA 2UV8G 3IE3A 4DVCA 5COHA 2FA8A 2TIRA 1MDIA 5A34A 4BVYA 1TXUA 3P90A 4JR6A 1R4WA 3APSA 1YQ1A 1OC3A 2FD3A 4JR4A 4KA0A 4USSA 5HFIA 4ZL7A 3QOUA 3GA4A 2WB9A 4MF5A 1GSYA 4QMKA 2R37A 2D2ZA 1KNGA 3TRPA 3TJBA 4RI6A 2CVKA 5G5FA 1S3DA 3U6VA 2IMDA 3IC8A 2PN8A 2VO4A 4ZB7A 2YWMA 5AN1A 1XWGA 4ICYA 3HKRA 3TOTA 2C0GA 5DQSA 2YPMA 4ECIA 2ON7A 4HEA2 3UJ1A 4BA7A 3GKXA 2DMMA 1XWAA 1EGOA 2H30A 6GSTA 1EV9A 2FY6A 4O5RA 1GL8A 3TB2A 3WGEA 3KEBA 4PGTA 3M8NA 5DVBA 2IMEA 2PVOC 1M2DA 3EYTA 1ERVA 3IPZA 1SVLA 4FYCA 1SENA 2QSIA 1F9MA 5GAPD 1K3YA 3HYPA 5HQPA 1N2AA 1SYXA 5E4WA 4GWRA 4Q5FA 4XIHA 1GLPA 1NHOA 5INYA 4BL7B 1T1VA 3E3EA 4G0IA 6GSSA 3GKMA 5C00A 5KN0A 1Z6NA 2YZUA 2CZ3A 2LSTA 3FEUA 1A2LA 1GH2A 5F0GA 1OYJA 4GXZA 4MZBA 1HNBA 4BWQA 2VOCA 5HR3A 4NHWA 2REMA 1PKZA 1M2AA 4MF7A 4AJ6A 3C8EA 4GCIA 1O85A 4KE3A 3FZ5A 19GSA 2L59A 2YV9A 4YQVA 1G6WA 3WGDA 1NSWA 2YOIA 1QUWA 4TXOB 1JLVA 2KOKA 2MZCA 3M9JA 1X9SB 5G30A 4O5QA 4TR1A 1ACVA 4AKIA 2PWJA 4CHSA 2Z9SA 1G0TA 1MD4A 2H72A 4I97A 1A8LA 18GSA 2HLSA 4PUAA 2DKHA 2GVPA 2F8FA 4TR1B 5IPGA 3TDGA 4AGSA 2PGTA 1ZOFA 2LKUA 4ZB8A 4HS1A 2V2GA 5IIZA 6GSXA 5B6NA 4I2TA 2AYTA 1AUCA 4HQZA 2HRAA 5BMUB 1H4OA 2XBQA 2FLSA 3HDCA 2YJHA 4NV2A 4KX4A 5CAXA 2H70A 4NWYA 2FUG2 3QDNA 1FB0A 3IC4A 4KB3A 3RBTA 2VCWA 4I6XA 2G2QA 5B6MA 2N5FA 2C3NA 2AUVA 1TK5B 2VCZA 1NM3A 1GSFA 3TU3B 3RPPA 2B1KA 3RHBA 1K0AA 4FXYP 5ECPB 5JCWA 5EVOA 2BJXA 1XW9A 2X8CA 3VPQA 5G1LA 3HJOA 4IVFA 1WIKA 5HFGA 5B8BA 3R2QA 1I9DA 4ZL9A 3EE2A 1K0MA 3G9BA 1ZYNA 4JEDA 1C72A 2DC5A 4WBRD 4TW5A 3FZ9A 3GN3A 2ES7A 2EFEA 3F3QA 1RW1A 2VKZG 5IOWA 4MK3A 3TKQA 1V2AA 2HRKA 3LG6A 5BRTA 4I5QA 4MLYA 5F07A 5KN2A 4XCSA 4HU9A 2OA7A 2O8VB 4FO5A 1VF1A 2R4VA 2HZFA 5ABRA 4GSSA 3LGCA 2ZUPA 3E9JB 3UEMA 2JSYA 5J4VA 2DJ3A 4ZL8A 5ID2A 1OAZA 2XPDA 5LCZA 4K5SA 3H8QA 2WDUA 2H73A 1EOHA 2NBSA 2TRCP 1PL1A 1OC9A 3VWXA 2PUKC 1JZWA 5CRGA 1YKCA 2NPBA 1V9WA 2HXKA 2GS3A 2R6KA 4JU5A 3AY8A 2K8SA 3D6IA 3IOSA 3S9FA 2AJQB 1GTBA 1X5EA 2PMTA 2DSAA 4AKGA 3H93A 6GSWA 4WBJA 1B4PA 1O8WA 5A1NA 4GRFA 4KSOA 3IDVA 1SK1A 5ECOB 2X8GA 2N5BA 2WW0A 1YVLA 1KEBA 3G7YA 4XS4B 1JZOA 1PX7A 1USBA 3U5RE 1R26A 2H1BA 2GSRA 4POKA 14GSA 4E8EA 2FWHA 4TVEA 4MDCA 1PN9A 1XVWA 2YJ7A 3BCKA 4FYBA 5J4UA 1Z6MA 1XWKA 2IFQA 1URMA 2WGRA 2EFDA 1EV4A 4BIKA 2VD0A 4GTUA 3KJYA
chains in the Genus database with same CATH topology
1J9BA 1FHEA 2OE1A 1LJRA 1Z7RA 2MMAA 2IFQB 5C04A 1PQNA 2L4CA 4MZCA 3KTLA 1F3AA 2HNLA 1CQHA 1ILOA 3TKRA 4MPGA 1ERUA 1I5GA 1XOBA 2AHEA 3BBYA 4OWYA 1QGVA 3PH9A 2DLXA 2GQMA 4N11A 4DEJA 1YEXA 3GSSA 2L5OA 1ERTA 4CDOA 4QQ7A 2OT3A 4PQ1A 4YQMA 5JCUA 2X49A 2N5AA 1JLWA 3HVSA 4WR5A 5DQYA 1AQWA 3QAVA 2OE0A 2F8AA 3IK7A 4POMA 4OO5A 2C3QA 3WYWA 2WS2A 4AJ7A 3P7XA 1GSUA 4RUVA 2LJRA 3D22A 5HR0A 4IP6A 4PURA 3RAZA 1Y1UA 4DSSB 3VI7A 2RUFA 1XWCA 5J5NA 4X1UA 4ZXGA 4MJEA 1S3AA 1TK8B 1GTIA 1OE8A 2DBCA 3ZVJD 1BQ7A 3TOUA 4K8MA 4YAVA 1WJKA 5J47A 2KP2A 4J57E 4V2NA 2IIYA 3LXTA 4TRXA 3KMOA 1PRXA 1TI1A 5JCGA 1BX9A 4ML1A 2V32A 1X0RA 5AIVA 5L71A 1O73A 5HR2A 4LMWA 1K0BA 1ST9A 1R7HA 2GGTA 2HRFA 1WOUA 5G1KA 4EIPA 1ERWA 1O6JA 1G7OA 4QL9A 2R0GA 1T4YA 4L0WA 2KP1A 4RQXA 4IBPA 5IOXA 4IKHA 1HD2A 2IN3A 1A0RP 4H86A 3FHKA 5D9WA 2C0DA 3EU3A 5H5RA 5A4UA 1SL0B 4OCEA 2K18A 2CAIA 6GSYA 3DEXA 3Q18A 2FA4A 5IQYA 2H66A 3F9UA 3UARA 2OE3A 1H75A 2LEGA 5IMZA 4K0GA 5GAND 6GSUA 4OFMA 3GHAA 5D9TA 1HNAA 4W66A 4XRDA 4N0VA 1WPIA 2LJKA 2ALBA 3IAS2 5A5HB 5IMDA 4K2XA 1UN2A 2QKEA 4A5PA 4KDUA 4GDFA 3HMJG 2V6KA 1GNWA 3KGKA 3F0IA 3CSJA 4AKHA 5J9CA 4MJCA 1XW5A 2H01A 2JZRA 3JCML 3DMLA 1IYIA 1LBKA 3FR3A 3D0ZA 1B4QA 5GZZB 2H6ZA 1GTUA 2H19A 2R5GA 4L5OA 3CSIA 1QFNA 2MMNA 1M9AA 2CX4A 1XCCA 1THXA 1XIYA 4N3ZA 3UMAA 5KN3A 2H6YA 1O81A 3V1WA 3MDKA 4O92A 4ML6A 5CNWA 1YF1A 1HNCA 3VWUA 2JL4A 4ACSA 3DWVA 1EP7A 2CV4A 1G6YA 4YKFA 4AF2A 3GL5A 4ZBAA 1OKDA 3I69A 2A2PA 3BCIA 4IJ3A 2BMXA 3TRQA 4K0NA 3W6GA 3DKSA 1HQOA 2CVDA 1DBYA 2RUEA 4Q5QA 3ERGA 2LNTA 4EO3A 2L5LA 3HVXA 1WE0A 4XS6A 2EFCA 3ZFBA 1KBNA 3G7IA 3HZ8A 2GT5A 1TRSA 4BL7A 2JACA 1U88A 4D73B 1MDKA 4GLTA 2CZ2A 4OCFA 5IMCA 4F0BA 1PX6A 1N8JA 2B7JA 2DKIA 4MPFA 2X8HA 1B8XA 2AB6A 1SJZA 4MCUA 3W8JA 4V1Ap 4L5LA 1M99A 1IYHA 3CTFA 4TXOA 1T7PB 3C73A 5D73A 2BTOT 5DJMA 1AQVA 4IQAA 1QXHA 5J4YA 1EEJA 2B7KA 4IW9A 1Q98A 4V2LA 5AIXA 4POLA 1ABAA 3GX0A 2HZEB 4WF5A 3QFBC 2FHEA 4ULXA 2H8LA 4XRAA 1ZL9A 1K3OA 2DJ2A 4MNNA 1MDJA 3ZMKA 4WETA 4TKYA 4QL7A 5CREA 3ZL5A 3BD2A 2H0HA 3CRUA 1YDKA 5A5KA 1ON4A 5HR1A 5BMUA 2YWOA 1T4ZA 4G0KA 3ZFLA 1A23A 2K9FA 3GNJA 5LD0A 5FHIA 3NIVA 2JU5A 4DSRA 1RQMA 2HQTA 1ZYQB 2A2RA 2IL3A 2QA1A 2LQOA 4Z2UA 2YANA 4G2EA 3ZVJA 3FY7A 3TUEA 3RHCA 2JZSA 3ERWA 5CRDA 2PVQA 2E0QA 4XTSA 1AAZA 5ENUA 5F06A 1GSDA 5D9XA 3F4TA 3IR4A 3RPNA 3GTUB 3QAWA 5F8BA 1B9XC 3D4TA 3R3EA 3WGXA 4O7HA 5ECKB 3PINA 1QK8A 1T8EB 2RM6A 4OD7A 4K7OA 2JSZA 1NW2A 5IO0A 1N25A 3ZYWA 4LL4B 4ZB9A 4HZ2A 2CT6A 4HDEA 3Q19A 3LXZA 4K6XA 1AXDA 4GSTA 3IK9A 3C1RA 3ZZXA 3EVIA 2YN1A 2CAQA 4HU7A 1U3AA 1UVZA 4LL1B 5DDLA 2B3SA 3LWAA 5D93A 5A4VA 3PPUA 1EZKA 3LYKA 4LMVA 2P31A 2X64A 1X5CA 2HYXA 3DD3A 5JWOB 3KM6A 2H1AA 1U6TA 5EPFA 1X5DA 1M0UA 2GQKA 4G9HA 3ZRDA 4N10A 2O85A 3K8NA 4WF4A 2WRTA 3IRAA 2VL9A 2VL3A 3KCMA 4OO4A 1FOVA 1TW9A 3GH6A 3IV4A 2IPAA 3ZLPA 1U3IA 2H76A 2I9HA 2MBTA 3DYRA 3F6DA 3CSHA 5DCHA 1OVNA 3A2XA 4XS4A 2R2JA 1FAAA 4HI7A 4XHMA 3L9UA 1XVQA 2LRNA 1BEDA 3L9VA 3EC3A 1M2BA 2YP6A 4PX1A 3VI5A 3CXGA 4ILFA 4KSMA 2GDRA 3HJPA 3EMXA 10GSA 1MEKA 3KIJA 2B5EA 1PA3A 3OR5A 4EL1A 2X4AA 2K8VA 3M9KA 2C8UA 3C7MA 4EKZA 2TRXA 2H1LA 1TJDA 4OFTA 1YEPA 1SKWB 4HZ4A 2OBIA 3ME7A 1SKSB 4MH2A 13GSA 2M46A 4TR4A 1X9WB 4GQFA 1TDIA 4WEYA 2WFCA 3MAKA 1SVMA 3UAPA 1LU4A 4JBBA 1TRUA 3GH9A 1SK2A 3GSTA 1K3LA 5AGYA 4BVXB 2GT6A 2GLRA 1TP9A 2H74A 1XBSA 5IM9A 4O5UA 1ZMAA 5ECMB 2OKAA 2H6XA 1ZYPA 4IGJA 4EE0A 2DJJA 1JZRA 1R5PA 3KP8A 4NHZA 1F6MC 1EEMA 5FT3A 3HHVA 2VCQA 1Q4JA 2CA8A 2L6CA 2WULA 2LRCA 5KOXA 2HE3A 3TGZA 2PBJA 3KH7A 1XXUA 2VD1A 4FQUA 4EDZA 4F9ZA 5DALA 5EY6A 1XPVA 2LS5A 3QMXA 4DSSA 3APQA 4YAPA 1TU7A 2I1UA 4E8HA 3HCZA 3TRXA 4N0ZA 5ELGA 4J56E 3ZIVA 3MNGA 4BPYA 3LJRA 5ECQB 2P0GA 5DBQA 2IJYA 4HUAA 3EPTA 4OMVA 3L9SA 3MYDA 5DALB 1JFUA 3TJFA 1W4VA 3M3MA 2C1YA 2HT9A 2AAWA 4ID0A 3J7Yb 4ECJA 1ZGNA 3TKSE 2HSHA 4FH8A 3TJJA 3UVHA 1YJ6A 3IHQA 2JZTA 5GSSA 1B48A 4MA9A 3P2AA 3ERFA 2EC4A 1F3BA 1BAYA 1EGRA 2FWEA 3VFIA 2VL2C 3WT1A 2VCXA 1X9MB 4RI7A 5DJLA 3FZAA 1DE2A 2ON5A 2XC2A 1GSSA 5GSTA 2I4AA 1OE7A 3WT2A 1A2JA 1YZXA 2NDOA 4AKXB 3H1NA 3VURA 2YWIA 4F2IA 4YQUA 1VRSD 3D5JA 2DJ0A 1VF3A 2IMKA 4EC0A 4EIQA 1RK4A 2HSNB 5A5HA 2NTOA 3KTBA 2DIYA 1XWBA 4NAXA 2GZPA 1VGLA 2OBKA 2RM5A 5DAKA 1GP1A 3VWVA 1ML6A 3FRCA 3EINA 2VL2A 2HSMB 3GX8A 1TXXA 4EVMA 3HD5A 1ZZYA 3GV1A 3GUSA 4HQSA 2C0FA 4G10A 5KEJA 2O87A 5DAKB 4NMUA 1TI3A 3EMPA 4G19A 2QA2A 3HZ4A 4V1Ag 1YF0A 2MMZA 1OKTA 1Z5YE 3DIEA 2K6VA 3L0HA 4PNGA 3ZIJA 2O5VA 2YZHA 1BJXA 4Q5NA 3RDWA 1GUMA 1V57A 4MP4A 4PTSA 3DXBA 5AISA 3KH9A 4MJBA 3ISOA 1B9YC 3FYGA 1V40A 3O3TA 4PXOA 3ZITA 5E59A 3C71A 2O7KA 4KDYA 1TTZA 3FMWA 1PGTA 3TJGA 3EU4A 3H4KA 2HSYA 1JHBA 1SKRB 2I81A 3ME8A 3UVTA 3PGTA 1GLQA 2GQLA 2VM1A 1XW6A 4KUNA 2OADA 1ZYEA 4KF9A 4RQRA 3KP9A 4Q5RA 1EOGA 2VCVA 3O6TA 4D73A 2VUPA 3CYNA 5CO3A 1AIUA 1THOA 1MTCA 5A34B 4BVYB 5B8AA 3IHGA 2LV3A 3DVXA 1FG4A 4ZBBA 4J2FA 1UC7A 3HXSA 2MYGA 2DJKA 2YCDA 11GSA 4IELA 2EIOA 1GNEA 1TOFA 3EWLA 