3RBTA

Crystal structure of glutathione s-transferase omega 3 from the silkworm bombyx mori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
VIPPPALTDKLRLYHVDMNPYGHRVLLVLEAKRIKYEVYRLDPLRLPEWFRAKNPRLKIPVLEIPTDQGDRFLFESVVICDYLDEKYTRHTLHSHDPYVKAQDRLLIERFNELIKGSLECFDTNFAFGSEQIIQTLEIFEKELTNRGTNYFGGNRPGMLDYMVWPWVERLYLLRCVNDRKFVEKKSLFPNFADWGDQMQLDDIVKKHAHSPQEYFDYYKNARAHSMGYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided activity restoration of the silkworm glutathione transferase Omega GSTO3-3
pubmed doi rcsb
molecule keywords Glutathione transferase o1
molecule tags Transferase
source organism Bombyx mori
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3rbtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3rbtA01
4KF9A 3EU3A 4K2DA 2HQTA 3GYKA 1K3LA 5J4UA 5IMVA 1AQXA 6GSYA 2LS5A 2DSAA 2HZFA 1X0RA 4KDUA 3FHKA 3KD0A 2R5GA 3G9BA 2LEGA 3D21A 5ECSA 2V1MA 1AQWA 1T4YA 4PNGA 2YV9A 2G0FA 3WGXA 1XCCA 2CAQA 1Z9HA 4WETA 4ZBAA 3EWLA 3UIWA 2OKAA 3UMAA 1W4VA 1GTAA 4MJEA 3GKKA 5EY6A 3HJOA 2B6MA 4N10A 2XPEA 1MDIA 1UC7A 1O7UA 1PGTA 1T7PB 3IXRA 1PKZA 4XCSA 3M1GA 4RQXA 3QOUA 4GF0A 5D8IA 5D73A 1R7HA 4AGSA 1Z5YE 4BA7A 5AISA 2L59A 1X5EA 4IN0A 1FHEA 1EP8A 3QAWA 14GSA 4JR6A 2C80A 2YWMA 3GFKA 5DVBA 2FLSA 4L0UA 3U5RE 3EMPA 1TOFA 4YH2A 2FY6A 3FZ5A 1AUCA 3N9JA 1GLPA 1SU9A 1VF2A 2IMFA 2LSTA 4BVYA 3F3QA 3GUSA 5LNKe 4POLA 1O85A 1NW2A 4RI6A 5HR3A 3ZLPA 1S3CA 5IMZA 2YCDA 2D2ZA 3CBUA 2VLVA 1ZGNA 5ECKB 2CVDA 3IC4A 4NHWA 2GZYA 2IL3A 6GSWA 3F3RA 1PL1A 1K0DA 4OFMA 6GSSA 4CW9A 1F37A 4HJ2A 3C1RA 2HXKA 2K6VA 3GKNA 5IO0A 2IN3A 1GSSA 2CZ2A 4MF6A 4TXVA 4KDXA 3U6VA 3LWAA 1EV9A 3C1SA 1R26A 2E2MA 1TRSA 1AQVA 2GQKA 5ECOB 4OD7A 1I9DA 2ON7A 2L5OA 4V1Ag 3IRAA 2BJXA 2AYTA 3SWLA 4I2UA 3MAKA 3ERWA 2C3TA 4AJ6A 4POKA 2QGVA 4IGJA 3GX8A 4O5RA 4TVEA 3F6DA 3QFBC 4HJMA 4N11A 5CRGA 3TB2A 4NAXA 4XS6A 5IMFA 1XBSA 2JZSA 2VCXA 4QL7A 1MDKA 2L4CA 4JZQA 1WP0A 3EE2A 5ID2B 1KBNA 1XVQA 2IFQB 1O8WA 3BCIA 1EEMA 3MWHA 3G7IA 3HVSA 2CV4A 3ZIVA 1DBYA 3ZIJA 5DJMA 1YKAA 2DJJA 1JZDA 4K7IA 4ECCA 4DEJA 4OCEA 4EVMA 3TOTA 2YZUA 4EC0A 1SKSB 3BJ5A 2C8UA 4KGIA 4LLRA 1BG5A 2OBKA 2BTOT 1XFLA 2TRXA 4JBBA 4XIHA 1USBA 4XRDA 1A2JA 3DEXA 1K3YA 2X8HA 1GNWA 3BOAA 1XW6A 4GSTA 3MDKA 2PGTA 3LQ7A 5FWGA 2WCIA 2HLSA 2JSZA 4RI7A 1TU8A 4HS1A 4NHZA 3IDVA 3GH6A 2VCQA 1JHBA 1YF0A 1SJ6A 5IMCA 1UA5A 1PRXA 4BL7A 3VLNA 3TJJA 4TN8A 5DDLA 3O76A 3HA9A 3W8JA 1XW5A 2TRCP 3A2XA 3KM6A 1SK1A 5ECQB 1ERWA 1TW9A 2L4QA 1ERTA 2HZEB 2IWTA 2GGTA 3UEMA 4IJ3A 3HD5A 4ZL8A 1ZMAA 4KX4A 4OWYA 5H5QA 3F8UA 1DE1A 2DIYA 1TJDA 3D4MA 2JL4A 1K0AA 3UVHA 1OKTA 3HY2A 2O89A 3TCOA 5AN1A 1K3OA 1EGOA 2VO4A 1FW1A 3M9JA 5IMDA 1EP7A 4MA9A 2A2RA 2VAFA 2HRFA 2FHEA 5A4WA 2YJ7A 3KGKA 3KCMA 3TJKA 1U3AA 1OE8A 1Q4JA 5GAPD 4NWYA 3IA1A 2VM1A 4TR1A 2GQLA 9GSSA 3D4TA 4O92A 1GUHA 4DSRA 4XS4A 2GQMA 4MPGA 1O6JA 3F0IA 3PH9A 1WJKA 2HFDA 2MMZA 3WGDA 2DJ1A 4Q5FA 4BVXA 4F03A 4KSMA 1A0FA 2MBSA 3RHBA 3RBTA 2GTUA 5D96A 3ZVJA 4O32A 1TRVA 1G6YA 2B1KA 3FW2A 3TRXA 4XTSA 1YKCA 2YV7A 4MZWA 2B3SA 4PQ1A 2VCWA 1OVNA 4GWRA 2YWNA 2EIRA 3LORA 1SD9A 7GSSA 1V40A 3GSSA 3CYNA 4G0IA 4HU9A 3QMXA 1RK4A 4IELA 3IHQA 2HSMB 3ME7A 1SK0A 3DVXA 3RPNA 5AIXA 3RPPA 3ZMKA 1NSWA 2V6OA 3TGZA 1WMJA 2X8CA 1GRXA 4E8HA 1YZXA 3J7Yb 1GUMA 1TRUA 1PD21 1VGLA 1YQ1A 4XRAA 1O81A 4F0BA 1QXHA 1NM3A 3PGTA 3FK8A 4ZBBA 3VPTA 2H30A 2KP1A 3VWWA 5B6NA 1IYHA 1F2EA 5DAKA 2HYXA 22GSA 1TK5B 3UARA 5J9BA 1M9AA 1B9XC 3KP9A 2JZRA 4HQZA 4YAVA 3C8EA 1M9BA 4I5QA 3J7Yk 2XC2A 1XOBA 3L9VA 3IV4A 3UL3A 1GP1A 1THXA 1QGVA 4V1Ap 4F82A 1GH2A 4GCIA 1PA3A 4J57E 3R2QA 1LJRA 3EYTA 1GL8A 6GSUA 2LJRA 3VI7A 3TOUA 3CSHA 3A2VA 1R5PA 5DQSA 3US3A 4TR0A 5L71A 4NXIA 4Q5NA 4GXZA 3D5JA 1DSBA 2JACA 1WOUA 3M3MA 5A4VA 2HE3A 1THOA 3FYGA 5KN2A 3PINA 4K0GA 5GZZB 2QKEA 3ZREA 2VOCA 2HI7A 4MJBA 5ECPB 2H75A 1TDIA 2FA8A 4Z7XA 3GNJA 3KTLA 2OE3A 3P8WA 1G6WA 3TDGA 1CQHA 1ERVA 1N8JA 2GSTA 1MDJA 2N5AA 2CX3A 2FWFA 1Y6EA 3HVVA 2I4AA 3ZITA 4ZL9A 4EDZA 2LQOA 1GULA 4IS0A 1F9MA 1BYEA 1GWCA 2LRTA 5JWRB 4MJAA 1AC1A 1V57A 2JU5A 3EINA 2VIMA 1VRSD 1WPIA 3H4KA 4FQUA 4OMVA 1OC9B 5IOXA 4DSQA 2MYGA 1XXUA 1A8LA 1H75A 3KH9A 2KLXA 2IPAA 2VD1A 3ED3A 4TXOA 4KUNA 4ML6A 3ERGA 5J5NA 2OE1A 1H4OA 1B4QA 5KN3A 1B4PA 2XHFA 4TR4A 4IW9A 5EL8A 3V1WA 4J56E 4V2NA 5JWOB 2VUPA 2OADA 4EKZA 2F9SA 5AIVA 5EVOA 3TKQA 2AUVA 5CYYA 2H0GA 1EWXA 2PWJA 3GA4A 2H6YA 3DXBA 5G1LA 5A5KA 2FNOA 1M2DA 2I81A 3GURA 3D6IA 1X9SB 1K0CA 1ERUA 1SYXA 4L8EA 4G10A 2WFCA 2ES7A 2MMOA 1ON4A 2F8AA 2YP6A 5DALB 4FYCA 4TOPA 4DSSA 3K8NA 5ENUA 2OACA 2DMLA 3TJFA 5D93A 4EO3A 4L0WA 4POMA 1G0TA 3PPUA 3DMLA 3W8SA 2H73A 1ZZYA 5JCGA 3G7YA 2E7PA 4IJIA 3VK9A 1BAYA 3IBHA 3I6AA 4IKHA 1FB6A 4ZB9A 5CREA 2NBSA 3UBKA 4YAPA 5IM9A 2GZZA 1XZOA 2J9HA 1GSEA 3BBYA 4MPFA 3C71A 3KJYA 2DLXA 2HT9A 3ZFBA 3IR4A 1BQ7A 3GL3A 1VF3A 2GT5A 4OFTA 1SK2A 2Z9SA 2H01A 4I2TA 4PXOA 4EE0A 2NDOA 3TKPA 1YEPA 3H93A 1TP9A 2PN8A 1J9BA 5HFIA 3ZVJD 2HRAA 3FR9A 2E2GA 2H6XA 4NV2A 5J9CA 1PQNA 5CRHA 5INYA 1PL2A 2O8VB 3APOA 4Q5QA 3GMFA 1ZYEA 2K18A 4MZCA 5COHA 4GQCA 2X64A 4KA0A 5J3RA 2FUG2 4IQ1A 1U3IA 2HNLA 4LMVA 5H5RA 2PMTA 1LU4A 1J0FA 4WR5A 8GSSA 4BPYA 1F3BA 3CRUA 2TIRA 3LXTA 4OO4A 1JFUA 2H19A 4BVYB 4IHUA 2EC4A 3GKMA 2R6KA 5DBQA 4WR4A 2IMDA 1G7OA 4KW6A 3LSZA 2H1BA 1S3AA 3JCML 4EDYA 2H1DA 1X5CA 1A0RP 1A2LA 3M0FA 2P5QA 1M2BA 2FGXA 3H79A 2AV4A 4ID0A 2WDUA 2I1UA 2E0QA 1YY7A 4TRXA 4I8BA 3DGQA 4ECJA 2H0IA 1SKWB 4TW5A 1M99A 3GKXA 5ABRA 1K0OA 2KHPA 3GL5A 4KNDA 1BJXA 4KCAA 5F8BA 1OE7A 2O7KA 10GSA 1UN2A 2RIIA 1B9YC 2LNSA 1FG4A 2DJ3A 2M72A 5EPFA 2C4JA 3I69A 4L5LA 4HQSA 2K9FA 2HRKA 1URMA 2A2SA 4TR3A 3MNGA 3A5WA 6GSTA 5LD0A 1T1VA 5IIZA 2RM5A 4LL4B 2F51A 3IPZA 2VCZA 2HRNA 1BEDA 2AB6A 3D22A 2LNTA 2NTOA 1ST9A 1Q98A 1PN9A 1B8XA 4BWQA 4H86A 1GSDA 1QUWA 2H6ZA 2PU9C 2YWIA 5G2ZA 2KUCA 1V9WA 2WJUA 4ECBA 2FD3A 3KTBA 5BMUA 2XBIA 3UBLA 5LCZA 2XPDA 1X5DA 5B7CA 4GSNA 5IO2A 1B48A 3TKSA 5ECNB 4NMUA 2L6DA 1SYRA 2LTKA 1SD8A 2J23A 5CRWA 3FZ4A 1A8YA 1G7EA 3HXSA 2GVPA 1YDKA 5J41A 2WGRA 1TTZA 5ECMB 2YPMA 2LKUA 1YEXA 3O3TA 2NVLA 2EIQA 2B7KA 2MZCA 3CXGA 2K8SA 1JZRA 4YQMA 5DJLA 3IAS2 5JCWA 2MMNA 4D73A 2VLTA 3GTUA 4QQ7A 3DVWA 1PX7A 3IK9A 2VL2A 2H8LA 2GSSA 1WRYA 4X1UA 1BX9A 1XIYA 2QC7A 2MMAA 3A3TA 4Q5RA 4ZBDA 16GSA 4RUVA 4BL7B 3VI5A 1VF1A 1SJZA 3LYKA 1F6MC 3EU4A 3GH9A 4KSOA 11GSA 4XHMA 1XVWA 3LJRA 2VCVA 1T8EB 4GTUA 2VCTA 2M80A 2GT6A 2YWOA 1QQ2A 3D0ZA 1C72A 1TI1A 4PUAA 5ECLB 2V32A 1KEBA 1TXXA 2ZCTA 20GSA 2GLRA 4JR4A 5F07A 4IP6A 3WT2A 5HR2A 2IMEA 3HZ8A 2JSYA 1O73A 3KIJA 2JZTA 1U88A 4V2LA 3HVXA 2V2GA 4ZIJA 2WRTA 3UAPA 2DIZA 2KP2A 5G1KA 3F6FA 3W6GA 2R37A 1F3AA 5E59A 3IK7A 5C00A 4TR1B 2RUEA 3IAM2 3CSIA 3HKRA 4IQAA 3AY8A 4HDEA 2VD0A 2C0GA 4XS4B 4MH3A 1FVJA 3L4NA 6GSXA 3LXZA 3WGEA 2ZUPA 2YANA 4BWSA 4GQFA 4PGTA 2P5RA 2LQQA 4BVXB 1M0UA 3ERFA 4K9ZA 1R5AA 5ELGA 1V2AA 4ZXGA 1EEJA 2H0HA 4RQRA 3TJBA 5JWQB 5CAXA 3ZMLA 2WZ9A 1GLQA 1XWKA 2YJHA 4N30A 5HR0A 1K0BA 5G31A 4ILFA 4GRFA 4V2MA 5G5EA 1OYJA 