1G7OA

Nmr solution structure of reduced e. coli glutaredoxin 2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUTAREDOXIN 2
publication title Solution structure of Escherichia coli glutaredoxin-2 shows similarity to mammalian glutathione-S-transferases.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1g7oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g7oA01
3DVWA 3ZVJD 5IPGA 4ZILA 4ML1A 4TOPA 2YV7A 2XC2A 3UEMA 1JZOA 5CRWA 2CZ3A 1OYJA 3N5OA 5IOWA 3I43A 1N2AA 2GT6A 3W8SA 1USBA 1T8EB 1CQGA 2OACA 1IYHA 1UN2A 4NV2A 4AGSA 3UIWA 1TP9A 1QQ2A 1ZGNA 4Z7XA 3PINA 4FYBA 3GV1A 5F07A 1QFNA 1VF4A 3FYGA 2H71A 1PL1A 4KF9A 3JCML 4MF6A 1WRYA 1Z7RA 3RDWA 4F82A 1GSQA 1WPIA 3FHKA 2VLUA 2CZ2A 1U3IA 3LXZA 4MPGA 4HJ2A 2V2GA 2C0DA 4BWSA 3QD9A 4MABA 4QL7A 4KNDA 3ZL5A 1PMTA 2I3YA 5G1KA 3KIJA 1T4ZA 2VM1A 3CTFA 4PNGA 2LV3A 2GSRA 3LGCA 4TKYA 1O7UA 4POKA 3L78A 1GWCA 3IK7A 2R2JA 3GH9A 5D8IA 4K0GA 4KX4A 1Z3EA 1HYUA 5H5RA 3ZFBA 3A2XA 1YKCA 4OO4A 3MWHA 2VD1A 4KE3A 2IFQB 4GTUA 4IQAA 3WT1A 1M7TA 1X5DA 4ZB8A 1GP1A 1J0FA 5J3RA 3HKRA 4N10A 2YWOA 4ML6A 1GLQA 1JFUA 5B6MA 4MZWA 2B1LA 2DSAA 2HSHA 3ZREA 4NHWA 2GS3A 3QCPA 1GRXA 4MZCA 2VL2C 4NXIA 1PD21 4ECCA 4LMVA 4EF0A 1Q98A 1U87A 3LYKA 2O85A 4POLA 3HY2A 1YDKA 4NAXA 3BCIA 3DYRA 3C8EA 1G7EA 1O85A 3V1WA 5ID2B 4YAVA 4ZIJA 4XCSA 2H1DA 2H0IA 3KMNA 2XPDA 2GT5A 2XBIA 4KDYA 2MBTA 4KW6A 4HEA2 3ME8A 2WCIA 3BOAA 2Z9SA 5IM9A 1SK1A 4FYCA 1NM3A 4ILFA 1ZYEA 2HSYA 1TJDA 4O5RA 4DSQA 1WMJA 1K0AA 4MMMA 4QQ7A 4E8EA 1TRUA 4G9HA 1XVQA 1TTZA 3H8QA 1XW9A 3GSSA 1PN9A 2UZ8A 4YQMA 1I9DA 3KGKA 2PMTA 1O6JA 1KNGA 2H1BA 3RAZA 4GQCA 2ZNMA 4XS4B 3UVHA 1GSFA 1A8YA 1OE8A 3ZMKA 1SENA 2OBIA 1ZYQB 4NHZA 1GNEA 4KUNA 3BD2A 1EP7A 3TGZA 3KXOA 2V41A 1RK4A 5KEJA 18GSA 1K0OA 3VI5A 4E8HA 2K8VA 5DAKB 1XVWA 2E0QA 4MZBA 5JWRB 1GSYA 4KCAA 1G6WA 3CXGA 3VWVA 2K18A 4P3YB 1ZOFA 3ZFLA 4JR4A 1YZXA 2DJKA 1A2LA 2LEGA 4JZQA 2L5LA 3IDVA 4BVYB 5B7CA 3ED3A 4J56E 2OA7A 1EWXA 6GSWA 1HNAA 2C80A 1THOA 2P0GA 3NZNA 2GZZA 1FB6A 1OC9B 2NPBA 3EVIA 2HSMB 5F8BA 4JEDA 2F8FA 2H66A 3HXSA 2B6MA 5ELGA 5A4WA 4BA7A 1DUGA 4K7OA 3ZITA 3FY7A 3QR6A 1Y25A 4OFMA 4IP1A 1YEXA 2C1YA 3HJMA 3TB2A 3M9JA 2KP1A 4GRFA 4O92A 3GUSA 1JHBA 2F9SA 3D6IA 4WBJA 4K9ZA 5C00A 2L57A 3ERGA 2HFDA 3C7MA 2LRCA 4OD7A 1HNCA 13GSA 5AIVA 5ECPB 5ELAA 2XPEA 2PWJA 5D9TA 2N5FA 5AGYA 1QMVA 2YWIA 4HDEA 3TKSE 2DJ0A 6GSTA 2GQKA 1GSUA 5ECNB 3GTUA 1AIUA 5DVBA 4V2NA 4YQUA 2MYGA 1UC7A 5IMVA 3F0IA 3GSTA 4F03A 2JL4A 2VM2A 5DALA 4WR4A 3IAS2 4ID0A 4TN8A 1XCCA 1M9BA 1XFLA 3A2VA 2PU9C 1CQHA 1HD2A 1BYEA 1SKWB 3TDGA 2JSYA 3R2QA 1PX6A 3EMXA 2YJHA 4JU5A 4GWRA 1DE2A 2WRTA 4K8MA 2L59A 3TJBA 4HQSA 3RBTA 4OO5A 2MMOA 2OE0A 3LFLA 3F3RA 4LLRA 2H01A 2LJAA 4ZBBA 1EOHA 3HYPA 1SJ6A 2C3TA 1DSBA 5ABRA 1GTAA 4WBRD 4I6XA 4CDOA 3CYNA 1K3YA 4IJIA 3RHCA 2DC5A 2H75A 3GIXA 2PBJA 2GZYA 5IMZA 5HR0A 2GZPA 1EZKA 3ZTLA 1XWCA 5C04A 4K1FA 2IN3A 3MSZA 2CAIA 1PL2A 3VI7A 3VWXA 2FCHA 1K0DA 3L9VA 1H4OA 3A3TA 4PQHA 3GKKA 4ACSA 1YQ1A 1T1VA 2YJ7A 4HU9A 4AJ7A 2VO4A 4L5LA 1B4QA 2KUCA 2F3MA 2I1UA 5B6NA 4G0IA 3D4MA 4TR3A 4K7IA 5DQYA 5JWOB 2TRCP 4PUAA 4RQXA 1AXDA 4ECBA 2ZCTA 3DRNA 1BEDA 5KN3A 4K2DA 4G19A 3QMXA 1X5CA 1WWJA 3F8UA 4MCUA 4D73B 2OBKA 1FAAA 1Z5YE 2C0GA 1E6BA 3ISOA 1KTEA 4N0VA 5J41A 2LNSA 4KSMA 4L0WA 1JZWA 4WEYA 3HHVA 2B5XA 1TU8A 2KLXA 4ECIA 2V6OA 2OADA 2V32A 2IWTA 2A2RA 3HVSA 2YWMA 2BTOT 1Z7PA 3F63A 1A0FA 3GNJA 1XW6A 4MJEA 4WF5A 4G0KA 3F4RA 2H6XA 3TUEA 3WGXA 1XPVA 2VCXA 1GSSA 3KTLA 2QGVA 3DIEA 4CW9A 5E59A 4DEJA 2NTOA 1O81A 4JRRA 1JLWA 5CREA 2H8LA 2LNTA 2E7PA 4MJCA 1R26A 3BBYA 1FOVA 4I5QA 1GUHA 2AHEA 5ECMB 4HZ4A 1PKWA 2R3XA 3EURA 1V58A 4MJAA 4KSOA 5CYYA 5EY6A 2LTKA 4L8EA 4ZBAA 3L9UA 4MPFA 2YZHA 3UVTA 3IR4A 5JCWA 2C3NA 1SJIA 3GKMA 5KN1A 3GN3A 3QAWA 2ES7A 1XBSA 4HQZA 1XWKA 2HRKA 1DBYA 7GSSA 1SL0B 5DCHA 1NHYA 3Q18A 2A2SA 5GAND 1QK8A 2C0FA 2YZUA 4I97A 2YWNA 3E9JB 5GZZB 5AN1A 3CBUA 4EKZA 1JZRA 1GTBA 3CSJA 3EWLA 4BWQA 2H73A 3QOUA 1PX7A 1OE7A 1SJZA 3GRXA 2NBSA 4PQIA 1QXHA 4MK3A 3NIVA 3PH9A 2HZFA 3N9JA 1GSDA 1F9MA 3APQA 2C8UA 2V6KA 1WJKA 3GH6A 4EUYA 2L5OA 2VLTA 1S3CA 1BQ7A 4V2LA 4IGJA 1XOBA 1T00A 2WB9A 1SYRA 5J9BA 2FLSA 3US3A 2AJQB 4Q5FA 4IN0A 5G2ZA 1AQVA 3CMIA 3SBCA 1GUKA 1ACVA 2GDRA 3GTUB 1M0UA 4X43A 9GSSA 3F4SA 4OCFA 1B4PA 3D0ZA 3RPPA 2JZTA 2YV9A 3LSZA 5DALB 4POBA 1E2YA 2C3QA 2H74A 3C1SA 2HI7A 3TRQA 4EXJA 3MAKA 5KN2A 1OVNA 4NMUA 3VFIA 1GLPA 2LKUA 1SK2A 2H6YA 2WJUA 2OE1A 2AAWA 3IHQA 5IMDA 2N5AA 3H93A 4G10A 4D73A 2L6CA 1THXA 2IMKA 4TVEA 2H0HA 3DEXA 3F9UA 3LORA 5E4WA 3Q74A 2HNLA 3DVXA 2CA8A 2WDUA 1TKDB 4ULXA 4MLYA 1RW1A 3O6TA 5D9XA 3A2WA 2M72A 4XRDA 1N8JA 1F37A 2EC4A 4LL4B 5J9CA 2DMMA 4WKWA 3ZYWA 3OR5A 2REMA 2RM5A 1T3BA 2ON5A 2VCTA 2J23A 1X5EA 5D93A 4TXOB 2M80A 1GNWA 5AIXA 4J57E 2BMXA 2F8AA 2ALBA 4TR4A 2X8GA 3LXTA 4FIWA 1AQXA 1EEJA 4H86A 2KP2A 3F4TA 2GSTA 2GLRA 1WE0A 2VAFA 3EYTA 3IPZA 4K0NA 3HVVA 2CX3A 5CAXA 3TKRA 3GX0A 2FA4A 2O89A 2OJLA 1V2AA 1PKZA 3VLNA 4KB3A 1XWGA 1EOGA 3HDCA 3WYWA 3VWUA 3MDKA 1ILOA 1GUMA 2LRNA 4QL9A 4IS0A 5LCZA 3LWAA 1M99A 2PPTA 1AUCA 1SK0A 3R3EA 3EMPA 2JACA 2AYTA 1V9WA 4KDXA 3PPUA 2MMAA 4O7HA 1ERUA 3FZ4A 2RIIA 1J08A 5L71A 1WIKA 2L4QA 3VURA 2J9HA 1X0RA 3LQ7A 1ERVA 2P5QA 5CRDA 1XZOA 3IBHA 1V98A 4HOJA 6GSYA 2ON7A 2E2MA 2XHFA 1M9AA 1ZL9A 2FWGA 2B1KA 5JCGA 1MD4A 3GKNA 2R5GA 5B8BA 3HCZA 1TK5B 3EINA 1A23A 3FZ9A 4IKHA 1H75A 4OWYA 5DJLA 4FH8A 1NW2A 2H6ZA 2JZRA 1PSQA 3IAM2 5ECSA 22GSA 3VPQA 2FHEA 4DVCA 2I9HA 1F2EA 4DSSA 2NVLA 2FUG2 5LD0A 1G6YA 5ECOB 4MDCA 5BMUA 2AB6A 4YH2A 3ZMLA 1ZCPA 3FRCA 3LEFA 1SKSB 4I8BA 3ZLPA 3KMOA 3IC4A 3GHAA 3TKQA 2HQTA 2HRKB 4Q5NA 1S3AA 4Q5RA 2QKEA 2YANA 1V57A 1A8LA 2CVKA 1YY7A 3P8WA 5HFKA 3ME7A 3D22A 5CRGA 4GSTA 1F6MC 2X8HA 2GQLA 2CVDA 3M1GA 4PQ1A 1SU9A 2FNOA 1R5AA 1VF3A 5ECRB 2NDOA 3W6GA 5FHIA 2PGTA 1C72A 2TIRA 5COHA 4EE0A 2GTUA 1BX9A 3O76A 3KJYA 3P2AA 5ECIB 3LJRA 3EU3A 1TW9A 2FY6A 1K0MA 4F2IA 4IQ1A 3C73A 1HNBA 1PQNA 3TKSA 4KGIA 2C0EA 1K0BA 1OC3A 3VK9A 2YOIA 1A2MA 2DLXA 4LL1B 2R4VA 4KCEA 5A5KA 3HJOA 3WT2A 4XTSA 5IPHA 1K3LA 1Y6EA 2YP6A 3I6AA 3H4KA 2TRXA 2JSZA 2R6KA 4MJBA 2VCQA 5ECQB 2JU5A 4TXOA 3APOA 1PRXA 3IC8A 1EGOA 3LYPA 3G7IA 4J2FA 1ML6A 4CHSA 2MMNA 5D9WA 1B9YC 3ERWA 1AQWA 1MTCA 1R7HA 1Q4JA 3CRUA 2RLIA 3UAPA 2GGTA 4OFTA 2EIOA 4K6XA 1Z6NA 3DWVA 5G30A 5EL8A 3APSA 5G5FA 3DKSA 4V2MA 4O32A 1OAZA 1U3AA 1VF2A 3ZIVA 1J9BA 5JWQB 5DCGA 2YNXA 4ZBDA 2O8VB 2FD3A 3EC3A 5CRHA 4AJ8A 1M2DA 3Q19A 4NWYA 4ZL8A 2H0GA 2JZSA 3FZ5A 3I69A 1NSWA 16GSA 2PERA 1AC1A 2FA8A 2KOKA 3TOUA 1AAZA 2BJXA 3IOSA 1LU4A 4RI6A 3WD6A 4KH7A 3O3TA 3QDNA 4PXOA 3ZRDA 3WGDA 4ZL9A 1HQOA 4X1UA 1ST9A 4PTSA 3U6VA 3GL5A 2K9FA 3KD0A 1EGRA 1R5PA 4XS6A 3TOTA 1GSEA 3VPTA 3NOFA 4BL7A 1YF0A 4YQVA 4K7NA 19GSA 1DE1A 3FZAA 1XWBA 1VRSD 2CQ9A 1A24A 2ZUPA 4IHUA 3GA4A 3KZQA 4TW5A 3W8JA 5F05A 3UOMA 3ZVJA 1UA5A 1TRSA 3QFAC 2HE3A 2CV4A 5G5EA 2B5YA 2WFCA 5G1LA 2C4JA 20GSA 3HVXA 4F9ZA 2FGXA 2QSIA 3M9KA 4IJ3A 6GSSA 3FR3A 1VGLA 5GAPD 1TK8B 2MBSA 4MF7A 4ZB6A 3UJ1A 2HLSA 1MDJA 4PX1A 2DIYA 2OE3A 1PA3A 4XRAA 3IK9A 2DJ2A 4F0CA 3MNGA 1XXUA 5KN0A 4POMA 3S9FA 4MA9A 2CT6A 2DJ3A 1IYIA 3RHBA 3D4TA 3TKPA 5HR3A 2VIMA 5HFGA 3KM6A 4EL1A 4MF5A 2QC7A 1B9XC 3FK8A 2VD0A 5IO0A 3TRXA 1KBNA 5DJMA 2DBCA 2L6DA 3KH7A 1XOAA 5LNKe 4RI7A 1T4YA 5A4UA 2HT9A 5ECHB 1SKRB 2B7JA 4JE1A 11GSA 3FR6A 5FWGA 2MZCA 2D2ZA 5J4UA 2H1AA 5B8AA 3GYKA 1TRWA 2FWEA 4PGTA 3J7Yk 5ECLB 2H19A 4G2EA 3HJPA 1A2JA 3FEUA 4DSSB 1B48A 1ERWA 5F0GA 4G0LA 4X0XA 5F06A 3HD5A 8GSSA 5CO3A 5J5NA 2CAQA 1MD3A 2PVOC 3EU4A 4L0UA 3TJGA 4LA1A 1A0RP 1WOUA 3GL3A 2I81A 2EIRA 2IMEA 4GXZA 4AF2A 3FW2A 4TR0A 3G7YA 2X64A 3GMFA 2GVPA 1TI1A 6GSXA 5HQPA 1SD9A 1R4WA 1XIYA 2HZEA 1F3AA 2HXKA 2M46A 1WP0A 1MDIA 1F3BA 17GSA 4RUVA 1QUWA 1TK0B 2IMIA 1G0TA 1GH2A 4FQUA 3IRAA 1O8XA 1ZMAA 4HJMA 4L5OA 2WZ9A 3IV4A 4HUAA 1Z9HA 1JZDA 2FWFA 5DDLA 3J7Yb 2IMFA 2LSTA 3HZ8A 4BPYA 3Q6OA 1LJRA 2P31A 3KTBA 5ENUA 2HRAA 4MP4A 1PGTA 3G9BA 3KCMA 4IP6A 10GSA 1M2AA 2GSSA 4KAEA 2H30A 3KP9A 3TKSC 3DMLA 5EVOA 1EV4A 3A5WA 2RM6A 2FWHA 4V1Ag 3TJKA 2LRTA 3D5JA 12GSA 4HZ2A 4TXVA 5D96A 2DJ1A 2XBQA 4PURA 4NPBA 5D73A 2K6VA 14GSA 3GKXA 3KEBA 3UARA 3L0HA 4HI7A 3F3QA 3UMAA 4EDZA 5IOXA 2G0FA 3DGQA 3TCOA 1FVJA 4TR1B 4DSRA 3L9SA 3U5RE 3M8NA 1SD8A 2B5EA 2VLVA 3GURA 4YAPA 1BAYA 1G7OA 3IXRA 2R37A 2H76A 4EC0A 2B3SA 2I4AA 1OKTA 1O73A 1AW9A 5IMCA 3C71A 2IJYA 1K0NA 2LJRA 3DD3A 1FW1A 4FO5A 5H5SA 1SL1B 4GF0A 2X8CA 1GL8A 2HYXA 2N5BA 5JCUA 3AY8A 3HZ4A 2WGRA 2RUEA 3QAVA 4IBPA 2LUSA 2MMZA 3F6FA 1TRVA 4Q5QA 2H1GA 1EV9A 4OCEA 3TJFA 4NV5A 4MH3A 1ERTA 3DXBA 5H5QA 1GTUA 5IQYA 1YJ6A 1S3DA 1FB0A 4BL7B 3VWWA 1FO5A 1FVKA 4WXTA 1JLVA 1RQMA 4IVFA 2GSQA 4XIHA 4GLTA 4TRXA 5EPFA 3SWLA 2P5RA 5CP1A 1I5GA 3I9V2 2HSNB 5DBQA 1URMA 2YN1A 4AJ6A 5IO2A 2VL9A 1BJXA 2DMLA 3PGTA 4BVXB 1YKAA 4EVMA 2IFQA 2DIZA 4ZXGA 3D21A 3IA1A 3L4NA 2GQMA 4ZL7A 1X9MB 1YF1A 2VL2A 4JBBA 3WGEA 3LG6A 4GQFA 4GSSA 3H79A 2O7KA 1YEPA 1Z6MA 3EE2A 2EIQA 1KEBA 2LJKA 3E0UA 5FT3A 3KH9A 1SL2B 3BJ5A 2O87A 1M2BA 2A4VA 2V1MA 5IMAA 1OC8A 1BG5A 1W4VA 3TRPA 3C1RA 1XWAA 2X99A 5ID2A 1UVZA 5A4VA 1EEMA 3CTGA 3CSHA 3GX8A 4XHMA 4N0ZA 4USSA 4ECJA 1T7PB 1K0CA 4HS1A 2L4CA 2G2QA 4IELA 2WS2A 1OKDA 4EO3A 1NHOA 2DJJA 1O8WA 1K3OA 2AUVA 5D9VA 3IE3A 2KHPA 1TOFA 5IMFA 2F51A 1ZZYA 3P90A 2VOCA 3FR9A 2HRNA 6GSUA 3M0FA 2K8SA 4PNFA 2B7KA 5ECKB 4JR6A 1W89A 3HA9A 1FG4A 4KDUA 4WR5A 5HR1A 1TDIA 5GSTA 4MH2A 2CX4A 3M3MA 2LQOA 2H70A 1U88A 3ZZXA 2IMDA 4XS4A 1V40A 2RUFA 4OFNA 2VUPA 3QPMA 3G7JA 3BCKA 1LBKA 4IW9A 2JADA 4TR1A 3UL3A 1GTIA 4XS1A 1TXXA 2HZEB 3K8NA 1B8XA 4V1Ap 6GSVA 1QGVA 2IL3A 2VL3A 2VCVA 3ZIJA 1ON4A 4WF4A 5DAKA 2OKAA 5IIZA 2YCDA 4N30A 4N11A 5GSSA 2LS5A 1XW5A 1U6TA 3UBKA 3FKFA 3CSIA 2PVQA 1TI3A 2E2GA 2IPAA 1GULA 1VF1A 1MEKA 5DQSA 4GSNA 2PN8A 5G31A 1X9SB 5INYA 2VCWA 4WETA 3GFKA 4BVYA 3CRTA 5CNWA 1TU7A 3F6DA 3H1NA 1MDKA 3QAGA 5HR2A 4RQRA 2WULA 1X9WB 4LMWA 2IIYA 3RPNA 3TJJA 3QFBC 1OC9A 4HU7A 2CVBA 3E3EA 3UBLA 2LQQA 2HRFA 2YPMA 4GCIA 2HSMA 3PR8A 4FYUA 3KP8A 4ZB9A 4PUFC 4F0BA 4I2TA 1ABAA 4EDYA 1EP8A 5AISA 4I2UA 2VCZA 2PUKC 1FHEA 4ISDA 5HFIA 4OMVA 3ERFA 4BVXA 3P7XA 4KA0A 2H72A 2AV4A 1SYXA