2FWFA 3GURA 3A2VA 1W89A 3H79A 5EL8A 4AI6A 4EUYA 3LFLA 3CMIA 3D21A 1GUHA 4MZWA 2FGXA 1GSEA 4ZBDA 3F8UA 2P5QA 1A2MA 3VK9A 2XHFA 2RLIA 4IN0A 4V2MA 4YH2A 1BF5A 3APOA 2HZEA 2VLUA 1Y6EA 2PERA 3HA9A 4K2DA 2EIRA 4MMMA 1R5AA 2J9HA 1SL1B 2VCTA 3I6AA 3ZTLA 12GSA 5IO2A 1SYRA 1GULA 2DJ1A 4CY8A 2A4VA 5F05A 2A4HA 2V1MA 3UBKA 5KOWA 4X43A 16GSA 1A8YA 1FOHA 3FKFA 3QCPA 2M80A 2RIIA 3SBCA 2I3YA 3TJKA 2LRTA 1PSQA 4LLRA 17GSA 2M72A 3UL3A 4ZIJA 2IMIA 2DIZA 2XPEA 4N30A 3ED3A 1F37A 1A24A 2PU9C 1K0CA 2O89A 1M9BA 5ECHB 4CW9A 2CQ9A 4KGIA 4OFNA 3LSZA 2H0GA 2YWNA 2X99A 3KZQA 1G7EA 1EWXA 3IXRA 4MABA 1QQ2A 4KNDA 5KN1A 4GQCA 4PQHA 2ZNMA 1OC8A 3FR9A 5B7CA 4E68A 3QD9A 2VIMA 3NOFA 3F4RA 3GTUA 2P5RA 1KTEA 4IP1A 1SD8A 3A5WA 4K7IA 3L4NA 1DE1A 5IMVA 1Z3EA 3MWHA 4I2UA 3TKSC 1VF4A 3GRXA 2E2MA 3C1SA 1TKDB 4EF0A 4DSQA 2VLTA 1GRXA 3QFAC 2WCIA 4KCEA 1SL2B 1T3BA 5J9BA 4L0UA 4KW6A 3US3A 2OJLA 1MD3A 3CWGA 1GWCA 4IHUA 3IAM2 4YKGA 2QC7A 1T00A 1PL2A 2EIQA 2LUSA 5CP1A 3N5OA 4HJ2A 3HVVA 1XOAA 2R0CA 4K5RA 3ZREA 3LW9A 5DCGA 3FK8A 4NPBA 5ELAA 2JADA 3A2WA 4GSNA 2VAFA 3IA1A 1YKAA 4Z7XA 3TKSA 4TOPA 3G7JA 2AV4A 4TR3A 3IBHA 2H75A 2NVLA 3ZMLA 3UBLA 3LEFA 1SK0A 1E6BA 1BG5A 4CY6A 3F4SA 3O76A 2F9SA 1K0NA 2GSSA 3QR6A 2LNSA 4X0XA 4K9ZA 4F82A 3DGQA 1VF2A 2EFHA 5D8IA 5CYYA 4IS0A 1J0FA 3LYPA 4Z2RA 3KMNA 2H0IA 2E2GA 4WKWA 4X4JA 1ZCPA 2VLVA 2KLXA 1AC1A 2YNXA 2MBSA 1QMVA 1FVKA 3SWLA 1E2YA 2KUCA 2F3MA 4Z2TA 1WWJA 2IMFA 2HRKB 4TXVA 5IMFA 1PD21 2F51A 1O7UA 2H71A 3LQ7A 3Q74A 2C3TA 4F0CA 1J08A 3A5IA 2CX3A 2GSTA 2WZ9A 2H1DA 5ID2B 3VWWA 2L6DA 4LA1A 5IMAA 2DMLA 1Y25A 1GUKA 1S3CA 5ECRB 1O8XA 1OC9B 2E7PA 4P3YB 4BVXA 4KCAA 1EP8A 3KXOA 3P8WA 4EXJA 1FB6A 2B5YA 1SD9A 3UOMA 1SJIA 4MH3A 5A1NB 4WR4A 4GF0A 3MIXA 3KD0A 4O32A 2L4QA 4I8BA 3FR6A 1PN0A 1WRYA 5ECLB 3TKPA 1F2EA 1PMTA 3GKNA 3LORA 7GSSA 1UA5A 5G5EA 3GMFA 4G0LA 3NZNA 2R0PA 2V6OA 1FO5A 5H5QA 5JWQB 4AJ8A 1FVJA 4KH7A 1GTAA 4ECCA 3FZ4A 2HFDA 3PR8A 3M1GA 4BWSA 4K7NA 5D9VA 4POBA 1AW9A 2VM2A 2H1GA 2YV7A 1TRVA 3DRNA 2GZZA 3D4MA 3GL3A 2C80A 5CRHA 2B6MA 3CRTA 3HJMA 2MMOA 2HRNA 4F03A 4TR0A 4HOJA 3E0UA 5H5SA 4G01A 3F3RA 3VPTA 4ZB6A 1DUGA 20GSA 5J41A 3GYKA 2FNOA 3I9V2 1TK0B 4MJAA 3VLNA 4WXTA 1YY7A 3HY2A 3EURA 1WMJA 2UZ8A 5D96A 2OACA 1K0DA 4EDYA 2CVBA 4FIWA 2FWGA 1GSQA 3CBUA 5J40A 2GTUA 1SU9A 4JZQA 2C4JA 3N9JA 1HYUA 1V58A 4IJIA 1A0FA 1SJ6A 2QGVA 2L57A 2GZYA 4L8EA 5G2ZA 2WJUA 4IQ1A 2FCHA 2IWTA 1TRWA 5G31A 2HSNA 1V98A 3MSZA 2LTKA 2LQQA 2V41A 5A4WA 1M7TA 4NV5A 4NXIA 3UIWA 2HSMA 5ECNB 2R3XA 4KDXA 4PUFC 1BG1A 2J23A 3GFKA 2HI7A 4TN8A 5LNKe 2GSQA 3FW2A 2A2SA 5ECSA 1XZOA 3BOAA 4KAEA 1Z7PA 1SVOA 1BYEA 5HFKA 3GKKA 3L78A 2C0EA 2G0FA 1AQXA 4HJMA 5J3RA 1CQGA 4XS1A 3GIXA 4K1FA 4JRRA 5JWRB 1JZDA 1NHYA 1XFLA 22GSA 3J7Yk 5ECIB 1FW1A 1U87A 3CTGA 4PQIA 3BJ5A 3Q6OA 2B5XA 4PNFA 3WD6A 4FYUA 3M0FA 3F6FA 8GSSA 2B1LA 2ZCTA 2PPTA 1TU8A 2LJAA 5IPHA 3DVWA 1WP0A 4ZILA 4MF6A 4ECBA 1K0OA 3QAGA 9GSSA 3QPMA 3W8SA 3F63A 5FWGA 3TCOA 6GSVA 4ISDA 2XBIA 4JE1A 2KHPA 1DSBA 5CRWA 3I43A 3A3TA 1Z9HA 1PKWA 2UV8G 3IE3A 4DVCA 5COHA 2FA8A 2TIRA 1MDIA 5A34A 4BVYA 1TXUA 3P90A 4JR6A 1R4WA 3APSA 1YQ1A 1OC3A 2FD3A 4JR4A 4KA0A 4USSA 5HFIA 4ZL7A 3QOUA 3GA4A 2WB9A 4MF5A 1GSYA 4QMKA 2R37A 2D2ZA 1KNGA 3TRPA 3TJBA 4RI6A 2CVKA 5G5FA 1S3DA 3U6VA 2IMDA 3IC8A 2PN8A 2VO4A 4ZB7A 2YWMA 5AN1A 1XWGA 4ICYA 3HKRA 3TOTA 2C0GA 5DQSA 2YPMA 4ECIA 2ON7A 4HEA2 3UJ1A 4BA7A 3GKXA 2DMMA 1XWAA 1EGOA 2H30A 6GSTA 1EV9A 2FY6A 4O5RA 1GL8A 3TB2A 3WGEA 3KEBA 4PGTA 3M8NA 5DVBA 2IMEA 2PVOC 1M2DA 3EYTA 1ERVA 3IPZA 1SVLA 4FYCA 1SENA 2QSIA 1F9MA 5GAPD 1K3YA 3HYPA 5HQPA 1N2AA 1SYXA 5E4WA 4GWRA 4Q5FA 4XIHA 1GLPA 1NHOA 5INYA 4BL7B 1T1VA 3E3EA 4G0IA 6GSSA 3GKMA 5C00A 5KN0A 1Z6NA 2YZUA 2CZ3A 2LSTA 3FEUA 1A2LA 1GH2A 5F0GA 1OYJA 4GXZA 4MZBA 1HNBA 4BWQA 2VOCA 5HR3A 4NHWA 2REMA 1PKZA 1M2AA 4MF7A 4AJ6A 3C8EA 4GCIA 1O85A 4KE3A 3FZ5A 19GSA 2L59A 2YV9A 4YQVA 1G6WA 3WGDA 1NSWA 2YOIA 1QUWA 4TXOB 1JLVA 2KOKA 2MZCA 3M9JA 1X9SB 5G30A 4O5QA 4TR1A 1ACVA 4AKIA 2PWJA 4CHSA 2Z9SA 1G0TA 1MD4A 2H72A 4I97A 1A8LA 18GSA 2HLSA 4PUAA 2DKHA 2GVPA 2F8FA 4TR1B 5IPGA 3TDGA 4AGSA 2PGTA 1ZOFA 2LKUA 4ZB8A 4HS1A 2V2GA 5IIZA 6GSXA 5B6NA 4I2TA 2AYTA 1AUCA 4HQZA 2HRAA 5BMUB 1H4OA 2XBQA 2FLSA 3HDCA 2YJHA 4NV2A 4KX4A 5CAXA 2H70A 4NWYA 2FUG2 3QDNA 1FB0A 3IC4A 4KB3A 3RBTA 2VCWA 4I6XA 2G2QA 5B6MA 2N5FA 2C3NA 2AUVA 1TK5B 2VCZA 1NM3A 1GSFA 3TU3B 3RPPA 2B1KA 3RHBA 1K0AA 5ECPB 5JCWA 5EVOA 2BJXA 1XW9A 2X8CA 3VPQA 5G1LA 3HJOA 4IVFA 1WIKA 5HFGA 5B8BA 3R2QA 1I9DA 4ZL9A 3EE2A 1K0MA 3G9BA 1ZYNA 4JEDA 1C72A 2DC5A 4WBRD 4TW5A 3FZ9A 3GN3A 2ES7A 2EFEA 3F3QA 1RW1A 2VKZG 5IOWA 4MK3A 3TKQA 1V2AA 2HRKA 3LG6A 5BRTA 4I5QA 4MLYA 5F07A 5KN2A 4XCSA 4HU9A 2OA7A 2O8VB 4FO5A 1VF1A 2R4VA 2HZFA 5ABRA 4GSSA 3LGCA 2ZUPA 3E9JB 3UEMA 2JSYA 5J4VA 2DJ3A 4ZL8A 5ID2A 1OAZA 2XPDA 5LCZA 4K5SA 3H8QA 2WDUA 2H73A 1EOHA 2NBSA 2TRCP 1PL1A 1OC9A 3VWXA 2PUKC 1JZWA 5CRGA 1YKCA 2NPBA 1V9WA 2HXKA 2GS3A 2R6KA 4JU5A 3AY8A 2K8SA 3D6IA 3IOSA 3S9FA 2AJQB 1GTBA 1X5EA 2PMTA 2DSAA 4AKGA 3H93A 6GSWA 4WBJA 1B4PA 1O8WA 5A1NA 4GRFA 4KSOA 3IDVA 1SK1A 5ECOB 2X8GA 2N5BA 1YVLA 1KEBA 3G7YA 4XS4B 1JZOA 1PX7A 1USBA 3U5RE 1R26A 2H1BA 2GSRA 4POKA 14GSA 4E8EA 2FWHA 4TVEA 4MDCA 1PN9A 1XVWA 2YJ7A 3BCKA 4FYBA 5J4UA 1Z6MA 1XWKA 2IFQA 1URMA 2WGRA 2EFDA 1EV4A 2VD0A 4GTUA 3KJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9B A;  1FHE A;  2OE1 A;  1LJR A;  1Z7R A;  2MMA A;  2IFQ B;  5C04 A;  1PQN A;  2L4C A;  4MZC A;  3KTL A;  1F3A A;  2HNL A;  1CQH A;  1ILO A;  3TKR A;  4MPG A;  1ERU A;  1I5G A;  1XOB A;  2AHE A;  3BBY A;  4OWY A;  1QGV A;  3PH9 A;  2DLX A;  2GQM A;  4N11 A;  4DEJ A;  1YEX A;  3GSS A;  2L5O A;  1ERT A;  4CDO A;  4QQ7 A;  4PQ1 A;  4YQM A;  5JCU A;  2N5A A;  1JLW A;  3HVS A;  4WR5 A;  5DQY A;  1AQW A;  3QAV A;  2OE0 A;  2F8A A;  3IK7 A;  4POM A;  4OO5 A;  2C3Q A;  3WYW A;  2WS2 A;  4AJ7 A;  3P7X A;  1GSU A;  4RUV A;  2LJR A;  3D22 A;  5HR0 A;  4IP6 A;  4PUR A;  3RAZ A;  4DSS B;  3VI7 A;  2RUF A;  1XWC A;  5J5N A;  4X1U A;  4ZXG A;  4MJE A;  1S3A A;  1TK8 B;  1GTI A;  1OE8 A;  2DBC A;  3ZVJ D;  1BQ7 A;  3TOU A;  4K8M A;  4YAV A;  1WJK A;  2KP2 A;  4J57 E;  4V2N A;  2IIY A;  3LXT A;  4TRX A;  3KMO A;  1PRX A;  1TI1 A;  5JCG A;  1BX9 A;  4ML1 A;  2V32 A;  1X0R A;  5AIV A;  5L71 A;  1O73 A;  5HR2 A;  4LMW A;  1K0B A;  1ST9 A;  1R7H A;  2GGT A;  2HRF A;  1WOU A;  5G1K A;  1ERW A;  1O6J A;  1G7O A;  4QL9 A;  1T4Y A;  4L0W A;  2KP1 A;  4RQX A;  4IBP A;  5IOX A;  4IKH A;  1HD2 A;  2IN3 A;  1A0R P;  4H86 A;  3FHK A;  5D9W A;  2C0D A;  3EU3 A;  5H5R A;  5A4U A;  1SL0 B;  4OCE A;  2K18 A;  2CAI A;  6GSY A;  3DEX A;  3Q18 A;  2FA4 A;  5IQY A;  2H66 A;  3F9U A;  3UAR A;  2OE3 A;  1H75 A;  2LEG A;  5IMZ A;  4K0G A;  5GAN D;  6GSU A;  4OFM A;  3GHA A;  5D9T A;  1HNA A;  4XRD A;  4N0V A;  1WPI A;  2LJK A;  2ALB A;  3IAS 2;  5IMD A;  1UN2 A;  2QKE A;  4KDU A;  2V6K A;  1GNW A;  3KGK A;  3F0I A;  3CSJ A;  5J9C A;  4MJC A;  1XW5 A;  2H01 A;  2JZR A;  3JCM L;  3DML A;  1IYI A;  1LBK A;  3FR3 A;  3D0Z A;  1B4Q A;  5GZZ B;  2H6Z A;  1GTU A;  2H19 A;  2R5G A;  4L5O A;  3CSI A;  1QFN A;  2MMN A;  1M9A A;  2CX4 A;  1XCC A;  1THX A;  1XIY A;  3UMA A;  5KN3 A;  2H6Y A;  1O81 A;  3V1W A;  3MDK A;  4O92 A;  4ML6 A;  5CNW A;  1YF1 A;  1HNC A;  3VWU