3GSTA 13GSA 5ECIB 2ON5A 3GN3A 2CAIA 2F8FA 4HOJA 4IP1A 1XWBA 4EF0A 5A4UA 2YOIA 3LGCA 19GSA 1PSQA 3KEBA 2X8GA 4WBJA 3VWXA 3H1NA 2PVQA 4MABA 1FOVA 1Z7PA 1JZOA 1CQGA 2OE0A 5GSSA 1LBKA 2IMIA 3KZQA 2H70A 4WEYA 1GTUA 5D9VA 3APSA 1GSYA 5DAKB 3HDCA 3RAZA 2FWGA 3QPMA 4K7OA 1T00A 5CNWA 5G30A 1TKDB 3ME8A 1EV4A 1E6BA 4JU5A 4MF5A 4FYBA 4WF4A 4ZB6A 3E9JB 3DKSA 3C7MA 5C04A 1HNBA 1QFNA 3UOMA 2V41A 3RHCA 3QAGA 4YQVA 1E2YA 1FVKA 5DCGA 1TU7A 1PMTA 1RW1A 2VL3A 3IC8A 4NPBA 2DJKA 3LG6A 17GSA 5KEJA 4K8MA 1PX6A 1ACVA 1ZYQB 5IPHA 3GRXA 3NIVA 1EZKA 3LEFA 3F63A 12GSA 5CRDA 3DD3A 2KOKA 1EGRA 3MSZA 3RDWA 4OFNA 3TKSE 1AAZA 3VPQA 1V58A 2YNXA 3C73A 3VURA 5F06A 1I5GA 5KN1A 5ID2A 4FIWA 2FA4A 1Z3EA 2IFQA 2GSRA 5E4WA 3L9SA 5B8AA 1GUKA 3QR6A 2C0DA 1A23A 3CSJA 4WF5A 2NPBA 1VF4A 3P7XA 4FYUA 2R3XA 4NV5A 4K6XA 4L5OA 3KXOA 2G2QA 4PNFA 2B7JA 1XPVA 4KAEA 4G0LA 1QMVA 2ALBA 4K1FA 1SJIA 3Q74A 2OBIA 2HSNB 1HQOA 1XWGA 4MH2A 3P2AA 4F0CA 4EUYA 3SBCA 4IVFA 2RUFA 3ZTLA 2PUKC 1GSUA 2YN1A 4AJ7A 1OKDA 2BMXA 4HZ4A 4TXOB 2M46A 4O7HA 1SENA 3GHAA 3ZZXA 4ECIA 4F9ZA 3FY7A 3F4TA 3NOFA 2B5YA 3DWVA 4MCUA 4MLYA 1OC3A 3DIEA 1TI3A 1W89A 2H66A 3O6TA 1K0NA 4TKYA 1NHYA 3TKSC 4AJ8A 4KDYA 1FB0A 2CVBA 2RLIA 3A2WA 1JZWA 4K7NA 5HFKA 2HZEA 4FO5A 1MEKA 1GNEA 4KB3A 2VM2A 5GAND 3LYPA 2FWEA 4LL1B 4DSSB 3WYWA 1M7TA 2GZPA 1O8XA 3GX0A 3ISOA 3M8NA 5IMAA 2N5BA 5IOWA 3CMIA 2VL2C 5CO3A 2HSYA 5DQYA 2YZHA 1WWJA 1S3DA 1SL0B 1XWAA 1GSQA 4JRRA 1WE0A 1SL2B 5FT3A 2CA8A 1KNGA 2PVOC 2GSQA 2CVKA 2WB9A 3BCKA 4LA1A 4ZL7A 3HHVA 3DRNA 3DYRA 1EOGA 1ZOFA 2OA7A 1GSFA 4FH8A 3TUEA 2C3QA 3FZ9A 18GSA 5IQYA 3KH7A 4HEA2 4I97A 3Q18A 2XBQA 2X99A 1FAAA 1MD3A 4PX1A 3HZ4A 4MP4A 2I9HA 1MD4A 1V98A 2EIOA 5F0GA 4P3YB 4AF2A 4ULXA 2C0FA 3E0UA 3R3EA 4MF7A 2LRCA 3UJ1A 3I43A 3G7JA 3P90A 3ZYWA 3GIXA 4PUFC 4CDOA 5HFGA 3FKFA 4G2EA 2CQ9A 1AW9A 2CX4A 4KE3A 4X43A 2HSMA 4ZB8A 3VWVA 1M2AA 1Z6NA 3QCPA 3FZAA 5D9WA 3L78A 3KP8A 5D9XA 1KTEA 5DCHA 2O85A 3EC3A 1A24A 1JLWA 4ACSA 4QL9A 2FWHA 1ABAA 5AGYA 3NZNA 1EOHA 1WIKA 3ZFLA 1HD2A 4MZBA 3VFIA 1JLVA 1XOAA 1HNCA 4KH7A 3WD6A 2AJQB 3WT1A 3F4RA 1XW9A 4POBA 1ILOA 4J2FA 1NHOA 1GTIA 1IYIA 3L0HA 4K0NA 5G5FA 3KMNA 2UZ8A 5F05A 1UVZA 4HZ2A 3KMOA 3FEUA 3BD2A 1SKRB 4GSSA 2P31A 1ZCPA 1TRWA 3IE3A 1AXDA 1U87A 2WULA 2CT6A 2CZ3A 3E3EA 2H74A 5GSTA 1SL1B 4N0VA 1K0MA 4G9HA 2N5FA 3APQA 1GTBA 2LUSA 3N5OA 4X0XA 4ISDA 2DJ0A 2HRKB 1U6TA 1XWCA 4WKWA 1Z7RA 2B1LA 2LJAA 3UVTA 4HUAA 1OC8A 1TK0B 3Q6OA 2ZNMA 3L9UA 4HU7A 5CP1A 2R4VA 1MTCA 4YQUA 2LJKA 2PBJA 3VWUA 3EURA 1FO5A 3Q19A 4CHSA 4OCFA 3M9KA 5H5SA 4DVCA 3HJMA 3EMXA 2K8VA 2DJ2A 1Z6MA 1RQMA 2RM6A 5HR1A 4MMMA 4HI7A 2H71A 5B8BA 4PURA 2FCHA 5ECRB 2H72A 2GDRA 2DMMA 4EXJA 4PTSA 2O87A 4F2IA 2PPTA 2A4VA 2MBTA 2IIYA 3FR6A 1OAZA 5IPGA 5B6MA 3CTFA 3ZL5A 4MK3A 4MDCA 1T4ZA 2R2JA 5ECHB 2IJYA 3F4SA 4PQIA 1DE2A 3CTGA 3FRCA 1OC9A 3ZRDA 2B5XA 2OJLA 3QFAC 5FHIA 4USSA 1YJ6A 4G0KA 5JCUA 4D73B 2V6KA 1AIUA 3H8QA 1J08A 2L6CA 2GS3A 3GTUB 2DBCA 4N0ZA 5HQPA 2QSIA 1HYUA 3QAVA 3CRTA 2IMKA 3QDNA 4E8EA 3LFLA 4WXTA 3HCZA 3TRPA 1Y25A 4MJCA 2B5EA 2C1YA 3PR8A 2L5LA 3IOSA 4KCEA 1X9WB 2DC5A 1ZL9A 3QD9A 6GSVA 2F3MA 3FR3A 2L57A 1YF1A 4I6XA 2LV3A 4G19A 4ZILA 1ML6A 4EL1A 2AAWA 1PKWA 1X9MB 3TJGA 1N2AA 5ELAA 2REMA 3TKRA 1HNAA 4OO5A 5DALA 4JE1A 4IBPA 2HSHA 5D9TA 3EVIA 4GLTA 2PERA 2JADA 3GV1A 1TK8B 3S9FA 3F9UA 4LMWA 4ML1A 1T3BA 4JEDA 3I9V2 2VL9A 4WBRD 2H1GA 1A2MA 1QK8A 3TRQA 5KN0A 2C3NA 3HYPA 4PQHA 2LRNA 2I3YA 2VLUA 2AHEA 2P0GA 2H1AA 2WS2A 1R4WA 2H76A 4XS1A 1DUGA 2C0EA 3HJPA 3OR5A
chains in the Genus database with same CATH superfamily
4KF9A 3EU3A 4K2DA 2HQTA 3GYKA 1K3LA 5J4UA 5IMVA 1AQXA 6GSYA 2LS5A 2DSAA 4EIQA 2HZFA 1X0RA 4KDUA 3FHKA 3KD0A 2R5GA 3G9BA 2LEGA 3D21A 5ECSA 2V1MA 1AQWA 1T4YA 4PNGA 2YV9A 2G0FA 3WGXA 5J40A 1XCCA 2CAQA 1Z9HA 4WETA 4ZBAA 3EWLA 3UIWA 2OKAA 3UMAA 1W4VA 1GTAA 4MJEA 3GKKA 5EY6A 3HJOA 2B6MA 4N10A 2XPEA 1MDIA 1UC7A 1O7UA 1BF5A 1PGTA 1T7PB 5A1NB 3IXRA 1PKZA 4XCSA 3M1GA 4RQXA 3QOUA 4GF0A 5D8IA 5D73A 1R7HA 4AGSA 1Z5YE 4BA7A 5AISA 2L59A 1X5EA 4IN0A 1FHEA 1EP8A 3QAWA 14GSA 4JR6A 2C80A 2YWMA 3GFKA 5DVBA 2FLSA 4L0UA 3U5RE 3EMPA 1TOFA 4YH2A 2FY6A 3FZ5A 1AUCA 3N9JA 1GLPA 1SU9A 1VF2A 2IMFA 2LSTA 4BVYA 3F3QA 3GUSA 5LNKe 4POLA 1O85A 1NW2A 4RI6A 5HR3A 3ZLPA 1S3CA 5IMZA 2YCDA 2D2ZA 4E68A 3CBUA 2VLVA 1ZGNA 5ECKB 2CVDA 3IC4A 4NHWA 2GZYA 2IL3A 6GSWA 3F3RA 1PL1A 1K0DA 4OFMA 6GSSA 4CW9A 1F37A 4HJ2A 3C1RA 2HXKA 2K6VA 3GKNA 5IO0A 2IN3A 1GSSA 2CZ2A 4MF6A 4TXVA 2O5VA 4KDXA 3U6VA 3LWAA 1EV9A 3C1SA 1R26A 2E2MA 1TRSA 5A5HB 1AQVA 2GQKA 5ECOB 4OD7A 1I9DA 2ON7A 2L5OA 4V1Ag 3IRAA 2BJXA 4FXYP 2AYTA 3SWLA 4I2UA 3MAKA 2WZSA 3ERWA 2C3TA 4AJ6A 4POKA 2QGVA 4IGJA 3GX8A 4O5RA 4TVEA 3F6DA 3QFBC 4HJMA 4N11A 5CRGA 3TB2A 4NAXA 4XS6A 5IMFA 1XBSA 2JZSA 2VCXA 4QL7A 1MDKA 2L4CA 4JZQA 1WP0A 3EE2A 5ID2B 1KBNA 1XVQA 2IFQB 1O8WA 3BCIA 1EEMA 3MWHA 4PHZC 3G7IA 3HVSA 2CV4A 3ZIVA 1DBYA 3ZIJA 5DJMA 1YKAA 2DJJA 1JZDA 4K7IA 4ECCA 4DEJA 4OCEA 4EVMA 3TOTA 2QA2A 2YZUA 4EC0A 1SKSB 3BJ5A 2C8UA 4KGIA 4LLRA 1BG5A 2OBKA 2BTOT 1XFLA 2TRXA 4JBBA 2WW2A 4XIHA 1USBA 4XRDA 1A2JA 3DEXA 1K3YA 2X8HA 1GNWA 3BOAA 1XW6A 4GSTA 3MDKA 2PGTA 3LQ7A 5FWGA 2WCIA 2HLSA 2JSZA 4RI7A 1TU8A 1ZYPA 4HS1A 4NHZA 3IDVA 3GH6A 2VCQA 1JHBA 1YF0A 1SJ6A 5IMCA 1UA5A 1PRXA 4BL7A 3VLNA 3TJJA 4TN8A 5DDLA 3O76A 3HA9A 3W8JA 1XW5A 2TRCP 3A2XA 3KM6A 1SK1A 5ECQB 1ERWA 1TW9A 2L4QA 4PI2C 1ERTA 2EFEA 2HZEB 2IWTA 2GGTA 3UEMA 2WVYA 4IJ3A 3HD5A 4ZL8A 1ZMAA 4KX4A 4OWYA 5H5QA 3F8UA 1DE1A 2DIYA 1TJDA 3D4MA 2JL4A 4YKFA 1K0AA 3UVHA 1OKTA 3HY2A 2O89A 3TCOA 5AN1A 1K3OA 1EGOA 2VO4A 2O36A 1FW1A 3M9JA 5IMDA 1EP7A 4MA9A 2A2RA 2VAFA 2HRFA 2FHEA 5A4WA 2YJ7A 3KGKA 3KCMA 3TJKA 1U3AA 1OE8A 1Q4JA 5GAPD 4NWYA 3IA1A 4AKGA 2VM1A 4TR1A 2GQLA 9GSSA 3D4TA 4O92A 1GUHA 4DSRA 4XS4A 2GQMA 4MPGA 1O6JA 3F0IA 3PH9A 1WJKA 2HFDA 2MMZA 3WGDA 2DJ1A 4Q5FA 4BVXA 4F03A 4KSMA 1A0FA 2MBSA 3RHBA 3RBTA 2GTUA 5D96A 3ZVJA 4O32A 1TRVA 1G6YA 2B1KA 3FW2A 3TRXA 4XTSA 1YKCA 3RGBC 2YV7A 4MZWA 2B3SA 4PQ1A 2VCWA 1OVNA 4GWRA 2YWNA 2EIRA 3LORA 1SD9A 7GSSA 1V40A 3GSSA 3CYNA 4G0IA 4HU9A 3QMXA 1RK4A 4IELA 3IHQA 2HSMB 3ME7A 1SK0A 3DVXA 3RPNA 5AIXA 3RPPA 3ZMKA 5J4YA 1NSWA 2V6OA 3TGZA 1WMJA 2X8CA 1GRXA 2QA1A 1I1IP 4E8HA 1YZXA 2EFCA 3J7Yb 1GUMA 1TRUA 1PD21 1VGLA 1YQ1A 4XRAA 2O3EA 1O81A 4F0BA 1QXHA 1NM3A 3PGTA 3FK8A 4ZBBA 1SVLA 4BIKA 3VPTA 2H30A 2KP1A 1ZYNA 3VWWA 5B6NA 1IYHA 1F2EA 5DAKA 2HYXA 22GSA 1TK5B 3UARA 4O5UA 1SVMA 1M9AA 5J9BA 1B9XC 3KP9A 2JZRA 4HQZA 4YAVA 3C8EA 1M9BA 4I5QA 3J7Yk 2XC2A 1XOBA 3L9VA 3IV4A 4PI0C 3UL3A 1GP1A 1THXA 1QGVA 4V1Ap 4F82A 1GH2A 4GCIA 1PA3A 4J57E 3CWGA 3R2QA 1LJRA 3EYTA 1GL8A 6GSUA 2WVZA 2LJRA 3VI7A 3TOUA 3CSHA 3A2VA 1R5PA 5DQSA 4AKIA 3US3A 4TR0A 5L71A 4NXIA 4Q5NA 4GXZA 3D5JA 1DSBA 2JACA 1WOUA 3M3MA 5A4VA 2HE3A 1THOA 3FYGA 5KN2A 3PINA 4K0GA 5GZZB 2QKEA 3ZREA 2VOCA 2HI7A 4MJBA 5ECPB 2H75A 1TDIA 2FA8A 4Z7XA 2EFHA 4ICYA 3GNJA 3KTLA 2OE3A 3P8WA 1G6WA 3TDGA 1CQHA 1ERVA 1M3JA 1N8JA 2GSTA 3HMJG 1MDJA 2CX3A 