chains in the Genus database with same CATH superfamily
3DVWA 3ZVJD 5IPGA 4ZILA 4ML1A 4TOPA 2YV7A 2EFEA 2XC2A 3UEMA 1JZOA 5CRWA 2CZ3A 1OYJA 3N5OA 5IOWA 3I43A 4EIQA 1N2AA 2GT6A 3W8SA 1USBA 1T8EB 1CQGA 2OACA 1IYHA 1UN2A 4NV2A 4AGSA 3UIWA 1TP9A 1QQ2A 1ZGNA 4Z7XA 3PINA 4FYBA 3GV1A 5F07A 1QFNA 1VF4A 3FYGA 2H71A 4CY8A 1PL1A 4KF9A 3JCML 4MF6A 1WRYA 2QA1A 1Z7RA 3RDWA 5J4VA 4F82A 1GSQA 1WPIA 3FHKA 2VLUA 2CZ2A 1U3IA 3LXZA 4MPGA 4HJ2A 2V2GA 5A5HB 2C0DA 4BWSA 3QD9A 4MABA 4QL7A 3EPTA 4KNDA 3ZL5A 1PMTA 4AKHA 2I3YA 5G1KA 3KIJA 1T4ZA 2VM1A 3CTFA 4PNGA 2LV3A 2GSRA 3LGCA 4TKYA 1O7UA 4POKA 3L78A 1GWCA 3IK7A 2R2JA 3GH9A 5D8IA 4K0GA 4KX4A 1Z3EA 1HYUA 5H5RA 3ZFBA 3A2XA 1YKCA 4OO4A 3MWHA 2VD1A 4KE3A 2IFQB 4GTUA 4IQAA 3WT1A 1M7TA 1X5DA 4ZB8A 4HSCX 1GP1A 1J0FA 5J3RA 3HKRA 4N10A 2YWOA 4ML6A 1GLQA 1JFUA 5B6MA 4MZWA 2B1LA 2DSAA 2HSHA 3ZREA 4NHWA 2GS3A 3QCPA 1GRXA 4MZCA 2VL2C 4NXIA 1PD21 4ECCA 4LMVA 4EF0A 1Q98A 1U87A 3LYKA 2O85A 4POLA 3HY2A 1YDKA 4NAXA 1PFOA 3BCIA 3DYRA 3C8EA 1G7EA 1O85A 3V1WA 5ID2B 4E68A 4YAVA 4ZIJA 4XCSA 2H1DA 2H0IA 3KMNA 2XPDA 2GT5A 2XBIA 4KDYA 2MBTA 4KW6A 4HEA2 3ME8A 2WCIA 3BOAA 2Z9SA 1BF5A 5IM9A 1SK1A 4FYCA 1NM3A 4ILFA 1ZYEA 2HSYA 2O36A 1TJDA 4O5RA 4DSQA 1WMJA 1K0AA 4MMMA 4QQ7A 4E8EA 1TRUA 4G9HA 1XVQA 1TTZA 3H8QA 1XW9A 3A5IA 3GSSA 1PN9A 2UZ8A 4PI2C 4ZB7A 4YQMA 1I9DA 3KGKA 2PMTA 1O6JA 1KNGA 2H1BA 3RAZA 4GQCA 2ZNMA 4XS4B 3UVHA 1GSFA 2WW3A 1A8YA 1OE8A 3ZMKA 1SENA 2OBIA 1ZYQB 4NHZA 1GNEA 4KUNA 3BD2A 1EP7A 4W66A 3TGZA 3KXOA 2V41A 1RK4A 5KEJA 18GSA 1K0OA 3VI5A 4E8HA 2K8VA 5DAKB 1XVWA 2E0QA 4MZBA 5JWRB 1GSYA 4KCAA 1G6WA 3CXGA 5BRTA 3VWVA 5A34A 2K18A 4P3YB 1ZOFA 3ZFLA 4JR4A 1YZXA 2DJKA 1A2LA 2LEGA 4JZQA 2L5LA 3IDVA 4BVYB 5B7CA 3ED3A 4J56E 2OA7A 1EWXA 6GSWA 1HNAA 2C80A 1THOA 2P0GA 3NZNA 4AI6A 2GZZA 1FB6A 1OC9B 2NPBA 3EVIA 2HSMB 5F8BA 4JEDA 2F8FA 5A5HA 2H66A 3HXSA 2B6MA 5ELGA 5A4WA 4BA7A 1DUGA 4K7OA 3ZITA 3FY7A 3QR6A 1Y25A 4OFMA 4IP1A 1YEXA 2C1YA 3HJMA 3TB2A 3M9JA 2KP1A 4GRFA 4O92A 3GUSA 2X4AA 1JHBA 2F9SA 3D6IA 4WBJA 4K9ZA 5C00A 2L57A 3ERGA 2HFDA 3C7MA 2LRCA 4OD7A 1HNCA 13GSA 5AIVA 5ECPB 5ELAA 2XPEA 2PWJA 5D9TA 2N5FA 5AGYA 1QMVA 2YWIA 4HDEA 3TKSE 2DJ0A 2DKHA 6GSTA 2GQKA 1GSUA 5ECNB 3GTUA 1AIUA 5DVBA 4V2NA 4YQUA 2MYGA 1UC7A 5IMVA 3F0IA 3GSTA 4F03A 2JL4A 2VM2A 5DALA 4WR4A 3IAS2 4ID0A 4TN8A 1XCCA 1M9BA 1XFLA 3A2VA 2PU9C 1CQHA 1HD2A 2WVXA 1BYEA 1SKWB 3TDGA 2JSYA 3R2QA 1PX6A 3EMXA 2YJHA 4JU5A 4GWRA 1DE2A 2WRTA 4K8MA 2L59A 3TJBA 4HQSA 3RBTA 4OO5A 2MMOA 2OE0A 2EFHA 3LFLA 3F3RA 4LLRA 4AKGA 4O5UA 2H01A 2LJAA 4ZBBA 1EOHA 3HYPA 1SJ6A 2C3TA 1DSBA 5ABRA 1GTAA 4WBRD 4I6XA 4CDOA 3CYNA 1K3YA 4IJIA 3RHCA 2DC5A 2H75A 3GIXA 2PBJA 4Z2RA 2GZYA 5IMZA 5HR0A 2GZPA 1EZKA 3ZTLA 1XWCA 5C04A 4K1FA 2IN3A 3MSZA 2CAIA 1PL2A 3VI7A 3VWXA 2FCHA 1K0DA 3L9VA 1H4OA 3A3TA 4PQHA 3GKKA 4G01A 4ACSA 1YQ1A 1T1VA 2YJ7A 4HU9A 4AJ7A 2VO4A 4L5LA 1B4QA 2KUCA 2F3MA 2I1UA 5B6NA 4G0IA 3D4MA 4TR3A 4K7IA 5DQYA 5JWOB 2TRCP 4PUAA 4RQXA 1AXDA 4ECBA 2ZCTA 4AKIA 3DRNA 1BEDA 4K2XA 5KN3A 4K2DA 4G19A 2EFDA 3QMXA 1X5CA 1WWJA 3F8UA 4MCUA 4D73B 2WVYA 2OBKA 1FAAA 1Z5YE 2C0GA 1E6BA 3ISOA 1KTEA 4N0VA 5J41A 2LNSA 4KSMA 4L0WA 1JZWA 4WEYA 3HHVA 2B5XA 1I1IP 1TU8A 2KLXA 4ECIA 2V6OA 2OADA 2V32A 2IWTA 2A2RA 3HVSA 1Y1UA 2YWMA 2BTOT 1Z7PA 3F63A 1A0FA 3GNJA 1XW6A 4MJEA 4WF5A 4G0KA 3F4RA 2H6XA 3TUEA 3WGXA 1XPVA 2VCXA 1GSSA 3KTLA 2QGVA 3DIEA 3MYDA 4CW9A 5E59A 4DEJA 2NTOA 1O81A 4JRRA 1JLWA 5CREA 2H8LA 2LNTA 2E7PA 4MJCA 1R26A 3BBYA 1FOVA 4I5QA 1GUHA 2AHEA 5ECMB 4HZ4A 1PKWA 2R3XA 3EURA 1V58A 4MJAA 4KSOA 5CYYA 5EY6A 2LTKA 4L8EA 5A34B 4ZBAA 3L9UA 4MPFA 2YZHA 3UVTA 3IR4A 5JCWA 2C3NA 1SJIA 3GKMA 5KN1A 3GN3A 3QAWA 2ES7A 1ZYNA 1XBSA 5J4YA 4HQZA 3MIXA 1XWKA 2HRKA 1DBYA 7GSSA 1SL0B 5DCHA 1NHYA 2EFCA 3Q18A 2A2SA 5GAND 1QK8A 2C0FA 2YZUA 4YKFA 4I97A 2YWNA 3E9JB 5GZZB 5AN1A 3CBUA 4EKZA 1JZRA 1GTBA 3CSJA 3EWLA 4BWQA 2H73A 3QOUA 1PX7A 1OE7A 1SJZA 3GRXA 2NBSA 4PQIA 1QXHA 4MK3A 3NIVA 3PH9A 2HZFA 3N9JA 1GSDA 1F9MA 3APQA 2C8UA 2V6KA 1WJKA 3GH6A 4EUYA 2L5OA 2VLTA 1S3CA 1BQ7A 4V2LA 4IGJA 1XOBA 1T00A 2WB9A 1SYRA 5J9BA 2FLSA 3US3A 2AJQB 4Q5FA 4IN0A 5G2ZA 4ICYA 1S3RA 1AQVA 3CMIA 3SBCA 1GUKA 1ACVA 5KOXA 2GDRA 3GTUB 1M0UA 4X43A 1ZYPA 9GSSA 3F4SA 4OCFA 1B4PA 3D0ZA 3RPPA 2JZTA 2YV9A 3LSZA 5DALB 4Z2UA 4POBA 4X4JA 1E2YA 2C3QA 3HMJG 2VKZG 2H74A 3C1SA 2HI7A 3TRQA 4EXJA 3MAKA 5KN2A 1OVNA 4NMUA 3VFIA 5J40A 1GLPA 2LKUA 2WVXB 4EIPA 1SK2A 2H6YA 2WJUA 2OE1A 2AAWA 3IHQA 5IMDA 2N5AA 3H93A 4G10A 4D73A 1XG8A 2L6CA 1THXA 2IMKA 4TVEA 2H0HA 3DEXA 3F9UA 3LORA 5E4WA 3Q74A 2HNLA 3DVXA 2CA8A 2WDUA 1TKDB 4ULXA 4MLYA 1RW1A 3O6TA 5D9XA 3A2WA 2M72A 4XRDA 1N8JA 1F37A 2EC4A 4LL4B 5J9CA 2DMMA 4WKWA 3ZYWA 3OR5A 2REMA 3RGBC 2RM5A 1T3BA 2ON5A 2VCTA 2J23A 1X5EA 5D93A 4TXOB 2M80A 1GNWA 5AIXA 4J57E 2BMXA 2F8AA 2ALBA 4TR4A 2X8GA 2WZSA 3LXTA 4FIWA 1AQXA 1EEJA 1SVOA 4H86A 2KP2A 3F4TA 2GSTA 2GLRA 1WE0A 2VAFA 3EYTA 3IPZA 4K0NA 3HVVA 2CX3A 5CAXA 3TKRA 3GX0A 2FA4A 2O89A 2OJLA 1V2AA 1PKZA 3VLNA 4KB3A 1XWGA 1EOGA 3HDCA 3WYWA 3VWUA 3MDKA 1ILOA 1GUMA 2LRNA 4QL9A 4IS0A 5LCZA 3LWAA 1M99A 2PPTA 1AUCA 1SK0A 3R3EA 3EMPA 2JACA 2H1LA 2AYTA 1V9WA 4KDXA 1YEWC 3PPUA 2MMAA 4O7HA 1ERUA 3FZ4A 2RIIA 1J08A 5L71A 1WIKA 2L4QA 4N3ZA 3VURA 2J9HA 1X0RA 3LQ7A 1ERVA 2P5QA 5CRDA 1XZOA 3IBHA 1V98A 4HOJA 6GSYA 2ON7A 2E2MA 2XHFA 1M9AA 1ZL9A 2FWGA 2B1KA 5JCGA 1MD4A 3GKNA 2R5GA 5B8BA 3HCZA 1TK5B 3EINA 4AKXB 1A23A 3FZ9A 4IKHA 2WW2A 1H75A 5DJLA 4OWYA 4FH8A 1NW2A 2H6ZA 2UV8G 2JZRA 1PSQA 3IAM2 5ECSA 22GSA 3VPQA 2FHEA 4DVCA 2I9HA 1F2EA 4DSSA 2NVLA 2FUG2 5LD0A 1G6YA 5ECOB 4MDCA 5BMUA 2AB6A 4YH2A 3ZMLA 1ZCPA 3FRCA 4Z2TA 3LEFA 1SKSB 4I8BA 3ZLPA 3KMOA 3IC4A 3GHAA 3TKQA 2HQTA 2HRKB 4Q5NA 1S3AA 4Q5RA 2QKEA 2YANA 1V57A 1A8LA 2CVKA 1YY7A 3P8WA 5HFKA 3ME7A 3D22A 2A2PA 5CRGA 4GSTA 1F6MC 2X8HA 2GQLA 2CVDA 3M1GA 4PQ1A 1SU9A 2FNOA 1R5AA 1VF3A 5ECRB 2NDOA 3W6GA 5FHIA 2PGTA 1C72A 2TIRA 5COHA 4EE0A 2GTUA 1BX9A 3KJYA 3O76A 3P2AA 5ECIB 3LJRA 3EU3A 1TW9A 2FY6A 1K0MA 4F2IA 4IQ1A 3C73A 1HNBA 1PQNA 3TKSA 4KGIA 2C0EA 1K0BA 4YKGA 1OC3A 3VK9A 2YOIA 1A2MA 2DLXA 4LL1B 2R4VA 4KCEA 5A5KA 3HJOA 3WT2A 4XTSA 5IPHA 1K3LA 1Y6EA 2YP6A 3I6AA 3H4KA 2TRXA 2JSZA 2R6KA 4MJBA 2VCQA 5ECQB 2JU5A 4TXOA 3APOA 1PRXA 3IC8A 1EGOA 3LYPA 3G7IA 4J2FA 1ML6A 4CHSA 2MMNA 5D9WA 1B9YC 3ERWA 1AQWA 1MTCA 1R7HA 1Q4JA 3CRUA 2RLIA 3UAPA 2GGTA 4OFTA 2EIOA 4K6XA 1Z6NA 3DWVA 5G30A 5EL8A 3APSA 5G5FA 3DKSA 4V2MA 4O32A 1OAZA 1U3AA 1VF2A 3ZIVA 1J9BA 5JWQB 5DCGA 2YNXA 4ZBDA 2O8VB 2FD3A 3EC3A 5CRHA 4AJ8A 1M2DA 3Q19A 4NWYA 4ZL8A 2H0GA 2JZSA 4PHZC 3FZ5A 3I69A 1NSWA 16GSA 2PERA 1AC1A 2FA8A 2KOKA 3TOUA 1AAZA 2BJXA 3IOSA 1LU4A 4RI6A 3WD6A 4KH7A 3O3TA 3QDNA 4PXOA 3ZRDA 3WGDA 4ZL9A 1HQOA 4X1UA 1ST9A 4PTSA 3U6VA 3GL5A 2K9FA 1N25A 1SVLA 3KD0A 2O3EA 1EGRA 1R5PA 4XS6A 3TOTA 1GSEA 3VPTA 3NOFA 4BL7A 1YF0A 4YQVA 4K7NA 19GSA 1DE1A 3FZAA 1XWBA 1VRSD 2CQ9A 1A24A 2ZUPA 4IHUA 3GA4A 3KZQA 4TW5A 3W8JA 2HSNA 5F05A 3UOMA 3ZVJA 4K5SA 1UA5A 1TRSA 3QFAC 2HE3A 2CV4A 5G5EA 2B5YA 2WFCA 5G1LA 2C4JA 20GSA 3HVXA 4F9ZA 2FGXA 2QSIA 3FMWA 5J47A 3M9KA 4IJ3A 6GSSA 3FR3A 1VGLA 5GAPD 1TK8B 2MBSA 4MF7A 4ZB6A 3UJ1A 2HLSA 1MDJA 4PX1A 2DIYA 2OE3A 4QMKA 2DKIA 1PA3A 4XRAA 3IK9A 2DJ2A 4F0CA 2WW1A 3MNGA 3CHXC 1XXUA 5KN0A 4POMA 3S9FA 4MA9A 2CT6A 2DJ3A 1IYIA 3RHBA 3D4TA 3TKPA 2R0PA 5HR3A 2VIMA 5HFGA 3KM6A 4EL1A 4K5RA 4MF5A 2QC7A 1B9XC 3FK8A 2VD0A 5IO0A 3TRXA 4CY6A 1KBNA 5DJMA 2DBCA 2L6DA 3KH7A 1XOAA 5LNKe 4RI7A 1T4YA 5A4UA 2HT9A 5ECHB 1SKRB 2B7JA 4JE1A 11GSA 3RFRC 3FR6A 5FWGA 2MZCA 2D2ZA 5J4UA 2H1AA 5B8AA 3GYKA 1TRWA 2FWEA 4PGTA 3J7Yk 5ECLB 2H19A 4G2EA 4O5QA 1S4BP 3HJPA 1A2JA 3FEUA 4DSSB 1B48A 1ERWA 5F0GA 4G0LA 4X0XA 1PN0A 5F06A 3HD5A 8GSSA 5CO3A 5BMUB 5J5NA 2CAQA 1MD3A 2PVOC 3EU4A 4L0UA 3TJGA 4LA1A 1A0RP 1WOUA 3GL3A 2I81A 2EIRA 2IMEA 4GXZA 4AF2A 3FW2A 4TR0A 3G7YA 2X64A 3GMFA 2GVPA 1TI1A 2X49A 6GSXA 5HQPA 1SD9A 1R4WA 1XIYA 2HZEA 1F3AA 2HXKA 2M46A 1WP0A 1MDIA 1F3BA 17GSA 4RUVA 1QUWA 1TK0B 2IMIA 1G0TA 1GH2A 4FQUA 3IRAA 1O8XA 4GDFA 1ZMAA 4HJMA 1FOHA 4L5OA 2WZ9A 3IV4A 4HUAA 1Z9HA 1JZDA 2FWFA 5DDLA 3J7Yb 2IMFA 2LSTA 3HZ8A 4BPYA 5A1NB 3Q6OA 1LJRA 2P31A 3KTBA 5ENUA 2HRAA 4MP4A 1PGTA 3G9BA 3KCMA 4IP6A 10GSA 1M2AA 2GSSA 4KAEA 2H30A 3HVNA 3KP9A 3TKSC 3DMLA 5EVOA 1EV4A 3A5WA 2RM6A 1TXUA 2FWHA 2R0CA 4V1Ag 3TJKA 2LRTA 3D5JA 12GSA 4HZ2A 4TXVA 5D96A 2DJ1A 2XBQA 4PURA 4NPBA 5D73A 2K6VA 14GSA 3GKXA 3KEBA 3UARA 3L0HA 4HI7A 3F3QA 3UMAA 4EDZA 5IOXA 2G0FA 3DGQA 3TCOA 1FVJA 4TR1B 4DSRA 3L9SA 3U5RE 3M8NA 2A4HA 1SD8A 2B5EA 2VLVA 3GURA 4YAPA 1BAYA 1G7OA 3IXRA 2R37A 2H76A 4EC0A 2B3SA 2I4AA 1OKTA 1O73A 1AW9A 5IMCA 3C71A 2IJYA 1K0NA 2LJRA 3DD3A 1FW1A 4FO5A 2WVZA 5H5SA 4GF0A 1SL1B 2X8CA 1GL8A 2HYXA 2N5BA 5JCUA 3AY8A 3HZ4A 2WGRA 2RUEA 3QAVA 4IBPA 2LUSA 2MMZA 3F6FA 1TRVA 4Q5QA 2H1GA 1EV9A 4OCEA 3TJFA 4NV5A 4MH3A 1ERTA 3DXBA 5H5QA 1GTUA 3TU3B 5IQYA 1YJ6A 1S3DA 1FB0A 4BL7B 3VWWA 1FO5A 1FVKA 4WXTA 1JLVA 1RQMA 4IVFA 2GSQA 4XIHA 4GLTA 4TRXA 5EPFA 3SWLA 2P5RA 5CP1A 1I5GA 3I9V2 2HSNB 5DBQA 1URMA 2YN1A 3IHGA 4AJ6A 5IO2A 2VL9A 1BJXA 2DMLA 3PGTA 4BVXB 1YKAA 4EVMA 2IFQA 2DIZA 4ZXGA 3CQFA 3D21A 3IA1A 3L4NA 2GQMA 4ZL7A 1X9MB 1YF1A 2VL2A 4JBBA 2OT3A 3WGEA 3LG6A 4GQFA 4GSSA 3H79A 2O7KA 1YEPA 1Z6MA 3EE2A 2EIQA 1KEBA 2LJKA 3E0UA 5FT3A 3KH9A 1SL2B 3BJ5A 2O87A 1M2BA 2A4VA 2V1MA 5IMAA 1OC8A 1BG5A 1W4VA 3TRPA 3C1RA 1XWAA 2X99A 5ID2A 1UVZA 5A4VA 1EEMA 3CTGA 3CSHA 3GX8A 1M3IA 4XHMA 4N0ZA 4USSA 4ECJA 1T7PB 1K0CA 5A1NA 4HS1A 2L4CA 2G2QA 4IELA 2WS2A 1OKDA 4EO3A 1NHOA 1SVMA 2DJJA 1O8WA 1K3OA 2AUVA 5D9VA 3IE3A 2KHPA 1TOFA 5IMFA 2F51A 1ZZYA 3P90A 2VOCA 3FR9A 2HRNA 6GSUA 3M0FA 2K8SA 4PNFA 2B7KA 5ECKB 4JR6A 1W89A 3HA9A 1FG4A 4KDUA 4A5PA 4WR5A 5HR1A 1TDIA 3CWGA 2WW0A 5GSTA 4MH2A 2CX4A 3M3MA 2LQOA 2H70A 1U88A 3ZZXA 2IMDA 4XS4A 1V40A 2RUFA 4OFNA 2VUPA 3QPMA 3G7JA 3BCKA 1LBKA 4IW9A 2JADA 4TR1A 3UL3A 1GTIA 4XS1A 4MNNA 1TXXA 2HZEB 3K8NA 1B8XA 4V1Ap 6GSVA 1QGVA 2R0GA 2IL3A 2VL3A 2VCVA 3ZIJA 1ON4A 4WF4A 5DAKA 2OKAA 5IIZA 2YCDA 4N30A 2QA2A 4N11A 5GSSA 2LS5A 1XW5A 1U6TA 3UBKA 3FKFA 3CSIA 2PVQA 4PI0C 1TI3A 2O5VA 2E2GA 2IPAA 1GULA 1VF1A 1MEKA 5DQSA 4GSNA 2PN8A 5G31A 1X9SB 5INYA 2VCWA 4WETA 3GFKA 4BVYA 3CRTA 5CNWA 1TU7A 3F6DA 3H1NA 1MDKA 3QAGA 5HR2A 4RQRA 2WULA 1X9WB 4LMWA 2IIYA 3RPNA 3TJJA 3QFBC 1OC9A 4HU7A 1M3JA 2CVBA 3E3EA 3UBLA 2LQQA 2HRFA 2YPMA 5KOWA 4GCIA 2HSMA 3PR8A 1YVLA 3LW9A 4BIKA 4FYUA 3KP8A 4FXYP 4ZB9A 4PUFC 4F0BA 4I2TA 1ABAA 4EDYA 1EP8A 5AISA 4I2UA 2VCZA 1BG1A 2PUKC 1FHEA 4ISDA 5HFIA 4OMVA 3ERFA 4BVXA 3P7XA 4KA0A 2H72A 2AV4A 1SYXA