A;  2JL4 A;  4ACS A;  3DWV A;  1EP7 A;  2CV4 A;  1G6Y A;  4AF2 A;  3GL5 A;  4ZBA A;  1OKD A;  3I69 A;  3BCI A;  4IJ3 A;  2BMX A;  3TRQ A;  4K0N A;  3W6G A;  3DKS A;  1HQO A;  2CVD A;  1DBY A;  2RUE A;  4Q5Q A;  3ERG A;  2LNT A;  4EO3 A;  2L5L A;  3HVX A;  1WE0 A;  4XS6 A;  3ZFB A;  1KBN A;  3G7I A;  3HZ8 A;  2GT5 A;  1TRS A;  4BL7 A;  2JAC A;  1U88 A;  4D73 B;  1MDK A;  4GLT A;  2CZ2 A;  4OCF A;  5IMC A;  4F0B A;  1PX6 A;  1N8J A;  2B7J A;  4MPF A;  2X8H A;  1B8X A;  2AB6 A;  1SJZ A;  4MCU A;  3W8J A;  4V1A p;  4L5L A;  1M99 A;  1IYH A;  3CTF A;  4TXO A;  1T7P B;  3C73 A;  5D73 A;  2BTO T;  5DJM A;  1AQV A;  4IQA A;  1QXH A;  1EEJ A;  2B7K A;  4IW9 A;  1Q98 A;  4V2L A;  5AIX A;  4POL A;  1ABA A;  3GX0 A;  2HZE B;  4WF5 A;  3QFB C;  2FHE A;  4ULX A;  2H8L A;  4XRA A;  1ZL9 A;  1K3O A;  2DJ2 A;  1MDJ A;  3ZMK A;  4WET A;  4TKY A;  4QL7 A;  5CRE A;  3ZL5 A;  3BD2 A;  2H0H A;  3CRU A;  1YDK A;  5A5K A;  1ON4 A;  5HR1 A;  5BMU A;  2YWO A;  1T4Z A;  4G0K A;  3ZFL A;  1A23 A;  2K9F A;  3GNJ A;  5LD0 A;  5FHI A;  3NIV A;  2JU5 A;  4DSR A;  1RQM A;  2HQT A;  1ZYQ B;  2A2R A;  2IL3 A;  2LQO A;  2YAN A;  4G2E A;  3ZVJ A;  3FY7 A;  3TUE A;  3RHC A;  2JZS A;  3ERW A;  5CRD A;  2PVQ A;  2E0Q A;  4XTS A;  1AAZ A;  5ENU A;  5F06 A;  1GSD A;  5D9X A;  3F4T A;  3IR4 A;  3RPN A;  3GTU B;  3QAW A;  5F8B A;  1B9X C;  3D4T A;  3R3E A;  3WGX A;  4O7H A;  5ECK B;  3PIN A;  1QK8 A;  1T8E B;  2RM6 A;  4OD7 A;  4K7O A;  2JSZ A;  1NW2 A;  5IO0 A;  3ZYW A;  4LL4 B;  4ZB9 A;  4HZ2 A;  2CT6 A;  4HDE A;  3Q19 A;  3LXZ A;  4K6X A;  1AXD A;  4GST A;  3IK9 A;  3C1R A;  3ZZX A;  3EVI A;  2YN1 A;  2CAQ A;  4HU7 A;  1U3A A;  1UVZ A;  4LL1 B;  5DDL A;  2B3S A;  3LWA A;  5D93 A;  5A4V A;  3PPU A;  1EZK A;  3LYK A;  4LMV A;  2P31 A;  2X64 A;  1X5C A;  2HYX A;  3DD3 A;  5JWO B;  3KM6 A;  2H1A A;  1U6T A;  5EPF A;  1X5D A;  1M0U A;  2GQK A;  4G9H A;  3ZRD A;  4N10 A;  2O85 A;  3K8N A;  4WF4 A;  2WRT A;  3IRA A;  2VL9 A;  2VL3 A;  3KCM A;  4OO4 A;  1FOV A;  1TW9 A;  3GH6 A;  3IV4 A;  2IPA A;  3ZLP A;  1U3I A;  2H76 A;  2I9H A;  2MBT A;  3DYR A;  3F6D A;  3CSH A;  5DCH A;  1OVN A;  3A2X A;  4XS4 A;  2R2J A;  1FAA A;  4HI7 A;  4XHM A;  3L9U A;  1XVQ A;  2LRN A;  1BED A;  3L9V A;  3EC3 A;  1M2B A;  2YP6 A;  4PX1 A;  3VI5 A;  3CXG A;  4ILF A;  4KSM A;  2GDR A;  3HJP A;  3EMX A;  10GS A;  1MEK A;  3KIJ A;  2B5E A;  1PA3 A;  3OR5 A;  4EL1 A;  2K8V A;  3M9K A;  2C8U A;  3C7M A;  4EKZ A;  2TRX A;  1TJD A;  4OFT A;  1YEP A;  1SKW B;  4HZ4 A;  2OBI A;  3ME7 A;  1SKS B;  4MH2 A;  13GS A;  2M46 A;  4TR4 A;  1X9W B;  4GQF A;  1TDI A;  4WEY A;  2WFC A;  3MAK A;  3UAP A;  1LU4 A;  4JBB A;  1TRU A;  3GH9 A;  1SK2 A;  3GST A;  1K3L A;  5AGY A;  4BVX B;  2GT6 A;  2GLR A;  1TP9 A;  2H74 A;  1XBS A;  5IM9 A;  1ZMA A;  5ECM B;  2OKA A;  2H6X A;  4IGJ A;  4EE0 A;  2DJJ A;  1JZR A;  1R5P A;  3KP8 A;  4NHZ A;  1F6M C;  1EEM A;  5FT3 A;  3HHV A;  2VCQ A;  1Q4J A;  2CA8 A;  2L6C A;  2WUL A;  2LRC A;  2HE3 A;  3TGZ A;  2PBJ A;  3KH7 A;  1XXU A;  2VD1 A;  4FQU A;  4EDZ A;  4F9Z A;  5DAL A;  5EY6 A;  1XPV A;  2LS5 A;  3QMX A;  4DSS A;  3APQ A;  4YAP A;  1TU7 A;  2I1U A;  4E8H A;  3HCZ A;  3TRX A;  4N0Z A;  5ELG A;  4J56 E;  3ZIV A;  3MNG A;  4BPY A;  3LJR A;  5ECQ B;  2P0G A;  5DBQ A;  2IJY A;  4HUA A;  3L9S A;  4OMV A;  5DAL B;  1JFU A;  3TJF A;  1W4V A;  3M3M A;  2C1Y A;  2HT9 A;  2AAW A;  4ID0 A;  3J7Y b;  4ECJ A;  1ZGN A;  3TKS E;  2HSH A;  4FH8 A;  3TJJ A;  3UVH A;  1YJ6 A;  3IHQ A;  2JZT A;  5GSS A;  1B48 A;  4MA9 A;  3P2A A;  3ERF A;  2EC4 A;  1F3B A;  1BAY A;  1EGR A;  2FWE A;  3VFI A;  2VL2 C;  3WT1 A;  2VCX A;  1X9M B;  4RI7 A;  5DJL A;  3FZA A;  1DE2 A;  2ON5 A;  2XC2 A;  1GSS A;  5GST A;  2I4A A;  1OE7 A;  3WT2 A;  1A2J A;  1YZX A;  2NDO A;  3H1N A;  3VUR A;  2YWI A;  4F2I A;  4YQU A;  1VRS D;  3D5J A;  2DJ0 A;  1VF3 A;  2IMK A;  4EC0 A;  1RK4 A;  2HSN B;  2NTO A;  3KTB A;  2DIY A;  1XWB A;  4NAX A;  2GZP A;  1VGL A;  2OBK A;  2RM5 A;  5DAK A;  1GP1 A;  3VWV A;  1ML6 A;  3FRC A;  3EIN A;  2VL2 A;  2HSM B;  3GX8 A;  1TXX A;  4EVM A;  3HD5 A;  1ZZY A;  3GV1 A;  3GUS A;  4HQS A;  2C0F A;  4G10 A;  5KEJ A;  2O87 A;  5DAK B;  4NMU A;  1TI3 A;  3EMP A;  4G19 A;  3HZ4 A;  4V1A g;  1YF0 A;  2MMZ A;  1OKT A;  1Z5Y E;  3DIE A;  2K6V A;  3L0H A;  4PNG A;  3ZIJ A;  2YZH A;  1BJX A;  4Q5N A;  3RDW A;  1GUM A;  1V57 A;  4MP4 A;  4PTS A;  3DXB A;  5AIS A;  3KH9 A;  4MJB A;  3ISO A;  1B9Y C;  3FYG A;  1V40 A;  3O3T A;  4PXO A;  3ZIT A;  5E59 A;  3C71 A;  2O7K A;  4KDY A;  1TTZ A;  1PGT A;  3TJG A;  3EU4 A;  3H4K A;  2HSY A;  1JHB A;  1SKR B;  2I81 A;  3ME8 A;  3UVT A;  3PGT A;  1GLQ A;  2GQL A;  2VM1 A;  1XW6 A;  4KUN A;  2OAD A;  1ZYE A;  4KF9 A;  4RQR A;  3KP9 A;  4Q5R A;  1EOG A;  2VCV A;  3O6T A;  4D73 A;  2VUP A;  3CYN A;  5CO3 A;  1AIU A;  1THO A;  1MTC A;  4BVY B;  5B8A A;  2LV3 A;  3DVX A;  1FG4 A;  4ZBB A;  4J2F A;  1UC7 A;  3HXS A;  2MYG A;  2DJK A;  2YCD A;  11GS A;  4IEL A;  2EIO A;  1GNE A;  1TOF A;  3EWL A;  2FWF A;  3GUR A;  3A2V A;  1W89 A;  3H79 A;  5EL8 A;  4EUY A;  3LFL A;  3CMI A;  3D21 A;  1GUH A;  4MZW A;  2FGX A;  1GSE A;  4ZBD A;  3F8U A;  2P5Q A;  1A2M A;  3VK9 A;  2XHF A;  2RLI A;  4IN0 A;  4V2M A;  4YH2 A;  3APO A;  2HZE A;  2VLU A;  1Y6E A;  2PER A;  3HA9 A;  4K2D A;  2EIR A;  4MMM A;  1R5A A;  2J9H A;  1SL1 B;  2VCT A;  3I6A A;  3ZTL A;  12GS A;  5IO2 A;  1SYR A;  1GUL A;  2DJ1 A;  2A4V A;  5F05 A;  2V1M A;  3UBK A;  4X43 A;  16GS A;  1A8Y A;  3FKF A;  3QCP A;  2M80 A;  2RII A;  3SBC A;  2I3Y A;  3TJK A;  2LRT A;  1PSQ A;  4LLR A;  17GS A;  2M72 A;  3UL3 A;  4ZIJ A;  2IMI A;  2DIZ A;  2XPE A;  4N30 A;  3ED3 A;  1F37 A;  1A24 A;  2PU9 C;  1K0C A;  2O89 A;  1M9B A;  5ECH B;  4CW9 A;  2CQ9 A;  4KGI A;  4OFN A;  3LSZ A;  2H0G A;  2YWN A;  2X99 A;  3KZQ A;  1G7E A;  1EWX A;  3IXR A;  4MAB A;  1QQ2 A;  4KND A;  5KN1 A;  4GQC A;  4PQH A;  2ZNM A;  1OC8 A;  3FR9 A;  5B7C A;  3QD9 A;  2VIM A;  3NOF A;  3F4R A;  3GTU A;  2P5R A;  1KTE A;  4IP1 A;  1SD8 A;  3A5W A;  4K7I A;  3L4N A;  1DE1 A;  5IMV A;  1Z3E A;  3MWH A;  4I2U A;  3TKS C;  1VF4 A;  3GRX A;  2E2M A;  3C1S A;  1TKD B;  4EF0 A;  4DSQ A;  2VLT A;  1GRX A;  3QFA C;  2WCI A;  4KCE A;  1SL2 B;  1T3B A;  5J9B A;  4L0U A;  4KW6 A;  3US3 A;  2OJL A;  1MD3 A;  1GWC A;  4IHU A;  3IAM 2;  2QC7 A;  1T00 A;  1PL2 A;  2EIQ A;  2LUS A;  5CP1 A;  3N5O A;  4HJ2 A;  3HVV A;  1XOA A;  3ZRE A;  5DCG A;  3FK8 A;  4NPB A;  5ELA A;  2JAD A;  3A2W A;  4GSN A;  2VAF A;  3IA1 A;  1YKA A;  4Z7X A;  3TKS A;  4TOP A;  3G7J A;  2AV4 A;  4TR3 A;  3IBH A;  2H75 A;  2NVL A;  3ZML A;  3UBL A;  3LEF A;  1SK0 A;  1E6B A;  1BG5 A;  3F4S A;  3O76 A;  2F9S A;  1K0N A;  2GSS A;  3QR6 A;  2LNS A;  4X0X A;  4K9Z A;  4F82 A;  3DGQ A;  1VF2 A;  5D8I A;  5CYY A;  4IS0 A;  1J0F A;  3LYP A;  3KMN A;  2H0I A;  2E2G A;  4WKW A;  1ZCP A;  2VLV A;  2KLX A;  1AC1 A;  2YNX A;  2MBS A;  1QMV A;  1FVK A;  3SWL A;  1E2Y A;  2KUC A;  2F3M A;  1WWJ A;  2IMF A;  2HRK B;  4TXV A;  5IMF A;  1PD2 1;  2F51 A;  1O7U A;  2H71 A;  3LQ7 A;  3Q74 A;  2C3T A;  4F0C A;  1J08 A;  2CX3 A;  2GST A;  2WZ9 A;  2H1D A;  5ID2 B;  3VWW A;  2L6D A;  4LA1 