2N5AA 2FWFA 1Y6EA 3HVVA 2I4AA 3ZITA 4ZL9A 4EDZA 2LQOA 1GULA 4IS0A 1F9MA 1BYEA 2HSNA 1GWCA 2LRTA 5JWRB 4MJAA 1AC1A 1V57A 2JU5A 3EINA 2VIMA 1VRSD 4N3ZA 1WPIA 3H4KA 4FQUA 4OMVA 1OC9B 5IOXA 4DSQA 2MYGA 1XXUA 1A8LA 1H75A 3KH9A 2KLXA 4O5QA 2A2PA 2IPAA 2VD1A 3ED3A 4TXOA 4KUNA 4ML6A 3ERGA 5J5NA 2OE1A 1H4OA 1B4QA 2EFDA 5KN3A 1B4PA 2XHFA 4TR4A 4IW9A 5EL8A 3V1WA 4J56E 4V2NA 5JWOB 2VUPA 2OADA 4EKZA 2F9SA 5AIVA 5EVOA 3TKQA 5A34B 2AUVA 5CYYA 2H0GA 1EWXA 2PWJA 3GA4A 2H6YA 3DXBA 5G1LA 5A5KA 2FNOA 1M2DA 2I81A 3GURA 3D6IA 1X9SB 1K0CA 1ERUA 1SYXA 4L8EA 4G10A 2WFCA 2ES7A 2MMOA 1ON4A 2F8AA 2YP6A 5DALB 4FYCA 4TOPA 4DSSA 3K8NA 5ENUA 2OACA 2DMLA 3TJFA 5D93A 4EO3A 2WVXB 4L0WA 4POMA 1G0TA 3PPUA 3DMLA 3W8SA 2H73A 1ZZYA 5JCGA 3G7YA 2E7PA 4IJIA 3VK9A 1BAYA 3IBHA 3I6AA 4IKHA 1FB6A 4ZB9A 5CREA 2NBSA 3UBKA 4YAPA 5IM9A 2GZZA 1XZOA 2J9HA 1GSEA 3BBYA 4MPFA 3C71A 3KJYA 2DLXA 2HT9A 3ZFBA 3IR4A 3CQFA 1BQ7A 3GL3A 1VF3A 2GT5A 4OFTA 1SK2A 2Z9SA 2H01A 4I2TA 4PXOA 4EE0A 2NDOA 3TKPA 1YEPA 3H93A 1TP9A 2PN8A 1J9BA 5HFIA 3ZVJD 2HRAA 3FR9A 2E2GA 2H6XA 4NV2A 5J9CA 1PQNA 5CRHA 5INYA 1PL2A 2O8VB 3APOA 4Q5QA 3GMFA 1ZYEA 2K18A 4MZCA 5COHA 4GQCA 2X64A 4KA0A 5J3RA 2FUG2 4IQ1A 1U3IA 2HNLA 4LMVA 5H5RA 2PMTA 1LU4A 1J0FA 4WR5A 8GSSA 4BPYA 1F3BA 3CRUA 2TIRA 3LXTA 4OO4A 1JFUA 2H19A 4BVYB 4IHUA 2EC4A 3GKMA 2R6KA 1Y1UA 4WR4A 5DBQA 2IMDA 1G7OA 4KW6A 3LSZA 2H1BA 2WW0A 1S3AA 3JCML 4EDYA 2H1DA 1X5CA 1A0RP 1A2LA 3M0FA 2P5QA 1M2BA 2FGXA 3H79A 4X4JA 2AV4A 4CY6A 4ID0A 2WDUA 2I1UA 2E0QA 1YY7A 4TRXA 4I8BA 3DGQA 4ECJA 1M3IA 2A4HA 2H0IA 1SKWB 4TW5A 1M99A 3GKXA 5ABRA 1K0OA 2KHPA 3GL5A 4KNDA 1BJXA 4KCAA 5F8BA 1OE7A 2O7KA 10GSA 1UN2A 2RIIA 1B9YC 2LNSA 1FG4A 2DJ3A 2M72A 5EPFA 2C4JA 3I69A 4L5LA 4HQSA 2K9FA 4Z2TA 1N25A 2HRKA 1URMA 2A2SA 4TR3A 3MNGA 3A5WA 6GSTA 5LD0A 1T1VA 5IIZA 2OT3A 2RM5A 1TXUA 4LL4B 2F51A 3IPZA 2VCZA 2HRNA 1BEDA 2AB6A 3D22A 2LNTA 2NTOA 1ST9A 1Q98A 1PN9A 1B8XA 4BWQA 4H86A 1GSDA 1QUWA 2H6ZA 2PU9C 2YWIA 5G2ZA 2KUCA 1V9WA 2WJUA 4ECBA 2FD3A 3KTBA 5BMUA 2XBIA 3UBLA 5LCZA 2XPDA 1X5DA 1YVLA 5B7CA 4GSNA 5IO2A 1B48A 3TKSA 2H1LA 5ECNB 4NMUA 2L6DA 1SYRA 2LTKA 1SD8A 2J23A 5CRWA 3FZ4A 1A8YA 3MIXA 1G7EA 3HXSA 2GVPA 1YDKA 5J41A 2WGRA 1TTZA 5ECMB 2YPMA 2LKUA 1YEXA 3O3TA 2NVLA 2EIQA 2B7KA 2MZCA 3CXGA 2K8SA 1JZRA 4YQMA 5DJLA 3IAS2 5JCWA 2MMNA 4D73A 2VLTA 3GTUA 4QQ7A 3DVWA 3EPTA 1PX7A 3IK9A 2VL2A 2H8LA 2GSSA 1WRYA 4X1UA 1BX9A 1XIYA 2QC7A 2MMAA 3A3TA 4Q5RA 4ZBDA 16GSA 4RUVA 4BL7B 3VI5A 4GDFA 3FMWA 1VF1A 1SJZA 3LYKA 1F6MC 3EU4A 3GH9A 4KSOA 11GSA 4XHMA 1XVWA 3LJRA 2VCVA 1T8EB 4GTUA 2VCTA 2M80A 2X4AA 2GT6A 2YWOA 1QQ2A 3D0ZA 1C72A 1TI1A 4PUAA 5ECLB 5BRTA 2WW3A 2V32A 1KEBA 1TXXA 2ZCTA 20GSA 2GLRA 4JR4A 5F07A 4IP6A 3WT2A 5HR2A 2IMEA 3HZ8A 2JSYA 1O73A 3KIJA 2JZTA 1U88A 4V2LA 3HVXA 2V2GA 4ZIJA 2WRTA 3UAPA 2DIZA 2KP2A 5G1KA 3F6FA 3W6GA 2R37A 1F3AA 5E59A 3IK7A 5C00A 4TR1B 2RUEA 3IAM2 3CSIA 1PN0A 3HKRA 4IQAA 3AY8A 4HDEA 2VD0A 2C0GA 4XS4B 4MH3A 1FVJA 3L4NA 6GSXA 3LXZA 3WGEA 2ZUPA 2YANA 4BWSA 2DKHA 4GQFA 4PGTA 2P5RA 2LQQA 4BVXB 1M0UA 3ERFA 4K9ZA 1R5AA 5ELGA 1V2AA 4ZXGA 1EEJA 2H0HA 4RQRA 3TJBA 5JWQB 5CAXA 3ZMLA 2WZ9A 1GLQA 1XWKA 2YJHA 4N30A 5HR0A 1K0BA 5G31A 4ILFA 4GRFA 4V2MA 5G5EA 5A34A 5A1NA 1OYJA 3GSTA 13GSA 5ECIB 2ON5A 3GN3A 2CAIA 1FOHA 2F8FA 4HOJA 4IP1A 1XWBA 4EF0A 5A4UA 2YOIA 3LGCA 19GSA 3LW9A 4CY8A 1PSQA 3KEBA 2X8GA 4WBJA 3VWXA 3H1NA 2PVQA 1S4BP 4MABA 1FOVA 1Z7PA 1JZOA 1CQGA 2OE0A 2DKIA 5GSSA 1LBKA 2IMIA 3KZQA 2H70A 4WEYA 1GTUA 5D9VA 3APSA 1GSYA 5DAKB 3CHXC 4YKGA 3RFRC 3HDCA 3RAZA 2FWGA 2R0GA 3QPMA 4K7OA 1T00A 5CNWA 5G30A 1TKDB 3ME8A 1EV4A 1E6BA 5A5HA 4JU5A 4MF5A 4FYBA 4WF4A 4ZB6A 4Z2RA 3E9JB 3DKSA 3C7MA 5C04A 1HNBA 1QFNA 3UOMA 2V41A 3RHCA 3QAGA 4YQVA 1E2YA 1FVKA 5KOWA 5DCGA 1TU7A 1PMTA 1RW1A 2VL3A 3IC8A 4NPBA 4K5RA 2DJKA 4ZB7A 3LG6A 17GSA 5KEJA 4K8MA 1PX6A 1ACVA 1ZYQB 5IPHA 3GRXA 3NIVA 1EZKA 3LEFA 3F63A 12GSA 5CRDA 3DD3A 2KOKA 1EGRA 3MSZA 3RDWA 4OFNA 3TKSE 1AAZA 3VPQA 1V58A 2YNXA 3C73A 3VURA 1YEWC 5F06A 1I5GA 5KN1A 5ID2A 4FIWA 2FA4A 1Z3EA 2IFQA 2GSRA 5E4WA 3L9SA 5B8AA 1GUKA 3QR6A 2C0DA 1A23A 3CSJA 4WF5A 2NPBA 1VF4A 3P7XA 4FYUA 2R3XA 4NV5A 4K6XA 4L5OA 3KXOA 2G2QA 4PNFA 2B7JA 4G01A 1XPVA 4KAEA 4G0LA 1QMVA 2ALBA 4K1FA 1SJIA 3Q74A 2OBIA 2HSNB 1HQOA 1XWGA 4MH2A 3P2AA 4F0CA 4EUYA 3SBCA 4IVFA 2RUFA 3ZTLA 2PUKC 1GSUA 4Z2UA 2YN1A 4AJ7A 1OKDA 2BMXA 4HZ4A 4TXOB 3IHGA 2M46A 4O7HA 1SENA 3GHAA 3ZZXA 4ECIA 4F9ZA 3FY7A 3F4TA 3NOFA 2B5YA 3DWVA 4MNNA 4MCUA 4MLYA 3MYDA 1OC3A 3DIEA 1TI3A 3A5IA 1W89A 2H66A 3O6TA 1K0NA 4TKYA 1NHYA 3TKSC 4AJ8A 4KDYA 1FB0A 2CVBA 2RLIA 3A2WA 1JZWA 4K7NA 4EIPA 5HFKA 2HZEA 4FO5A 1MEKA 1GNEA 4KB3A 2VM2A 5GAND 3LYPA 2FWEA 4LL1B 4DSSB 3WYWA 1M7TA 2GZPA 1O8XA 3GX0A 3ISOA 3M8NA 5IMAA 4QMKA 2N5BA 5IOWA 3CMIA 2VL2C 5CO3A 2HSYA 5DQYA 2YZHA 1WWJA 1S3DA 1SL0B 1XWAA 1GSQA 4JRRA 1WE0A 1SL2B 5FT3A 2CA8A 1KNGA 2PVOC 2GSQA 4AI6A 2CVKA 2WB9A 3BCKA 4LA1A 4ZL7A 3HHVA 3DRNA 3DYRA 1EOGA 1ZOFA 2OA7A 1GSFA 4FH8A 3TUEA 2C3QA 3FZ9A 18GSA 5J4VA 5IQYA 3KH7A 4HEA2 4I97A 3Q18A 2XBQA 2X99A 1FAAA 1MD3A 4PX1A 3HZ4A 4MP4A 2I9HA 1MD4A 1V98A 2EIOA 5F0GA 4P3YB 4AF2A 4ULXA 2C0FA 3E0UA 3R3EA 4MF7A 2LRCA 3UJ1A 3I43A 3G7JA 3P90A 3ZYWA 3GIXA 4PUFC 4CDOA 5HFGA 4A5PA 5KOXA 3FKFA 4G2EA 2CQ9A 1AW9A 2X49A 2CX4A 4KE3A 4X43A 2HSMA 4ZB8A 3VWVA 1M2AA 1Z6NA 3QCPA 3FZAA 5D9WA 3L78A 3KP8A 5D9XA 1KTEA 1S3RA 5DCHA 2O85A 3EC3A 1A24A 1JLWA 4ACSA 4QL9A 2FWHA 1ABAA 5AGYA 3NZNA 1EOHA 1WIKA 3ZFLA 1HD2A 4MZBA 3VFIA 1JLVA 1XOAA 1HNCA 4KH7A 3WD6A 2AJQB 3WT1A 3F4RA 1BG1A 1XW9A 4POBA 1ILOA 4J2FA 1NHOA 1GTIA 1IYIA 3L0HA 4K0NA 5G5FA 3KMNA 2WW1A 2UZ8A 5F05A 1UVZA 4HZ2A 3KMOA 3FEUA 3BD2A 1SKRB 4GSSA 2P31A 1SVOA 1ZCPA 1TRWA 3IE3A 1AXDA 1U87A 2WULA 2CT6A 2CZ3A 3E3EA 2H74A 5GSTA 1SL1B 4N0VA 1K0MA 2VKZG 4G9HA 2N5FA 3APQA 1GTBA 2LUSA 3N5OA 4X0XA 4ISDA 2DJ0A 2HRKB 1U6TA 1XWCA 4WKWA 1Z7RA 2B1LA 2LJAA 3UVTA 4HUAA 1OC8A 1TK0B 3Q6OA 2R0CA 2ZNMA 3L9UA 4HU7A 5CP1A 2R4VA 1MTCA 4YQUA 2LJKA 2PBJA 3VWUA 2UV8G 3EURA 1FO5A 3Q19A 4CHSA 4OCFA 3M9KA 5H5SA 4DVCA 3HJMA 3EMXA 4AKXB 2K8VA 2DJ2A 3TU3B 1Z6MA 1RQMA 2RM6A 5HR1A 4MMMA 4HI7A 2H71A 3HVNA 5BMUB 5B8BA 4PURA 2FCHA 5ECRB 2H72A 2GDRA 2DMMA 4EXJA 4PTSA 2O87A 4K2XA 4F2IA 2PPTA 2A4VA 1XG8A 2MBTA 2IIYA 3FR6A 1OAZA 5IPGA 5B6MA 3CTFA 3ZL5A 4MK3A 1PFOA 4MDCA 1T4ZA 2R2JA 5ECHB 2IJYA 3F4SA 4PQIA 1DE2A 3CTGA 3FRCA 1OC9A 3ZRDA 2B5XA 2OJLA 3QFAC 5FHIA 4USSA 1YJ6A 4G0KA 5JCUA 4D73B 2V6KA 1AIUA 3H8QA 1J08A 2L6CA 2GS3A 3GTUB 2DBCA 4K5SA 4N0ZA 5HQPA 2QSIA 1HYUA 3QAVA 3CRTA 2IMKA 3QDNA 4E8EA 3LFLA 4WXTA 3HCZA 3TRPA 1Y25A 5J47A 4MJCA 2B5EA 2C1YA 3PR8A 2L5LA 3IOSA 4KCEA 1X9WB 2DC5A 1ZL9A 4AKHA 3QD9A 6GSVA 2F3MA 3FR3A 2L57A 1YF1A 4I6XA 2LV3A 4W66A 4G19A 4ZILA 1ML6A 4EL1A 2AAWA 1PKWA 1X9MB 3TJGA 1N2AA 5ELAA 2REMA 3TKRA 1HNAA 4OO5A 5DALA 4JE1A 4IBPA 2HSHA 5D9TA 3EVIA 4GLTA 2PERA 2JADA 3GV1A 1TK8B 3S9FA 3F9UA 4LMWA 4ML1A 1T3BA 2WVXA 4JEDA 3I9V2 2VL9A 4WBRD 2H1GA 1A2MA 1QK8A 3TRQA 5KN0A 2C3NA 3HYPA 4PQHA 2LRNA 2I3YA 2VLUA 2AHEA 2P0GA 2H1AA 2WS2A 4HSCX 1R4WA 2H76A 4XS1A 1DUGA 2C0EA 2R0PA 3HJPA 3OR5A