chains in the Genus database with same CATH topology
3DVWA 3ZVJD 5IPGA 4ZILA 4ML1A 4TOPA 2YV7A 2EFEA 2XC2A 3UEMA 1JZOA 5CRWA 2CZ3A 1OYJA 3N5OA 5IOWA 3I43A 4EIQA 1N2AA 2GT6A 3W8SA 1USBA 1T8EB 1CQGA 2OACA 1IYHA 1UN2A 4NV2A 4AGSA 3UIWA 1TP9A 1QQ2A 1ZGNA 4Z7XA 3PINA 4FYBA 3GV1A 5F07A 1QFNA 1VF4A 3FYGA 2H71A 4CY8A 1PL1A 4KF9A 3JCML 4MF6A 1WRYA 2QA1A 1Z7RA 3RDWA 5J4VA 4F82A 1GSQA 1WPIA 3FHKA 2VLUA 2CZ2A 1U3IA 3LXZA 4MPGA 4HJ2A 2V2GA 5A5HB 2C0DA 4BWSA 3QD9A 4MABA 4QL7A 3EPTA 4KNDA 3ZL5A 1PMTA 4AKHA 2I3YA 5G1KA 3KIJA 1T4ZA 2VM1A 3CTFA 4PNGA 2LV3A 2GSRA 3LGCA 4TKYA 1O7UA 4POKA 3L78A 1GWCA 3IK7A 2R2JA 3GH9A 5D8IA 4K0GA 4KX4A 1Z3EA 1HYUA 5H5RA 3ZFBA 3A2XA 1YKCA 4OO4A 3MWHA 2VD1A 4KE3A 2IFQB 4GTUA 4IQAA 3WT1A 1M7TA 1X5DA 4ZB8A 1GP1A 1J0FA 5J3RA 3HKRA 4N10A 2YWOA 4ML6A 1GLQA 1JFUA 5B6MA 4MZWA 2B1LA 2DSAA 2HSHA 3ZREA 4NHWA 2GS3A 3QCPA 1GRXA 4MZCA 2VL2C 4NXIA 1PD21 4ECCA 4LMVA 4EF0A 1Q98A 1U87A 3LYKA 2O85A 4POLA 3HY2A 1YDKA 4NAXA 3BCIA 3DYRA 3C8EA 1G7EA 1O85A 3V1WA 5ID2B 4E68A 4YAVA 4ZIJA 4XCSA 2H1DA 2H0IA 3KMNA 2XPDA 2GT5A 2XBIA 4KDYA 2MBTA 4KW6A 4HEA2 3ME8A 2WCIA 3BOAA 2Z9SA 1BF5A 5IM9A 1SK1A 4FYCA 1NM3A 4ILFA 1ZYEA 2HSYA 1TJDA 4O5RA 4DSQA 1WMJA 1K0AA 4MMMA 4QQ7A 4E8EA 1TRUA 4G9HA 1XVQA 1TTZA 3H8QA 1XW9A 3A5IA 3GSSA 1PN9A 2UZ8A 4ZB7A 4YQMA 1I9DA 3KGKA 2PMTA 1O6JA 1KNGA 2H1BA 3RAZA 4GQCA 2ZNMA 4XS4B 3UVHA 1GSFA 1A8YA 1OE8A 3ZMKA 1SENA 2OBIA 1ZYQB 4NHZA 1GNEA 4KUNA 3BD2A 1EP7A 4W66A 3TGZA 3KXOA 2V41A 1RK4A 5KEJA 18GSA 1K0OA 3VI5A 4E8HA 2K8VA 5DAKB 1XVWA 2E0QA 4MZBA 5JWRB 1GSYA 4KCAA 1G6WA 3CXGA 5BRTA 3VWVA 5A34A 2K18A 4P3YB 1ZOFA 3ZFLA 4JR4A 1YZXA 2DJKA 1A2LA 2LEGA 4JZQA 2L5LA 3IDVA 4BVYB 5B7CA 3ED3A 4J56E 2OA7A 1EWXA 6GSWA 1HNAA 2C80A 1THOA 2P0GA 3NZNA 4AI6A 2GZZA 1FB6A 1OC9B 2NPBA 3EVIA 2HSMB 5F8BA 4JEDA 2F8FA 5A5HA 2H66A 3HXSA 2B6MA 5ELGA 5A4WA 4BA7A 1DUGA 4K7OA 3ZITA 3FY7A 3QR6A 1Y25A 4OFMA 4IP1A 1YEXA 2C1YA 3HJMA 3TB2A 3M9JA 2KP1A 4GRFA 4O92A 3GUSA 2X4AA 1JHBA 2F9SA 3D6IA 4WBJA 4K9ZA 5C00A 2L57A 3ERGA 2HFDA 3C7MA 2LRCA 4OD7A 1HNCA 13GSA 5AIVA 5ECPB 5ELAA 2XPEA 2PWJA 5D9TA 2N5FA 5AGYA 1QMVA 2YWIA 4HDEA 3TKSE 2DJ0A 2DKHA 6GSTA 2GQKA 1GSUA 5ECNB 3GTUA 1AIUA 5DVBA 4V2NA 4YQUA 2MYGA 1UC7A 5IMVA 3F0IA 3GSTA 4F03A 2JL4A 2VM2A 5DALA 4WR4A 3IAS2 4ID0A 4TN8A 1XCCA 1M9BA 1XFLA 3A2VA 2PU9C 1CQHA 1HD2A 1BYEA 1SKWB 3TDGA 2JSYA 3R2QA 1PX6A 3EMXA 2YJHA 4JU5A 4GWRA 1DE2A 2WRTA 4K8MA 2L59A 3TJBA 4HQSA 3RBTA 4OO5A 2MMOA 2OE0A 2EFHA 3LFLA 3F3RA 4LLRA 4AKGA 4O5UA 2H01A 2LJAA 4ZBBA 1EOHA 3HYPA 1SJ6A 2C3TA 1DSBA 5ABRA 1GTAA 4WBRD 4I6XA 4CDOA 3CYNA 1K3YA 4IJIA 3RHCA 2DC5A 2H75A 3GIXA 2PBJA 4Z2RA 2GZYA 5IMZA 5HR0A 2GZPA 1EZKA 3ZTLA 1XWCA 5C04A 4K1FA 2IN3A 3MSZA 2CAIA 1PL2A 3VI7A 3VWXA 2FCHA 1K0DA 3L9VA 1H4OA 3A3TA 4PQHA 3GKKA 4G01A 4ACSA 1YQ1A 1T1VA 2YJ7A 4HU9A 4AJ7A 2VO4A 4L5LA 1B4QA 2KUCA 2F3MA 2I1UA 5B6NA 4G0IA 3D4MA 4TR3A 4K7IA 5DQYA 5JWOB 2TRCP 4PUAA 4RQXA 1AXDA 4ECBA 2ZCTA 4AKIA 3DRNA 1BEDA 4K2XA 5KN3A 4K2DA 4G19A 2EFDA 3QMXA 1X5CA 1WWJA 3F8UA 4MCUA 4D73B 2OBKA 1FAAA 1Z5YE 2C0GA 1E6BA 3ISOA 1KTEA 4N0VA 5J41A 2LNSA 4KSMA 4L0WA 1JZWA 4WEYA 3HHVA 2B5XA 1TU8A 2KLXA 4ECIA 2V6OA 2OADA 2V32A 2IWTA 2A2RA 3HVSA 1Y1UA 2YWMA 2BTOT 1Z7PA 3F63A 1A0FA 3GNJA 1XW6A 4MJEA 4WF5A 4G0KA 3F4RA 2H6XA 3TUEA 3WGXA 1XPVA 2VCXA 1GSSA 3KTLA 2QGVA 3DIEA 3MYDA 4CW9A 5E59A 4DEJA 2NTOA 1O81A 4JRRA 1JLWA 5CREA 2H8LA 2LNTA 2E7PA 4MJCA 1R26A 3BBYA 1FOVA 4I5QA 1GUHA 2AHEA 5ECMB 4HZ4A 1PKWA 2R3XA 3EURA 1V58A 4MJAA 4KSOA 5CYYA 5EY6A 2LTKA 4L8EA 5A34B 4ZBAA 3L9UA 4MPFA 2YZHA 3UVTA 3IR4A 5JCWA 2C3NA 1SJIA 3GKMA 5KN1A 3GN3A 3QAWA 2ES7A 1ZYNA 1XBSA 5J4YA 4HQZA 3MIXA 1XWKA 2HRKA 1DBYA 7GSSA 1SL0B 5DCHA 1NHYA 2EFCA 3Q18A 2A2SA 5GAND 1QK8A 2C0FA 2YZUA 4YKFA 4I97A 2YWNA 3E9JB 5GZZB 5AN1A 3CBUA 4EKZA 1JZRA 1GTBA 3CSJA 3EWLA 4BWQA 2H73A 3QOUA 1PX7A 1OE7A 1SJZA 3GRXA 2NBSA 4PQIA 1QXHA 4MK3A 3NIVA 3PH9A 2HZFA 3N9JA 1GSDA 1F9MA 3APQA 2C8UA 2V6KA 1WJKA 3GH6A 4EUYA 2L5OA 2VLTA 1S3CA 1BQ7A 4V2LA 4IGJA 1XOBA 1T00A 2WB9A 1SYRA 5J9BA 2FLSA 3US3A 2AJQB 4Q5FA 4IN0A 5G2ZA 4ICYA 1AQVA 3CMIA 3SBCA 1GUKA 1ACVA 5KOXA 2GDRA 3GTUB 1M0UA 4X43A 1ZYPA 9GSSA 3F4SA 4OCFA 1B4PA 3D0ZA 3RPPA 2JZTA 2YV9A 3LSZA 5DALB 4Z2UA 4POBA 4X4JA 1E2YA 2C3QA 3HMJG 2VKZG 2H74A 3C1SA 2HI7A 3TRQA 4EXJA 3MAKA 5KN2A 1OVNA 4NMUA 3VFIA 5J40A 1GLPA 2LKUA 4EIPA 1SK2A 2H6YA 2WJUA 2OE1A 2AAWA 3IHQA 5IMDA 2N5AA 3H93A 4G10A 4D73A 2L6CA 1THXA 2IMKA 4TVEA 2H0HA 3DEXA 3F9UA 3LORA 5E4WA 3Q74A 2HNLA 3DVXA 2CA8A 2WDUA 1TKDB 4ULXA 4MLYA 1RW1A 3O6TA 5D9XA 3A2WA 2M72A 4XRDA 1N8JA 1F37A 2EC4A 4LL4B 5J9CA 2DMMA 4WKWA 3ZYWA 3OR5A 2REMA 2RM5A 1T3BA 2ON5A 2VCTA 2J23A 1X5EA 5D93A 4TXOB 2M80A 1GNWA 5AIXA 4J57E 2BMXA 2F8AA 2ALBA 4TR4A 2X8GA 3LXTA 4FIWA 1AQXA 1EEJA 1SVOA 4H86A 2KP2A 3F4TA 2GSTA 2GLRA 1WE0A 2VAFA 3EYTA 3IPZA 4K0NA 3HVVA 2CX3A 5CAXA 3TKRA 3GX0A 2FA4A 2O89A 2OJLA 1V2AA 1PKZA 3VLNA 4KB3A 1XWGA 1EOGA 3HDCA 3WYWA 3VWUA 3MDKA 1ILOA 1GUMA 2LRNA 4QL9A 4IS0A 5LCZA 3LWAA 1M99A 2PPTA 1AUCA 1SK0A 3R3EA 3EMPA 2JACA 2H1LA 2AYTA 1V9WA 4KDXA 3PPUA 2MMAA 4O7HA 1ERUA 3FZ4A 2RIIA 1J08A 5L71A 1WIKA 2L4QA 4N3ZA 3VURA 2J9HA 1X0RA 3LQ7A 1ERVA 2P5QA 5CRDA 1XZOA 3IBHA 1V98A 4HOJA 6GSYA 2ON7A 2E2MA 2XHFA 1M9AA 1ZL9A 2FWGA 2B1KA 5JCGA 1MD4A 3GKNA 2R5GA 5B8BA 3HCZA 1TK5B 3EINA 4AKXB 1A23A 3FZ9A 4IKHA 1H75A 4OWYA 5DJLA 4FH8A 1NW2A 2H6ZA 2UV8G 2JZRA 1PSQA 3IAM2 5ECSA 22GSA 3VPQA 2FHEA 4DVCA 2I9HA 1F2EA 4DSSA 2NVLA 2FUG2 5LD0A 1G6YA 5ECOB 4MDCA 5BMUA 2AB6A 4YH2A 3ZMLA 1ZCPA 3FRCA 4Z2TA 3LEFA 1SKSB 4I8BA 3ZLPA 3KMOA 3IC4A 3GHAA 3TKQA 2HQTA 2HRKB 4Q5NA 1S3AA 4Q5RA 2QKEA 2YANA 1V57A 1A8LA 2CVKA 1YY7A 3P8WA 5HFKA 3ME7A 3D22A 2A2PA 5CRGA 4GSTA 1F6MC 2X8HA 2GQLA 2CVDA 3M1GA 4PQ1A 1SU9A 2FNOA 1R5AA 1VF3A 5ECRB 2NDOA 3W6GA 5FHIA 2PGTA 1C72A 2TIRA 5COHA 4EE0A 2GTUA 1BX9A 3KJYA 3O76A 3P2AA 5ECIB 3LJRA 3EU3A 1TW9A 2FY6A 1K0MA 4F2IA 4IQ1A 3C73A 1HNBA 1PQNA 3TKSA 4KGIA 2C0EA 1K0BA 4YKGA 1OC3A 3VK9A 2YOIA 1A2MA 2DLXA 4LL1B 2R4VA 4KCEA 5A5KA 3HJOA 3WT2A 4XTSA 5IPHA 1K3LA 1Y6EA 2YP6A 3I6AA 3H4KA 2TRXA 2JSZA 2R6KA 4MJBA 2VCQA 5ECQB 2JU5A 4TXOA 3APOA 1PRXA 3IC8A 1EGOA 3LYPA 3G7IA 4J2FA 1ML6A 4CHSA 2MMNA 5D9WA 1B9YC 3ERWA 1AQWA 1MTCA 1R7HA 1Q4JA 3CRUA 2RLIA 3UAPA 2GGTA 4OFTA 2EIOA 4K6XA 1Z6NA 3DWVA 5G30A 5EL8A 3APSA 5G5FA 3DKSA 4V2MA 4O32A 1OAZA 1U3AA 1VF2A 3ZIVA 1J9BA 5JWQB 5DCGA 2YNXA 4ZBDA 2O8VB 2FD3A 3EC3A 5CRHA 4AJ8A 1M2DA 3Q19A 4NWYA 4ZL8A 2H0GA 2JZSA 3FZ5A 3I69A 1NSWA 16GSA 2PERA 1AC1A 2FA8A 2KOKA 3TOUA 1AAZA 2BJXA 3IOSA 1LU4A 4RI6A 3WD6A 4KH7A 3O3TA 3QDNA 4PXOA 3ZRDA 3WGDA 4ZL9A 1HQOA 4X1UA 1ST9A 4PTSA 3U6VA 3GL5A 2K9FA 1N25A 1SVLA 3KD0A 1EGRA 1R5PA 4XS6A 3TOTA 1GSEA 3VPTA 3NOFA 4BL7A 1YF0A 4YQVA 4K7NA 19GSA 1DE1A 3FZAA 1XWBA 1VRSD 2CQ9A 1A24A 2ZUPA 4IHUA 3GA4A 3KZQA 4TW5A 3W8JA 2HSNA 5F05A 3UOMA 3ZVJA 4K5SA 1UA5A 1TRSA 3QFAC 2HE3A 2CV4A 5G5EA 2B5YA 2WFCA 5G1LA 2C4JA 20GSA 3HVXA 4F9ZA 2FGXA 2QSIA 3FMWA 5J47A 3M9KA 4IJ3A 6GSSA 3FR3A 1VGLA 5GAPD 1TK8B 2MBSA 4MF7A 4ZB6A 3UJ1A 2HLSA 1MDJA 4PX1A 2DIYA 2OE3A 4QMKA 2DKIA 1PA3A 4XRAA 3IK9A 2DJ2A 4F0CA 3MNGA 1XXUA 5KN0A 4POMA 3S9FA 4MA9A 2CT6A 2DJ3A 1IYIA 3RHBA 3D4TA 3TKPA 2R0PA 5HR3A 2VIMA 5HFGA 3KM6A 4EL1A 4K5RA 4MF5A 2QC7A 1B9XC 3FK8A 2VD0A 5IO0A 3TRXA 4CY6A 1KBNA 5DJMA 2DBCA 2L6DA 3KH7A 1XOAA 5LNKe 4RI7A 1T4YA 5A4UA 2HT9A 5ECHB 1SKRB 2B7JA 4JE1A 11GSA 3FR6A 5FWGA 2MZCA 2D2ZA 5J4UA 2H1AA 5B8AA 3GYKA 1TRWA 2FWEA 4PGTA 3J7Yk 5ECLB 2H19A 4G2EA 4O5QA 3HJPA 1A2JA 3FEUA 4DSSB 1B48A 1ERWA 5F0GA 4G0LA 4X0XA 1PN0A 5F06A 3HD5A 8GSSA 5CO3A 5BMUB 5J5NA 2CAQA 1MD3A 2PVOC 3EU4A 4L0UA 3TJGA 4LA1A 1A0RP 1WOUA 3GL3A 2I81A 2EIRA 2IMEA 4GXZA 4AF2A 3FW2A 4TR0A 3G7YA 2X64A 3GMFA 2GVPA 1TI1A 2X49A 6GSXA 5HQPA 1SD9A 1R4WA 1XIYA 2HZEA 1F3AA 2HXKA 2M46A 1WP0A 1MDIA 1F3BA 17GSA 4RUVA 1QUWA 1TK0B 2IMIA 1G0TA 1GH2A 4FQUA 3IRAA 1O8XA 4GDFA 1ZMAA 4HJMA 1FOHA 4L5OA 2WZ9A 3IV4A 4HUAA 1Z9HA 1JZDA 2FWFA 5DDLA 3J7Yb 2IMFA 2LSTA 3HZ8A 4BPYA 5A1NB 3Q6OA 1LJRA 2P31A 3KTBA 5ENUA 2HRAA 4MP4A 1PGTA 3G9BA 3KCMA 4IP6A 10GSA 1M2AA 2GSSA 4KAEA 2H30A 3KP9A 3TKSC 3DMLA 5EVOA 1EV4A 3A5WA 2RM6A 1TXUA 2FWHA 2R0CA 4V1Ag 3TJKA 2LRTA 3D5JA 12GSA 4HZ2A 4TXVA 5D96A 2DJ1A 