A;  5IMA A;  2DML A;  1Y25 A;  1GUK A;  1S3C A;  5ECR B;  1O8X A;  1OC9 B;  2E7P A;  4P3Y B;  4BVX A;  4KCA A;  1EP8 A;  3KXO A;  3P8W A;  4EXJ A;  1FB6 A;  2B5Y A;  1SD9 A;  3UOM A;  1SJI A;  4MH3 A;  4WR4 A;  4GF0 A;  3KD0 A;  4O32 A;  2L4Q A;  4I8B A;  3FR6 A;  1WRY A;  5ECL B;  3TKP A;  1F2E A;  1PMT A;  3GKN A;  3LOR A;  7GSS A;  1UA5 A;  5G5E A;  3GMF A;  4G0L A;  3NZN A;  2V6O A;  1FO5 A;  5H5Q A;  5JWQ B;  4AJ8 A;  1FVJ A;  4KH7 A;  1GTA A;  4ECC A;  3FZ4 A;  2HFD A;  3PR8 A;  3M1G A;  4BWS A;  4K7N A;  5D9V A;  4POB A;  1AW9 A;  2VM2 A;  2H1G A;  2YV7 A;  1TRV A;  3DRN A;  2GZZ A;  3D4M A;  3GL3 A;  2C80 A;  5CRH A;  2B6M A;  3CRT A;  3HJM A;  2MMO A;  2HRN A;  4F03 A;  4TR0 A;  4HOJ A;  3E0U A;  5H5S A;  3F3R A;  3VPT A;  4ZB6 A;  1DUG A;  20GS A;  5J41 A;  3GYK A;  2FNO A;  3I9V 2;  1TK0 B;  4MJA A;  3VLN A;  4WXT A;  1YY7 A;  3HY2 A;  3EUR A;  1WMJ A;  2UZ8 A;  5D96 A;  2OAC A;  1K0D A;  4EDY A;  2CVB A;  4FIW A;  2FWG A;  1GSQ A;  3CBU A;  2GTU A;  1SU9 A;  4JZQ A;  2C4J A;  3N9J A;  1HYU A;  1V58 A;  4IJI A;  1A0F A;  1SJ6 A;  2QGV A;  2L57 A;  2GZY A;  4L8E A;  5G2Z A;  2WJU A;  4IQ1 A;  2FCH A;  2IWT A;  1TRW A;  5G31 A;  1V98 A;  3MSZ A;  2LTK A;  2LQQ A;  2V41 A;  5A4W A;  1M7T A;  4NV5 A;  4NXI A;  3UIW A;  2HSM A;  5ECN B;  2R3X A;  4KDX A;  4PUF C;  2J23 A;  3GFK A;  2HI7 A;  4TN8 A;  5LNK e;  2GSQ A;  3FW2 A;  2A2S A;  5ECS A;  1XZO A;  3BOA A;  4KAE A;  1Z7P A;  1BYE A;  5HFK A;  3GKK A;  3L78 A;  2C0E A;  2G0F A;  1AQX A;  4HJM A;  5J3R A;  1CQG A;  4XS1 A;  3GIX A;  4K1F A;  4JRR A;  5JWR B;  1JZD A;  1NHY A;  1XFL A;  22GS A;  3J7Y k;  5ECI B;  1FW1 A;  1U87 A;  3CTG A;  4PQI A;  3BJ5 A;  3Q6O A;  2B5X A;  4PNF A;  3WD6 A;  4FYU A;  3M0F A;  3F6F A;  8GSS A;  2B1L A;  2ZCT A;  2PPT A;  1TU8 A;  2LJA A;  5IPH A;  3DVW A;  1WP0 A;  4ZIL A;  4MF6 A;  4ECB A;  1K0O A;  3QAG A;  9GSS A;  3QPM A;  3W8S A;  3F63 A;  5FWG A;  3TCO A;  6GSV A;  4ISD A;  2XBI A;  4JE1 A;  2KHP A;  1DSB A;  5CRW A;  3I43 A;  3A3T A;  1Z9H A;  1PKW A;  3IE3 A;  4DVC A;  5COH A;  2FA8 A;  2TIR A;  1MDI A;  4BVY A;  3P90 A;  4JR6 A;  1R4W A;  3APS A;  1YQ1 A;  1OC3 A;  2FD3 A;  4JR4 A;  4KA0 A;  4USS A;  5HFI A;  4ZL7 A;  3QOU A;  3GA4 A;  2WB9 A;  4MF5 A;  1GSY A;  2R37 A;  2D2Z A;  1KNG A;  3TRP A;  3TJB A;  4RI6 A;  2CVK A;  5G5F A;  1S3D A;  3U6V A;  2IMD A;  3IC8 A;  2PN8 A;  2VO4 A;  2YWM A;  5AN1 A;  1XWG A;  3HKR A;  3TOT A;  2C0G A;  5DQS A;  2YPM A;  4ECI A;  2ON7 A;  4HEA 2;  3UJ1 A;  4BA7 A;  3GKX A;  2DMM A;  1XWA A;  1EGO A;  2H30 A;  6GST A;  1EV9 A;  2FY6 A;  4O5R A;  1GL8 A;  3TB2 A;  3WGE A;  3KEB A;  4PGT A;  3M8N A;  5DVB A;  2IME A;  2PVO C;  1M2D A;  3EYT A;  1ERV A;  3IPZ A;  4FYC A;  1SEN A;  2QSI A;  1F9M A;  5GAP D;  1K3Y A;  3HYP A;  5HQP A;  1N2A A;  1SYX A;  5E4W A;  4GWR A;  4Q5F A;  4XIH A;  1GLP A;  1NHO A;  5INY A;  4BL7 B;  1T1V A;  3E3E A;  4G0I A;  6GSS A;  3GKM A;  5C00 A;  5KN0 A;  1Z6N A;  2YZU A;  2CZ3 A;  2LST A;  3FEU A;  1A2L A;  1GH2 A;  5F0G A;  1OYJ A;  4GXZ A;  4MZB A;  1HNB A;  4BWQ A;  2VOC A;  5HR3 A;  4NHW A;  2REM A;  1PKZ A;  1M2A A;  4MF7 A;  4AJ6 A;  3C8E A;  4GCI A;  1O85 A;  4KE3 A;  3FZ5 A;  19GS A;  2L59 A;  2YV9 A;  4YQV A;  1G6W A;  3WGD A;  1NSW A;  2YOI A;  1QUW A;  4TXO B;  1JLV A;  2KOK A;  2MZC A;  3M9J A;  1X9S B;  5G30 A;  4TR1 A;  1ACV A;  2PWJ A;  4CHS A;  2Z9S A;  1G0T A;  1MD4 A;  2H72 A;  4I97 A;  1A8L A;  18GS A;  2HLS A;  4PUA A;  2GVP A;  2F8F A;  4TR1 B;  5IPG A;  3TDG A;  4AGS A;  2PGT A;  1ZOF A;  2LKU A;  4ZB8 A;  4HS1 A;  2V2G A;  5IIZ A;  6GSX A;  5B6N A;  4I2T A;  2AYT A;  1AUC A;  4HQZ A;  2HRA A;  1H4O A;  2XBQ A;  2FLS A;  3HDC A;  2YJH A;  4NV2 A;  4KX4 A;  5CAX A;  2H70 A;  4NWY A;  2FUG 2;  3QDN A;  1FB0 A;  3IC4 A;  4KB3 A;  3RBT A;  2VCW A;  4I6X A;  2G2Q A;  5B6M A;  2N5F A;  2C3N A;  2AUV A;  1TK5 B;  2VCZ A;  1NM3 A;  1GSF A;  3RPP A;  2B1K A;  3RHB A;  1K0A A;  5ECP B;  5JCW A;  5EVO A;  2BJX A;  1XW9 A;  2X8C A;  3VPQ A;  5G1L A;  3HJO A;  4IVF A;  1WIK A;  5HFG A;  5B8B A;  3R2Q A;  1I9D A;  4ZL9 A;  3EE2 A;  1K0M A;  3G9B A;  4JED A;  1C72 A;  2DC5 A;  4WBR D;  4TW5 A;  3FZ9 A;  3GN3 A;  2ES7 A;  3F3Q A;  1RW1 A;  5IOW A;  4MK3 A;  3TKQ A;  1V2A A;  2HRK A;  3LG6 A;  4I5Q A;  4MLY A;  5F07 A;  5KN2 A;  4XCS A;  4HU9 A;  2OA7 A;  2O8V B;  4FO5 A;  1VF1 A;  2R4V A;  2HZF A;  5ABR A;  4GSS A;  3LGC A;  2ZUP A;  3E9J B;  3UEM A;  2JSY A;  4ZL8 A;  2DJ3 A;  5ID2 A;  1OAZ A;  2XPD A;  5LCZ A;  3H8Q A;  2WDU A;  2H73 A;  1EOH A;  2NBS A;  2TRC P;  1PL1 A;  1OC9 A;  3VWX A;  2PUK C;  1JZW A;  5CRG A;  1YKC A;  2NPB A;  1V9W A;  2HXK A;  2GS3 A;  2R6K A;  4JU5 A;  3AY8 A;  2K8S A;  3D6I A;  3IOS A;  3S9F A;  2AJQ B;  1GTB A;  1X5E A;  2PMT A;  2DSA A;  3H93 A;  6GSW A;  4WBJ A;  1B4P A;  1O8W A;  4GRF A;  4KSO A;  3IDV A;  1SK1 A;  5ECO B;  2X8G A;  2N5B A;  1KEB A;  3G7Y A;  4XS4 B;  1JZO A;  1PX7 A;  1USB A;  3U5R E;  1R26 A;  2H1B A;  2GSR A;  4POK A;  14GS A;  4E8E A;  2FWH A;  4TVE A;  4MDC A;  1PN9 A;  1XVW A;  2YJ7 A;  3BCK A;  4FYB A;  5J4U A;  1Z6M A;  1XWK A;  2IFQ A;  1URM A;  2WGR A;  1EV4 A;  2VD0 A;  4GTU A;  3KJY A; 
#chains in the Genus database with same CATH topology
 1J9B A;  1FHE A;  2OE1 A;  1LJR A;  1Z7R A;  2MMA A;  2IFQ B;  5C04 A;  1PQN A;  2L4C A;  4MZC A;  3KTL A;  1F3A A;  2HNL A;  1CQH A;  1ILO A;  3TKR A;  4MPG A;  1ERU A;  1I5G A;  1XOB A;  2AHE A;  3BBY A;  4OWY A;  1QGV A;  3PH9 A;  2DLX A;  2GQM A;  4N11 A;  4DEJ A;  1YEX A;  3GSS A;  2L5O A;  1ERT A;  4CDO A;  4QQ7 A;  2OT3 A;  4PQ1 A;  4YQM A;  5JCU A;  2X49 A;  2N5A A;  1JLW A;  3HVS A;  4WR5 A;  1M3J A;  5DQY A;  1AQW A;  3QAV A;  2OE0 A;  2F8A A;  3IK7 A;  4POM A;  4OO5 A;  2C3Q A;  3WYW A;  2WS2 A;  4AJ7 A;  3P7X A;  1GSU A;  4RUV A;  2LJR A;  3D22 A;  5HR0 A;  4IP6 A;  4PUR A;  3RAZ A;  1Y1U A;  4DSS B;  3VI7 A;  2RUF A;  1XWC A;  5J5N A;  4X1U A;  4ZXG A;  4MJE A;  1S3A A;  1TK8 B;  1GTI A;  1OE8 A;  2DBC A;  3ZVJ D;  1BQ7 A;  3TOU A;  4K8M A;  4YAV A;  1WJK A;  5J47 A;  2KP2 A;  4J57 E;  4V2N A;  2IIY A;  3LXT A;  4TRX A;  3KMO A;  1PRX A;  1TI1 A;  5JCG A;  1BX9 A;  4ML1 A;  2V32 A;  1X0R A;  5AIV A;  5L71 A;  1O73 A;  5HR2 A;  4LMW A;  1K0B A;  1ST9 A;  1R7H A;  2GGT A;  2HRF A;  1WOU A;  5G1K A;  4EIP A;  1ERW A;  1O6J A;  1G7O A;  4QL9 A;  2R0G A;  1T4Y A;  1M3I A;  4L0W A;  2KP1 A;  4RQX A;  4IBP A;  5IOX A;  4IKH A;  1HD2 A;  2IN3 A;  1A0R P;  4H86 A;  3FHK A;  5D9W A;  2C0D A;  2WW1 A;  3EU3 A;  5H5R A;  5A4U A;  1SL0 B;  4OCE A;  2K18 A;  2CAI A;  6GSY A;  3DEX A;  3Q18 A;  2FA4 A;  5IQY A;  2H66 A;  3F9U A;  3UAR A;  2OE3 A;  1H75 A;  2LEG A;  5IMZ A;  4K0G A;  5GAN D;  6GSU A;  4OFM A;  3GHA A;  5D9T A;  1HNA A;  4W66 A;  4XRD A;  4N0V A;  1WPI A;  2LJK A;  2ALB A;  3IAS 2;  5A5H B;  5IMD A;  4K2X A;  1UN2 A;  2QKE A;  4A5P A;  4KDU A;  4GDF A;  3HMJ G;  2V6K A;  1GNW A;  3KGK A;  3F0I A;  3CSJ A;  4AKH A;  5J9C A;  4MJC A;  1XW5 A;  2H01 A;  2JZR A;  3JCM L;  3DML A;  1IYI A;  1XG8 A;  1LBK A;  3FR3 A;  3D0Z A;  1B4Q A;  5GZZ B;  2H6Z A;  1GTU A;  2H19 A;  2R5G A;  4L5O A;  3CSI A;  1QFN A;  2MMN