chains in the Genus database with same CATH topology
4KF9A 3EU3A 4K2DA 2HQTA 3GYKA 1K3LA 5J4UA 5IMVA 1AQXA 6GSYA 2LS5A 2DSAA 4EIQA 2HZFA 1X0RA 4KDUA 3FHKA 3KD0A 2R5GA 3G9BA 2LEGA 3D21A 5ECSA 2V1MA 1AQWA 1T4YA 4PNGA 2YV9A 2G0FA 3WGXA 5J40A 1XCCA 2CAQA 1Z9HA 4WETA 4ZBAA 3EWLA 3UIWA 2OKAA 3UMAA 1W4VA 1GTAA 4MJEA 3GKKA 5EY6A 3HJOA 2B6MA 4N10A 2XPEA 1MDIA 1UC7A 1O7UA 1BF5A 1PGTA 1T7PB 5A1NB 3IXRA 1PKZA 4XCSA 3M1GA 4RQXA 3QOUA 4GF0A 5D8IA 5D73A 1R7HA 4AGSA 1Z5YE 4BA7A 5AISA 2L59A 1X5EA 4IN0A 1FHEA 1EP8A 3QAWA 14GSA 4JR6A 2C80A 2YWMA 3GFKA 5DVBA 2FLSA 4L0UA 3U5RE 3EMPA 1TOFA 4YH2A 2FY6A 3FZ5A 1AUCA 3N9JA 1GLPA 1SU9A 1VF2A 2IMFA 2LSTA 4BVYA 3F3QA 3GUSA 5LNKe 4POLA 1O85A 1NW2A 4RI6A 5HR3A 3ZLPA 1S3CA 5IMZA 2YCDA 2D2ZA 4E68A 3CBUA 2VLVA 1ZGNA 5ECKB 2CVDA 3IC4A 4NHWA 2GZYA 2IL3A 6GSWA 3F3RA 1PL1A 1K0DA 4OFMA 6GSSA 4CW9A 1F37A 4HJ2A 3C1RA 2HXKA 2K6VA 3GKNA 5IO0A 2IN3A 1GSSA 2CZ2A 4MF6A 4TXVA 2O5VA 4KDXA 3U6VA 3LWAA 1EV9A 3C1SA 1R26A 2E2MA 1TRSA 5A5HB 1AQVA 2GQKA 5ECOB 4OD7A 1I9DA 2ON7A 2L5OA 4V1Ag 3IRAA 2BJXA 2AYTA 3SWLA 4I2UA 3MAKA 3ERWA 2C3TA 4AJ6A 4POKA 2QGVA 4IGJA 3GX8A 4O5RA 4TVEA 3F6DA 3QFBC 4HJMA 4N11A 5CRGA 3TB2A 4NAXA 4XS6A 5IMFA 1XBSA 2JZSA 2VCXA 4QL7A 1MDKA 2L4CA 4JZQA 1WP0A 3EE2A 5ID2B 1KBNA 1XVQA 2IFQB 1O8WA 3BCIA 1EEMA 3MWHA 3G7IA 3HVSA 2CV4A 3ZIVA 1DBYA 3ZIJA 5DJMA 1YKAA 2DJJA 1JZDA 4K7IA 4ECCA 4DEJA 4OCEA 4EVMA 3TOTA 2QA2A 2YZUA 4EC0A 1SKSB 3BJ5A 2C8UA 4KGIA 4LLRA 1BG5A 2OBKA 2BTOT 1XFLA 2TRXA 4JBBA 4XIHA 1USBA 4XRDA 1A2JA 3DEXA 1K3YA 2X8HA 1GNWA 3BOAA 1XW6A 4GSTA 3MDKA 2PGTA 3LQ7A 5FWGA 2WCIA 2HLSA 2JSZA 4RI7A 1TU8A 1ZYPA 4HS1A 4NHZA 3IDVA 3GH6A 2VCQA 1JHBA 1YF0A 1SJ6A 5IMCA 1UA5A 1PRXA 4BL7A 3VLNA 3TJJA 4TN8A 5DDLA 3O76A 3HA9A 3W8JA 1XW5A 2TRCP 3A2XA 3KM6A 1SK1A 5ECQB 1ERWA 1TW9A 2L4QA 1ERTA 2EFEA 2HZEB 2IWTA 2GGTA 3UEMA 4IJ3A 3HD5A 4ZL8A 1ZMAA 4KX4A 4OWYA 5H5QA 3F8UA 1DE1A 2DIYA 1TJDA 3D4MA 2JL4A 4YKFA 1K0AA 3UVHA 1OKTA 3HY2A 2O89A 3TCOA 5AN1A 1K3OA 1EGOA 2VO4A 1FW1A 3M9JA 5IMDA 1EP7A 4MA9A 2A2RA 2VAFA 2HRFA 2FHEA 5A4WA 2YJ7A 3KGKA 3KCMA 3TJKA 1U3AA 1OE8A 1Q4JA 5GAPD 4NWYA 3IA1A 4AKGA 2VM1A 4TR1A 2GQLA 9GSSA 3D4TA 4O92A 1GUHA 4DSRA 4XS4A 2GQMA 4MPGA 1O6JA 3F0IA 3PH9A 1WJKA 2HFDA 2MMZA 3WGDA 2DJ1A 4Q5FA 4BVXA 4F03A 4KSMA 1A0FA 2MBSA 3RHBA 3RBTA 2GTUA 5D96A 3ZVJA 4O32A 1TRVA 1G6YA 2B1KA 3FW2A 3TRXA 4XTSA 1YKCA 2YV7A 4MZWA 2B3SA 4PQ1A 2VCWA 1OVNA 4GWRA 2YWNA 2EIRA 3LORA 1SD9A 7GSSA 1V40A 3GSSA 3CYNA 4G0IA 4HU9A 3QMXA 1RK4A 4IELA 3IHQA 2HSMB 3ME7A 1SK0A 3DVXA 3RPNA 5AIXA 3RPPA 3ZMKA 5J4YA 1NSWA 2V6OA 3TGZA 1WMJA 2X8CA 1GRXA 2QA1A 4E8HA 1YZXA 2EFCA 3J7Yb 1GUMA 1TRUA 1PD21 1VGLA 1YQ1A 4XRAA 1O81A 4F0BA 1QXHA 1NM3A 3PGTA 3FK8A 4ZBBA 1SVLA 3VPTA 2H30A 2KP1A 1ZYNA 3VWWA 5B6NA 1IYHA 1F2EA 5DAKA 2HYXA 22GSA 1TK5B 3UARA 4O5UA 1SVMA 1M9AA 5J9BA 1B9XC 3KP9A 2JZRA 4HQZA 4YAVA 3C8EA 1M9BA 4I5QA 3J7Yk 2XC2A 1XOBA 3L9VA 3IV4A 3UL3A 1GP1A 1THXA 1QGVA 4V1Ap 4F82A 1GH2A 4GCIA 1PA3A 4J57E 3CWGA 3R2QA 1LJRA 3EYTA 1GL8A 6GSUA 2LJRA 3VI7A 3TOUA 3CSHA 3A2VA 1R5PA 5DQSA 4AKIA 3US3A 4TR0A 5L71A 4NXIA 4Q5NA 4GXZA 3D5JA 1DSBA 2JACA 1WOUA 3M3MA 5A4VA 2HE3A 1THOA 3FYGA 5KN2A 3PINA 4K0GA 5GZZB 2QKEA 3ZREA 2VOCA 2HI7A 4MJBA 5ECPB 2H75A 1TDIA 2FA8A 4Z7XA 2EFHA 4ICYA 3GNJA 3KTLA 2OE3A 3P8WA 1G6WA 3TDGA 1CQHA 1ERVA 1N8JA 2GSTA 3HMJG 1MDJA 2CX3A 2N5AA 2FWFA 1Y6EA 3HVVA 2I4AA 3ZITA 4ZL9A 4EDZA 2LQOA 1GULA 4IS0A 1F9MA 1BYEA 2HSNA 1GWCA 2LRTA 5JWRB 4MJAA 1AC1A 1V57A 2JU5A 3EINA 2VIMA 1VRSD 4N3ZA 1WPIA 3H4KA 4FQUA 4OMVA 1OC9B 5IOXA 4DSQA 2MYGA 1XXUA 1A8LA 1H75A 3KH9A 2KLXA 4O5QA 2A2PA 2IPAA 2VD1A 3ED3A 4TXOA 4KUNA 4ML6A 3ERGA 5J5NA 2OE1A 1H4OA 1B4QA 2EFDA 5KN3A 1B4PA 2XHFA 4TR4A 4IW9A 5EL8A 3V1WA 4J56E 4V2NA 5JWOB 2VUPA 2OADA 4EKZA 2F9SA 5AIVA 5EVOA 3TKQA 5A34B 2AUVA 5CYYA 2H0GA 1EWXA 2PWJA 3GA4A 2H6YA 3DXBA 5G1LA 5A5KA 2FNOA 1M2DA 2I81A 3GURA 3D6IA 1X9SB 1K0CA 1ERUA 1SYXA 4L8EA 4G10A 2WFCA 2ES7A 2MMOA 1ON4A 2F8AA 2YP6A 5DALB 4FYCA 4TOPA 4DSSA 3K8NA 5ENUA 2OACA 2DMLA 3TJFA 5D93A 4EO3A 4L0WA 4POMA 1G0TA 3PPUA 3DMLA 3W8SA 2H73A 1ZZYA 5JCGA 3G7YA 2E7PA 4IJIA 3VK9A 1BAYA 3IBHA 3I6AA 4IKHA 1FB6A 4ZB9A 5CREA 2NBSA 3UBKA 4YAPA 5IM9A 2GZZA 1XZOA 2J9HA 1GSEA 3BBYA 4MPFA 3C71A 3KJYA 2DLXA 2HT9A 3ZFBA 3IR4A 1BQ7A 3GL3A 1VF3A 2GT5A 4OFTA 1SK2A 2Z9SA 2H01A 4I2TA 4PXOA 4EE0A 2NDOA 3TKPA 1YEPA 3H93A 1TP9A 2PN8A 1J9BA 5HFIA 3ZVJD 2HRAA 3FR9A 2E2GA 2H6XA 4NV2A 5J9CA 1PQNA 5CRHA 5INYA 1PL2A 2O8VB 3APOA 4Q5QA 3GMFA 1ZYEA 2K18A 4MZCA 5COHA 4GQCA 2X64A 4KA0A 5J3RA 2FUG2 4IQ1A 1U3IA 2HNLA 4LMVA 5H5RA 2PMTA 1LU4A 1J0FA 4WR5A 8GSSA 4BPYA 1F3BA 3CRUA 2TIRA 3LXTA 4OO4A 1JFUA 2H19A 4BVYB 4IHUA 2EC4A 3GKMA 2R6KA 1Y1UA 4WR4A 5DBQA 2IMDA 1G7OA 4KW6A 3LSZA 2H1BA 1S3AA 3JCML 4EDYA 2H1DA 1X5CA 1A0RP 1A2LA 3M0FA 2P5QA 1M2BA 2FGXA 3H79A 4X4JA 2AV4A 4CY6A 4ID0A 2WDUA 2I1UA 2E0QA 1YY7A 4TRXA 4I8BA 3DGQA 4ECJA 2A4HA 2H0IA 1SKWB 4TW5A 1M99A 3GKXA 5ABRA 1K0OA 2KHPA 3GL5A 4KNDA 1BJXA 4KCAA 5F8BA 1OE7A 2O7KA 10GSA 1UN2A 2RIIA 1B9YC 2LNSA 1FG4A 2DJ3A 2M72A 5EPFA 2C4JA 3I69A 4L5LA 4HQSA 2K9FA 4Z2TA 1N25A 2HRKA 1URMA 2A2SA 4TR3A 3MNGA 3A5WA 6GSTA 5LD0A 1T1VA 5IIZA 2OT3A 2RM5A 1TXUA 4LL4B 2F51A 3IPZA 2VCZA 2HRNA 1BEDA 2AB6A 3D22A 2LNTA 2NTOA 1ST9A 1Q98A 1PN9A 1B8XA 4BWQA 4H86A 1GSDA 1QUWA 2H6ZA 2PU9C 2YWIA 5G2ZA 2KUCA 1V9WA 2WJUA 4ECBA 2FD3A 3KTBA 5BMUA 2XBIA 3UBLA 5LCZA 2XPDA 1X5DA 1YVLA 5B7CA 4GSNA 5IO2A 1B48A 3TKSA 2H1LA 5ECNB 4NMUA 2L6DA 1SYRA 2LTKA 1SD8A 2J23A 5CRWA 3FZ4A 1A8YA 3MIXA 1G7EA 3HXSA 2GVPA 1YDKA 5J41A 2WGRA 1TTZA 5ECMB 2YPMA 2LKUA 1YEXA 3O3TA 2NVLA 2EIQA 2B7KA 2MZCA 3CXGA 2K8SA 1JZRA 4YQMA 5DJLA 3IAS2 5JCWA 2MMNA 4D73A 2VLTA 3GTUA 4QQ7A 3DVWA 3EPTA 1PX7A 3IK9A 2VL2A 2H8LA 2GSSA 1WRYA 4X1UA 1BX9A 1XIYA 2QC7A 2MMAA 3A3TA 4Q5RA 4ZBDA 16GSA 4RUVA 4BL7B 3VI5A 4GDFA 3FMWA 1VF1A 1SJZA 3LYKA 1F6MC 3EU4A 3GH9A 4KSOA 11GSA 4XHMA 1XVWA 3LJRA 2VCVA 1T8EB 4GTUA 2VCTA 2M80A 2X4AA 2GT6A 2YWOA 1QQ2A 3D0ZA 1C72A 1TI1A 4PUAA 5ECLB 5BRTA 2V32A 1KEBA 1TXXA 2ZCTA 20GSA 2GLRA 4JR4A 5F07A 4IP6A 3WT2A 5HR2A 2IMEA 3HZ8A 2JSYA 1O73A 3KIJA 2JZTA 1U88A 4V2LA 3HVXA 2V2GA 4ZIJA 2WRTA 3UAPA 2DIZA 2KP2A 5G1KA 3F6FA 3W6GA 2R37A 1F3AA 5E59A 3IK7A 5C00A 4TR1B 2RUEA 3IAM2 3CSIA 1PN0A 3HKRA 4IQAA 3AY8A 4HDEA 2VD0A 2C0GA 4XS4B 4MH3A 1FVJA 3L4NA 6GSXA 3LXZA 3WGEA 2ZUPA 2YANA 4BWSA 2DKHA 4GQFA 4PGTA 2P5RA 2LQQA 4BVXB 1M0UA 3ERFA 4K9ZA 1R5AA 5ELGA 1V2AA 4ZXGA 1EEJA 2H0HA 4RQRA 3TJBA 5JWQB 5CAXA 3ZMLA 2WZ9A 1GLQA 1XWKA 2YJHA 4N30A 5HR0A 1K0BA 5G31A 4ILFA 4GRFA 4V2MA 5G5EA 5A34A 5A1NA 1OYJA 3GSTA 13GSA 5ECIB 2ON5A 3GN3A 2CAIA 1FOHA 2F8FA 4HOJA 4IP1A 1XWBA 4EF0A 5A4UA 2YOIA 3LGCA 19GSA 3LW9A 4CY8A 1PSQA 3KEBA 2X8GA 4WBJA 3VWXA 3H1NA 2PVQA 4MABA 1FOVA 1Z7PA 1JZOA 1CQGA 2OE0A 2DKIA 5GSSA 1LBKA 2IMIA 3KZQA 2H70A 4WEYA 1GTUA 5D9VA 3APSA 1GSYA 5DAKB 4YKGA 3HDCA 3RAZA 2FWGA 2R0GA 