2XBQA 4PURA 4NPBA 5D73A 2K6VA 14GSA 3GKXA 3KEBA 3UARA 3L0HA 4HI7A 3F3QA 3UMAA 4EDZA 5IOXA 2G0FA 3DGQA 3TCOA 1FVJA 4TR1B 4DSRA 3L9SA 3U5RE 3M8NA 2A4HA 1SD8A 2B5EA 2VLVA 3GURA 4YAPA 1BAYA 1G7OA 3IXRA 2R37A 2H76A 4EC0A 2B3SA 2I4AA 1OKTA 1O73A 1AW9A 5IMCA 3C71A 2IJYA 1K0NA 2LJRA 3DD3A 1FW1A 4FO5A 5H5SA 1SL1B 4GF0A 2X8CA 1GL8A 2HYXA 2N5BA 5JCUA 3AY8A 3HZ4A 2WGRA 2RUEA 3QAVA 4IBPA 2LUSA 2MMZA 3F6FA 1TRVA 4Q5QA 2H1GA 1EV9A 4OCEA 3TJFA 4NV5A 4MH3A 1ERTA 3DXBA 5H5QA 1GTUA 3TU3B 5IQYA 1YJ6A 1S3DA 1FB0A 4BL7B 3VWWA 1FO5A 1FVKA 4WXTA 1JLVA 1RQMA 4IVFA 2GSQA 4XIHA 4GLTA 4TRXA 5EPFA 3SWLA 2P5RA 5CP1A 1I5GA 3I9V2 2HSNB 5DBQA 1URMA 2YN1A 3IHGA 4AJ6A 5IO2A 2VL9A 1BJXA 2DMLA 3PGTA 4BVXB 1YKAA 4EVMA 2IFQA 2DIZA 4ZXGA 3D21A 3IA1A 3L4NA 2GQMA 4ZL7A 1X9MB 1YF1A 2VL2A 4JBBA 2OT3A 3WGEA 3LG6A 4GQFA 4GSSA 3H79A 2O7KA 1YEPA 1Z6MA 3EE2A 2EIQA 1KEBA 2LJKA 3E0UA 5FT3A 3KH9A 1SL2B 3BJ5A 2O87A 1M2BA 2A4VA 2V1MA 5IMAA 1OC8A 1BG5A 1W4VA 3TRPA 3C1RA 1XWAA 2X99A 5ID2A 1UVZA 5A4VA 1EEMA 3CTGA 3CSHA 3GX8A 4XHMA 4N0ZA 4USSA 4ECJA 1T7PB 1K0CA 5A1NA 4HS1A 2L4CA 2G2QA 4IELA 2WS2A 1OKDA 4EO3A 1NHOA 1SVMA 2DJJA 1O8WA 1K3OA 2AUVA 5D9VA 3IE3A 2KHPA 1TOFA 5IMFA 2F51A 1ZZYA 3P90A 2VOCA 3FR9A 2HRNA 6GSUA 3M0FA 2K8SA 4PNFA 2B7KA 5ECKB 4JR6A 1W89A 3HA9A 1FG4A 4KDUA 4A5PA 4WR5A 5HR1A 1TDIA 3CWGA 5GSTA 4MH2A 2CX4A 3M3MA 2LQOA 2H70A 1U88A 3ZZXA 2IMDA 4XS4A 1V40A 2RUFA 4OFNA 2VUPA 3QPMA 3G7JA 3BCKA 1LBKA 4IW9A 2JADA 4TR1A 3UL3A 1GTIA 4XS1A 4MNNA 1TXXA 2HZEB 3K8NA 1B8XA 4V1Ap 6GSVA 1QGVA 2R0GA 2IL3A 2VL3A 2VCVA 3ZIJA 1ON4A 4WF4A 5DAKA 2OKAA 5IIZA 2YCDA 4N30A 2QA2A 4N11A 5GSSA 2LS5A 1XW5A 1U6TA 3UBKA 3FKFA 3CSIA 2PVQA 1TI3A 2O5VA 2E2GA 2IPAA 1GULA 1VF1A 1MEKA 5DQSA 4GSNA 2PN8A 5G31A 1X9SB 5INYA 2VCWA 4WETA 3GFKA 4BVYA 3CRTA 5CNWA 1TU7A 3F6DA 3H1NA 1MDKA 3QAGA 5HR2A 4RQRA 2WULA 1X9WB 4LMWA 2IIYA 3RPNA 3TJJA 3QFBC 1OC9A 4HU7A 2CVBA 3E3EA 3UBLA 2LQQA 2HRFA 2YPMA 5KOWA 4GCIA 2HSMA 3PR8A 1YVLA 3LW9A 4FYUA 3KP8A 4ZB9A 4PUFC 4F0BA 4I2TA 1ABAA 4EDYA 1EP8A 5AISA 4I2UA 2VCZA 1BG1A 2PUKC 1FHEA 4ISDA 5HFIA 4OMVA 3ERFA 4BVXA 3P7XA 4KA0A 2H72A 2AV4A 1SYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVW A;  3ZVJ D;  5IPG A;  4ZIL A;  4ML1 A;  4TOP A;  2YV7 A;  2XC2 A;  3UEM A;  1JZO A;  5CRW A;  2CZ3 A;  1OYJ A;  3N5O A;  5IOW A;  3I43 A;  1N2A A;  2GT6 A;  3W8S A;  1USB A;  1T8E B;  1CQG A;  2OAC A;  1IYH A;  1UN2 A;  4NV2 A;  4AGS A;  3UIW A;  1TP9 A;  1QQ2 A;  1ZGN A;  4Z7X A;  3PIN A;  4FYB A;  3GV1 A;  5F07 A;  1QFN A;  1VF4 A;  3FYG A;  2H71 A;  1PL1 A;  4KF9 A;  3JCM L;  4MF6 A;  1WRY A;  1Z7R A;  3RDW A;  4F82 A;  1GSQ A;  1WPI A;  3FHK A;  2VLU A;  2CZ2 A;  1U3I A;  3LXZ A;  4MPG A;  4HJ2 A;  2V2G A;  2C0D A;  4BWS A;  3QD9 A;  4MAB A;  4QL7 A;  4KND A;  3ZL5 A;  1PMT A;  2I3Y A;  5G1K A;  3KIJ A;  1T4Z A;  2VM1 A;  3CTF A;  4PNG A;  2LV3 A;  2GSR A;  3LGC A;  4TKY A;  1O7U A;  4POK A;  3L78 A;  1GWC A;  3IK7 A;  2R2J A;  3GH9 A;  5D8I A;  4K0G A;  4KX4 A;  1Z3E A;  1HYU A;  5H5R A;  3ZFB A;  3A2X A;  1YKC A;  4OO4 A;  3MWH A;  2VD1 A;  4KE3 A;  2IFQ B;  4GTU A;  4IQA A;  3WT1 A;  1M7T A;  1X5D A;  4ZB8 A;  1GP1 A;  1J0F A;  5J3R A;  3HKR A;  4N10 A;  2YWO A;  4ML6 A;  1GLQ A;  1JFU A;  5B6M A;  4MZW A;  2B1L A;  2DSA A;  2HSH A;  3ZRE A;  4NHW A;  2GS3 A;  3QCP A;  1GRX A;  4MZC A;  2VL2 C;  4NXI A;  1PD2 1;  4ECC A;  4LMV A;  4EF0 A;  1Q98 A;  1U87 A;  3LYK A;  2O85 A;  4POL A;  3HY2 A;  1YDK A;  4NAX A;  3BCI A;  3DYR A;  3C8E A;  1G7E A;  1O85 A;  3V1W A;  5ID2 B;  4YAV A;  4ZIJ A;  4XCS A;  2H1D A;  2H0I A;  3KMN A;  2XPD A;  2GT5 A;  2XBI A;  4KDY A;  2MBT A;  4KW6 A;  4HEA 2;  3ME8 A;  2WCI A;  3BOA A;  2Z9S A;  5IM9 A;  1SK1 A;  4FYC A;  1NM3 A;  4ILF A;  1ZYE A;  2HSY A;  1TJD A;  4O5R A;  4DSQ A;  1WMJ A;  1K0A A;  4MMM A;  4QQ7 A;  4E8E A;  1TRU A;  4G9H A;  1XVQ A;  1TTZ A;  3H8Q A;  1XW9 A;  3GSS A;  1PN9 A;  2UZ8 A;  4YQM A;  1I9D A;  3KGK A;  2PMT A;  1O6J A;  1KNG A;  2H1B A;  3RAZ A;  4GQC A;  2ZNM A;  4XS4 B;  3UVH A;  1GSF A;  1A8Y A;  1OE8 A;  3ZMK A;  1SEN A;  2OBI A;  1ZYQ B;  4NHZ A;  1GNE A;  4KUN A;  3BD2 A;  1EP7 A;  3TGZ A;  3KXO A;  2V41 A;  1RK4 A;  5KEJ A;  18GS A;  1K0O A;  3VI5 A;  4E8H A;  2K8V A;  5DAK B;  1XVW A;  2E0Q A;  4MZB A;  5JWR B;  1GSY A;  4KCA A;  1G6W A;  3CXG A;  3VWV A;  2K18 A;  4P3Y B;  1ZOF A;  3ZFL A;  4JR4 A;  1YZX A;  2DJK A;  1A2L A;  2LEG A;  4JZQ A;  2L5L A;  3IDV A;  4BVY B;  5B7C A;  3ED3 A;  4J56 E;  2OA7 A;  1EWX A;  6GSW A;  1HNA A;  2C80 A;  1THO A;  2P0G A;  3NZN A;  2GZZ A;  1FB6 A;  1OC9 B;  2NPB A;  3EVI A;  2HSM B;  5F8B A;  4JED A;  2F8F A;  2H66 A;  3HXS A;  2B6M A;  5ELG A;  5A4W A;  4BA7 A;  1DUG A;  4K7O A;  3ZIT A;  3FY7 A;  3QR6 A;  1Y25 A;  4OFM A;  4IP1 A;  1YEX A;  2C1Y A;  3HJM A;  3TB2 A;  3M9J A;  2KP1 A;  4GRF A;  4O92 A;  3GUS A;  1JHB A;  2F9S A;  3D6I A;  4WBJ A;  4K9Z A;  5C00 A;  2L57 A;  3ERG A;  2HFD A;  3C7M A;  2LRC A;  4OD7 A;  1HNC A;  13GS A;  5AIV A;  5ECP B;  5ELA A;  2XPE A;  2PWJ A;  5D9T A;  2N5F A;  5AGY A;  1QMV A;  2YWI A;  4HDE A;  3TKS E;  2DJ0 A;  6GST A;  2GQK A;  1GSU A;  5ECN B;  3GTU A;  1AIU A;  5DVB A;  4V2N A;  4YQU A;  2MYG A;  1UC7 A;  5IMV A;  3F0I A;  3GST A;  4F03 A;  2JL4 A;  2VM2 A;  5DAL A;  4WR4 A;  3IAS 2;  4ID0 A;  4TN8 A;  1XCC A;  1M9B A;  1XFL A;  3A2V A;  2PU9 C;  1CQH A;  1HD2 A;  1BYE A;  1SKW B;  3TDG A;  2JSY A;  3R2Q A;  1PX6 A;  3EMX A;  2YJH A;  4JU5 A;  4GWR A;  1DE2 A;  2WRT A;  4K8M A;  2L59 A;  3TJB A;  4HQS A;  3RBT A;  4OO5 A;  2MMO A;  2OE0 A;  3LFL A;  3F3R A;  4LLR A;  2H01 A;  2LJA A;  4ZBB A;  1EOH A;  3HYP A;  1SJ6 A;  2C3T A;  1DSB A;  5ABR A;  1GTA A;  4WBR D;  4I6X A;  4CDO A;  3CYN A;  1K3Y A;  4IJI A;  3RHC A;  2DC5 A;  2H75 A;  3GIX A;  2PBJ A;  2GZY A;  5IMZ A;  5HR0 A;  2GZP A;  1EZK A;  3ZTL A;  1XWC A;  5C04 A;  4K1F A;  2IN3 A;  3MSZ A;  2CAI A;  1PL2 A;  3VI7 A;  3VWX A;  2FCH A;  1K0D A;  3L9V A;  1H4O A;  3A3T A;  4PQH A;  3GKK A;  4ACS A;  1YQ1 A;  1T1V A;  2YJ7 A;  4HU9 A;  4AJ7 A;  2VO4 A;  4L5L A;  1B4Q A;  2KUC A;  2F3M A;  2I1U A;  5B6N A;  4G0I A;  3D4M A;  4TR3 A;  4K7I A;  5DQY A;  5JWO B;  2TRC P;  4PUA A;  4RQX A;  1AXD A;  4ECB A;  2ZCT A;  3DRN A;  1BED A;  5KN3 A;  4K2D A;  4G19 A;  3QMX A;  1X5C A;  1WWJ A;  3F8U A;  4MCU A;  4D73 B;  2OBK A;  1FAA A;  1Z5Y E;  2C0G A;  1E6B A;  3ISO A;  1KTE A;  4N0V A;  5J41 A;  2LNS A;  4KSM A;  4L0W A;  1JZW A;  4WEY A;  3HHV A;  2B5X A;  1TU8 A;  2KLX A;  4ECI A;  2V6O A;  2OAD A;  2V32 A;  2IWT A;  2A2R A;  3HVS A;  2YWM A;  2BTO T;  1Z7P A;  3F63 A;  1A0F A;  3GNJ A;  1XW6 A;  4MJE A;  4WF5 A;  4G0K A;  3F4R A;  2H6X A;  3TUE A;  3WGX A;  1XPV A;  2VCX A;  1GSS A;  3KTL A;  2QGV A;  3DIE A;  4CW9 A;  5E59 A;  4DEJ A;  2NTO A;  1O81 A;  4JRR A;  1JLW A;  5CRE A;  2H8L A;  2LNT A;  2E7P A;  4MJC A;  1R26 A;  3BBY A;  1FOV A;  4I5Q A;  1GUH A;  2AHE A;  5ECM B;  4HZ4 A;  1PKW A;  2R3X A;  3EUR A;  1V58 A;  4MJA A;  4KSO A;  5CYY A;  5EY6 A;  2LTK A;  4L8E A;  4ZBA A;  3L9U A;  4MPF A;  2YZH A;  3UVT A;  3IR4 A;  5JCW A;  2C3N A;  1SJI A;  3GKM A;  5KN1 A;  3GN3 A;  3QAW A;  2ES7 A;  1XBS A;  4HQZ A;  1XWK A;  2HRK A;  1DBY A;  7GSS A;  1SL0 B;  5DCH A;  1NHY A;  3Q18 A;  2A2S A;  5GAN D;  1QK8 A;  2C0F A;  2YZU A;  4I97 A;  2YWN A;  3E9J B;  5GZZ B;  5AN1 A;  3CBU A;  4EKZ A;  1JZR A;  1GTB A;  3CSJ A;  3EWL A;  4BWQ A;  2H73 A;  3QOU A;  1PX7 A;  1OE7 A;  1SJZ A;  3GRX A;  2NBS A;  4PQI A;  1QXH A;  4MK3 A;  3NIV A;  3PH9 A;  2HZF A;  3N9J A;  1GSD A;  1F9M A;  3APQ A;  2C8U A;  2V6K A;  1WJK A;  3GH6 A;  4EUY A;  2L5O A;  2VLT A;  1S3C A;  1BQ7 A;  4V2L A;  4IGJ A;  1XOB A;  1T00 A;  2WB9 A;  1SYR A;  5J9B A;  2FLS A;  3US3 A;  2AJQ B;  4Q5F A;  4IN0 A;  5G2Z A;  1AQV A;  3CMI A;  3SBC A;  1GUK A;  1ACV A;  2GDR A;  3GTU B;  1M0U A;  4X43 A;  9GSS A;  3F4S A;  4OCF A;  1B4P A;  3D0Z A;  3RPP A;  2JZT A;  2YV9 A;  3LSZ A;  5DAL B;  4POB A;  1E2Y A;  2C3Q A;  2H74 A;  3C1S A;  2HI7 A;  3TRQ A;  4EXJ A;  3MAK A;  5KN2 A;  1OVN A;  4NMU A;  3VFI A;  1GLP A;  2LKU A;  1SK2 A;  2H6Y A;  2WJU A;  2OE1 A;  2AAW A;  3IHQ A;  5IMD A;  2N5A A;  3H93 A;  4G10 A;  4D73 A;  2L6C A;  1THX A;  2IMK A;  4TVE A;  2H0H A;  3DEX A;  3F9U A;  3LOR A;  5E4W A;  3Q74 A;  2HNL A;  3DVX A;  2CA8 A;  2WDU A;  1TKD B;  4ULX A;  4MLY A;  1RW1 A;  3O6T A;  5D9X A;  3A2W A;  2M72 A;  4XRD A;  1N8J A;  1F37 A;  2EC4 A;  4LL4 B;  5J9C A;  2DMM A;  4WKW A;  3ZYW A;  3OR5 A;  2REM A;  2RM5 A;  1T3B A;  2ON5 A;  2VCT A;  2J23 A;  1X5E A;  5D93 A;  4TXO B;  2M80 A;  1GNW A;  5AIX A;  4J57 E;  2BMX A;  2F8A A;  2ALB A;  4TR4 A;  2X8G A;  3LXT A;  4FIW A;  1AQX A;  1EEJ A;  4H86 A;  2KP2 A;  3F4T A;  2GST A;  2GLR A;  1WE0 A;  2VAF A;  3EYT A;  3IPZ A;  4K0N A;  3HVV A;  2CX3 A;  5CAX A;  3TKR A;  3GX0 A;  2FA4 A;  2O89 A;  2OJL A;  1V2A A;  1PKZ A;  3VLN A;  4KB3 A;  1XWG A;  1EOG A;  3HDC A;  3WYW A;  3VWU A;  3MDK A;  1ILO A;  1GUM A;  2LRN A;  4QL9 A;  4IS0 A;  5LCZ A;  3LWA A;  1M99 A;  2PPT A;  1AUC A;  1SK0 A;  3R3E A;  3EMP A;  2JAC A;  2AYT A;  1V9W A;  4KDX A;  3PPU A;  2MMA A;  4O7H A;  1ERU A;  3FZ4 A;  2RII A;  1J08 A;  5L71 A;  1WIK A;  2L4Q A;  3VUR A;  2J9H A;  1X0R A;  3LQ7 A;  1ERV A;  2P5Q A;  5CRD A;  1XZO A;  3IBH A;  1V98 A;  4HOJ A;  6GSY A;  2ON7 A;  2E2M A;  2XHF A;  1M9A A;  1ZL9 A;  2FWG A;  2B1K A;  5JCG A;  1MD4 A;  3GKN A;  2R5G A;  5B8B A;  3HCZ A;  1TK5 