A;  1M9A A;  2CX4 A;  1XCC A;  1THX A;  1XIY A;  4N3Z A;  3UMA A;  5KN3 A;  2H6Y A;  1O81 A;  3V1W A;  3MDK A;  4O92 A;  4ML6 A;  5CNW A;  1YF1 A;  1HNC A;  3VWU A;  2JL4 A;  4ACS A;  3DWV A;  1EP7 A;  2CV4 A;  1G6Y A;  4YKF A;  4AF2 A;  3GL5 A;  4ZBA A;  1OKD A;  3I69 A;  2O36 A;  2A2P A;  3BCI A;  4IJ3 A;  2BMX A;  3TRQ A;  4K0N A;  3W6G A;  3DKS A;  1HQO A;  2CVD A;  1DBY A;  2RUE A;  4Q5Q A;  3ERG A;  2LNT A;  4EO3 A;  2L5L A;  3HVX A;  1WE0 A;  4XS6 A;  2EFC A;  3ZFB A;  1KBN A;  3G7I A;  3HZ8 A;  2GT5 A;  1TRS A;  4BL7 A;  2JAC A;  1U88 A;  4D73 B;  1MDK A;  4GLT A;  2CZ2 A;  4OCF A;  5IMC A;  4F0B A;  1PX6 A;  1N8J A;  2B7J A;  2DKI A;  4MPF A;  2X8H A;  1B8X A;  2AB6 A;  1SJZ A;  4MCU A;  3W8J A;  4V1A p;  4L5L A;  1M99 A;  1IYH A;  3CTF A;  4TXO A;  1T7P B;  3C73 A;  5D73 A;  2BTO T;  5DJM A;  1AQV A;  4IQA A;  1QXH A;  5J4Y A;  1EEJ A;  2B7K A;  4IW9 A;  1Q98 A;  4V2L A;  5AIX A;  4POL A;  1ABA A;  3GX0 A;  2HZE B;  4WF5 A;  3QFB C;  2FHE A;  4ULX A;  2H8L A;  4XRA A;  1ZL9 A;  1K3O A;  2DJ2 A;  4MNN A;  1MDJ A;  3ZMK A;  4WET A;  4TKY A;  4QL7 A;  5CRE A;  3ZL5 A;  3BD2 A;  2H0H A;  3CRU A;  1YDK A;  5A5K A;  1ON4 A;  5HR1 A;  5BMU A;  1S3R A;  2YWO A;  1T4Z A;  4G0K A;  3ZFL A;  1A23 A;  2K9F A;  3GNJ A;  5LD0 A;  5FHI A;  3NIV A;  2JU5 A;  4DSR A;  1RQM A;  2HQT A;  1ZYQ B;  2A2R A;  2IL3 A;  2QA1 A;  2LQO A;  4Z2U A;  2YAN A;  4G2E A;  3ZVJ A;  3FY7 A;  3TUE A;  3RHC A;  2JZS A;  3ERW A;  3CQF A;  5CRD A;  2PVQ A;  2E0Q A;  4XTS A;  1AAZ A;  5ENU A;  5F06 A;  1GSD A;  5D9X A;  1I1I P;  3F4T A;  3IR4 A;  3RPN A;  3GTU B;  3QAW A;  5F8B A;  1B9X C;  3D4T A;  3R3E A;  3WGX A;  4O7H A;  5ECK B;  3PIN A;  1QK8 A;  1T8E B;  2RM6 A;  4OD7 A;  4K7O A;  2JSZ A;  1NW2 A;  5IO0 A;  1N25 A;  3ZYW A;  4LL4 B;  4ZB9 A;  4HZ2 A;  2CT6 A;  4HDE A;  3Q19 A;  3LXZ A;  4K6X A;  1AXD A;  4GST A;  3IK9 A;  3C1R A;  3ZZX A;  3EVI A;  2YN1 A;  2CAQ A;  4HU7 A;  1U3A A;  1UVZ A;  4LL1 B;  5DDL A;  2B3S A;  3LWA A;  5D93 A;  5A4V A;  3PPU A;  1EZK A;  3LYK A;  4LMV A;  2P31 A;  2X64 A;  1X5C A;  2HYX A;  3DD3 A;  5JWO B;  3KM6 A;  2H1A A;  1U6T A;  5EPF A;  1X5D A;  1M0U A;  2GQK A;  4G9H A;  3ZRD A;  4N10 A;  2O85 A;  3K8N A;  4WF4 A;  2WRT A;  3IRA A;  2VL9 A;  2VL3 A;  3KCM A;  4OO4 A;  1FOV A;  1TW9 A;  3GH6 A;  3IV4 A;  2IPA A;  3ZLP A;  1U3I A;  2H76 A;  2I9H A;  2MBT A;  3DYR A;  3F6D A;  3CSH A;  5DCH A;  1OVN A;  3A2X A;  4XS4 A;  2R2J A;  1FAA A;  4HI7 A;  4XHM A;  3L9U A;  1XVQ A;  2LRN A;  1BED A;  3L9V A;  3EC3 A;  1M2B A;  2YP6 A;  4PX1 A;  3VI5 A;  3CXG A;  4ILF A;  4KSM A;  2GDR A;  3HJP A;  3EMX A;  10GS A;  1MEK A;  3KIJ A;  2B5E A;  1PA3 A;  3OR5 A;  4EL1 A;  2X4A A;  2K8V A;  3M9K A;  2C8U A;  3C7M A;  4EKZ A;  2TRX A;  2H1L A;  1TJD A;  4OFT A;  1YEP A;  1SKW B;  4HZ4 A;  2OBI A;  3ME7 A;  1SKS B;  4MH2 A;  13GS A;  2M46 A;  4TR4 A;  1X9W B;  4GQF A;  1TDI A;  4WEY A;  2WFC A;  3MAK A;  1SVM A;  3UAP A;  1LU4 A;  4JBB A;  1TRU A;  3GH9 A;  1SK2 A;  3GST A;  1K3L A;  5AGY A;  4BVX B;  2GT6 A;  2GLR A;  1TP9 A;  2H74 A;  1XBS A;  5IM9 A;  4O5U A;  1ZMA A;  5ECM B;  2OKA A;  2H6X A;  1ZYP A;  4IGJ A;  4EE0 A;  2DJJ A;  1JZR A;  1R5P A;  3KP8 A;  4NHZ A;  1F6M C;  1EEM A;  5FT3 A;  3HHV A;  2WVX B;  2VCQ A;  1Q4J A;  2CA8 A;  2L6C A;  2WUL A;  2LRC A;  5KOX A;  2HE3 A;  3TGZ A;  2PBJ A;  3KH7 A;  1XXU A;  2VD1 A;  4FQU A;  4EDZ A;  4F9Z A;  5DAL A;  5EY6 A;  1XPV A;  2LS5 A;  3QMX A;  4DSS A;  3APQ A;  4YAP A;  1TU7 A;  2I1U A;  4E8H A;  3HCZ A;  3TRX A;  4N0Z A;  5ELG A;  4J56 E;  3ZIV A;  3MNG A;  4BPY A;  3LJR A;  5ECQ B;  2P0G A;  5DBQ A;  2IJY A;  4HUA A;  3EPT A;  4OMV A;  3L9S A;  3MYD A;  5DAL B;  1JFU A;  3TJF A;  1W4V A;  3M3M A;  2C1Y A;  2HT9 A;  2AAW A;  4ID0 A;  3J7Y b;  4ECJ A;  1PFO A;  3HVN A;  1ZGN A;  3TKS E;  2HSH A;  4FH8 A;  3TJJ A;  3UVH A;  1YJ6 A;  3IHQ A;  2JZT A;  5GSS A;  1B48 A;  4MA9 A;  3P2A A;  3ERF A;  2EC4 A;  1F3B A;  1BAY A;  1EGR A;  2FWE A;  3VFI A;  2VL2 C;  1S4B P;  3WT1 A;  2VCX A;  1X9M B;  4RI7 A;  5DJL A;  3FZA A;  1DE2 A;  2ON5 A;  2XC2 A;  1GSS A;  5GST A;  2I4A A;  1OE7 A;  3WT2 A;  1A2J A;  1YZX A;  2NDO A;  4AKX B;  3H1N A;  3VUR A;  2YWI A;  4F2I A;  4YQU A;  1VRS D;  3D5J A;  2DJ0 A;  1VF3 A;  2IMK A;  4EC0 A;  4EIQ A;  1RK4 A;  2HSN B;  5A5H A;  2WW2 A;  2NTO A;  3KTB A;  2DIY A;  1XWB A;  4HSC X;  4NAX A;  2GZP A;  1VGL A;  2OBK A;  2RM5 A;  5DAK A;  1GP1 A;  3VWV A;  1ML6 A;  3FRC A;  3EIN A;  2VL2 A;  2HSM B;  3GX8 A;  1TXX A;  4EVM A;  3HD5 A;  1ZZY A;  3GV1 A;  3GUS A;  4HQS A;  2C0F A;  4G10 A;  5KEJ A;  2O87 A;  5DAK B;  4NMU A;  1TI3 A;  3EMP A;  4G19 A;  2QA2 A;  3HZ4 A;  4V1A g;  1YF0 A;  2MMZ A;  1OKT A;  1Z5Y E;  3DIE A;  2K6V A;  3L0H A;  2WVY A;  4PNG A;  3ZIJ A;  2O5V A;  2YZH A;  1BJX A;  4Q5N A;  3RDW A;  1GUM A;  1V57 A;  4MP4 A;  4PTS A;  3DXB A;  5AIS A;  3KH9 A;  4MJB A;  3ISO A;  1B9Y C;  3FYG A;  1V40 A;  3O3T A;  4PXO A;  3ZIT A;  5E59 A;  3C71 A;  2O7K A;  4KDY A;  1TTZ A;  3FMW A;  1PGT A;  3TJG A;  3EU4 A;  3H4K A;  2HSY A;  1JHB A;  1SKR B;  2I81 A;  3ME8 A;  3UVT A;  3PGT A;  1GLQ A;  2GQL A;  2VM1 A;  1XW6 A;  4KUN A;  2OAD A;  1ZYE A;  4KF9 A;  4RQR A;  3KP9 A;  4Q5R A;  1EOG A;  2VCV A;  3O6T A;  4D73 A;  2VUP A;  3CYN A;  5CO3 A;  1AIU A;  1THO A;  1MTC A;  5A34 B;  4BVY B;  5B8A A;  3IHG A;  2LV3 A;  3DVX A;  1FG4 A;  4ZBB A;  4J2F A;  1UC7 A;  3HXS A;  2MYG A;  2DJK A;  2YCD A;  11GS A;  4IEL A;  2EIO A;  1GNE A;  1TOF A;  3EWL A;  2FWF A;  3GUR A;  3A2V A;  1W89 A;  3H79 A;  5EL8 A;  4AI6 A;  4EUY A;  3LFL A;  3CMI A;  3D21 A;  1GUH A;  4MZW A;  2FGX A;  1GSE A;  4ZBD A;  3F8U A;  2P5Q A;  1A2M A;  3VK9 A;  2XHF A;  2RLI A;  4IN0 A;  4V2M A;  4YH2 A;  1BF5 A;  3APO A;  2HZE A;  2VLU A;  1Y6E A;  2PER A;  3HA9 A;  4K2D A;  2EIR A;  4PHZ C;  4MMM A;  1R5A A;  2J9H A;  1SL1 B;  2VCT A;  3I6A A;  3ZTL A;  12GS A;  5IO2 A;  1SYR A;  1GUL A;  2DJ1 A;  4CY8 A;  2A4V A;  5F05 A;  2A4H A;  2V1M A;  3UBK A;  5KOW A;  4X43 A;  16GS A;  1A8Y A;  1FOH A;  3FKF A;  3QCP A;  2M80 A;  2RII A;  3SBC A;  2I3Y A;  3TJK A;  2LRT A;  1PSQ A;  4LLR A;  17GS A;  2M72 A;  3UL3 A;  4ZIJ A;  2IMI A;  2DIZ A;  2XPE A;  4N30 A;  3ED3 A;  1F37 A;  1A24 A;  2PU9 C;  1K0C A;  2O89 A;  1M9B A;  5ECH B;  4CW9 A;  2CQ9 A;  4KGI A;  4OFN A;  3LSZ A;  2H0G A;  2YWN A;  2X99 A;  3KZQ A;  1G7E A;  1EWX A;  3IXR A;  3CHX C;  4MAB A;  1QQ2 A;  4KND A;  5KN1 A;  4GQC A;  4PQH A;  2ZNM A;  1OC8 A;  3FR9 A;  5B7C A;  4E68 A;  3QD9 A;  2VIM A;  3NOF A;  3F4R A;  3GTU A;  2P5R A;  1KTE A;  4IP1 A;  1SD8 A;  3A5W A;  4K7I A;  3L4N A;  1DE1 A;  2O3E A;  5IMV A;  1Z3E A;  3MWH A;  4I2U A;  3TKS C;  1VF4 A;  3GRX A;  2E2M A;  3C1S A;  1TKD B;  4EF0 A;  4DSQ A;  2VLT A;  1GRX A;  3QFA C;  2WCI A;  4KCE A;  1SL2 B;  1T3B A;  5J9B A;  4L0U A;  4KW6 A;  3US3 A;  2OJL A;  1MD3 A;  3CWG A;  1GWC A;  4IHU A;  3IAM 2;  4YKG A;  2QC7 A;  1T00 A;  1PL2 A;  2EIQ A;  2LUS A;  5CP1 A;  3N5O A;  4HJ2 A;  3HVV A;  1XOA A;  2R0C A;  4K5R A;  3ZRE A;  3LW9 A;  5DCG A;  3FK8 A;  4NPB A;  5ELA A;  2JAD A;  3A2W A;  4GSN A;  2VAF A;  3IA1 A;  1YKA A;  4Z7X