3QPMA 4K7OA 1T00A 5CNWA 5G30A 1TKDB 3ME8A 1EV4A 1E6BA 5A5HA 4JU5A 4MF5A 4FYBA 4WF4A 4ZB6A 4Z2RA 3E9JB 3DKSA 3C7MA 5C04A 1HNBA 1QFNA 3UOMA 2V41A 3RHCA 3QAGA 4YQVA 1E2YA 1FVKA 5KOWA 5DCGA 1TU7A 1PMTA 1RW1A 2VL3A 3IC8A 4NPBA 4K5RA 2DJKA 4ZB7A 3LG6A 17GSA 5KEJA 4K8MA 1PX6A 1ACVA 1ZYQB 5IPHA 3GRXA 3NIVA 1EZKA 3LEFA 3F63A 12GSA 5CRDA 3DD3A 2KOKA 1EGRA 3MSZA 3RDWA 4OFNA 3TKSE 1AAZA 3VPQA 1V58A 2YNXA 3C73A 3VURA 5F06A 1I5GA 5KN1A 5ID2A 4FIWA 2FA4A 1Z3EA 2IFQA 2GSRA 5E4WA 3L9SA 5B8AA 1GUKA 3QR6A 2C0DA 1A23A 3CSJA 4WF5A 2NPBA 1VF4A 3P7XA 4FYUA 2R3XA 4NV5A 4K6XA 4L5OA 3KXOA 2G2QA 4PNFA 2B7JA 4G01A 1XPVA 4KAEA 4G0LA 1QMVA 2ALBA 4K1FA 1SJIA 3Q74A 2OBIA 2HSNB 1HQOA 1XWGA 4MH2A 3P2AA 4F0CA 4EUYA 3SBCA 4IVFA 2RUFA 3ZTLA 2PUKC 1GSUA 4Z2UA 2YN1A 4AJ7A 1OKDA 2BMXA 4HZ4A 4TXOB 3IHGA 2M46A 4O7HA 1SENA 3GHAA 3ZZXA 4ECIA 4F9ZA 3FY7A 3F4TA 3NOFA 2B5YA 3DWVA 4MNNA 4MCUA 4MLYA 3MYDA 1OC3A 3DIEA 1TI3A 3A5IA 1W89A 2H66A 3O6TA 1K0NA 4TKYA 1NHYA 3TKSC 4AJ8A 4KDYA 1FB0A 2CVBA 2RLIA 3A2WA 1JZWA 4K7NA 4EIPA 5HFKA 2HZEA 4FO5A 1MEKA 1GNEA 4KB3A 2VM2A 5GAND 3LYPA 2FWEA 4LL1B 4DSSB 3WYWA 1M7TA 2GZPA 1O8XA 3GX0A 3ISOA 3M8NA 5IMAA 4QMKA 2N5BA 5IOWA 3CMIA 2VL2C 5CO3A 2HSYA 5DQYA 2YZHA 1WWJA 1S3DA 1SL0B 1XWAA 1GSQA 4JRRA 1WE0A 1SL2B 5FT3A 2CA8A 1KNGA 2PVOC 2GSQA 4AI6A 2CVKA 2WB9A 3BCKA 4LA1A 4ZL7A 3HHVA 3DRNA 3DYRA 1EOGA 1ZOFA 2OA7A 1GSFA 4FH8A 3TUEA 2C3QA 3FZ9A 18GSA 5J4VA 5IQYA 3KH7A 4HEA2 4I97A 3Q18A 2XBQA 2X99A 1FAAA 1MD3A 4PX1A 3HZ4A 4MP4A 2I9HA 1MD4A 1V98A 2EIOA 5F0GA 4P3YB 4AF2A 4ULXA 2C0FA 3E0UA 3R3EA 4MF7A 2LRCA 3UJ1A 3I43A 3G7JA 3P90A 3ZYWA 3GIXA 4PUFC 4CDOA 5HFGA 4A5PA 5KOXA 3FKFA 4G2EA 2CQ9A 1AW9A 2X49A 2CX4A 4KE3A 4X43A 2HSMA 4ZB8A 3VWVA 1M2AA 1Z6NA 3QCPA 3FZAA 5D9WA 3L78A 3KP8A 5D9XA 1KTEA 5DCHA 2O85A 3EC3A 1A24A 1JLWA 4ACSA 4QL9A 2FWHA 1ABAA 5AGYA 3NZNA 1EOHA 1WIKA 3ZFLA 1HD2A 4MZBA 3VFIA 1JLVA 1XOAA 1HNCA 4KH7A 3WD6A 2AJQB 3WT1A 3F4RA 1BG1A 1XW9A 4POBA 1ILOA 4J2FA 1NHOA 1GTIA 1IYIA 3L0HA 4K0NA 5G5FA 3KMNA 2UZ8A 5F05A 1UVZA 4HZ2A 3KMOA 3FEUA 3BD2A 1SKRB 4GSSA 2P31A 1SVOA 1ZCPA 1TRWA 3IE3A 1AXDA 1U87A 2WULA 2CT6A 2CZ3A 3E3EA 2H74A 5GSTA 1SL1B 4N0VA 1K0MA 2VKZG 4G9HA 2N5FA 3APQA 1GTBA 2LUSA 3N5OA 4X0XA 4ISDA 2DJ0A 2HRKB 1U6TA 1XWCA 4WKWA 1Z7RA 2B1LA 2LJAA 3UVTA 4HUAA 1OC8A 1TK0B 3Q6OA 2R0CA 2ZNMA 3L9UA 4HU7A 5CP1A 2R4VA 1MTCA 4YQUA 2LJKA 2PBJA 3VWUA 2UV8G 3EURA 1FO5A 3Q19A 4CHSA 4OCFA 3M9KA 5H5SA 4DVCA 3HJMA 3EMXA 4AKXB 2K8VA 2DJ2A 3TU3B 1Z6MA 1RQMA 2RM6A 5HR1A 4MMMA 4HI7A 2H71A 5BMUB 5B8BA 4PURA 2FCHA 5ECRB 2H72A 2GDRA 2DMMA 4EXJA 4PTSA 2O87A 4K2XA 4F2IA 2PPTA 2A4VA 2MBTA 2IIYA 3FR6A 1OAZA 5IPGA 5B6MA 3CTFA 3ZL5A 4MK3A 4MDCA 1T4ZA 2R2JA 5ECHB 2IJYA 3F4SA 4PQIA 1DE2A 3CTGA 3FRCA 1OC9A 3ZRDA 2B5XA 2OJLA 3QFAC 5FHIA 4USSA 1YJ6A 4G0KA 5JCUA 4D73B 2V6KA 1AIUA 3H8QA 1J08A 2L6CA 2GS3A 3GTUB 2DBCA 4K5SA 4N0ZA 5HQPA 2QSIA 1HYUA 3QAVA 3CRTA 2IMKA 3QDNA 4E8EA 3LFLA 4WXTA 3HCZA 3TRPA 1Y25A 5J47A 4MJCA 2B5EA 2C1YA 3PR8A 2L5LA 3IOSA 4KCEA 1X9WB 2DC5A 1ZL9A 4AKHA 3QD9A 6GSVA 2F3MA 3FR3A 2L57A 1YF1A 4I6XA 2LV3A 4W66A 4G19A 4ZILA 1ML6A 4EL1A 2AAWA 1PKWA 1X9MB 3TJGA 1N2AA 5ELAA 2REMA 3TKRA 1HNAA 4OO5A 5DALA 4JE1A 4IBPA 2HSHA 5D9TA 3EVIA 4GLTA 2PERA 2JADA 3GV1A 1TK8B 3S9FA 3F9UA 4LMWA 4ML1A 1T3BA 4JEDA 3I9V2 2VL9A 4WBRD 2H1GA 1A2MA 1QK8A 3TRQA 5KN0A 2C3NA 3HYPA 4PQHA 2LRNA 2I3YA 2VLUA 2AHEA 2P0GA 2H1AA 2WS2A 1R4WA 2H76A 4XS1A 1DUGA 2C0EA 2R0PA 3HJPA 3OR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KF9 A;  3EU3 A;  4K2D A;  2HQT A;  3GYK A;  1K3L A;  5J4U A;  5IMV A;  1AQX A;  6GSY A;  2LS5 A;  2DSA A;  2HZF A;  1X0R A;  4KDU A;  3FHK A;  3KD0 A;  2R5G A;  3G9B A;  2LEG A;  3D21 A;  5ECS A;  2V1M A;  1AQW A;  1T4Y A;  4PNG A;  2YV9 A;  2G0F A;  3WGX A;  1XCC A;  2CAQ A;  1Z9H A;  4WET A;  4ZBA A;  3EWL A;  3UIW A;  2OKA A;  3UMA A;  1W4V A;  1GTA A;  4MJE A;  3GKK A;  5EY6 A;  3HJO A;  2B6M A;  4N10 A;  2XPE A;  1MDI A;  1UC7 A;  1O7U A;  1PGT A;  1T7P B;  3IXR A;  1PKZ A;  4XCS A;  3M1G A;  4RQX A;  3QOU A;  4GF0 A;  5D8I A;  5D73 A;  1R7H A;  4AGS A;  1Z5Y E;  4BA7 A;  5AIS A;  2L59 A;  1X5E A;  4IN0 A;  1FHE A;  1EP8 A;  3QAW A;  14GS A;  4JR6 A;  2C80 A;  2YWM A;  3GFK A;  5DVB A;  2FLS A;  4L0U A;  3U5R E;  3EMP A;  1TOF A;  4YH2 A;  2FY6 A;  3FZ5 A;  1AUC A;  3N9J A;  1GLP A;  1SU9 A;  1VF2 A;  2IMF A;  2LST A;  4BVY A;  3F3Q A;  3GUS A;  5LNK e;  4POL A;  1O85 A;  1NW2 A;  4RI6 A;  5HR3 A;  3ZLP A;  1S3C A;  5IMZ A;  2YCD A;  2D2Z A;  3CBU A;  2VLV A;  1ZGN A;  5ECK B;  2CVD A;  3IC4 A;  4NHW A;  2GZY A;  2IL3 A;  6GSW A;  3F3R A;  1PL1 A;  1K0D A;  4OFM A;  6GSS A;  4CW9 A;  1F37 A;  4HJ2 A;  3C1R A;  2HXK A;  2K6V A;  3GKN A;  5IO0 A;  2IN3 A;  1GSS A;  2CZ2 A;  4MF6 A;  4TXV A;  4KDX A;  3U6V A;  3LWA A;  1EV9 A;  3C1S A;  1R26 A;  2E2M A;  1TRS A;  1AQV A;  2GQK A;  5ECO B;  4OD7 A;  1I9D A;  2ON7 A;  2L5O A;  4V1A g;  3IRA A;  2BJX A;  2AYT A;  3SWL A;  4I2U A;  3MAK A;  3ERW A;  2C3T A;  4AJ6 A;  4POK A;  2QGV A;  4IGJ A;  3GX8 A;  4O5R A;  4TVE A;  3F6D A;  3QFB C;  4HJM A;  4N11 A;  5CRG A;  3TB2 A;  4NAX A;  4XS6 A;  5IMF A;  1XBS A;  2JZS A;  2VCX A;  4QL7 A;  1MDK A;  2L4C A;  4JZQ A;  1WP0 A;  3EE2 A;  5ID2 B;  1KBN A;  1XVQ A;  2IFQ B;  1O8W A;  3BCI A;  1EEM A;  3MWH A;  3G7I A;  3HVS A;  2CV4 A;  3ZIV A;  1DBY A;  3ZIJ A;  5DJM A;  1YKA A;  2DJJ A;  1JZD A;  4K7I A;  4ECC A;  4DEJ A;  4OCE A;  4EVM A;  3TOT A;  2YZU A;  4EC0 A;  1SKS B;  3BJ5 A;  2C8U A;  4KGI A;  4LLR A;  1BG5 A;  2OBK A;  2BTO T;  1XFL A;  2TRX A;  4JBB A;  4XIH A;  1USB A;  4XRD A;  1A2J A;  3DEX A;  1K3Y A;  2X8H A;  1GNW A;  3BOA A;  1XW6 A;  4GST A;  3MDK A;  2PGT A;  3LQ7 A;  5FWG A;  2WCI A;  2HLS A;  2JSZ A;  4RI7 A;  1TU8 A;  4HS1 A;  4NHZ A;  3IDV A;  3GH6 A;  2VCQ A;  1JHB A;  1YF0 A;  1SJ6 A;  5IMC A;  1UA5 A;  1PRX A;  4BL7 A;  3VLN A;  3TJJ A;  4TN8 A;  5DDL A;  3O76 A;  3HA9 A;  3W8J A;  1XW5 A;  2TRC P;  3A2X A;  3KM6 A;  1SK1 A;  5ECQ B;  1ERW A;  1TW9 A;  2L4Q A;  1ERT A;  2HZE B;  2IWT A;  2GGT A;  3UEM A;  4IJ3 A;  3HD5 A;  4ZL8 A;  1ZMA A;  4KX4 A;  4OWY A;  5H5Q A;  3F8U A;  1DE1 A;  2DIY A;  1TJD A;  3D4M A;  2JL4 A;  1K0A A;  3UVH A;  1OKT A;  3HY2 A;  2O89 A;  3TCO A;  5AN1 A;  1K3O A;  1EGO A;  2VO4 A;  1FW1 A;  3M9J A;  5IMD A;  1EP7 A;  4MA9 A;  2A2R A;  2VAF A;  2HRF A;  2FHE A;  5A4W A;  2YJ7 A;  3KGK A;  3KCM A;  3TJK A;  1U3A A;  1OE8 A;  1Q4J A;  5GAP D;  4NWY A;  3IA1 A;  2VM1 A;  4TR1 A;  2GQL A;  9GSS A;  3D4T A;  4O92 A;  1GUH A;  4DSR A;  4XS4 A;  2GQM A;  4MPG A;  1O6J A;  3F0I A;  3PH9 A;  1WJK A;  2HFD A;  2MMZ A;  3WGD A;  2DJ1 A;  4Q5F A;  4BVX A;  4F03 A;  4KSM A;  1A0F A;  2MBS A;  3RHB A;  3RBT A;  2GTU A;  5D96 A;  3ZVJ A;  4O32 A;  1TRV A;  1G6Y A;  2B1K A;  3FW2 A;  3TRX A;  4XTS A;  1YKC A;  2YV7 A;  4MZW A;  2B3S A;  4PQ1 A;  2VCW A;  1OVN A;  4GWR A;  2YWN A;  2EIR