B;  3EIN A;  1A23 A;  3FZ9 A;  4IKH A;  1H75 A;  4OWY A;  5DJL A;  4FH8 A;  1NW2 A;  2H6Z A;  2JZR A;  1PSQ A;  3IAM 2;  5ECS A;  22GS A;  3VPQ A;  2FHE A;  4DVC A;  2I9H A;  1F2E A;  4DSS A;  2NVL A;  2FUG 2;  5LD0 A;  1G6Y A;  5ECO B;  4MDC A;  5BMU A;  2AB6 A;  4YH2 A;  3ZML A;  1ZCP A;  3FRC A;  3LEF A;  1SKS B;  4I8B A;  3ZLP A;  3KMO A;  3IC4 A;  3GHA A;  3TKQ A;  2HQT A;  2HRK B;  4Q5N A;  1S3A A;  4Q5R A;  2QKE A;  2YAN A;  1V57 A;  1A8L A;  2CVK A;  1YY7 A;  3P8W A;  5HFK A;  3ME7 A;  3D22 A;  5CRG A;  4GST A;  1F6M C;  2X8H A;  2GQL A;  2CVD A;  3M1G A;  4PQ1 A;  1SU9 A;  2FNO A;  1R5A A;  1VF3 A;  5ECR B;  2NDO A;  3W6G A;  5FHI A;  2PGT A;  1C72 A;  2TIR A;  5COH A;  4EE0 A;  2GTU A;  1BX9 A;  3O76 A;  3KJY A;  3P2A A;  5ECI B;  3LJR A;  3EU3 A;  1TW9 A;  2FY6 A;  1K0M A;  4F2I A;  4IQ1 A;  3C73 A;  1HNB A;  1PQN A;  3TKS A;  4KGI A;  2C0E A;  1K0B A;  1OC3 A;  3VK9 A;  2YOI A;  1A2M A;  2DLX A;  4LL1 B;  2R4V A;  4KCE A;  5A5K A;  3HJO A;  3WT2 A;  4XTS A;  5IPH A;  1K3L A;  1Y6E A;  2YP6 A;  3I6A A;  3H4K A;  2TRX A;  2JSZ A;  2R6K A;  4MJB A;  2VCQ A;  5ECQ B;  2JU5 A;  4TXO A;  3APO A;  1PRX A;  3IC8 A;  1EGO A;  3LYP A;  3G7I A;  4J2F A;  1ML6 A;  4CHS A;  2MMN A;  5D9W A;  1B9Y C;  3ERW A;  1AQW A;  1MTC A;  1R7H A;  1Q4J A;  3CRU A;  2RLI A;  3UAP A;  2GGT A;  4OFT A;  2EIO A;  4K6X A;  1Z6N A;  3DWV A;  5G30 A;  5EL8 A;  3APS A;  5G5F A;  3DKS A;  4V2M A;  4O32 A;  1OAZ A;  1U3A A;  1VF2 A;  3ZIV A;  1J9B A;  5JWQ B;  5DCG A;  2YNX A;  4ZBD A;  2O8V B;  2FD3 A;  3EC3 A;  5CRH A;  4AJ8 A;  1M2D A;  3Q19 A;  4NWY A;  4ZL8 A;  2H0G A;  2JZS A;  3FZ5 A;  3I69 A;  1NSW A;  16GS A;  2PER A;  1AC1 A;  2FA8 A;  2KOK A;  3TOU A;  1AAZ A;  2BJX A;  3IOS A;  1LU4 A;  4RI6 A;  3WD6 A;  4KH7 A;  3O3T A;  3QDN A;  4PXO A;  3ZRD A;  3WGD A;  4ZL9 A;  1HQO A;  4X1U A;  1ST9 A;  4PTS A;  3U6V A;  3GL5 A;  2K9F A;  3KD0 A;  1EGR A;  1R5P A;  4XS6 A;  3TOT A;  1GSE A;  3VPT A;  3NOF A;  4BL7 A;  1YF0 A;  4YQV A;  4K7N A;  19GS A;  1DE1 A;  3FZA A;  1XWB A;  1VRS D;  2CQ9 A;  1A24 A;  2ZUP A;  4IHU A;  3GA4 A;  3KZQ A;  4TW5 A;  3W8J A;  5F05 A;  3UOM A;  3ZVJ A;  1UA5 A;  1TRS A;  3QFA C;  2HE3 A;  2CV4 A;  5G5E A;  2B5Y A;  2WFC A;  5G1L A;  2C4J A;  20GS A;  3HVX A;  4F9Z A;  2FGX A;  2QSI A;  3M9K A;  4IJ3 A;  6GSS A;  3FR3 A;  1VGL A;  5GAP D;  1TK8 B;  2MBS A;  4MF7 A;  4ZB6 A;  3UJ1 A;  2HLS A;  1MDJ A;  4PX1 A;  2DIY A;  2OE3 A;  1PA3 A;  4XRA A;  3IK9 A;  2DJ2 A;  4F0C A;  3MNG A;  1XXU A;  5KN0 A;  4POM A;  3S9F A;  4MA9 A;  2CT6 A;  2DJ3 A;  1IYI A;  3RHB A;  3D4T A;  3TKP A;  5HR3 A;  2VIM A;  5HFG A;  3KM6 A;  4EL1 A;  4MF5 A;  2QC7 A;  1B9X C;  3FK8 A;  2VD0 A;  5IO0 A;  3TRX A;  1KBN A;  5DJM A;  2DBC A;  2L6D A;  3KH7 A;  1XOA A;  5LNK e;  4RI7 A;  1T4Y A;  5A4U A;  2HT9 A;  5ECH B;  1SKR B;  2B7J A;  4JE1 A;  11GS A;  3FR6 A;  5FWG A;  2MZC A;  2D2Z A;  5J4U A;  2H1A A;  5B8A A;  3GYK A;  1TRW A;  2FWE A;  4PGT A;  3J7Y k;  5ECL B;  2H19 A;  4G2E A;  3HJP A;  1A2J A;  3FEU A;  4DSS B;  1B48 A;  1ERW A;  5F0G A;  4G0L A;  4X0X A;  5F06 A;  3HD5 A;  8GSS A;  5CO3 A;  5J5N A;  2CAQ A;  1MD3 A;  2PVO C;  3EU4 A;  4L0U A;  3TJG A;  4LA1 A;  1A0R P;  1WOU A;  3GL3 A;  2I81 A;  2EIR A;  2IME A;  4GXZ A;  4AF2 A;  3FW2 A;  4TR0 A;  3G7Y A;  2X64 A;  3GMF A;  2GVP A;  1TI1 A;  6GSX A;  5HQP A;  1SD9 A;  1R4W A;  1XIY A;  2HZE A;  1F3A A;  2HXK A;  2M46 A;  1WP0 A;  1MDI A;  1F3B A;  17GS A;  4RUV A;  1QUW A;  1TK0 B;  2IMI A;  1G0T A;  1GH2 A;  4FQU A;  3IRA A;  1O8X A;  1ZMA A;  4HJM A;  4L5O A;  2WZ9 A;  3IV4 A;  4HUA A;  1Z9H A;  1JZD A;  2FWF A;  5DDL A;  3J7Y b;  2IMF A;  2LST A;  3HZ8 A;  4BPY A;  3Q6O A;  1LJR A;  2P31 A;  3KTB A;  5ENU A;  2HRA A;  4MP4 A;  1PGT A;  3G9B A;  3KCM A;  4IP6 A;  10GS A;  1M2A A;  2GSS A;  4KAE A;  2H30 A;  3KP9 A;  3TKS C;  3DML A;  5EVO A;  1EV4 A;  3A5W A;  2RM6 A;  2FWH A;  4V1A g;  3TJK A;  2LRT A;  3D5J A;  12GS A;  4HZ2 A;  4TXV A;  5D96 A;  2DJ1 A;  2XBQ A;  4PUR A;  4NPB A;  5D73 A;  2K6V A;  14GS A;  3GKX A;  3KEB A;  3UAR A;  3L0H A;  4HI7 A;  3F3Q A;  3UMA A;  4EDZ A;  5IOX A;  2G0F A;  3DGQ A;  3TCO A;  1FVJ A;  4TR1 B;  4DSR A;  3L9S A;  3U5R E;  3M8N A;  1SD8 A;  2B5E A;  2VLV A;  3GUR A;  4YAP A;  1BAY A;  1G7O A;  3IXR A;  2R37 A;  2H76 A;  4EC0 A;  2B3S A;  2I4A A;  1OKT A;  1O73 A;  1AW9 A;  5IMC A;  3C71 A;  2IJY A;  1K0N A;  2LJR A;  3DD3 A;  1FW1 A;  4FO5 A;  5H5S A;  1SL1 B;  4GF0 A;  2X8C A;  1GL8 A;  2HYX A;  2N5B A;  5JCU A;  3AY8 A;  3HZ4 A;  2WGR A;  2RUE A;  3QAV A;  4IBP A;  2LUS A;  2MMZ A;  3F6F A;  1TRV A;  4Q5Q A;  2H1G A;  1EV9 A;  4OCE A;  3TJF A;  4NV5 A;  4MH3 A;  1ERT A;  3DXB A;  5H5Q A;  1GTU A;  5IQY A;  1YJ6 A;  1S3D A;  1FB0 A;  4BL7 B;  3VWW A;  1FO5 A;  1FVK A;  4WXT A;  1JLV A;  1RQM A;  4IVF A;  2GSQ A;  4XIH A;  4GLT A;  4TRX A;  5EPF A;  3SWL A;  2P5R A;  5CP1 A;  1I5G A;  3I9V 2;  2HSN B;  5DBQ A;  1URM A;  2YN1 A;  4AJ6 A;  5IO2 A;  2VL9 A;  1BJX A;  2DML A;  3PGT A;  4BVX B;  1YKA A;  4EVM A;  2IFQ A;  2DIZ A;  4ZXG A;  3D21 A;  3IA1 A;  3L4N A;  2GQM A;  4ZL7 A;  1X9M B;  1YF1 A;  2VL2 A;  4JBB A;  3WGE A;  3LG6 A;  4GQF A;  4GSS A;  3H79 A;  2O7K A;  1YEP A;  1Z6M A;  3EE2 A;  2EIQ A;  1KEB A;  2LJK A;  3E0U A;  5FT3 A;  3KH9 A;  1SL2 B;  3BJ5 A;  2O87 A;  1M2B A;  2A4V A;  2V1M A;  5IMA A;  1OC8 A;  1BG5 A;  1W4V A;  3TRP A;  3C1R A;  1XWA A;  2X99 A;  5ID2 A;  1UVZ A;  5A4V A;  1EEM A;  3CTG A;  3CSH A;  3GX8 A;  4XHM A;  4N0Z A;  4USS A;  4ECJ A;  1T7P B;  1K0C A;  4HS1 A;  2L4C A;  2G2Q A;  4IEL A;  2WS2 A;  1OKD A;  4EO3 A;  1NHO A;  2DJJ A;  1O8W A;  1K3O A;  2AUV A;  5D9V A;  3IE3 A;  2KHP A;  1TOF A;  5IMF A;  2F51 A;  1ZZY A;  3P90 A;  2VOC A;  3FR9 A;  2HRN A;  6GSU A;  3M0F A;  2K8S A;  4PNF A;  2B7K A;  5ECK B;  4JR6 A;  1W89 A;  3HA9 A;  1FG4 A;  4KDU A;  4WR5 A;  5HR1 A;  1TDI A;  5GST A;  4MH2 A;  2CX4 A;  3M3M A;  2LQO A;  2H70 A;  1U88 A;  3ZZX A;  2IMD A;  4XS4 A;  1V40 A;  2RUF A;  4OFN A;  2VUP A;  3QPM A;  3G7J A;  3BCK A;  1LBK A;  4IW9 A;  2JAD A;  4TR1 A;  3UL3 A;  1GTI A;  4XS1 A;  1TXX A;  2HZE B;  3K8N A;  1B8X A;  4V1A p;  6GSV A;  1QGV A;  2IL3 A;  2VL3 A;  2VCV A;  3ZIJ A;  1ON4 A;  4WF4 A;  5DAK A;  2OKA A;  5IIZ A;  2YCD A;  4N30 A;  4N11 A;  5GSS A;  2LS5 A;  1XW5 A;  1U6T A;  3UBK A;  3FKF A;  3CSI A;  2PVQ A;  1TI3 A;  2E2G A;  2IPA A;  1GUL A;  1VF1 A;  1MEK A;  5DQS A;  4GSN A;  2PN8 A;  5G31 A;  1X9S B;  5INY A;  2VCW A;  4WET A;  3GFK A;  4BVY A;  3CRT A;  5CNW A;  1TU7 A;  3F6D A;  3H1N A;  1MDK A;  3QAG A;  5HR2 A;  4RQR A;  2WUL A;  1X9W B;  4LMW A;  2IIY A;  3RPN A;  3TJJ A;  3QFB C;  1OC9 A;  4HU7 A;  2CVB A;  3E3E A;  3UBL A;  2LQQ A;  2HRF A;  2YPM A;  4GCI A;  2HSM A;  3PR8 A;  4FYU A;  3KP8 A;  4ZB9 A;  4PUF C;  4F0B A;  4I2T A;  1ABA A;  4EDY A;  1EP8 A;  5AIS A;  4I2U A;  2VCZ A;  2PUK C;  1FHE A;  4ISD A;  5HFI A;  4OMV A;  3ERF A;  4BVX A;  3P7X A;  4KA0 A;  2H72 A;  2AV4 A;  1SYX A; 
#chains in the Genus database with same CATH topology
 3DVW A;  3ZVJ D;  5IPG A;  4ZIL A;  4ML1 A;  4TOP A;  2YV7 A;  2EFE A;  2XC2 A;  3UEM A;  1JZO A;  5CRW A;  2CZ3 A;  1OYJ A;  3N5O A;  5IOW A;  3I43 A;  4EIQ A;  1N2A A;  2GT6 A;  3W8S A;  1USB A;  1T8E B;  1CQG A;  2OAC A;  1IYH A;  1UN2 A;  4NV2 A;  4AGS A;  3UIW A;  1TP9 A;  1QQ2 A;  1ZGN A;  4Z7X A;  3PIN A;  4FYB A;  3GV1 A;  5F07 A;  1QFN A;  1VF4 A;  3FYG A;  2H71 A;  4CY8 A;  1PL1 A;  4KF9 A;  3JCM L;  4MF6 A;  1WRY A;  2QA1 A;  1Z7R A;  3RDW A;  5J4V A;  4F82 A;  1GSQ A;  1WPI A;  3FHK A;  2VLU A;  2CZ2 A;  1U3I A;  3LXZ A;  4MPG A;  4HJ2 A;  2V2G A;  5A5H B;  2C0D A;  4BWS A;  3QD9 A;  4MAB A;  4QL7 A;  3EPT A;  4KND A;  3ZL5 A;  1PMT A;  4AKH A;  2I3Y A;  5G1K A;  3KIJ A;  1T4Z A;  2VM1 A;  3CTF A;  4PNG A;  2LV3 A;  2GSR A;  3LGC A;  4TKY A;  1O7U A;  4POK A;  3L78 A;  1GWC A;  3IK7 A;  2R2J A;  3GH9 A;  5D8I A;  4K0G A;  4KX4 A;  1Z3E A;  1HYU A;  5H5R A;  3ZFB A;  3A2X A;  1YKC A;  4OO4 A;  3MWH A;  2VD1 A;  4KE3 A;  2IFQ B;  4GTU A;  4IQA A;  3WT1 A;  1M7T A;  1X5D A;  4ZB8 A;  4HSC X;  1GP1 A;  1J0F A;  5J3R A;  3HKR A;  4N10 A;  2YWO A;  4ML6 A;  1GLQ A;  1JFU A;  5B6M A;  4MZW A;  2B1L A;  2DSA A;  2HSH A;  3ZRE A;  4NHW A;  2GS3 A;  3QCP A;  1GRX A;  4MZC A;  2VL2 C;  4NXI A;  1PD2 1;  4ECC A;  4LMV A;  4EF0 A;  1Q98 A;  1U87 A;  3LYK A;  2O85 A;  4POL A;  3HY2 A;  1YDK A;  4NAX A;  1PFO A;  3BCI A;  3DYR A;  3C8E A;  1G7E A;  1O85 A;  3V1W A;  5ID2 B;  4E68 A;  4YAV A;  4ZIJ A;  4XCS A;  2H1D A;  2H0I A;  3KMN A;  2XPD A;  2GT5 A;  2XBI A;  4KDY A;  2MBT A;  4KW6 A;  4HEA 2;  3ME8 A;  2WCI A;  3BOA A;  2Z9S A;  1BF5 A;  5IM9 A;  1SK1 A;  4FYC A;  1NM3 A;  4ILF A;  1ZYE A;  2HSY A;  2O36 A;  1TJD A;  4O5R A;  4DSQ A;  1WMJ A;  1K0A A;  4MMM A;  4QQ7 A;  4E8E A;  1TRU A;  4G9H A;  1XVQ A;  1TTZ A;  3H8Q A;  1XW9 A;  3A5I A;  3GSS A;  1PN9 A;  2UZ8 A;  4PI2 C;  4ZB7 A;  4YQM A;  1I9D A;  3KGK A;  2PMT A;  1O6J A;  1KNG A;  2H1B A;  3RAZ A;  4GQC A;  2ZNM A;  4XS4 B;  3UVH A;  1GSF A;  2WW3 A;  1A8Y A;  1OE8 A;  3ZMK A;  1SEN A;  2OBI A;  1ZYQ B;  4NHZ A;  1GNE A;  4KUN A;  3BD2 A;  1EP7 A;  4W66 A;  3TGZ A;  3KXO A;  2V41 A;  1RK4 A;  5KEJ A;  18GS A;  1K0O A;  3VI5 A;  4E8H A;  2K8V A;  5DAK B;  1XVW A;  2E0Q A;  4MZB A;  5JWR B;  1GSY A;  4KCA A;  1G6W A;  3CXG A;  5BRT A;  3VWV A;  5A34 A;  2K18 A;  4P3Y