A;  3TKS A;  1YEW C;  3RFR C;  4TOP A;  4PI2 C;  3G7J A;  2AV4 A;  4TR3 A;  3IBH A;  2H75 A;  2NVL A;  3ZML A;  3UBL A;  3LEF A;  1SK0 A;  1E6B A;  1BG5 A;  4CY6 A;  3F4S A;  3O76 A;  2F9S A;  1K0N A;  2GSS A;  3QR6 A;  2LNS A;  4X0X A;  4K9Z A;  4F82 A;  3DGQ A;  1VF2 A;  2EFH A;  5D8I A;  5CYY A;  4IS0 A;  1J0F A;  3LYP A;  4Z2R A;  3KMN A;  2H0I A;  2E2G A;  4WKW A;  4X4J A;  1ZCP A;  2VLV A;  2KLX A;  1AC1 A;  2YNX A;  4PI0 C;  1QMV A;  2MBS A;  1FVK A;  3SWL A;  1E2Y A;  2KUC A;  2F3M A;  4Z2T A;  1WWJ A;  2IMF A;  2HRK B;  4TXV A;  5IMF A;  1PD2 1;  2F51 A;  1O7U A;  2H71 A;  3LQ7 A;  3Q74 A;  2C3T A;  4F0C A;  1J08 A;  3A5I A;  2CX3 A;  2GST A;  2WZ9 A;  2H1D A;  5ID2 B;  3VWW A;  2L6D A;  4LA1 A;  5IMA A;  2DML A;  1Y25 A;  1GUK A;  1S3C A;  5ECR B;  1O8X A;  1OC9 B;  2E7P A;  4P3Y B;  4BVX A;  4KCA A;  1EP8 A;  3KXO A;  3P8W A;  2WVZ A;  4EXJ A;  1FB6 A;  2B5Y A;  1SD9 A;  3UOM A;  1SJI A;  4MH3 A;  5A1N B;  4WR4 A;  4GF0 A;  3MIX A;  3KD0 A;  4O32 A;  2WVX A;  2L4Q A;  4I8B A;  3FR6 A;  1PN0 A;  1WRY A;  5ECL B;  3TKP A;  1F2E A;  1PMT A;  3GKN A;  3LOR A;  7GSS A;  1UA5 A;  5G5E A;  3GMF A;  4G0L A;  3NZN A;  2R0P A;  2V6O A;  1FO5 A;  5H5Q A;  5JWQ B;  4AJ8 A;  1FVJ A;  4KH7 A;  1GTA A;  4ECC A;  3FZ4 A;  2HFD A;  3PR8 A;  3M1G A;  4BWS A;  4K7N A;  5D9V A;  4POB A;  1AW9 A;  2VM2 A;  2H1G A;  2YV7 A;  1TRV A;  3DRN A;  2GZZ A;  3D4M A;  3GL3 A;  2C80 A;  5CRH A;  2B6M A;  3CRT A;  3HJM A;  2MMO A;  2HRN A;  4F03 A;  4TR0 A;  4HOJ A;  3E0U A;  5H5S A;  4G01 A;  3F3R A;  3VPT A;  4ZB6 A;  1DUG A;  20GS A;  5J41 A;  3GYK A;  2FNO A;  3I9V 2;  1TK0 B;  4MJA A;  3VLN A;  4WXT A;  1YY7 A;  3HY2 A;  3EUR A;  1WMJ A;  2UZ8 A;  5D96 A;  2OAC A;  1K0D A;  4EDY A;  2CVB A;  4FIW A;  2FWG A;  2WW3 A;  1GSQ A;  3CBU A;  5J40 A;  2GTU A;  1SU9 A;  4JZQ A;  2C4J A;  3N9J A;  1HYU A;  1V58 A;  4IJI A;  1A0F A;  1SJ6 A;  2QGV A;  2L57 A;  2GZY A;  4L8E A;  5G2Z A;  2WJU A;  4IQ1 A;  2FCH A;  2IWT A;  1TRW A;  5G31 A;  2HSN A;  1V98 A;  3MSZ A;  2LTK A;  2LQQ A;  2V41 A;  5A4W A;  1M7T A;  4NV5 A;  4NXI A;  3UIW A;  2HSM A;  5ECN B;  2R3X A;  4KDX A;  4PUF C;  1BG1 A;  2J23 A;  3GFK A;  2HI7 A;  2WZS A;  4TN8 A;  5LNK e;  2GSQ A;  3FW2 A;  2A2S A;  5ECS A;  1XZO A;  3BOA A;  4KAE A;  1Z7P A;  1SVO A;  1BYE A;  5HFK A;  3RGB C;  3GKK A;  3L78 A;  2C0E A;  2G0F A;  1AQX A;  4HJM A;  5J3R A;  1CQG A;  4XS1 A;  3GIX A;  4K1F A;  4JRR A;  5JWR B;  1JZD A;  1NHY A;  1XFL A;  22GS A;  3J7Y k;  5ECI B;  1FW1 A;  1U87 A;  3CTG A;  4PQI A;  3BJ5 A;  3Q6O A;  2B5X A;  4PNF A;  3WD6 A;  4FYU A;  3M0F A;  3F6F A;  8GSS A;  2B1L A;  2ZCT A;  2PPT A;  1TU8 A;  2LJA A;  5IPH A;  3DVW A;  1WP0 A;  4ZIL A;  4MF6 A;  4ECB A;  1K0O A;  3QAG A;  9GSS A;  3QPM A;  3W8S A;  3F63 A;  5FWG A;  3TCO A;  6GSV A;  4ISD A;  2XBI A;  4JE1 A;  2KHP A;  1DSB A;  5CRW A;  3I43 A;  3A3T A;  1Z9H A;  1PKW A;  2UV8 G;  3IE3 A;  4DVC A;  5COH A;  2FA8 A;  2TIR A;  1MDI A;  5A34 A;  4BVY A;  1TXU A;  3P90 A;  4JR6 A;  1R4W A;  3APS A;  1YQ1 A;  1OC3 A;  2FD3 A;  4JR4 A;  4KA0 A;  4USS A;  5HFI A;  4ZL7 A;  3QOU A;  3GA4 A;  2WB9 A;  4MF5 A;  1GSY A;  4QMK A;  2R37 A;  2D2Z A;  1KNG A;  3TRP A;  3TJB A;  4RI6 A;  2CVK A;  5G5F A;  1S3D A;  3U6V A;  2IMD A;  3IC8 A;  2PN8 A;  2VO4 A;  4ZB7 A;  2YWM A;  5AN1 A;  1XWG A;  4ICY A;  3HKR A;  3TOT A;  2C0G A;  5DQS A;  2YPM A;  4ECI A;  2ON7 A;  4HEA 2;  3UJ1 A;  4BA7 A;  3GKX A;  2DMM A;  1XWA A;  1EGO A;  2H30 A;  6GST A;  1EV9 A;  2FY6 A;  4O5R A;  1GL8 A;  3TB2 A;  3WGE A;  3KEB A;  4PGT A;  3M8N A;  5DVB A;  2IME A;  2PVO C;  1M2D A;  3EYT A;  1ERV A;  3IPZ A;  1SVL A;  4FYC A;  1SEN A;  2QSI A;  1F9M A;  5GAP D;  1K3Y A;  3HYP A;  5HQP A;  1N2A A;  1SYX A;  5E4W A;  4GWR A;  4Q5F A;  4XIH A;  1GLP A;  1NHO A;  5INY A;  4BL7 B;  1T1V A;  3E3E A;  4G0I A;  6GSS A;  3GKM A;  5C00 A;  5KN0 A;  1Z6N A;  2YZU A;  2CZ3 A;  2LST A;  3FEU A;  1A2L A;  1GH2 A;  5F0G A;  1OYJ A;  4GXZ A;  4MZB A;  1HNB A;  4BWQ A;  2VOC A;  5HR3 A;  4NHW A;  2REM A;  1PKZ A;  1M2A A;  4MF7 A;  4AJ6 A;  3C8E A;  4GCI A;  1O85 A;  4KE3 A;  3FZ5 A;  19GS A;  2L59 A;  2YV9 A;  4YQV A;  1G6W A;  3WGD A;  1NSW A;  2YOI A;  1QUW A;  4TXO B;  1JLV A;  2KOK A;  2MZC A;  3M9J A;  1X9S B;  5G30 A;  4O5Q A;  4TR1 A;  1ACV A;  4AKI A;  2PWJ A;  4CHS A;  2Z9S A;  1G0T A;  1MD4 A;  2H72 A;  4I97 A;  1A8L A;  18GS A;  2HLS A;  4PUA A;  2DKH A;  2GVP A;  2F8F A;  4TR1 B;  5IPG A;  3TDG A;  4AGS A;  2PGT A;  1ZOF A;  2LKU A;  4ZB8 A;  4HS1 A;  2V2G A;  5IIZ A;  6GSX A;  5B6N A;  4I2T A;  2AYT A;  1AUC A;  4HQZ A;  2HRA A;  5BMU B;  1H4O A;  2XBQ A;  2FLS A;  3HDC A;  2YJH A;  4NV2 A;  4KX4 A;  5CAX A;  2H70 A;  4NWY A;  2FUG 2;  3QDN A;  1FB0 A;  3IC4 A;  4KB3 A;  3RBT A;  2VCW A;  4I6X A;  2G2Q A;  5B6M A;  2N5F A;  2C3N A;  2AUV A;  1TK5 B;  2VCZ A;  1NM3 A;  1GSF A;  3TU3 B;  3RPP A;  2B1K A;  3RHB A;  1K0A A;  4FXY P;  5ECP B;  5JCW A;  5EVO A;  2BJX A;  1XW9 A;  2X8C A;  3VPQ A;  5G1L A;  3HJO A;  4IVF A;  1WIK A;  5HFG A;  5B8B A;  3R2Q A;  1I9D A;  4ZL9 A;  3EE2 A;  1K0M A;  3G9B A;  1ZYN A;  4JED A;  1C72 A;  2DC5 A;  4WBR D;  4TW5 A;  3FZ9 A;  3GN3 A;  2ES7 A;  2EFE A;  3F3Q A;  1RW1 A;  2VKZ G;  5IOW A;  4MK3 A;  3TKQ A;  1V2A A;  2HRK A;  3LG6 A;  5BRT A;  4I5Q A;  4MLY A;  5F07 A;  5KN2 A;  4XCS A;  4HU9 A;  2OA7 A;  2O8V B;  4FO5 A;  1VF1 A;  2R4V A;  2HZF A;  5ABR A;  4GSS A;  3LGC A;  2ZUP A;  3E9J B;  3UEM A;  2JSY A;  5J4V A;  2DJ3 A;  4ZL8 A;  5ID2 A;  1OAZ A;  2XPD A;  5LCZ A;  4K5S A;  3H8Q A;  2WDU A;  2H73 A;  1EOH A;  2NBS A;  2TRC P;  1PL1 A;  1OC9 A;  3VWX A;  2PUK C;  1JZW A;  5CRG A;  1YKC A;  2NPB A;  1V9W A;  2HXK A;  2GS3 A;  2R6K A;  4JU5 A;  3AY8 A;  2K8S A;  3D6I A;  3IOS A;  3S9F A;  2AJQ B;  1GTB A;  1X5E A;  2PMT A;  2DSA A;  4AKG A;  3H93 A;  6GSW A;  4WBJ A;  1B4P A;  1O8W A;  5A1N A;  4GRF A;  4KSO A;  3IDV A;  1SK1 A;  5ECO B;  2X8G A;  2N5B A;  2WW0 A;  1YVL A;  1KEB A;  3G7Y A;  4XS4 B;  1JZO A;  1PX7 A;  1USB A;  3U5R E;  1R26 A;  2H1B A;  2GSR A;  4POK A;  14GS A;  4E8E A;  2FWH A;  4TVE A;  4MDC A;  1PN9 A;  1XVW A;  2YJ7 A;  3BCK A;  4FYB A;  5J4U A;  1Z6M A;  1XWK A;  2IFQ A;  1URM A;  2WGR A;  2EFD A;  1EV4 A;  4BIK A;  2VD0 A;  4GTU A;  3KJY A; 
#chains in the Genus database with same CATH homology