A;  3LOR A;  1SD9 A;  7GSS A;  1V40 A;  3GSS A;  3CYN A;  4G0I A;  4HU9 A;  3QMX A;  1RK4 A;  4IEL A;  3IHQ A;  2HSM B;  3ME7 A;  1SK0 A;  3DVX A;  3RPN A;  5AIX A;  3RPP A;  3ZMK A;  1NSW A;  2V6O A;  3TGZ A;  1WMJ A;  2X8C A;  1GRX A;  4E8H A;  1YZX A;  3J7Y b;  1GUM A;  1TRU A;  1PD2 1;  1VGL A;  1YQ1 A;  4XRA A;  1O81 A;  4F0B A;  1QXH A;  1NM3 A;  3PGT A;  3FK8 A;  4ZBB A;  3VPT A;  2H30 A;  2KP1 A;  3VWW A;  5B6N A;  1IYH A;  1F2E A;  5DAK A;  2HYX A;  22GS A;  1TK5 B;  3UAR A;  5J9B A;  1M9A A;  1B9X C;  3KP9 A;  2JZR A;  4HQZ A;  4YAV A;  3C8E A;  1M9B A;  4I5Q A;  3J7Y k;  2XC2 A;  1XOB A;  3L9V A;  3IV4 A;  3UL3 A;  1GP1 A;  1THX A;  1QGV A;  4V1A p;  4F82 A;  1GH2 A;  4GCI A;  1PA3 A;  4J57 E;  3R2Q A;  1LJR A;  3EYT A;  1GL8 A;  6GSU A;  2LJR A;  3VI7 A;  3TOU A;  3CSH A;  3A2V A;  1R5P A;  5DQS A;  3US3 A;  4TR0 A;  5L71 A;  4NXI A;  4Q5N A;  4GXZ A;  3D5J A;  1DSB A;  2JAC A;  1WOU A;  3M3M A;  5A4V A;  2HE3 A;  1THO A;  3FYG A;  5KN2 A;  3PIN A;  4K0G A;  5GZZ B;  2QKE A;  3ZRE A;  2VOC A;  2HI7 A;  4MJB A;  5ECP B;  2H75 A;  1TDI A;  2FA8 A;  4Z7X A;  3GNJ A;  3KTL A;  2OE3 A;  3P8W A;  1G6W A;  3TDG A;  1CQH A;  1ERV A;  1N8J A;  2GST A;  1MDJ A;  2N5A A;  2CX3 A;  2FWF A;  1Y6E A;  3HVV A;  2I4A A;  3ZIT A;  4ZL9 A;  4EDZ A;  2LQO A;  1GUL A;  4IS0 A;  1F9M A;  1BYE A;  1GWC A;  2LRT A;  5JWR B;  4MJA A;  1AC1 A;  1V57 A;  2JU5 A;  3EIN A;  2VIM A;  1VRS D;  1WPI A;  3H4K A;  4FQU A;  4OMV A;  1OC9 B;  5IOX A;  4DSQ A;  2MYG A;  1XXU A;  1A8L A;  1H75 A;  3KH9 A;  2KLX A;  2IPA A;  2VD1 A;  3ED3 A;  4TXO A;  4KUN A;  4ML6 A;  3ERG A;  5J5N A;  2OE1 A;  1H4O A;  1B4Q A;  5KN3 A;  1B4P A;  2XHF A;  4TR4 A;  4IW9 A;  5EL8 A;  3V1W A;  4J56 E;  4V2N A;  5JWO B;  2VUP A;  2OAD A;  4EKZ A;  2F9S A;  5AIV A;  5EVO A;  3TKQ A;  2AUV A;  5CYY A;  2H0G A;  1EWX A;  2PWJ A;  3GA4 A;  2H6Y A;  3DXB A;  5G1L A;  5A5K A;  2FNO A;  1M2D A;  2I81 A;  3GUR A;  3D6I A;  1X9S B;  1K0C A;  1ERU A;  1SYX A;  4L8E A;  4G10 A;  2WFC A;  2ES7 A;  2MMO A;  1ON4 A;  2F8A A;  2YP6 A;  5DAL B;  4FYC A;  4TOP A;  4DSS A;  3K8N A;  5ENU A;  2OAC A;  2DML A;  3TJF A;  5D93 A;  4EO3 A;  4L0W A;  4POM A;  1G0T A;  3PPU A;  3DML A;  3W8S A;  2H73 A;  1ZZY A;  5JCG A;  3G7Y A;  2E7P A;  4IJI A;  3VK9 A;  1BAY A;  3IBH A;  3I6A A;  4IKH A;  1FB6 A;  4ZB9 A;  5CRE A;  2NBS A;  3UBK A;  4YAP A;  5IM9 A;  2GZZ A;  1XZO A;  2J9H A;  1GSE A;  3BBY A;  4MPF A;  3C71 A;  3KJY A;  2DLX A;  2HT9 A;  3ZFB A;  3IR4 A;  1BQ7 A;  3GL3 A;  1VF3 A;  2GT5 A;  4OFT A;  1SK2 A;  2Z9S A;  2H01 A;  4I2T A;  4PXO A;  4EE0 A;  2NDO A;  3TKP A;  1YEP A;  3H93 A;  1TP9 A;  2PN8 A;  1J9B A;  5HFI A;  3ZVJ D;  2HRA A;  3FR9 A;  2E2G A;  2H6X A;  4NV2 A;  5J9C A;  1PQN A;  5CRH A;  5INY A;  1PL2 A;  2O8V B;  3APO A;  4Q5Q A;  3GMF A;  1ZYE A;  2K18 A;  4MZC A;  5COH A;  4GQC A;  2X64 A;  4KA0 A;  5J3R A;  2FUG 2;  4IQ1 A;  1U3I A;  2HNL A;  4LMV A;  5H5R A;  2PMT A;  1LU4 A;  1J0F A;  4WR5 A;  8GSS A;  4BPY A;  1F3B A;  3CRU A;  2TIR A;  3LXT A;  4OO4 A;  1JFU A;  2H19 A;  4BVY B;  4IHU A;  2EC4 A;  3GKM A;  2R6K A;  5DBQ A;  4WR4 A;  2IMD A;  1G7O A;  4KW6 A;  3LSZ A;  2H1B A;  1S3A A;  3JCM L;  4EDY A;  2H1D A;  1X5C A;  1A0R P;  1A2L A;  3M0F A;  2P5Q A;  1M2B A;  2FGX A;  3H79 A;  2AV4 A;  4ID0 A;  2WDU A;  2I1U A;  2E0Q A;  1YY7 A;  4TRX A;  4I8B A;  3DGQ A;  4ECJ A;  2H0I A;  1SKW B;  4TW5 A;  1M99 A;  3GKX A;  5ABR A;  1K0O A;  2KHP A;  3GL5 A;  4KND A;  1BJX A;  4KCA A;  5F8B A;  1OE7 A;  2O7K A;  10GS A;  1UN2 A;  2RII A;  1B9Y C;  2LNS A;  1FG4 A;  2DJ3 A;  2M72 A;  5EPF A;  2C4J A;  3I69 A;  4L5L A;  4HQS A;  2K9F A;  2HRK A;  1URM A;  2A2S A;  4TR3 A;  3MNG A;  3A5W A;  6GST A;  5LD0 A;  1T1V A;  5IIZ A;  2RM5 A;  4LL4 B;  2F51 A;  3IPZ A;  2VCZ A;  2HRN A;  1BED A;  2AB6 A;  3D22 A;  2LNT A;  2NTO A;  1ST9 A;  1Q98 A;  1PN9 A;  1B8X A;  4BWQ A;  4H86 A;  1GSD A;  1QUW A;  2H6Z A;  2PU9 C;  2YWI A;  5G2Z A;  2KUC A;  1V9W A;  2WJU A;  4ECB A;  2FD3 A;  3KTB A;  5BMU A;  2XBI A;  3UBL A;  5LCZ A;  2XPD A;  1X5D A;  5B7C A;  4GSN A;  5IO2 A;  1B48 A;  3TKS A;  5ECN B;  4NMU A;  2L6D A;  1SYR A;  2LTK A;  1SD8 A;  2J23 A;  5CRW A;  3FZ4 A;  1A8Y A;  1G7E A;  3HXS A;  2GVP A;  1YDK A;  5J41 A;  2WGR A;  1TTZ A;  5ECM B;  2YPM A;  2LKU A;  1YEX A;  3O3T A;  2NVL A;  2EIQ A;  2B7K A;  2MZC A;  3CXG A;  2K8S A;  1JZR A;  4YQM A;  5DJL A;  3IAS 2;  5JCW A;  2MMN A;  4D73 A;  2VLT A;  3GTU A;  4QQ7 A;  3DVW A;  1PX7 A;  3IK9 A;  2VL2 A;  2H8L A;  2GSS A;  1WRY A;  4X1U A;  1BX9 A;  1XIY A;  2QC7 A;  2MMA A;  3A3T A;  4Q5R A;  4ZBD A;  16GS A;  4RUV A;  4BL7 B;  3VI5 A;  1VF1 A;  1SJZ A;  3LYK A;  1F6M C;  3EU4 A;  3GH9 A;  4KSO A;  11GS A;  4XHM A;  1XVW A;  3LJR A;  2VCV A;  1T8E B;  4GTU A;  2VCT A;  2M80 A;  2GT6 A;  2YWO A;  1QQ2 A;  3D0Z A;  1C72 A;  1TI1 A;  4PUA A;  5ECL B;  2V32 A;  1KEB A;  1TXX A;  2ZCT A;  20GS A;  2GLR A;  4JR4 A;  5F07 A;  4IP6 A;  3WT2 A;  5HR2 A;  2IME A;  3HZ8 A;  2JSY A;  1O73 A;  3KIJ A;  2JZT A;  1U88 A;  4V2L A;  3HVX A;  2V2G A;  4ZIJ A;  2WRT A;  3UAP A;  2DIZ A;  2KP2 A;  5G1K A;  3F6F A;  3W6G A;  2R37 A;  1F3A A;  5E59 A;  3IK7 A;  5C00 A;  4TR1 B;  2RUE A;  3IAM 2;  3CSI A;  3HKR A;  4IQA A;  3AY8 A;  4HDE A;  2VD0 A;  2C0G A;  4XS4 B;  4MH3 A;  1FVJ A;  3L4N A;  6GSX A;  3LXZ A;  3WGE A;  2ZUP A;  2YAN A;  4BWS A;  4GQF A;  4PGT A;  2P5R A;  2LQQ A;  4BVX B;  1M0U A;  3ERF A;  4K9Z A;  1R5A A;  5ELG A;  1V2A A;  4ZXG A;  1EEJ A;  2H0H A;  4RQR A;  3TJB A;  5JWQ B;  5CAX A;  3ZML A;  2WZ9 A;  1GLQ A;  1XWK A;  2YJH A;  4N30 A;  5HR0 A;  1K0B A;  5G31 A;  4ILF A;  4GRF A;  4V2M A;  5G5E A;  1OYJ A;  3GST A;  13GS A;  5ECI B;  2ON5 A;  3GN3 A;  2CAI A;  2F8F A;  4HOJ A;  4IP1 A;  1XWB A;  4EF0 A;  5A4U A;  2YOI A;  3LGC A;  19GS A;  1PSQ A;  3KEB A;  2X8G A;  4WBJ A;  3VWX A;  3H1N A;  2PVQ A;  4MAB A;  1FOV A;  1Z7P A;  1JZO A;  1CQG A;  2OE0 A;  5GSS A;  1LBK A;  2IMI A;  3KZQ A;  2H70 A;  4WEY A;  1GTU A;  5D9V A;  3APS A;  1GSY A;  5DAK B;  3HDC A;  3RAZ A;  2FWG A;  3QPM A;  4K7O A;  1T00 A;  5CNW A;  5G30 A;  1TKD B;  3ME8 A;  1EV4 A;  1E6B A;  4JU5 A;  4MF5 A;  4FYB A;  4WF4 A;  4ZB6 A;  3E9J B;  3DKS A;  3C7M A;  5C04 A;  1HNB A;  1QFN A;  3UOM A;  2V41 A;  3RHC A;  3QAG A;  4YQV A;  1E2Y A;  1FVK A;  5DCG A;  1TU7 A;  1PMT A;  1RW1 A;  2VL3 A;  3IC8 A;  4NPB A;  2DJK A;  3LG6 A;  17GS A;  5KEJ A;  4K8M A;  1PX6 A;  1ACV A;  1ZYQ B;  5IPH A;  3GRX A;  3NIV A;  1EZK A;  3LEF A;  3F63 A;  12GS A;  5CRD A;  3DD3 A;  2KOK A;  1EGR A;  3MSZ A;  3RDW A;  4OFN A;  3TKS E;  1AAZ A;  3VPQ A;  1V58 A;  2YNX A;  3C73 A;  3VUR A;  5F06 A;  1I5G A;  5KN1 A;  5ID2 A;  4FIW A;  2FA4 A;  1Z3E A;  2IFQ A;  2GSR A;  5E4W A;  3L9S A;  5B8A A;  1GUK A;  3QR6 A;  2C0D A;  1A23 A;  