B;  1ZOF A;  3ZFL A;  4JR4 A;  1YZX A;  2DJK A;  1A2L A;  2LEG A;  4JZQ A;  2L5L A;  3IDV A;  4BVY B;  5B7C A;  3ED3 A;  4J56 E;  2OA7 A;  1EWX A;  6GSW A;  1HNA A;  2C80 A;  1THO A;  2P0G A;  3NZN A;  4AI6 A;  2GZZ A;  1FB6 A;  1OC9 B;  2NPB A;  3EVI A;  2HSM B;  5F8B A;  4JED A;  2F8F A;  5A5H A;  2H66 A;  3HXS A;  2B6M A;  5ELG A;  5A4W A;  4BA7 A;  1DUG A;  4K7O A;  3ZIT A;  3FY7 A;  3QR6 A;  1Y25 A;  4OFM A;  4IP1 A;  1YEX A;  2C1Y A;  3HJM A;  3TB2 A;  3M9J A;  2KP1 A;  4GRF A;  4O92 A;  3GUS A;  2X4A A;  1JHB A;  2F9S A;  3D6I A;  4WBJ A;  4K9Z A;  5C00 A;  2L57 A;  3ERG A;  2HFD A;  3C7M A;  2LRC A;  4OD7 A;  1HNC A;  13GS A;  5AIV A;  5ECP B;  5ELA A;  2XPE A;  2PWJ A;  5D9T A;  2N5F A;  5AGY A;  1QMV A;  2YWI A;  4HDE A;  3TKS E;  2DJ0 A;  2DKH A;  6GST A;  2GQK A;  1GSU A;  5ECN B;  3GTU A;  1AIU A;  5DVB A;  4V2N A;  4YQU A;  2MYG A;  1UC7 A;  5IMV A;  3F0I A;  3GST A;  4F03 A;  2JL4 A;  2VM2 A;  5DAL A;  4WR4 A;  3IAS 2;  4ID0 A;  4TN8 A;  1XCC A;  1M9B A;  1XFL A;  3A2V A;  2PU9 C;  1CQH A;  1HD2 A;  2WVX A;  1BYE A;  1SKW B;  3TDG A;  2JSY A;  3R2Q A;  1PX6 A;  3EMX A;  2YJH A;  4JU5 A;  4GWR A;  1DE2 A;  2WRT A;  4K8M A;  2L59 A;  3TJB A;  4HQS A;  3RBT A;  4OO5 A;  2MMO A;  2OE0 A;  2EFH A;  3LFL A;  3F3R A;  4LLR A;  4AKG A;  4O5U A;  2H01 A;  2LJA A;  4ZBB A;  1EOH A;  3HYP A;  1SJ6 A;  2C3T A;  1DSB A;  5ABR A;  1GTA A;  4WBR D;  4I6X A;  4CDO A;  3CYN A;  1K3Y A;  4IJI A;  3RHC A;  2DC5 A;  2H75 A;  3GIX A;  2PBJ A;  4Z2R A;  2GZY A;  5IMZ A;  5HR0 A;  2GZP A;  1EZK A;  3ZTL A;  1XWC A;  5C04 A;  4K1F A;  2IN3 A;  3MSZ A;  2CAI A;  1PL2 A;  3VI7 A;  3VWX A;  2FCH A;  1K0D A;  3L9V A;  1H4O A;  3A3T A;  4PQH A;  3GKK A;  4G01 A;  4ACS A;  1YQ1 A;  1T1V A;  2YJ7 A;  4HU9 A;  4AJ7 A;  2VO4 A;  4L5L A;  1B4Q A;  2KUC A;  2F3M A;  2I1U A;  5B6N A;  4G0I A;  3D4M A;  4TR3 A;  4K7I A;  5DQY A;  5JWO B;  2TRC P;  4PUA A;  4RQX A;  1AXD A;  4ECB A;  2ZCT A;  4AKI A;  3DRN A;  1BED A;  4K2X A;  5KN3 A;  4K2D A;  4G19 A;  2EFD A;  3QMX A;  1X5C A;  1WWJ A;  3F8U A;  4MCU A;  4D73 B;  2WVY A;  2OBK A;  1FAA A;  1Z5Y E;  2C0G A;  1E6B A;  3ISO A;  1KTE A;  4N0V A;  5J41 A;  2LNS A;  4KSM A;  4L0W A;  1JZW A;  4WEY A;  3HHV A;  2B5X A;  1I1I P;  1TU8 A;  2KLX A;  4ECI A;  2V6O A;  2OAD A;  2V32 A;  2IWT A;  2A2R A;  3HVS A;  1Y1U A;  2YWM A;  2BTO T;  1Z7P A;  3F63 A;  1A0F A;  3GNJ A;  1XW6 A;  4MJE A;  4WF5 A;  4G0K A;  3F4R A;  2H6X A;  3TUE A;  3WGX A;  1XPV A;  2VCX A;  1GSS A;  3KTL A;  2QGV A;  3DIE A;  3MYD A;  4CW9 A;  5E59 A;  4DEJ A;  2NTO A;  1O81 A;  4JRR A;  1JLW A;  5CRE A;  2H8L A;  2LNT A;  2E7P A;  4MJC A;  1R26 A;  3BBY A;  1FOV A;  4I5Q A;  1GUH A;  2AHE A;  5ECM B;  4HZ4 A;  1PKW A;  2R3X A;  3EUR A;  1V58 A;  4MJA A;  4KSO A;  5CYY A;  5EY6 A;  2LTK A;  4L8E A;  5A34 B;  4ZBA A;  3L9U A;  4MPF A;  2YZH A;  3UVT A;  3IR4 A;  5JCW A;  2C3N A;  1SJI A;  3GKM A;  5KN1 A;  3GN3 A;  3QAW A;  2ES7 A;  1ZYN A;  1XBS A;  5J4Y A;  4HQZ A;  3MIX A;  1XWK A;  2HRK A;  1DBY A;  7GSS A;  1SL0 B;  5DCH A;  1NHY A;  2EFC A;  3Q18 A;  2A2S A;  5GAN D;  1QK8 A;  2C0F A;  2YZU A;  4YKF A;  4I97 A;  2YWN A;  3E9J B;  5GZZ B;  5AN1 A;  3CBU A;  4EKZ A;  1JZR A;  1GTB A;  3CSJ A;  3EWL A;  4BWQ A;  2H73 A;  3QOU A;  1PX7 A;  1OE7 A;  1SJZ A;  3GRX A;  2NBS A;  4PQI A;  1QXH A;  4MK3 A;  3NIV A;  3PH9 A;  2HZF A;  3N9J A;  1GSD A;  1F9M A;  3APQ A;  2C8U A;  2V6K A;  1WJK A;  3GH6 A;  4EUY A;  2L5O A;  2VLT A;  1S3C A;  1BQ7 A;  4V2L A;  4IGJ A;  1XOB A;  1T00 A;  2WB9 A;  1SYR A;  5J9B A;  2FLS A;  3US3 A;  2AJQ B;  4Q5F A;  4IN0 A;  5G2Z A;  4ICY A;  1S3R A;  1AQV A;  3CMI A;  3SBC A;  1GUK A;  1ACV A;  5KOX A;  2GDR A;  3GTU B;  1M0U A;  4X43 A;  1ZYP A;  9GSS A;  3F4S A;  4OCF A;  1B4P A;  3D0Z A;  3RPP A;  2JZT A;  2YV9 A;  3LSZ A;  5DAL B;  4Z2U A;  4POB A;  4X4J A;  1E2Y A;  2C3Q A;  3HMJ G;  2VKZ G;  2H74 A;  3C1S A;  2HI7 A;  3TRQ A;  4EXJ A;  3MAK A;  5KN2 A;  1OVN A;  4NMU A;  3VFI A;  5J40 A;  1GLP A;  2LKU A;  2WVX B;  4EIP A;  1SK2 A;  2H6Y A;  2WJU A;  2OE1 A;  2AAW A;  3IHQ A;  5IMD A;  2N5A A;  3H93 A;  4G10 A;  4D73 A;  1XG8 A;  2L6C A;  1THX A;  2IMK A;  4TVE A;  2H0H A;  3DEX A;  3F9U A;  3LOR A;  5E4W A;  3Q74 A;  2HNL A;  3DVX A;  2CA8 A;  2WDU A;  1TKD B;  4ULX A;  4MLY A;  1RW1 A;  3O6T A;  5D9X A;  3A2W A;  2M72 A;  4XRD A;  1N8J A;  1F37 A;  2EC4 A;  4LL4 B;  5J9C A;  2DMM A;  4WKW A;  3ZYW A;  3OR5 A;  2REM A;  3RGB C;  2RM5 A;  1T3B A;  2ON5 A;  2VCT A;  2J23 A;  1X5E A;  5D93 A;  4TXO B;  2M80 A;  1GNW A;  5AIX A;  4J57 E;  2BMX A;  2F8A A;  2ALB A;  4TR4 A;  2X8G A;  2WZS A;  3LXT A;  4FIW A;  1AQX A;  1EEJ A;  1SVO A;  4H86 A;  2KP2 A;  3F4T A;  2GST A;  2GLR A;  1WE0 A;  2VAF A;  3EYT A;  3IPZ A;  4K0N A;  3HVV A;  2CX3 A;  5CAX A;  3TKR A;  3GX0 A;  2FA4 A;  2O89 A;  2OJL A;  1V2A A;  1PKZ A;  3VLN A;  4KB3 A;  1XWG A;  1EOG A;  3HDC A;  3WYW A;  3VWU A;  3MDK A;  1ILO A;  1GUM A;  2LRN A;  4QL9 A;  4IS0 A;  5LCZ A;  3LWA A;  1M99 A;  2PPT A;  1AUC A;  1SK0 A;  3R3E A;  3EMP A;  2JAC A;  2H1L A;  2AYT A;  1V9W A;  4KDX A;  1YEW C;  3PPU A;  2MMA A;  4O7H A;  1ERU A;  3FZ4 A;  2RII A;  1J08 A;  5L71 A;  1WIK A;  2L4Q A;  4N3Z A;  3VUR A;  2J9H A;  1X0R A;  3LQ7 A;  1ERV A;  2P5Q A;  5CRD A;  1XZO A;  3IBH A;  1V98 A;  4HOJ A;  6GSY A;  2ON7 A;  2E2M A;  2XHF A;  1M9A A;  1ZL9 A;  2FWG A;  2B1K A;  5JCG A;  1MD4 A;  3GKN A;  2R5G A;  5B8B A;  3HCZ A;  1TK5 B;  3EIN A;  4AKX B;  1A23 A;  3FZ9 A;  4IKH A;  2WW2 A;  1H75 A;  5DJL A;  4OWY A;  4FH8 A;  1NW2 A;  2H6Z A;  2UV8 G;  2JZR A;  1PSQ A;  3IAM 2;  5ECS A;  22GS A;  3VPQ A;  2FHE A;  4DVC A;  2I9H A;  1F2E A;  4DSS A;  2NVL A;  2FUG 2;  5LD0 A;  1G6Y A;  5ECO B;  4MDC A;  5BMU A;  2AB6 A;  4YH2 A;  3ZML A;  1ZCP A;  3FRC A;  4Z2T A;  3LEF A;  1SKS B;  4I8B A;  3ZLP A;  3KMO A;  3IC4 A;  3GHA A;  3TKQ A;  2HQT A;  2HRK B;  4Q5N A;  1S3A A;  4Q5R A;  2QKE A;  2YAN A;  1V57 A;  1A8L A;  2CVK A;  1YY7 A;  3P8W A;  5HFK A;  3ME7 A;  3D22 A;  2A2P A;  5CRG A;  4GST A;  1F6M C;  2X8H A;  2GQL A;  2CVD A;  3M1G A;  4PQ1 A;  1SU9 A;  2FNO A;  1R5A A;  1VF3 A;  5ECR B;  2NDO A;  3W6G A;  5FHI A;  2PGT A;  1C72 A;  2TIR A;  5COH A;  4EE0 A;  2GTU A;  1BX9 A;  3KJY A;  3O76 A;  3P2A A;  5ECI B;  3LJR A;  3EU3 A;  1TW9 A;  2FY6 A;  1K0M A;  4F2I A;  4IQ1 A;  3C73 A;  1HNB A;  1PQN A;  3TKS A;  4KGI A;  2C0E A;  1K0B A;  4YKG A;  1OC3 A;  3VK9 A;  2YOI A;  1A2M A;  2DLX A;  4LL1 B;  2R4V A;  4KCE A;  5A5K A;  3HJO A;  3WT2 A;  4XTS A;  5IPH A;  1K3L A;  1Y6E A;  2YP6 A;  3I6A A;  3H4K A;  2TRX A;  2JSZ A;  2R6K A;  4MJB A;  2VCQ A;  5ECQ B;  2JU5 A;  4TXO A;  3APO A;  1PRX A;  3IC8 A;  1EGO A;  3LYP A;  3G7I A;  4J2F A;  1ML6 A;  4CHS A;  2MMN A;  5D9W A;  1B9Y C;  3ERW A;  1AQW A;  1MTC A;  1R7H A;  1Q4J A;  3CRU A;  2RLI A;  3UAP A;  2GGT A;  4OFT A;  2EIO A;  4K6X A;  1Z6N A;  3DWV A;  5G30 A;  5EL8 A;  3APS A;  5G5F A;  3DKS A;  4V2M A;  4O32 A;  1OAZ A;  1U3A A;  1VF2 A;  3ZIV A;  1J9B A;  5JWQ B;  5DCG A;  2YNX A;  4ZBD A;  2O8V B;  2FD3 A;  3EC3 A;  5CRH A;  4AJ8 A;  1M2D A;  3Q19 A;  4NWY A;  4ZL8 A;  2H0G A;  2JZS A;  4PHZ C;  3FZ5 A;  3I69 A;  1NSW A;  16GS A;  2PER A;  1AC1 A;  2FA8 A;  2KOK A;  3TOU A;  1AAZ A;  2BJX A;  3IOS A;  1LU4 A;  4RI6 A;  3WD6 A;  4KH7 A;  3O3T A;  3QDN A;  4PXO A;  3ZRD A;  3WGD A;  4ZL9 A;  1HQO A;  4X1U A;  1ST9 A;  4PTS A;  3U6V A;  3GL5 A;  2K9F A;  1N25 A;  1SVL A;  3KD0 A;  2O3E A;  1EGR A;  1R5P A;  4XS6 A;  3TOT A;  1GSE A;  3VPT A;  3NOF A;  4BL7 A;  1YF0 A;  4YQV A;  4K7N A;  19GS A;  1DE1 A;  3FZA A;  1XWB A;  1VRS D;  2CQ9 A;  1A24 A;  2ZUP A;  4IHU A;  3GA4 A;  3KZQ A;  4TW5 A;  3W8J A;  2HSN A;  5F05 A;  3UOM A;  3ZVJ A;  4K5S A;  1UA5 A;  1TRS A;  3QFA C;  2HE3 A;  2CV4 A;  5G5E A;  2B5Y A;  2WFC A;  5G1L A;  2C4J A;  20GS A;  3HVX A;  4F9Z A;  2FGX A;  2QSI A;  3FMW A;  5J47 A;  3M9K A;  4IJ3 A;  6GSS A;  3FR3 A;  1VGL A;  5GAP D;  1TK8 B;  2MBS A;  4MF7 A;  4ZB6 A;  3UJ1 A;  2HLS A;  1MDJ A;  4PX1 A;  2DIY A;  2OE3 A;  4QMK A;  2DKI A;  1PA3 A;  4XRA A;  3IK9 A;  2DJ2 A;  4F0C A;  2WW1 A;  3MNG A;  3CHX C;  1XXU A;  5KN0 A;  4POM A;  3S9F A;  4MA9 A;  2CT6 A;  2DJ3 A;  1IYI A;  3RHB A;  3D4T A;  3TKP A;  2R0P A;  5HR3 A;  2VIM A;  5HFG A;  3KM6 A;  4EL1 A;  4K5R A;  4MF5 A;  2QC7 A;  1B9X C;  3FK8 A;  2VD0 A;  5IO0 A;  3TRX A;  4CY6 A;  1KBN A;  5DJM A;  2DBC A;  2L6D A;  3KH7 A;  1XOA A;  5LNK e;  4RI7 A;  1T4Y A;  5A4U A;  2HT9 A;  5ECH B;  1SKR B;  2B7J A;  4JE1 A;  11GS A;  3RFR C;  3FR6 A;  5FWG A;  2MZC A;  2D2Z A;  5J4U A;  2H1A A;  5B8A A;  3GYK A;  1TRW A;  2FWE A;  4PGT A;  3J7Y k;  5ECL B;  2H19 A;  4G2E A;  4O5Q A;  1S4B P;  3HJP A;  1A2J A;  3FEU A;  4DSS B;  1B48 A;  1ERW A;  5F0G A;  4G0L A;  4X0X A;  1PN0 A;  5F06 A;  3HD5 A;  8GSS A;  5CO3 A;  5BMU B;  5J5N A;  2CAQ A;  1MD3 A;  2PVO C;  3EU4 A;  4L0U A;  3TJG A;  4LA1 A;  1A0R P;  1WOU A;  3GL3 A;  2I81 A;  2EIR A;  2IME A;  4GXZ A;  4AF2 A;  3FW2 A;  4TR0 A;  3G7Y A;  2X64 A;  3GMF A;  2GVP A;  1TI1 A;  2X49 A;  6GSX A;  5HQP A;  1SD9 A;  1R4W A;  1XIY A;  2HZE A;  1F3A A;  2HXK A;  2M46 A;  1WP0 A;  1MDI A;  1F3B A;  17GS A;  4RUV A;  1QUW A;  1TK0 B;  2IMI A;  1G0T A;  1GH2 A;  4FQU A;  3IRA A;  1O8X A;  4GDF A;  1ZMA A;  4HJM A;  1FOH A;  4L5O A;  2WZ9 A;  3IV4 A;  4HUA A;  1Z9H A;  1JZD A;  2FWF A;  