 1J9B A;  1FHE A;  2OE1 A;  1LJR A;  1Z7R A;  2MMA A;  2IFQ B;  5C04 A;  1PQN A;  2L4C A;  4MZC A;  3KTL A;  1F3A A;  2HNL A;  1CQH A;  1ILO A;  3TKR A;  4MPG A;  1ERU A;  1I5G A;  1XOB A;  2AHE A;  3BBY A;  4OWY A;  1QGV A;  3PH9 A;  2DLX A;  2GQM A;  4N11 A;  4DEJ A;  1YEX A;  3GSS A;  2L5O A;  1ERT A;  4CDO A;  4QQ7 A;  2OT3 A;  4PQ1 A;  4YQM A;  5JCU A;  2X49 A;  2N5A A;  1JLW A;  3HVS A;  4WR5 A;  5DQY A;  1AQW A;  3QAV A;  2OE0 A;  2F8A A;  3IK7 A;  4POM A;  4OO5 A;  2C3Q A;  3WYW A;  2WS2 A;  4AJ7 A;  3P7X A;  1GSU A;  4RUV A;  2LJR A;  3D22 A;  5HR0 A;  4IP6 A;  4PUR A;  3RAZ A;  1Y1U A;  4DSS B;  3VI7 A;  2RUF A;  1XWC A;  5J5N A;  4X1U A;  4ZXG A;  4MJE A;  1S3A A;  1TK8 B;  1GTI A;  1OE8 A;  2DBC A;  3ZVJ D;  1BQ7 A;  3TOU A;  4K8M A;  4YAV A;  1WJK A;  5J47 A;  2KP2 A;  4J57 E;  4V2N A;  2IIY A;  3LXT A;  4TRX A;  3KMO A;  1PRX A;  1TI1 A;  5JCG A;  1BX9 A;  4ML1 A;  2V32 A;  1X0R A;  5AIV A;  5L71 A;  1O73 A;  5HR2 A;  4LMW A;  1K0B A;  1ST9 A;  1R7H A;  2GGT A;  2HRF A;  1WOU A;  5G1K A;  4EIP A;  1ERW A;  1O6J A;  1G7O A;  4QL9 A;  2R0G A;  1T4Y A;  4L0W A;  2KP1 A;  4RQX A;  4IBP A;  5IOX A;  4IKH A;  1HD2 A;  2IN3 A;  1A0R P;  4H86 A;  3FHK A;  5D9W A;  2C0D A;  3EU3 A;  5H5R A;  5A4U A;  1SL0 B;  4OCE A;  2K18 A;  2CAI A;  6GSY A;  3DEX A;  3Q18 A;  2FA4 A;  5IQY A;  2H66 A;  3F9U A;  3UAR A;  2OE3 A;  1H75 A;  2LEG A;  5IMZ A;  4K0G A;  5GAN D;  6GSU A;  4OFM A;  3GHA A;  5D9T A;  1HNA A;  4W66 A;  4XRD A;  4N0V A;  1WPI A;  2LJK A;  2ALB A;  3IAS 2;  5A5H B;  5IMD A;  4K2X A;  1UN2 A;  2QKE A;  4A5P A;  4KDU A;  4GDF A;  3HMJ G;  2V6K A;  1GNW A;  3KGK A;  3F0I A;  3CSJ A;  4AKH A;  5J9C A;  4MJC A;  1XW5 A;  2H01 A;  2JZR A;  3JCM L;  3DML A;  1IYI A;  1LBK A;  3FR3 A;  3D0Z A;  1B4Q A;  5GZZ B;  2H6Z A;  1GTU A;  2H19 A;  2R5G A;  4L5O A;  3CSI A;  1QFN A;  2MMN A;  1M9A A;  2CX4 A;  1XCC A;  1THX A;  1XIY A;  4N3Z A;  3UMA A;  5KN3 A;  2H6Y A;  1O81 A;  3V1W A;  3MDK A;  4O92 A;  4ML6 A;  5CNW A;  1YF1 A;  1HNC A;  3VWU A;  2JL4 A;  4ACS A;  3DWV A;  1EP7 A;  2CV4 A;  1G6Y A;  4YKF A;  4AF2 A;  3GL5 A;  4ZBA A;  1OKD A;  3I69 A;  2A2P A;  3BCI A;  4IJ3 A;  2BMX A;  3TRQ A;  4K0N A;  3W6G A;  3DKS A;  1HQO A;  2CVD A;  1DBY A;  2RUE A;  4Q5Q A;  3ERG A;  2LNT A;  4EO3 A;  2L5L A;  3HVX A;  1WE0 A;  4XS6 A;  2EFC A;  3ZFB A;  1KBN A;  3G7I A;  3HZ8 A;  2GT5 A;  1TRS A;  4BL7 A;  2JAC A;  1U88 A;  4D73 B;  1MDK A;  4GLT A;  2CZ2 A;  4OCF A;  5IMC A;  4F0B A;  1PX6 A;  1N8J A;  2B7J A;  2DKI A;  4MPF A;  2X8H A;  1B8X A;  2AB6 A;  1SJZ A;  4MCU A;  3W8J A;  4V1A p;  4L5L A;  1M99 A;  1IYH A;  3CTF A;  4TXO A;  1T7P B;  3C73 A;  5D73 A;  2BTO T;  5DJM A;  1AQV A;  4IQA A;  1QXH A;  5J4Y A;  1EEJ A;  2B7K A;  4IW9 A;  1Q98 A;  4V2L A;  5AIX A;  4POL A;  1ABA A;  3GX0 A;  2HZE B;  4WF5 A;  3QFB C;  2FHE A;  4ULX A;  2H8L A;  4XRA A;  1ZL9 A;  1K3O A;  2DJ2 A;  4MNN A;  1MDJ A;  3ZMK A;  4WET A;  4TKY A;  4QL7 A;  5CRE A;  3ZL5 A;  3BD2 A;  2H0H A;  3CRU A;  1YDK A;  5A5K A;  1ON4 A;  5HR1 A;  5BMU A;  2YWO A;  1T4Z A;  4G0K A;  3ZFL A;  1A23 A;  2K9F A;  3GNJ A;  5LD0 A;  5FHI A;  3NIV A;  2JU5 A;  4DSR A;  1RQM A;  2HQT A;  1ZYQ B;  2A2R A;  2IL3 A;  2QA1 A;  2LQO A;  4Z2U A;  2YAN A;  4G2E A;  3ZVJ A;  3FY7 A;  3TUE A;  3RHC A;  2JZS A;  3ERW A;  5CRD A;  2PVQ A;  2E0Q A;  4XTS A;  1AAZ A;  5ENU A;  5F06 A;  1GSD A;  5D9X A;  3F4T A;  3IR4 A;  3RPN A;  3GTU B;  3QAW A;  5F8B A;  1B9X C;  3D4T A;  3R3E A;  3WGX A;  4O7H A;  5ECK B;  3PIN A;  1QK8 A;  1T8E B;  2RM6 A;  4OD7 A;  4K7O A;  2JSZ A;  1NW2 A;  5IO0 A;  1N25 A;  3ZYW A;  4LL4 B;  4ZB9 A;  4HZ2 A;  2CT6 A;  4HDE A;  3Q19 A;  3LXZ A;  4K6X A;  1AXD A;  4GST A;  3IK9 A;  3C1R A;  3ZZX A;  3EVI A;  2YN1 A;  2CAQ A;  4HU7 A;  1U3A A;  1UVZ A;  4LL1 B;  5DDL A;  2B3S A;  3LWA A;  5D93 A;  5A4V A;  3PPU A;  1EZK A;  3LYK A;  4LMV A;  2P31 A;  2X64 A;  1X5C A;  2HYX A;  3DD3 A;  5JWO B;  3KM6 A;  2H1A A;  1U6T A;  5EPF A;  1X5D A;  1M0U A;  2GQK A;  4G9H A;  3ZRD A;  4N10 A;  2O85 A;  3K8N A;  4WF4 A;  2WRT A;  3IRA A;  2VL9 A;  2VL3 A;  3KCM A;  4OO4 A;  1FOV A;  1TW9 A;  3GH6 A;  3IV4 A;  2IPA A;  3ZLP A;  1U3I A;  2H76 A;  2I9H A;  2MBT A;  3DYR A;  3F6D A;  3CSH A;  5DCH A;  1OVN A;  3A2X A;  4XS4 A;  2R2J A;  1FAA A;  4HI7 A;  4XHM A;  3L9U A;  1XVQ A;  2LRN A;  1BED A;  3L9V A;  3EC3 A;  1M2B A;  2YP6 A;  4PX1 A;  3VI5 A;  3CXG A;  4ILF A;  4KSM A;  2GDR A;  3HJP A;  3EMX A;  10GS A;  1MEK A;  3KIJ A;  2B5E A;  1PA3 A;  3OR5 A;  4EL1 A;  2X4A A;  2K8V A;  3M9K A;  2C8U A;  3C7M A;  4EKZ A;  2TRX A;  2H1L A;  1TJD A;  4OFT A;  1YEP A;  1SKW B;  4HZ4 A;  2OBI A;  3ME7 A;  1SKS B;  4MH2 A;  13GS A;  2M46 A;  4TR4 A;  1X9W B;  4GQF A;  1TDI A;  4WEY A;  2WFC A;  3MAK A;  1SVM A;  3UAP A;  1LU4 A;  4JBB A;  1TRU A;  3GH9 A;  1SK2 A;  3GST A;  1K3L A;  5AGY A;  4BVX B;  2GT6 A;  2GLR A;  1TP9 A;  2H74 A;  1XBS A;  5IM9 A;  4O5U A;  1ZMA A;  5ECM B;  2OKA A;  2H6X A;  1ZYP A;  4IGJ A;  4EE0 A;  2DJJ A;  1JZR A;  1R5P A;  3KP8 A;  4NHZ A;  1F6M C;  1EEM A;  5FT3 A;  3HHV A;  2VCQ A;  1Q4J A;  2CA8 A;  2L6C A;  2WUL A;  2LRC A;  5KOX A;  2HE3 A;  3TGZ A;  2PBJ A;  3KH7 A;  1XXU A;  2VD1 A;  4FQU A;  4EDZ A;  4F9Z A;  5DAL A;  5EY6 A;  1XPV A;  2LS5 A;  3QMX A;  4DSS A;  3APQ A;  4YAP A;  1TU7 A;  2I1U A;  4E8H A;  3HCZ A;  3TRX A;  4N0Z A;  5ELG A;  4J56 E;  3ZIV A;  3MNG A;  4BPY A;  3LJR A;  5ECQ B;  2P0G A;  5DBQ A;  2IJY A;  4HUA A;  3EPT A;  4OMV A;  3L9S A;  3MYD A;  5DAL B;  1JFU A;  3TJF A;  1W4V A;  3M3M A;  2C1Y A;  2HT9 A;  2AAW A;  4ID0 A;  3J7Y b;  4ECJ A;  1ZGN A;  3TKS E;  2HSH A;  4FH8 A;  3TJJ A;  3UVH A;  1YJ6 A;  3IHQ A;  2JZT A;  5GSS A;  1B48 A;  4MA9 A;  3P2A A;  3ERF A;  2EC4 A;  1F3B A;  1BAY A;  1EGR A;  2FWE A;  3VFI A;  2VL2 C;  3WT1 A;  2VCX A;  1X9M B;  4RI7 A;  5DJL A;  3FZA A;  1DE2 A;  2ON5 A;  2XC2 A;  1GSS A;  5GST A;  2I4A A;  1OE7 A;  3WT2 A;  1A2J A;  1YZX A;  2NDO A;  4AKX B;  3H1N A;  3VUR A;  2YWI A;  4F2I A;  4YQU A;  1VRS D;  3D5J A;  2DJ0 A;  1VF3 A;  2IMK A;  4EC0 A;  4EIQ A;  1RK4 A;  2HSN B;  5A5H A;  2NTO A;  3KTB A;  2DIY A;  1XWB A;  4NAX A;  2GZP A;  1VGL A;  2OBK A;  2RM5 A;  5DAK A;  1GP1 A;  3VWV A;  1ML6 A;  3FRC A;  3EIN A;  2VL2 A;  2HSM B;  3GX8 A;  1TXX A;  4EVM A;  3HD5 A;  1ZZY A;  3GV1 A;  3GUS A;  4HQS A;  2C0F A;  4G10 A;  5KEJ A;  2O87 A;  5DAK B;  4NMU A;  1TI3 A;  3EMP A;  4G19 A;  2QA2 A;  3HZ4 A;  4V1A g;  1YF0 A;  2MMZ A;  1OKT A;  1Z5Y E;  3DIE A;  2K6V A;  3L0H A;  4PNG A;  3ZIJ A;  2O5V A;  2YZH A;  1BJX A;  4Q5N A;  3RDW A;  1GUM A;  1V57 A;  4MP4 A;  4PTS A;  3DXB A;  5AIS A;  3KH9 A;  4MJB A;  3ISO A;  1B9Y C;  3FYG A;  1V40 A;  3O3T A;  4PXO A;  3ZIT A;  5E59 A;  3C71 A;  2O7K A;  4KDY A;  1TTZ A;  3FMW A;  1PGT A;  3TJG A;  3EU4 A;  3H4K A;  2HSY A;  1JHB A;  1SKR B;  2I81 A;  3ME8 A;  3UVT A;  3PGT A;  1GLQ A;  2GQL A;  2VM1 A;  1XW6 A;  4KUN A;  2OAD A;  1ZYE A;  4KF9 A;  4RQR A;  3KP9 A;  4Q5R A;  1EOG A;  2VCV A;  3O6T A;  4D73 A;  2VUP A;  3CYN A;  5CO3 A;  1AIU A;  1THO A;  1MTC A;  5A34 B;  4BVY B;  5B8A A;  3IHG A;  2LV3 A;  3DVX A;  1FG4 A;  4ZBB A;  4J2F A;  1UC7 A;  3HXS A;  2MYG A;  2DJK A;  2YCD A;  11GS A;  4IEL A;  2EIO A;  1GNE A;  1TOF A;  3EWL A;  2FWF A;  3GUR A;  3A2V A;  1W89 A;  3H79 A;  5EL8 A;  4AI6 A;  4EUY A;  3LFL A;  3CMI A;  3D21 A;  1GUH A;  4MZW A;  2FGX A;  1GSE A;  4ZBD A;  3F8U A;  2P5Q A;  1A2M A;  3VK9 A;  2XHF A;  2RLI A;  4IN0 A;  4V2M A;  4YH2 A;  1BF5 A;  3APO A;  2HZE A;  2VLU A;  1Y6E A;  2PER A;  3HA9 A;  4K2D A;  2EIR A;  4MMM A;  1R5A A;  2J9H A;  1SL1 B;  2VCT A;  3I6A A;  3ZTL A;  12GS A;  5IO2 A;  1SYR A;  1GUL A;  2DJ1 A;  4CY8 A;  2A4V A;  5F05 A;  2A4H A;  2V1M A;  3UBK A;  5KOW A;  4X43 A;  16GS A;  1A8Y A;  1FOH A;  3FKF A;  3QCP A;  2M80 A;  2RII A;  3SBC A;  2I3Y A;  3TJK A;  2LRT A;  1PSQ A;  4LLR A;  17GS A;  2M72 A;  3UL3 A;  4ZIJ A;  2IMI A;  2DIZ A;  2XPE