3CSJ A;  4WF5 A;  2NPB A;  1VF4 A;  3P7X A;  4FYU A;  2R3X A;  4NV5 A;  4K6X A;  4L5O A;  3KXO A;  2G2Q A;  4PNF A;  2B7J A;  1XPV A;  4KAE A;  4G0L A;  1QMV A;  2ALB A;  4K1F A;  1SJI A;  3Q74 A;  2OBI A;  2HSN B;  1HQO A;  1XWG A;  4MH2 A;  3P2A A;  4F0C A;  4EUY A;  3SBC A;  4IVF A;  2RUF A;  3ZTL A;  2PUK C;  1GSU A;  2YN1 A;  4AJ7 A;  1OKD A;  2BMX A;  4HZ4 A;  4TXO B;  2M46 A;  4O7H A;  1SEN A;  3GHA A;  3ZZX A;  4ECI A;  4F9Z A;  3FY7 A;  3F4T A;  3NOF A;  2B5Y A;  3DWV A;  4MCU A;  4MLY A;  1OC3 A;  3DIE A;  1TI3 A;  1W89 A;  2H66 A;  3O6T A;  1K0N A;  4TKY A;  1NHY A;  3TKS C;  4AJ8 A;  4KDY A;  1FB0 A;  2CVB A;  2RLI A;  3A2W A;  1JZW A;  4K7N A;  5HFK A;  2HZE A;  4FO5 A;  1MEK A;  1GNE A;  4KB3 A;  2VM2 A;  5GAN D;  3LYP A;  2FWE A;  4LL1 B;  4DSS B;  3WYW A;  1M7T A;  2GZP A;  1O8X A;  3GX0 A;  3ISO A;  3M8N A;  5IMA A;  2N5B A;  5IOW A;  3CMI A;  2VL2 C;  5CO3 A;  2HSY A;  5DQY A;  2YZH A;  1WWJ A;  1S3D A;  1SL0 B;  1XWA A;  1GSQ A;  4JRR A;  1WE0 A;  1SL2 B;  5FT3 A;  2CA8 A;  1KNG A;  2PVO C;  2GSQ A;  2CVK A;  2WB9 A;  3BCK A;  4LA1 A;  4ZL7 A;  3HHV A;  3DRN A;  3DYR A;  1EOG A;  1ZOF A;  2OA7 A;  1GSF A;  4FH8 A;  3TUE A;  2C3Q A;  3FZ9 A;  18GS A;  5IQY A;  3KH7 A;  4HEA 2;  4I97 A;  3Q18 A;  2XBQ A;  2X99 A;  1FAA A;  1MD3 A;  4PX1 A;  3HZ4 A;  4MP4 A;  2I9H A;  1MD4 A;  1V98 A;  2EIO A;  5F0G A;  4P3Y B;  4AF2 A;  4ULX A;  2C0F A;  3E0U A;  3R3E A;  4MF7 A;  2LRC A;  3UJ1 A;  3I43 A;  3G7J A;  3P90 A;  3ZYW A;  3GIX A;  4PUF C;  4CDO A;  5HFG A;  3FKF A;  4G2E A;  2CQ9 A;  1AW9 A;  2CX4 A;  4KE3 A;  4X43 A;  2HSM A;  4ZB8 A;  3VWV A;  1M2A A;  1Z6N A;  3QCP A;  3FZA A;  5D9W A;  3L78 A;  3KP8 A;  5D9X A;  1KTE A;  5DCH A;  2O85 A;  3EC3 A;  1A24 A;  1JLW A;  4ACS A;  4QL9 A;  2FWH A;  1ABA A;  5AGY A;  3NZN A;  1EOH A;  1WIK A;  3ZFL A;  1HD2 A;  4MZB A;  3VFI A;  1JLV A;  1XOA A;  1HNC A;  4KH7 A;  3WD6 A;  2AJQ B;  3WT1 A;  3F4R A;  1XW9 A;  4POB A;  1ILO A;  4J2F A;  1NHO A;  1GTI A;  1IYI A;  3L0H A;  4K0N A;  5G5F A;  3KMN A;  2UZ8 A;  5F05 A;  1UVZ A;  4HZ2 A;  3KMO A;  3FEU A;  3BD2 A;  1SKR B;  4GSS A;  2P31 A;  1ZCP A;  1TRW A;  3IE3 A;  1AXD A;  1U87 A;  2WUL A;  2CT6 A;  2CZ3 A;  3E3E A;  2H74 A;  5GST A;  1SL1 B;  4N0V A;  1K0M A;  4G9H A;  2N5F A;  3APQ A;  1GTB A;  2LUS A;  3N5O A;  4X0X A;  4ISD A;  2DJ0 A;  2HRK B;  1U6T A;  1XWC A;  4WKW A;  1Z7R A;  2B1L A;  2LJA A;  3UVT A;  4HUA A;  1OC8 A;  1TK0 B;  3Q6O A;  2ZNM A;  3L9U A;  4HU7 A;  5CP1 A;  2R4V A;  1MTC A;  4YQU A;  2LJK A;  2PBJ A;  3VWU A;  3EUR A;  1FO5 A;  3Q19 A;  4CHS A;  4OCF A;  3M9K A;  5H5S A;  4DVC A;  3HJM A;  3EMX A;  2K8V A;  2DJ2 A;  1Z6M A;  1RQM A;  2RM6 A;  5HR1 A;  4MMM A;  4HI7 A;  2H71 A;  5B8B A;  4PUR A;  2FCH A;  5ECR B;  2H72 A;  2GDR A;  2DMM A;  4EXJ A;  4PTS A;  2O87 A;  4F2I A;  2PPT A;  2A4V A;  2MBT A;  2IIY A;  3FR6 A;  1OAZ A;  5IPG A;  5B6M A;  3CTF A;  3ZL5 A;  4MK3 A;  4MDC A;  1T4Z A;  2R2J A;  5ECH B;  2IJY A;  3F4S A;  4PQI A;  1DE2 A;  3CTG A;  3FRC A;  1OC9 A;  3ZRD A;  2B5X A;  2OJL A;  3QFA C;  5FHI A;  4USS A;  1YJ6 A;  4G0K A;  5JCU A;  4D73 B;  2V6K A;  1AIU A;  3H8Q A;  1J08 A;  2L6C A;  2GS3 A;  3GTU B;  2DBC A;  4N0Z A;  5HQP A;  2QSI A;  1HYU A;  3QAV A;  3CRT A;  2IMK A;  3QDN A;  4E8E A;  3LFL A;  4WXT A;  3HCZ A;  3TRP A;  1Y25 A;  4MJC A;  2B5E A;  2C1Y A;  3PR8 A;  2L5L A;  3IOS A;  4KCE A;  1X9W B;  2DC5 A;  1ZL9 A;  3QD9 A;  6GSV A;  2F3M A;  3FR3 A;  2L57 A;  1YF1 A;  4I6X A;  2LV3 A;  4G19 A;  4ZIL A;  1ML6 A;  4EL1 A;  2AAW A;  1PKW A;  1X9M B;  3TJG A;  1N2A A;  5ELA A;  2REM A;  3TKR A;  1HNA A;  4OO5 A;  5DAL A;  4JE1 A;  4IBP A;  2HSH A;  5D9T A;  3EVI A;  4GLT A;  2PER A;  2JAD A;  3GV1 A;  1TK8 B;  3S9F A;  3F9U A;  4LMW A;  4ML1 A;  1T3B A;  4JED A;  3I9V 2;  2VL9 A;  4WBR D;  2H1G A;  1A2M A;  1QK8 A;  3TRQ A;  5KN0 A;  2C3N A;  3HYP A;  4PQH A;  2LRN A;  2I3Y A;  2VLU A;  2AHE A;  2P0G A;  2H1A A;  2WS2 A;  1R4W A;  2H76 A;  4XS1 A;  1DUG A;  2C0E A;  3HJP A;  3OR5 A; 
#chains in the Genus database with same CATH topology
 4KF9 A;  3EU3 A;  4K2D A;  2HQT A;  3GYK A;  1K3L A;  5J4U A;  5IMV A;  1AQX A;  6GSY A;  2LS5 A;  2DSA A;  4EIQ A;  2HZF A;  1X0R A;  4KDU A;  3FHK A;  3KD0 A;  2R5G A;  3G9B A;  2LEG A;  3D21 A;  5ECS A;  2V1M A;  1AQW A;  1T4Y A;  4PNG A;  2YV9 A;  2G0F A;  3WGX A;  5J40 A;  1XCC A;  2CAQ A;  1Z9H A;  4WET A;  4ZBA A;  3EWL A;  3UIW A;  2OKA A;  3UMA A;  1W4V A;  1GTA A;  4MJE A;  3GKK A;  5EY6 A;  3HJO A;  2B6M A;  4N10 A;  2XPE A;  1MDI A;  1UC7 A;  1O7U A;  1BF5 A;  1PGT A;  1T7P B;  5A1N B;  3IXR A;  1PKZ A;  4XCS A;  3M1G A;  4RQX A;  3QOU A;  4GF0 A;  5D8I A;  5D73 A;  1R7H A;  4AGS A;  1Z5Y E;  4BA7 A;  5AIS A;  2L59 A;  1X5E A;  4IN0 A;  1FHE A;  1EP8 A;  3QAW A;  14GS A;  4JR6 A;  2C80 A;  2YWM A;  3GFK A;  5DVB A;  2FLS A;  4L0U A;  3U5R E;  3EMP A;  1TOF A;  4YH2 A;  2FY6 A;  3FZ5 A;  1AUC A;  3N9J A;  1GLP A;  1SU9 A;  1VF2 A;  2IMF A;  2LST A;  4BVY A;  3F3Q A;  3GUS A;  5LNK e;  4POL A;  1O85 A;  1NW2 A;  4RI6 A;  5HR3 A;  3ZLP A;  1S3C A;  5IMZ A;  2YCD A;  2D2Z A;  4E68 A;  3CBU A;  2VLV A;  1ZGN A;  5ECK B;  2CVD A;  3IC4 A;  4NHW A;  2GZY A;  2IL3 A;  6GSW A;  3F3R A;  1PL1 A;  1K0D A;  4OFM A;  6GSS A;  4CW9 A;  1F37 A;  4HJ2 A;  3C1R A;  2HXK A;  2K6V A;  3GKN A;  5IO0 A;  2IN3 A;  1GSS A;  2CZ2 A;  4MF6 A;  4TXV A;  2O5V A;  4KDX A;  3U6V A;  3LWA A;  1EV9 A;  3C1S A;  1R26 A;  2E2M A;  1TRS A;  5A5H B;  1AQV A;  2GQK A;  5ECO B;  4OD7 A;  1I9D A;  2ON7 A;  2L5O A;  4V1A g;  3IRA A;  2BJX A;  4FXY P;  2AYT A;  3SWL A;  4I2U A;  3MAK A;  2WZS A;  3ERW A;  2C3T A;  4AJ6 A;  4POK A;  2QGV A;  4IGJ A;  3GX8 A;  4O5R A;  4TVE A;  3F6D A;  3QFB C;  4HJM A;  4N11 A;  5CRG A;  3TB2 A;  4NAX A;  4XS6 A;  5IMF A;  1XBS A;  2JZS A;  2VCX A;  4QL7 A;  1MDK A;  2L4C A;  4JZQ A;  1WP0 A;  3EE2 A;  5ID2 B;  1KBN A;  1XVQ A;  2IFQ B;  1O8W A;  3BCI A;  1EEM A;  3MWH A;  4PHZ C;  3G7I A;  3HVS A;  2CV4 A;  3ZIV A;  1DBY A;  3ZIJ A;  5DJM A;  1YKA A;  2DJJ A;  1JZD A;  4K7I A;  4ECC A;  4DEJ A;  4OCE A;  4EVM A;  3TOT A;  2QA2 A;  2YZU A;  4EC0 A;  1SKS B;  3BJ5 A;  2C8U A;  4KGI A;  4LLR A;  1BG5 A;  2OBK A;  2BTO T;  1XFL A;  2TRX A;  4JBB A;  2WW2 A;  4XIH A;  1USB A;  4XRD A;  1A2J A;  3DEX A;  1K3Y A;  2X8H A;  1GNW A;  3BOA A;  1XW6 A;  4GST A;  3MDK A;  2PGT A;  3LQ7 A;  5FWG A;  2WCI A;  2HLS A;  2JSZ A;  4RI7 A;  1TU8 A;  1ZYP A;  4HS1 A;  4NHZ A;  3IDV A;  3GH6 A;  2VCQ A;  1JHB A;  1YF0 A;  1SJ6 A;  5IMC A;  1UA5 A;  1PRX A;  4BL7 A;  3VLN A;  3TJJ A;  4TN8 A;  5DDL A;  3O76 A;  3HA9 A;  3W8J A;  1XW5 A;  2TRC P;  3A2X A;  3KM6 A;  1SK1 A;  5ECQ B;  1ERW A;  1TW9 A;  2L4Q A;  4PI2 C;  1ERT A;  2EFE A;  2HZE B;  2IWT A;  2GGT A;  3UEM A;  2WVY A;  4IJ3 A;  3HD5 A;  