5DDL A;  3J7Y b;  2IMF A;  2LST A;  3HZ8 A;  4BPY A;  5A1N B;  3Q6O A;  1LJR A;  2P31 A;  3KTB A;  5ENU A;  2HRA A;  4MP4 A;  1PGT A;  3G9B A;  3KCM A;  4IP6 A;  10GS A;  1M2A A;  2GSS A;  4KAE A;  2H30 A;  3HVN A;  3KP9 A;  3TKS C;  3DML A;  5EVO A;  1EV4 A;  3A5W A;  2RM6 A;  1TXU A;  2FWH A;  2R0C A;  4V1A g;  3TJK A;  2LRT A;  3D5J A;  12GS A;  4HZ2 A;  4TXV A;  5D96 A;  2DJ1 A;  2XBQ A;  4PUR A;  4NPB A;  5D73 A;  2K6V A;  14GS A;  3GKX A;  3KEB A;  3UAR A;  3L0H A;  4HI7 A;  3F3Q A;  3UMA A;  4EDZ A;  5IOX A;  2G0F A;  3DGQ A;  3TCO A;  1FVJ A;  4TR1 B;  4DSR A;  3L9S A;  3U5R E;  3M8N A;  2A4H A;  1SD8 A;  2B5E A;  2VLV A;  3GUR A;  4YAP A;  1BAY A;  1G7O A;  3IXR A;  2R37 A;  2H76 A;  4EC0 A;  2B3S A;  2I4A A;  1OKT A;  1O73 A;  1AW9 A;  5IMC A;  3C71 A;  2IJY A;  1K0N A;  2LJR A;  3DD3 A;  1FW1 A;  4FO5 A;  2WVZ A;  5H5S A;  4GF0 A;  1SL1 B;  2X8C A;  1GL8 A;  2HYX A;  2N5B A;  5JCU A;  3AY8 A;  3HZ4 A;  2WGR A;  2RUE A;  3QAV A;  4IBP A;  2LUS A;  2MMZ A;  3F6F A;  1TRV A;  4Q5Q A;  2H1G A;  1EV9 A;  4OCE A;  3TJF A;  4NV5 A;  4MH3 A;  1ERT A;  3DXB A;  5H5Q A;  1GTU A;  3TU3 B;  5IQY A;  1YJ6 A;  1S3D A;  1FB0 A;  4BL7 B;  3VWW A;  1FO5 A;  1FVK A;  4WXT A;  1JLV A;  1RQM A;  4IVF A;  2GSQ A;  4XIH A;  4GLT A;  4TRX A;  5EPF A;  3SWL A;  2P5R A;  5CP1 A;  1I5G A;  3I9V 2;  2HSN B;  5DBQ A;  1URM A;  2YN1 A;  3IHG A;  4AJ6 A;  5IO2 A;  2VL9 A;  1BJX A;  2DML A;  3PGT A;  4BVX B;  1YKA A;  4EVM A;  2IFQ A;  2DIZ A;  4ZXG A;  3CQF A;  3D21 A;  3IA1 A;  3L4N A;  2GQM A;  4ZL7 A;  1X9M B;  1YF1 A;  2VL2 A;  4JBB A;  2OT3 A;  3WGE A;  3LG6 A;  4GQF A;  4GSS A;  3H79 A;  2O7K A;  1YEP A;  1Z6M A;  3EE2 A;  2EIQ A;  1KEB A;  2LJK A;  3E0U A;  5FT3 A;  3KH9 A;  1SL2 B;  3BJ5 A;  2O87 A;  1M2B A;  2A4V A;  2V1M A;  5IMA A;  1OC8 A;  1BG5 A;  1W4V A;  3TRP A;  3C1R A;  1XWA A;  2X99 A;  5ID2 A;  1UVZ A;  5A4V A;  1EEM A;  3CTG A;  3CSH A;  3GX8 A;  1M3I A;  4XHM A;  4N0Z A;  4USS A;  4ECJ A;  1T7P B;  1K0C A;  5A1N A;  4HS1 A;  2L4C A;  2G2Q A;  4IEL A;  2WS2 A;  1OKD A;  4EO3 A;  1NHO A;  1SVM A;  2DJJ A;  1O8W A;  1K3O A;  2AUV A;  5D9V A;  3IE3 A;  2KHP A;  1TOF A;  5IMF A;  2F51 A;  1ZZY A;  3P90 A;  2VOC A;  3FR9 A;  2HRN A;  6GSU A;  3M0F A;  2K8S A;  4PNF A;  2B7K A;  5ECK B;  4JR6 A;  1W89 A;  3HA9 A;  1FG4 A;  4KDU A;  4A5P A;  4WR5 A;  5HR1 A;  1TDI A;  3CWG A;  2WW0 A;  5GST A;  4MH2 A;  2CX4 A;  3M3M A;  2LQO A;  2H70 A;  1U88 A;  3ZZX A;  2IMD A;  4XS4 A;  1V40 A;  2RUF A;  4OFN A;  2VUP A;  3QPM A;  3G7J A;  3BCK A;  1LBK A;  4IW9 A;  2JAD A;  4TR1 A;  3UL3 A;  1GTI A;  4XS1 A;  4MNN A;  1TXX A;  2HZE B;  3K8N A;  1B8X A;  4V1A p;  6GSV A;  1QGV A;  2R0G A;  2IL3 A;  2VL3 A;  2VCV A;  3ZIJ A;  1ON4 A;  4WF4 A;  5DAK A;  2OKA A;  5IIZ A;  2YCD A;  4N30 A;  2QA2 A;  4N11 A;  5GSS A;  2LS5 A;  1XW5 A;  1U6T A;  3UBK A;  3FKF A;  3CSI A;  2PVQ A;  4PI0 C;  1TI3 A;  2O5V A;  2E2G A;  2IPA A;  1GUL A;  1VF1 A;  1MEK A;  5DQS A;  4GSN A;  2PN8 A;  5G31 A;  1X9S B;  5INY A;  2VCW A;  4WET A;  3GFK A;  4BVY A;  3CRT A;  5CNW A;  1TU7 A;  3F6D A;  3H1N A;  1MDK A;  3QAG A;  5HR2 A;  4RQR A;  2WUL A;  1X9W B;  4LMW A;  2IIY A;  3RPN A;  3TJJ A;  3QFB C;  1OC9 A;  4HU7 A;  1M3J A;  2CVB A;  3E3E A;  3UBL A;  2LQQ A;  2HRF A;  2YPM A;  5KOW A;  4GCI A;  2HSM A;  3PR8 A;  1YVL A;  3LW9 A;  4BIK A;  4FYU A;  3KP8 A;  4FXY P;  4ZB9 A;  4PUF C;  4F0B A;  4I2T A;  1ABA A;  4EDY A;  1EP8 A;  5AIS A;  4I2U A;  2VCZ A;  1BG1 A;  2PUK C;  1FHE A;  4ISD A;  5HFI A;  4OMV A;  3ERF A;  4BVX A;  3P7X A;  4KA0 A;  2H72 A;  2AV4 A;  1SYX A; 
#chains in the Genus database with same CATH homology
 3DVW A;  3ZVJ D;  5IPG A;  4ZIL A;  4ML1 A;  4TOP A;  2YV7 A;  2EFE A;  2XC2 A;  3UEM A;  1JZO A;  5CRW A;  2CZ3 A;  1OYJ A;  3N5O A;  5IOW A;  3I43 A;  4EIQ A;  1N2A A;  2GT6 A;  3W8S A;  1USB A;  1T8E B;  1CQG A;  2OAC A;  1IYH A;  1UN2 A;  4NV2 A;  4AGS A;  3UIW A;  1TP9 A;  1QQ2 A;  1ZGN A;  4Z7X A;  3PIN A;  4FYB A;  3GV1 A;  5F07 A;  1QFN A;  1VF4 A;  3FYG A;  2H71 A;  4CY8 A;  1PL1 A;  4KF9 A;  3JCM L;  4MF6 A;  1WRY A;  2QA1 A;  1Z7R A;  3RDW A;  5J4V A;  4F82 A;  1GSQ A;  1WPI A;  3FHK A;  2VLU A;  2CZ2 A;  1U3I A;  3LXZ A;  4MPG A;  4HJ2 A;  2V2G A;  5A5H B;  2C0D A;  4BWS A;  3QD9 A;  4MAB A;  4QL7 A;  3EPT A;  4KND A;  3ZL5 A;  1PMT A;  4AKH A;  2I3Y A;  5G1K A;  3KIJ A;  1T4Z A;  2VM1 A;  3CTF A;  4PNG A;  2LV3 A;  2GSR A;  3LGC A;  4TKY A;  1O7U A;  4POK A;  3L78 A;  1GWC A;  3IK7 A;  2R2J A;  3GH9 A;  5D8I A;  4K0G A;  4KX4 A;  1Z3E A;  1HYU A;  5H5R A;  3ZFB A;  3A2X A;  1YKC A;  4OO4 A;  3MWH A;  2VD1 A;  4KE3 A;  2IFQ B;  4GTU A;  4IQA A;  3WT1 A;  1M7T A;  1X5D A;  4ZB8 A;  1GP1 A;  1J0F A;  5J3R A;  3HKR A;  4N10 A;  2YWO A;  4ML6 A;  1GLQ A;  1JFU A;  5B6M A;  4MZW A;  2B1L A;  2DSA A;  2HSH A;  3ZRE A;  4NHW A;  2GS3 A;  3QCP A;  1GRX A;  4MZC A;  2VL2 C;  4NXI A;  1PD2 1;  4ECC A;  4LMV A;  4EF0 A;  1Q98 A;  1U87 A;  3LYK A;  2O85 A;  4POL A;  3HY2 A;  1YDK A;  4NAX A;  3BCI A;  3DYR A;  3C8E A;  1G7E A;  1O85 A;  3V1W A;  5ID2 B;  4E68 A;  4YAV A;  4ZIJ A;  4XCS A;  2H1D A;  2H0I A;  3KMN A;  2XPD A;  2GT5 A;  2XBI A;  4KDY A;  2MBT A;  4KW6 A;  4HEA 2;  3ME8 A;  2WCI A;  3BOA A;  2Z9S A;  1BF5 A;  5IM9 A;  1SK1 A;  4FYC A;  1NM3 A;  4ILF A;  1ZYE A;  2HSY A;  1TJD A;  4O5R A;  4DSQ A;  1WMJ A;  1K0A A;  4MMM A;  4QQ7 A;  4E8E A;  1TRU A;  4G9H A;  1XVQ A;  1TTZ A;  3H8Q A;  1XW9 A;  3A5I A;  3GSS A;  1PN9 A;  2UZ8 A;  4ZB7 A;  4YQM A;  1I9D A;  3KGK A;  2PMT A;  1O6J A;  1KNG A;  2H1B A;  3RAZ A;  4GQC A;  2ZNM A;  4XS4 B;  3UVH A;  1GSF A;  1A8Y A;  1OE8 A;  3ZMK A;  1SEN A;  2OBI A;  1ZYQ B;  4NHZ A;  1GNE A;  4KUN A;  3BD2 A;  1EP7 A;  4W66 A;  3TGZ A;  3KXO A;  2V41 A;  1RK4 A;  5KEJ A;  18GS A;  1K0O A;  3VI5 A;  4E8H A;  2K8V A;  5DAK B;  1XVW A;  2E0Q A;  4MZB A;  5JWR B;  1GSY A;  4KCA A;  1G6W A;  3CXG A;  5BRT A;  3VWV A;  5A34 A;  2K18 A;  4P3Y B;  1ZOF A;  3ZFL A;  4JR4 A;  1YZX A;  2DJK A;  1A2L A;  2LEG A;  4JZQ A;  2L5L A;  3IDV A;  4BVY B;  5B7C A;  3ED3 A;  4J56 E;  2OA7 A;  1EWX A;  6GSW A;  1HNA A;  2C80 A;  1THO A;  2P0G A;  3NZN A;  4AI6 A;  2GZZ A;  1FB6 A;  1OC9 B;  2NPB A;  3EVI A;  2HSM B;  5F8B A;  4JED A;  2F8F A;  5A5H A;  2H66 A;  3HXS A;  2B6M A;  5ELG A;  5A4W A;  4BA7 A;  1DUG A;  4K7O A;  3ZIT A;  3FY7 A;  3QR6 A;  1Y25 A;  4OFM A;  4IP1 A;  1YEX A;  2C1Y A;  3HJM A;  3TB2 A;  3M9J A;  2KP1 A;  4GRF A;  4O92 A;  3GUS A;  2X4A A;  1JHB A;  2F9S A;  3D6I A;  4WBJ A;  4K9Z A;  5C00 A;  2L57 A;  3ERG A;  2HFD A;  3C7M A;  2LRC A;  4OD7 A;  1HNC A;  13GS A;  5AIV A;  5ECP B;  5ELA A;  2XPE A;  2PWJ A;  5D9T A;  2N5F A;  5AGY A;  1QMV A;  2YWI A;  4HDE A;  3TKS E;  2DJ0 A;  2DKH A;  6GST A;  2GQK A;  1GSU A;  5ECN B;  3GTU A;  1AIU A;  5DVB A;  4V2N A;  4YQU A;  2MYG A;  1UC7 A;  5IMV A;  3F0I A;  3GST A;  4F03 A;  2JL4 A;  2VM2 A;  5DAL A;  4WR4 A;  3IAS 2;  4ID0 A;  4TN8 A;  1XCC A;  1M9B A;  1XFL A;  3A2V A;  2PU9 C;  1CQH A;  1HD2 A;  1BYE A;  1SKW B;  3TDG A;  2JSY A;  3R2Q A;  1PX6 A;  3EMX A;  2YJH A;  4JU5 A;  4GWR A;  1DE2 A;  2WRT A;  4K8M A;  2L59 A;  3TJB A;  4HQS A;  3RBT A;  4OO5 A;  2MMO A;  2OE0 A;  2EFH A;  3LFL A;  3F3R A;  4LLR A;  4AKG A;  4O5U A;  2H01 A;  2LJA A;  4ZBB A;  1EOH A;  3HYP A;  1SJ6 A;  2C3T A;  1DSB A;  5ABR A;  1GTA A;  4WBR D;  4I6X A;  4CDO A;  3CYN A;  1K3Y A;  4IJI A;  3RHC A;  2DC5 A;  2H75 A;  3GIX A;  2PBJ A;  4Z2R A;  2GZY A;  5IMZ A;  5HR0 A;  2GZP A;  1EZK A;  3ZTL A;  1XWC A;  5C04 A;  4K1F A;  2IN3 A;  3MSZ A;  2CAI A;  1PL2 A;  3VI7 A;  3VWX A;  2FCH A;  1K0D A;  3L9V A;  1H4O A;  3A3T A;  4PQH A;  3GKK A;  4G01 A;  4ACS A;  1YQ1 A;  1T1V A;  2YJ7 A;  4HU9 A;  4AJ7 A;  2VO4 A;  4L5L A;  1B4Q A;  2KUC A;  2F3M A;  2I1U A;  5B6N A;  4G0I A;  3D4M A;  4TR3 A;  4K7I A;  5DQY A;  5JWO B;  2TRC P;  4PUA A;  4RQX A;  1AXD A;  4ECB A;  2ZCT A;  4AKI A;  3DRN A;  1BED A;  4K2X A;  5KN3 A;  4K2D A;  4G19 A;  2EFD A;  3QMX A;  1X5C A;  1WWJ A;  3F8U A;  4MCU A;  4D73 B;  2OBK A;  1FAA A;  1Z5Y E;  2C0G A;  1E6B A;  3ISO A;  1KTE A;  4N0V A;  5J41 A;  2LNS A;  4KSM A;  4L0W A;  1JZW A;  4WEY A;  3HHV A;  2B5X A;  1TU8 A;  2KLX A;  4ECI A;  2V6O A;  2OAD A;  2V32 A;  2IWT A;  2A2R A;  3HVS A;  1Y1U A;  2YWM A;  2BTO T;  1Z7P A;  3F63 A;  1A0F A;  3GNJ A;  1XW6 A;  4MJE A;  4WF5 A;  4G0K A;  3F4R A;  2H6X A;  3TUE A;  3WGX A;  1XPV A;  2VCX A;  1GSS A;  3KTL A;  2QGV A;  3DIE A;  3MYD A;  4CW9 A;  5E59 A;  4DEJ A;  2NTO A;  1O81 A;  4JRR A;  1JLW A;  5CRE A;  2H8L A;  2LNT A;  2E7P A;  4MJC A;  1R26 A;  3BBY A;  1FOV A;  4I5Q A;  1GUH A;  2AHE A;  5ECM B;  4HZ4 A;  1PKW A;  2R3X A;  3EUR A;  1V58 A;  4MJA A;  4KSO A;  5CYY A;  5EY6 A;  2LTK A;  4L8E A;  5A34 B;  4ZBA A;  3L9U A;  4MPF A;  2YZH A;  3UVT A;  3IR4 A;  5JCW A;  2C3N A;  1SJI A;  3GKM A;  5KN1 A;  3GN3 A;  3QAW A;  2ES7 A;  1ZYN A;  1XBS A;  5J4Y A;  4HQZ A;  3MIX A;  1XWK A;  2HRK A;  1DBY A;  7GSS A;  1SL0 B;  5DCH A;  1NHY A;  2EFC A;  3Q18 A;  2A2S A;  5GAN D;  1QK8 A;  2C0F A;  2YZU A;  4YKF A;  4I97 A;  2YWN A;  3E9J B;  5GZZ B;  5AN1 A;  3CBU A;  4EKZ A;  1JZR A;  1GTB A;  3CSJ A;  3EWL A;  4BWQ A;  2H73 A;  3QOU A;  1PX7 A;  1OE7 A;  1SJZ A;  3GRX A;  2NBS A;  4PQI A;  1QXH A;  4MK3 A;  3NIV A;  3PH9 A;  2HZF A;  3N9J A;  1GSD A;  1F9M A;  3APQ A;  2C8U A;  2V6K A;  1WJK