A;  4N30 A;  3ED3 A;  1F37 A;  1A24 A;  2PU9 C;  1K0C A;  2O89 A;  1M9B A;  5ECH B;  4CW9 A;  2CQ9 A;  4KGI A;  4OFN A;  3LSZ A;  2H0G A;  2YWN A;  2X99 A;  3KZQ A;  1G7E A;  1EWX A;  3IXR A;  4MAB A;  1QQ2 A;  4KND A;  5KN1 A;  4GQC A;  4PQH A;  2ZNM A;  1OC8 A;  3FR9 A;  5B7C A;  4E68 A;  3QD9 A;  2VIM A;  3NOF A;  3F4R A;  3GTU A;  2P5R A;  1KTE A;  4IP1 A;  1SD8 A;  3A5W A;  4K7I A;  3L4N A;  1DE1 A;  5IMV A;  1Z3E A;  3MWH A;  4I2U A;  3TKS C;  1VF4 A;  3GRX A;  2E2M A;  3C1S A;  1TKD B;  4EF0 A;  4DSQ A;  2VLT A;  1GRX A;  3QFA C;  2WCI A;  4KCE A;  1SL2 B;  1T3B A;  5J9B A;  4L0U A;  4KW6 A;  3US3 A;  2OJL A;  1MD3 A;  3CWG A;  1GWC A;  4IHU A;  3IAM 2;  4YKG A;  2QC7 A;  1T00 A;  1PL2 A;  2EIQ A;  2LUS A;  5CP1 A;  3N5O A;  4HJ2 A;  3HVV A;  1XOA A;  2R0C A;  4K5R A;  3ZRE A;  3LW9 A;  5DCG A;  3FK8 A;  4NPB A;  5ELA A;  2JAD A;  3A2W A;  4GSN A;  2VAF A;  3IA1 A;  1YKA A;  4Z7X A;  3TKS A;  4TOP A;  3G7J A;  2AV4 A;  4TR3 A;  3IBH A;  2H75 A;  2NVL A;  3ZML A;  3UBL A;  3LEF A;  1SK0 A;  1E6B A;  1BG5 A;  4CY6 A;  3F4S A;  3O76 A;  2F9S A;  1K0N A;  2GSS A;  3QR6 A;  2LNS A;  4X0X A;  4K9Z A;  4F82 A;  3DGQ A;  1VF2 A;  2EFH A;  5D8I A;  5CYY A;  4IS0 A;  1J0F A;  3LYP A;  4Z2R A;  3KMN A;  2H0I A;  2E2G A;  4WKW A;  4X4J A;  1ZCP A;  2VLV A;  2KLX A;  1AC1 A;  2YNX A;  2MBS A;  1QMV A;  1FVK A;  3SWL A;  1E2Y A;  2KUC A;  2F3M A;  4Z2T A;  1WWJ A;  2IMF A;  2HRK B;  4TXV A;  5IMF A;  1PD2 1;  2F51 A;  1O7U A;  2H71 A;  3LQ7 A;  3Q74 A;  2C3T A;  4F0C A;  1J08 A;  3A5I A;  2CX3 A;  2GST A;  2WZ9 A;  2H1D A;  5ID2 B;  3VWW A;  2L6D A;  4LA1 A;  5IMA A;  2DML A;  1Y25 A;  1GUK A;  1S3C A;  5ECR B;  1O8X A;  1OC9 B;  2E7P A;  4P3Y B;  4BVX A;  4KCA A;  1EP8 A;  3KXO A;  3P8W A;  4EXJ A;  1FB6 A;  2B5Y A;  1SD9 A;  3UOM A;  1SJI A;  4MH3 A;  5A1N B;  4WR4 A;  4GF0 A;  3MIX A;  3KD0 A;  4O32 A;  2L4Q A;  4I8B A;  3FR6 A;  1PN0 A;  1WRY A;  5ECL B;  3TKP A;  1F2E A;  1PMT A;  3GKN A;  3LOR A;  7GSS A;  1UA5 A;  5G5E A;  3GMF A;  4G0L A;  3NZN A;  2R0P A;  2V6O A;  1FO5 A;  5H5Q A;  5JWQ B;  4AJ8 A;  1FVJ A;  4KH7 A;  1GTA A;  4ECC A;  3FZ4 A;  2HFD A;  3PR8 A;  3M1G A;  4BWS A;  4K7N A;  5D9V A;  4POB A;  1AW9 A;  2VM2 A;  2H1G A;  2YV7 A;  1TRV A;  3DRN A;  2GZZ A;  3D4M A;  3GL3 A;  2C80 A;  5CRH A;  2B6M A;  3CRT A;  3HJM A;  2MMO A;  2HRN A;  4F03 A;  4TR0 A;  4HOJ A;  3E0U A;  5H5S A;  4G01 A;  3F3R A;  3VPT A;  4ZB6 A;  1DUG A;  20GS A;  5J41 A;  3GYK A;  2FNO A;  3I9V 2;  1TK0 B;  4MJA A;  3VLN A;  4WXT A;  1YY7 A;  3HY2 A;  3EUR A;  1WMJ A;  2UZ8 A;  5D96 A;  2OAC A;  1K0D A;  4EDY A;  2CVB A;  4FIW A;  2FWG A;  1GSQ A;  3CBU A;  5J40 A;  2GTU A;  1SU9 A;  4JZQ A;  2C4J A;  3N9J A;  1HYU A;  1V58 A;  4IJI A;  1A0F A;  1SJ6 A;  2QGV A;  2L57 A;  2GZY A;  4L8E A;  5G2Z A;  2WJU A;  4IQ1 A;  2FCH A;  2IWT A;  1TRW A;  5G31 A;  2HSN A;  1V98 A;  3MSZ A;  2LTK A;  2LQQ A;  2V41 A;  5A4W A;  1M7T A;  4NV5 A;  4NXI A;  3UIW A;  2HSM A;  5ECN B;  2R3X A;  4KDX A;  4PUF C;  1BG1 A;  2J23 A;  3GFK A;  2HI7 A;  4TN8 A;  5LNK e;  2GSQ A;  3FW2 A;  2A2S A;  5ECS A;  1XZO A;  3BOA A;  4KAE A;  1Z7P A;  1SVO A;  1BYE A;  5HFK A;  3GKK A;  3L78 A;  2C0E A;  2G0F A;  1AQX A;  4HJM A;  5J3R A;  1CQG A;  4XS1 A;  3GIX A;  4K1F A;  4JRR A;  5JWR B;  1JZD A;  1NHY A;  1XFL A;  22GS A;  3J7Y k;  5ECI B;  1FW1 A;  1U87 A;  3CTG A;  4PQI A;  3BJ5 A;  3Q6O A;  2B5X A;  4PNF A;  3WD6 A;  4FYU A;  3M0F A;  3F6F A;  8GSS A;  2B1L A;  2ZCT A;  2PPT A;  1TU8 A;  2LJA A;  5IPH A;  3DVW A;  1WP0 A;  4ZIL A;  4MF6 A;  4ECB A;  1K0O A;  3QAG A;  9GSS A;  3QPM A;  3W8S A;  3F63 A;  5FWG A;  3TCO A;  6GSV A;  4ISD A;  2XBI A;  4JE1 A;  2KHP A;  1DSB A;  5CRW A;  3I43 A;  3A3T A;  1Z9H A;  1PKW A;  2UV8 G;  3IE3 A;  4DVC A;  5COH A;  2FA8 A;  2TIR A;  1MDI A;  5A34 A;  4BVY A;  1TXU A;  3P90 A;  4JR6 A;  1R4W A;  3APS A;  1YQ1 A;  1OC3 A;  2FD3 A;  4JR4 A;  4KA0 A;  4USS A;  5HFI A;  4ZL7 A;  3QOU A;  3GA4 A;  2WB9 A;  4MF5 A;  1GSY A;  4QMK A;  2R37 A;  2D2Z A;  1KNG A;  3TRP A;  3TJB A;  4RI6 A;  2CVK A;  5G5F A;  1S3D A;  3U6V A;  2IMD A;  3IC8 A;  2PN8 A;  2VO4 A;  4ZB7 A;  2YWM A;  5AN1 A;  1XWG A;  4ICY A;  3HKR A;  3TOT A;  2C0G A;  5DQS A;  2YPM A;  4ECI A;  2ON7 A;  4HEA 2;  3UJ1 A;  4BA7 A;  3GKX A;  2DMM A;  1XWA A;  1EGO A;  2H30 A;  6GST A;  1EV9 A;  2FY6 A;  4O5R A;  1GL8 A;  3TB2 A;  3WGE A;  3KEB A;  4PGT A;  3M8N A;  5DVB A;  2IME A;  2PVO C;  1M2D A;  3EYT A;  1ERV A;  3IPZ A;  1SVL A;  4FYC A;  1SEN A;  2QSI A;  1F9M A;  5GAP D;  1K3Y A;  3HYP A;  5HQP A;  1N2A A;  1SYX A;  5E4W A;  4GWR A;  4Q5F A;  4XIH A;  1GLP A;  1NHO A;  5INY A;  4BL7 B;  1T1V A;  3E3E A;  4G0I A;  6GSS A;  3GKM A;  5C00 A;  5KN0 A;  1Z6N A;  2YZU A;  2CZ3 A;  2LST A;  3FEU A;  1A2L A;  1GH2 A;  5F0G A;  1OYJ A;  4GXZ A;  4MZB A;  1HNB A;  4BWQ A;  2VOC A;  5HR3 A;  4NHW A;  2REM A;  1PKZ A;  1M2A A;  4MF7 A;  4AJ6 A;  3C8E A;  4GCI A;  1O85 A;  4KE3 A;  3FZ5 A;  19GS A;  2L59 A;  2YV9 A;  4YQV A;  1G6W A;  3WGD A;  1NSW A;  2YOI A;  1QUW A;  4TXO B;  1JLV A;  2KOK A;  2MZC A;  3M9J A;  1X9S B;  5G30 A;  4O5Q A;  4TR1 A;  1ACV A;  4AKI A;  2PWJ A;  4CHS A;  2Z9S A;  1G0T A;  1MD4 A;  2H72 A;  4I97 A;  1A8L A;  18GS A;  2HLS A;  4PUA A;  2DKH A;  2GVP A;  2F8F A;  4TR1 B;  5IPG A;  3TDG A;  4AGS A;  2PGT A;  1ZOF A;  2LKU A;  4ZB8 A;  4HS1 A;  2V2G A;  5IIZ A;  6GSX A;  5B6N A;  4I2T A;  2AYT A;  1AUC A;  4HQZ A;  2HRA A;  5BMU B;  1H4O A;  2XBQ A;  2FLS A;  3HDC A;  2YJH A;  4NV2 A;  4KX4 A;  5CAX A;  2H70 A;  4NWY A;  2FUG 2;  3QDN A;  1FB0 A;  3IC4 A;  4KB3 A;  3RBT A;  2VCW A;  4I6X A;  2G2Q A;  5B6M A;  2N5F A;  2C3N A;  2AUV A;  1TK5 B;  2VCZ A;  1NM3 A;  1GSF A;  3TU3 B;  3RPP A;  2B1K A;  3RHB A;  1K0A A;  5ECP B;  5JCW A;  5EVO A;  2BJX A;  1XW9 A;  2X8C A;  3VPQ A;  5G1L A;  3HJO A;  4IVF A;  1WIK A;  5HFG A;  5B8B A;  3R2Q A;  1I9D A;  4ZL9 A;  3EE2 A;  1K0M A;  3G9B A;  1ZYN A;  4JED A;  1C72 A;  2DC5 A;  4WBR D;  4TW5 A;  3FZ9 A;  3GN3 A;  2ES7 A;  2EFE A;  3F3Q A;  1RW1 A;  2VKZ G;  5IOW A;  4MK3 A;  3TKQ A;  1V2A A;  2HRK A;  3LG6 A;  5BRT A;  4I5Q A;  4MLY A;  5F07 A;  5KN2 A;  4XCS A;  4HU9 A;  2OA7 A;  2O8V B;  4FO5 A;  1VF1 A;  2R4V A;  2HZF A;  5ABR A;  4GSS A;  3LGC A;  2ZUP A;  3E9J B;  3UEM A;  2JSY A;  5J4V A;  2DJ3 A;  4ZL8 A;  5ID2 A;  1OAZ A;  2XPD A;  5LCZ A;  4K5S A;  3H8Q A;  2WDU A;  2H73 A;  1EOH A;  2NBS A;  2TRC P;  1PL1 A;  1OC9 A;  3VWX A;  2PUK C;  1JZW A;  5CRG A;  1YKC A;  2NPB A;  1V9W A;  2HXK A;  2GS3 A;  2R6K A;  4JU5 A;  3AY8 A;  2K8S A;  3D6I A;  3IOS A;  3S9F A;  2AJQ B;  1GTB A;  1X5E A;  2PMT A;  2DSA A;  4AKG A;  3H93 A;  6GSW A;  4WBJ A;  1B4P A;  1O8W A;  5A1N A;  4GRF A;  4KSO A;  3IDV A;  1SK1 A;  5ECO B;  2X8G A;  2N5B A;  1YVL A;  1KEB A;  3G7Y A;  4XS4 B;  1JZO A;  1PX7 A;  1USB A;  3U5R E;  1R26 A;  2H1B A;  2GSR A;  4POK A;  14GS A;  4E8E A;  2FWH A;  4TVE A;  4MDC A;  1PN9 A;  1XVW A;  2YJ7 A;  3BCK A;  4FYB A;  5J4U A;  1Z6M A;  1XWK A;  2IFQ A;  1URM A;  2WGR A;  2EFD A;  1EV4 A;  2VD0 A;  4GTU A;  3KJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...