A;  3GH6 A;  4EUY A;  2L5O A;  2VLT A;  1S3C A;  1BQ7 A;  4V2L A;  4IGJ A;  1XOB A;  1T00 A;  2WB9 A;  1SYR A;  5J9B A;  2FLS A;  3US3 A;  2AJQ B;  4Q5F A;  4IN0 A;  5G2Z A;  4ICY A;  1AQV A;  3CMI A;  3SBC A;  1GUK A;  1ACV A;  5KOX A;  2GDR A;  3GTU B;  1M0U A;  4X43 A;  1ZYP A;  9GSS A;  3F4S A;  4OCF A;  1B4P A;  3D0Z A;  3RPP A;  2JZT A;  2YV9 A;  3LSZ A;  5DAL B;  4Z2U A;  4POB A;  4X4J A;  1E2Y A;  2C3Q A;  3HMJ G;  2VKZ G;  2H74 A;  3C1S A;  2HI7 A;  3TRQ A;  4EXJ A;  3MAK A;  5KN2 A;  1OVN A;  4NMU A;  3VFI A;  5J40 A;  1GLP A;  2LKU A;  4EIP A;  1SK2 A;  2H6Y A;  2WJU A;  2OE1 A;  2AAW A;  3IHQ A;  5IMD A;  2N5A A;  3H93 A;  4G10 A;  4D73 A;  2L6C A;  1THX A;  2IMK A;  4TVE A;  2H0H A;  3DEX A;  3F9U A;  3LOR A;  5E4W A;  3Q74 A;  2HNL A;  3DVX A;  2CA8 A;  2WDU A;  1TKD B;  4ULX A;  4MLY A;  1RW1 A;  3O6T A;  5D9X A;  3A2W A;  2M72 A;  4XRD A;  1N8J A;  1F37 A;  2EC4 A;  4LL4 B;  5J9C A;  2DMM A;  4WKW A;  3ZYW A;  3OR5 A;  2REM A;  2RM5 A;  1T3B A;  2ON5 A;  2VCT A;  2J23 A;  1X5E A;  5D93 A;  4TXO B;  2M80 A;  1GNW A;  5AIX A;  4J57 E;  2BMX A;  2F8A A;  2ALB A;  4TR4 A;  2X8G A;  3LXT A;  4FIW A;  1AQX A;  1EEJ A;  1SVO A;  4H86 A;  2KP2 A;  3F4T A;  2GST A;  2GLR A;  1WE0 A;  2VAF A;  3EYT A;  3IPZ A;  4K0N A;  3HVV A;  2CX3 A;  5CAX A;  3TKR A;  3GX0 A;  2FA4 A;  2O89 A;  2OJL A;  1V2A A;  1PKZ A;  3VLN A;  4KB3 A;  1XWG A;  1EOG A;  3HDC A;  3WYW A;  3VWU A;  3MDK A;  1ILO A;  1GUM A;  2LRN A;  4QL9 A;  4IS0 A;  5LCZ A;  3LWA A;  1M99 A;  2PPT A;  1AUC A;  1SK0 A;  3R3E A;  3EMP A;  2JAC A;  2H1L A;  2AYT A;  1V9W A;  4KDX A;  3PPU A;  2MMA A;  4O7H A;  1ERU A;  3FZ4 A;  2RII A;  1J08 A;  5L71 A;  1WIK A;  2L4Q A;  4N3Z A;  3VUR A;  2J9H A;  1X0R A;  3LQ7 A;  1ERV A;  2P5Q A;  5CRD A;  1XZO A;  3IBH A;  1V98 A;  4HOJ A;  6GSY A;  2ON7 A;  2E2M A;  2XHF A;  1M9A A;  1ZL9 A;  2FWG A;  2B1K A;  5JCG A;  1MD4 A;  3GKN A;  2R5G A;  5B8B A;  3HCZ A;  1TK5 B;  3EIN A;  4AKX B;  1A23 A;  3FZ9 A;  4IKH A;  1H75 A;  4OWY A;  5DJL A;  4FH8 A;  1NW2 A;  2H6Z A;  2UV8 G;  2JZR A;  1PSQ A;  3IAM 2;  5ECS A;  22GS A;  3VPQ A;  2FHE A;  4DVC A;  2I9H A;  1F2E A;  4DSS A;  2NVL A;  2FUG 2;  5LD0 A;  1G6Y A;  5ECO B;  4MDC A;  5BMU A;  2AB6 A;  4YH2 A;  3ZML A;  1ZCP A;  3FRC A;  4Z2T A;  3LEF A;  1SKS B;  4I8B A;  3ZLP A;  3KMO A;  3IC4 A;  3GHA A;  3TKQ A;  2HQT A;  2HRK B;  4Q5N A;  1S3A A;  4Q5R A;  2QKE A;  2YAN A;  1V57 A;  1A8L A;  2CVK A;  1YY7 A;  3P8W A;  5HFK A;  3ME7 A;  3D22 A;  2A2P A;  5CRG A;  4GST A;  1F6M C;  2X8H A;  2GQL A;  2CVD A;  3M1G A;  4PQ1 A;  1SU9 A;  2FNO A;  1R5A A;  1VF3 A;  5ECR B;  2NDO A;  3W6G A;  5FHI A;  2PGT A;  1C72 A;  2TIR A;  5COH A;  4EE0 A;  2GTU A;  1BX9 A;  3KJY A;  3O76 A;  3P2A A;  5ECI B;  3LJR A;  3EU3 A;  1TW9 A;  2FY6 A;  1K0M A;  4F2I A;  4IQ1 A;  3C73 A;  1HNB A;  1PQN A;  3TKS A;  4KGI A;  2C0E A;  1K0B A;  4YKG A;  1OC3 A;  3VK9 A;  2YOI A;  1A2M A;  2DLX A;  4LL1 B;  2R4V A;  4KCE A;  5A5K A;  3HJO A;  3WT2 A;  4XTS A;  5IPH A;  1K3L A;  1Y6E A;  2YP6 A;  3I6A A;  3H4K A;  2TRX A;  2JSZ A;  2R6K A;  4MJB A;  2VCQ A;  5ECQ B;  2JU5 A;  4TXO A;  3APO A;  1PRX A;  3IC8 A;  1EGO A;  3LYP A;  3G7I A;  4J2F A;  1ML6 A;  4CHS A;  2MMN A;  5D9W A;  1B9Y C;  3ERW A;  1AQW A;  1MTC A;  1R7H A;  1Q4J A;  3CRU A;  2RLI A;  3UAP A;  2GGT A;  4OFT A;  2EIO A;  4K6X A;  1Z6N A;  3DWV A;  5G30 A;  5EL8 A;  3APS A;  5G5F A;  3DKS A;  4V2M A;  4O32 A;  1OAZ A;  1U3A A;  1VF2 A;  3ZIV A;  1J9B A;  5JWQ B;  5DCG A;  2YNX A;  4ZBD A;  2O8V B;  2FD3 A;  3EC3 A;  5CRH A;  4AJ8 A;  1M2D A;  3Q19 A;  4NWY A;  4ZL8 A;  2H0G A;  2JZS A;  3FZ5 A;  3I69 A;  1NSW A;  16GS A;  2PER A;  1AC1 A;  2FA8 A;  2KOK A;  3TOU A;  1AAZ A;  2BJX A;  3IOS A;  1LU4 A;  4RI6 A;  3WD6 A;  4KH7 A;  3O3T A;  3QDN A;  4PXO A;  3ZRD A;  3WGD A;  4ZL9 A;  1HQO A;  4X1U A;  1ST9 A;  4PTS A;  3U6V A;  3GL5 A;  2K9F A;  1N25 A;  1SVL A;  3KD0 A;  1EGR A;  1R5P A;  4XS6 A;  3TOT A;  1GSE A;  3VPT A;  3NOF A;  4BL7 A;  1YF0 A;  4YQV A;  4K7N A;  19GS A;  1DE1 A;  3FZA A;  1XWB A;  1VRS D;  2CQ9 A;  1A24 A;  2ZUP A;  4IHU A;  3GA4 A;  3KZQ A;  4TW5 A;  3W8J A;  2HSN A;  5F05 A;  3UOM A;  3ZVJ A;  4K5S A;  1UA5 A;  1TRS A;  3QFA C;  2HE3 A;  2CV4 A;  5G5E A;  2B5Y A;  2WFC A;  5G1L A;  2C4J A;  20GS A;  3HVX A;  4F9Z A;  2FGX A;  2QSI A;  3FMW A;  5J47 A;  3M9K A;  4IJ3 A;  6GSS A;  3FR3 A;  1VGL A;  5GAP D;  1TK8 B;  2MBS A;  4MF7 A;  4ZB6 A;  3UJ1 A;  2HLS A;  1MDJ A;  4PX1 A;  2DIY A;  2OE3 A;  4QMK A;  2DKI A;  1PA3 A;  4XRA A;  3IK9 A;  2DJ2 A;  4F0C A;  3MNG A;  1XXU A;  5KN0 A;  4POM A;  3S9F A;  4MA9 A;  2CT6 A;  2DJ3 A;  1IYI A;  3RHB A;  3D4T A;  3TKP A;  2R0P A;  5HR3 A;  2VIM A;  5HFG A;  3KM6 A;  4EL1 A;  4K5R A;  4MF5 A;  2QC7 A;  1B9X C;  3FK8 A;  2VD0 A;  5IO0 A;  3TRX A;  4CY6 A;  1KBN A;  5DJM A;  2DBC A;  2L6D A;  3KH7 A;  1XOA A;  5LNK e;  4RI7 A;  1T4Y A;  5A4U A;  2HT9 A;  5ECH B;  1SKR B;  2B7J A;  4JE1 A;  11GS A;  3FR6 A;  5FWG A;  2MZC A;  2D2Z A;  5J4U A;  2H1A A;  5B8A A;  3GYK A;  1TRW A;  2FWE A;  4PGT A;  3J7Y k;  5ECL B;  2H19 A;  4G2E A;  4O5Q A;  3HJP A;  1A2J A;  3FEU A;  4DSS B;  1B48 A;  1ERW A;  5F0G A;  4G0L A;  4X0X A;  1PN0 A;  5F06 A;  3HD5 A;  8GSS A;  5CO3 A;  5BMU B;  5J5N A;  2CAQ A;  1MD3 A;  2PVO C;  3EU4 A;  4L0U A;  3TJG A;  4LA1 A;  1A0R P;  1WOU A;  3GL3 A;  2I81 A;  2EIR A;  2IME A;  4GXZ A;  4AF2 A;  3FW2 A;  4TR0 A;  3G7Y A;  2X64 A;  3GMF A;  2GVP A;  1TI1 A;  2X49 A;  6GSX A;  5HQP A;  1SD9 A;  1R4W A;  1XIY A;  2HZE A;  1F3A A;  2HXK A;  2M46 A;  1WP0 A;  1MDI A;  1F3B A;  17GS A;  4RUV A;  1QUW A;  1TK0 B;  2IMI A;  1G0T A;  1GH2 A;  4FQU A;  3IRA A;  1O8X A;  4GDF A;  1ZMA A;  4HJM A;  1FOH A;  4L5O A;  2WZ9 A;  3IV4 A;  4HUA A;  1Z9H A;  1JZD A;  2FWF A;  5DDL A;  3J7Y b;  2IMF A;  2LST A;  3HZ8 A;  4BPY A;  5A1N B;  3Q6O A;  1LJR A;  2P31 A;  3KTB A;  5ENU A;  2HRA A;  4MP4 A;  1PGT A;  3G9B A;  3KCM A;  4IP6 A;  10GS A;  1M2A A;  2GSS A;  4KAE A;  2H30 A;  3KP9 A;  3TKS C;  3DML A;  5EVO A;  1EV4 A;  3A5W A;  2RM6 A;  1TXU A;  2FWH A;  2R0C A;  4V1A g;  3TJK A;  2LRT A;  3D5J A;  12GS A;  4HZ2 A;  4TXV A;  5D96 A;  2DJ1 A;  2XBQ A;  4PUR A;  4NPB A;  5D73 A;  2K6V A;  14GS A;  3GKX A;  3KEB A;  3UAR A;  3L0H A;  4HI7 A;  3F3Q A;  3UMA A;  4EDZ A;  5IOX A;  2G0F A;  3DGQ A;  3TCO A;  1FVJ A;  4TR1 B;  4DSR A;  3L9S A;  3U5R E;  3M8N A;  2A4H A;  1SD8 A;  2B5E A;  2VLV A;  3GUR A;  4YAP A;  1BAY A;  1G7O A;  3IXR A;  2R37 A;  2H76 A;  4EC0 A;  2B3S A;  2I4A A;  1OKT A;  1O73 A;  1AW9 A;  5IMC A;  3C71 A;  2IJY A;  1K0N A;  2LJR A;  3DD3 A;  1FW1 A;  4FO5 A;  5H5S A;  1SL1 B;  4GF0 A;  2X8C A;  1GL8 A;  2HYX A;  2N5B A;  5JCU A;  3AY8 A;  3HZ4 A;  2WGR A;  2RUE A;  3QAV A;  4IBP A;  2LUS A;  2MMZ A;  3F6F A;  1TRV A;  4Q5Q A;  2H1G A;  1EV9 A;  4OCE A;  3TJF A;  4NV5 A;  4MH3 A;  1ERT A;  3DXB A;  5H5Q A;  1GTU A;  3TU3 B;  5IQY A;  1YJ6 A;  1S3D A;  1FB0 A;  4BL7 B;  3VWW A;  1FO5 A;  1FVK A;  4WXT A;  1JLV A;  1RQM A;  4IVF A;  2GSQ A;  4XIH A;  4GLT A;  4TRX A;  5EPF A;  3SWL A;  2P5R A;  5CP1 A;  1I5G A;  3I9V 2;  2HSN B;  5DBQ A;  1URM A;  2YN1 A;  3IHG A;  4AJ6 A;  5IO2 A;  2VL9 A;  1BJX A;  2DML A;  3PGT A;  4BVX B;  1YKA A;  4EVM A;  2IFQ A;  2DIZ A;  4ZXG A;  3D21 A;  3IA1 A;  3L4N A;  2GQM A;  4ZL7 A;  1X9M B;  1YF1 A;  2VL2 A;  4JBB A;  2OT3 A;  3WGE A;  3LG6 A;  4GQF A;  4GSS A;  3H79 A;  2O7K A;  1YEP A;  1Z6M A;  3EE2 A;  2EIQ A;  1KEB A;  2LJK A;  3E0U A;  5FT3 A;  3KH9 A;  1SL2 B;  3BJ5 A;  2O87 A;  1M2B A;  2A4V A;  2V1M A;  5IMA A;  1OC8 A;  1BG5 A;  1W4V A;  3TRP A;  3C1R A;  1XWA A;  2X99 A;  5ID2 A;  1UVZ A;  5A4V A;  1EEM A;  3CTG A;  3CSH A;  3GX8 A;  4XHM A;  4N0Z A;  4USS A;  4ECJ A;  1T7P B;  1K0C A;  5A1N A;  4HS1 A;  2L4C A;  2G2Q A;  4IEL A;  2WS2 A;  1OKD A;  4EO3 A;  1NHO A;  1SVM A;  2DJJ A;  1O8W A;  1K3O A;  2AUV A;  5D9V A;  3IE3 A;  2KHP A;  1TOF A;  5IMF A;  2F51 A;  1ZZY A;  3P90 A;  2VOC A;  3FR9 A;  2HRN A;  6GSU A;  3M0F A;  2K8S A;  4PNF A;  2B7K A;  5ECK B;  4JR6 A;  1W89 A;  3HA9 A;  1FG4 A;  4KDU A;  4A5P A;  4WR5 A;  5HR1 A;  1TDI A;  3CWG A;  5GST A;  4MH2 A;  2CX4 A;  3M3M A;  2LQO A;  2H70 A;  1U88 A;  3ZZX A;  2IMD A;  4XS4 A;  1V40 A;  2RUF A;  4OFN A;  2VUP A;  3QPM A;  3G7J A;  3BCK A;  1LBK A;  4IW9 A;  2JAD A;  4TR1 A;  3UL3 A;  1GTI A;  4XS1 A;  4MNN A;  1TXX A;  2HZE B;  3K8N A;  1B8X A;  4V1A p;  6GSV A;  1QGV A;  2R0G A;  2IL3 A;  2VL3 A;  2VCV A;  3ZIJ A;  1ON4 A;  4WF4 A;  5DAK A;  2OKA A;  5IIZ A;  2YCD A;  4N30 A;  2QA2 A;  4N11 A;  5GSS A;  2LS5 A;  1XW5 A;  1U6T A;  3UBK A;  3FKF A;  3CSI A;  2PVQ A;  1TI3 A;  2O5V A;  2E2G A;  2IPA A;  1GUL A;  1VF1 A;  1MEK A;  5DQS A;  4GSN A;  2PN8 A;  5G31 A;  1X9S B;  5INY A;  2VCW A;  4WET A;  3GFK A;  4BVY A;  3CRT A;  5CNW A;  1TU7 A;  3F6D A;  3H1N A;  1MDK A;  3QAG A;  5HR2 A;  4RQR A;  2WUL A;  1X9W B;  4LMW A;  2IIY A;  3RPN A;  3TJJ A;  3QFB C;  1OC9 A;  4HU7 A;  2CVB A;  3E3E A;  3UBL A;  2LQQ A;  2HRF A;  2YPM A;  5KOW A;  4GCI A;  2HSM A;  3PR8 A;  1YVL A;  3LW9 A;  4FYU A;  3KP8 A;  4ZB9 A;  4PUF C;  4F0B A;  4I2T A;  1ABA A;  4EDY A;  1EP8 A;  5AIS A;  4I2U A;  2VCZ A;  1BG1 A;  2PUK C;  1FHE A;  4ISD A;  5HFI A;  4OMV A;  3ERF A;  4BVX A;  3P7X A;  4KA0 A;  2H72 A;  2AV4 A;  1SYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...