4ZL8 A;  1ZMA A;  4KX4 A;  4OWY A;  5H5Q A;  3F8U A;  1DE1 A;  2DIY A;  1TJD A;  3D4M A;  2JL4 A;  4YKF A;  1K0A A;  3UVH A;  1OKT A;  3HY2 A;  2O89 A;  3TCO A;  5AN1 A;  1K3O A;  1EGO A;  2VO4 A;  2O36 A;  1FW1 A;  3M9J A;  5IMD A;  1EP7 A;  4MA9 A;  2A2R A;  2VAF A;  2HRF A;  2FHE A;  5A4W A;  2YJ7 A;  3KGK A;  3KCM A;  3TJK A;  1U3A A;  1OE8 A;  1Q4J A;  5GAP D;  4NWY A;  3IA1 A;  4AKG A;  2VM1 A;  4TR1 A;  2GQL A;  9GSS A;  3D4T A;  4O92 A;  1GUH A;  4DSR A;  4XS4 A;  2GQM A;  4MPG A;  1O6J A;  3F0I A;  3PH9 A;  1WJK A;  2HFD A;  2MMZ A;  3WGD A;  2DJ1 A;  4Q5F A;  4BVX A;  4F03 A;  4KSM A;  1A0F A;  2MBS A;  3RHB A;  3RBT A;  2GTU A;  5D96 A;  3ZVJ A;  4O32 A;  1TRV A;  1G6Y A;  2B1K A;  3FW2 A;  3TRX A;  4XTS A;  1YKC A;  3RGB C;  2YV7 A;  4MZW A;  2B3S A;  4PQ1 A;  2VCW A;  1OVN A;  4GWR A;  2YWN A;  2EIR A;  3LOR A;  1SD9 A;  7GSS A;  1V40 A;  3GSS A;  3CYN A;  4G0I A;  4HU9 A;  3QMX A;  1RK4 A;  4IEL A;  3IHQ A;  2HSM B;  3ME7 A;  1SK0 A;  3DVX A;  3RPN A;  5AIX A;  3RPP A;  3ZMK A;  5J4Y A;  1NSW A;  2V6O A;  3TGZ A;  1WMJ A;  2X8C A;  1GRX A;  2QA1 A;  1I1I P;  4E8H A;  1YZX A;  2EFC A;  3J7Y b;  1GUM A;  1TRU A;  1PD2 1;  1VGL A;  1YQ1 A;  4XRA A;  2O3E A;  1O81 A;  4F0B A;  1QXH A;  1NM3 A;  3PGT A;  3FK8 A;  4ZBB A;  1SVL A;  4BIK A;  3VPT A;  2H30 A;  2KP1 A;  1ZYN A;  3VWW A;  5B6N A;  1IYH A;  1F2E A;  5DAK A;  2HYX A;  22GS A;  1TK5 B;  3UAR A;  4O5U A;  1SVM A;  1M9A A;  5J9B A;  1B9X C;  3KP9 A;  2JZR A;  4HQZ A;  4YAV A;  3C8E A;  1M9B A;  4I5Q A;  3J7Y k;  2XC2 A;  1XOB A;  3L9V A;  3IV4 A;  4PI0 C;  3UL3 A;  1GP1 A;  1THX A;  1QGV A;  4V1A p;  4F82 A;  1GH2 A;  4GCI A;  1PA3 A;  4J57 E;  3CWG A;  3R2Q A;  1LJR A;  3EYT A;  1GL8 A;  6GSU A;  2WVZ A;  2LJR A;  3VI7 A;  3TOU A;  3CSH A;  3A2V A;  1R5P A;  5DQS A;  4AKI A;  3US3 A;  4TR0 A;  5L71 A;  4NXI A;  4Q5N A;  4GXZ A;  3D5J A;  1DSB A;  2JAC A;  1WOU A;  3M3M A;  5A4V A;  2HE3 A;  1THO A;  3FYG A;  5KN2 A;  3PIN A;  4K0G A;  5GZZ B;  2QKE A;  3ZRE A;  2VOC A;  2HI7 A;  4MJB A;  5ECP B;  2H75 A;  1TDI A;  2FA8 A;  4Z7X A;  2EFH A;  4ICY A;  3GNJ A;  3KTL A;  2OE3 A;  3P8W A;  1G6W A;  3TDG A;  1CQH A;  1ERV A;  1M3J A;  1N8J A;  2GST A;  3HMJ G;  1MDJ A;  2CX3 A;  2N5A A;  2FWF A;  1Y6E A;  3HVV A;  2I4A A;  3ZIT A;  4ZL9 A;  4EDZ A;  2LQO A;  1GUL A;  4IS0 A;  1F9M A;  1BYE A;  2HSN A;  1GWC A;  2LRT A;  5JWR B;  4MJA A;  1AC1 A;  1V57 A;  2JU5 A;  3EIN A;  2VIM A;  1VRS D;  4N3Z A;  1WPI A;  3H4K A;  4FQU A;  4OMV A;  1OC9 B;  5IOX A;  4DSQ A;  2MYG A;  1XXU A;  1A8L A;  1H75 A;  3KH9 A;  2KLX A;  4O5Q A;  2A2P A;  2IPA A;  2VD1 A;  3ED3 A;  4TXO A;  4KUN A;  4ML6 A;  3ERG A;  5J5N A;  2OE1 A;  1H4O A;  1B4Q A;  2EFD A;  5KN3 A;  1B4P A;  2XHF A;  4TR4 A;  4IW9 A;  5EL8 A;  3V1W A;  4J56 E;  4V2N A;  5JWO B;  2VUP A;  2OAD A;  4EKZ A;  2F9S A;  5AIV A;  5EVO A;  3TKQ A;  5A34 B;  2AUV A;  5CYY A;  2H0G A;  1EWX A;  2PWJ A;  3GA4 A;  2H6Y A;  3DXB A;  5G1L A;  5A5K A;  2FNO A;  1M2D A;  2I81 A;  3GUR A;  3D6I A;  1X9S B;  1K0C A;  1ERU A;  1SYX A;  4L8E A;  4G10 A;  2WFC A;  2ES7 A;  2MMO A;  1ON4 A;  2F8A A;  2YP6 A;  5DAL B;  4FYC A;  4TOP A;  4DSS A;  3K8N A;  5ENU A;  2OAC A;  2DML A;  3TJF A;  5D93 A;  4EO3 A;  2WVX B;  4L0W A;  4POM A;  1G0T A;  3PPU A;  3DML A;  3W8S A;  2H73 A;  1ZZY A;  5JCG A;  3G7Y A;  2E7P A;  4IJI A;  3VK9 A;  1BAY A;  3IBH A;  3I6A A;  4IKH A;  1FB6 A;  4ZB9 A;  5CRE A;  2NBS A;  3UBK A;  4YAP A;  5IM9 A;  2GZZ A;  1XZO A;  2J9H A;  1GSE A;  3BBY A;  4MPF A;  3C71 A;  3KJY A;  2DLX A;  2HT9 A;  3ZFB A;  3IR4 A;  3CQF A;  1BQ7 A;  3GL3 A;  1VF3 A;  2GT5 A;  4OFT A;  1SK2 A;  2Z9S A;  2H01 A;  4I2T A;  4PXO A;  4EE0 A;  2NDO A;  3TKP A;  1YEP A;  3H93 A;  1TP9 A;  2PN8 A;  1J9B A;  5HFI A;  3ZVJ D;  2HRA A;  3FR9 A;  2E2G A;  2H6X A;  4NV2 A;  5J9C A;  1PQN A;  5CRH A;  5INY A;  1PL2 A;  2O8V B;  3APO A;  4Q5Q A;  3GMF A;  1ZYE A;  2K18 A;  4MZC A;  5COH A;  4GQC A;  2X64 A;  4KA0 A;  5J3R A;  2FUG 2;  4IQ1 A;  1U3I A;  2HNL A;  4LMV A;  5H5R A;  2PMT A;  1LU4 A;  1J0F A;  4WR5 A;  8GSS A;  4BPY A;  1F3B A;  3CRU A;  2TIR A;  3LXT A;  4OO4 A;  1JFU A;  2H19 A;  4BVY B;  4IHU A;  2EC4 A;  3GKM A;  2R6K A;  1Y1U A;  4WR4 A;  5DBQ A;  2IMD A;  1G7O A;  4KW6 A;  3LSZ A;  2H1B A;  2WW0 A;  1S3A A;  3JCM L;  4EDY A;  2H1D A;  1X5C A;  1A0R P;  1A2L A;  3M0F A;  2P5Q A;  1M2B A;  2FGX A;  3H79 A;  4X4J A;  2AV4 A;  4CY6 A;  4ID0 A;  2WDU A;  2I1U A;  2E0Q A;  1YY7 A;  4TRX A;  4I8B A;  3DGQ A;  4ECJ A;  1M3I A;  2A4H A;  2H0I A;  1SKW B;  4TW5 A;  1M99 A;  3GKX A;  5ABR A;  1K0O A;  2KHP A;  3GL5 A;  4KND A;  1BJX A;  4KCA A;  5F8B A;  1OE7 A;  2O7K A;  10GS A;  1UN2 A;  2RII A;  1B9Y C;  2LNS A;  1FG4 A;  2DJ3 A;  2M72 A;  5EPF A;  2C4J A;  3I69 A;  4L5L A;  4HQS A;  2K9F A;  4Z2T A;  1N25 A;  2HRK A;  1URM A;  2A2S A;  4TR3 A;  3MNG A;  3A5W A;  6GST A;  5LD0 A;  1T1V A;  5IIZ A;  2OT3 A;  2RM5 A;  1TXU A;  4LL4 B;  2F51 A;  3IPZ A;  2VCZ A;  2HRN A;  1BED A;  2AB6 A;  3D22 A;  2LNT A;  2NTO A;  1ST9 A;  1Q98 A;  1PN9 A;  1B8X A;  4BWQ A;  4H86 A;  1GSD A;  1QUW A;  2H6Z A;  2PU9 C;  2YWI A;  5G2Z A;  2KUC A;  1V9W A;  2WJU A;  4ECB A;  2FD3 A;  3KTB A;  5BMU A;  2XBI A;  3UBL A;  5LCZ A;  2XPD A;  1X5D A;  1YVL A;  5B7C A;  4GSN A;  5IO2 A;  1B48 A;  3TKS A;  2H1L A;  5ECN B;  4NMU A;  2L6D A;  1SYR A;  2LTK A;  1SD8 A;  2J23 A;  5CRW A;  3FZ4 A;  1A8Y A;  3MIX A;  1G7E A;  3HXS A;  2GVP A;  1YDK A;  5J41 A;  2WGR A;  1TTZ A;  5ECM B;  2YPM A;  2LKU A;  1YEX A;  3O3T A;  2NVL A;  2EIQ A;  2B7K A;  2MZC A;  3CXG A;  2K8S A;  1JZR A;  4YQM A;  5DJL A;  3IAS 2;  5JCW A;  2MMN A;  4D73 A;  2VLT A;  3GTU A;  4QQ7 A;  3DVW A;  3EPT A;  1PX7 A;  3IK9 A;  2VL2 A;  2H8L A;  2GSS A;  1WRY A;  4X1U A;  1BX9 A;  1XIY A;  2QC7 A;  2MMA A;  3A3T A;  4Q5R A;  4ZBD A;  16GS A;  4RUV A;  4BL7 B;  3VI5 A;  4GDF A;  3FMW A;  1VF1 A;  1SJZ A;  3LYK A;  1F6M C;  3EU4 A;  3GH9 A;  4KSO A;  11GS A;  4XHM A;  1XVW A;  3LJR A;  2VCV A;  1T8E B;  4GTU A;  2VCT A;  2M80 A;  2X4A A;  2GT6 A;  2YWO A;  1QQ2 A;  3D0Z A;  1C72 A;  1TI1 A;  4PUA A;  5ECL B;  5BRT A;  2WW3 A;  2V32 A;  1KEB A;  1TXX A;  2ZCT A;  20GS A;  2GLR A;  4JR4 A;  5F07 A;  4IP6 A;  3WT2 A;  5HR2 A;  2IME A;  3HZ8 A;  2JSY A;  1O73 A;  3KIJ A;  2JZT A;  1U88 A;  4V2L A;  3HVX A;  2V2G A;  4ZIJ A;  2WRT A;  3UAP A;  2DIZ A;  2KP2 A;  5G1K A;  3F6F A;  3W6G A;  2R37 A;  1F3A A;  5E59 A;  3IK7 A;  5C00 A;  4TR1 B;  2RUE A;  3IAM 2;  3CSI A;  1PN0 A;  3HKR A;  4IQA A;  3AY8 A;  4HDE A;  2VD0 A;  2C0G A;  4XS4 B;  4MH3 A;  1FVJ A;  3L4N A;  6GSX A;  3LXZ A;  3WGE A;  2ZUP A;  2YAN A;  4BWS A;  2DKH A;  4GQF A;  4PGT A;  2P5R A;  2LQQ A;  4BVX B;  1M0U A;  3ERF A;  4K9Z A;  1R5A A;  5ELG A;  1V2A A;  4ZXG A;  1EEJ A;  2H0H A;  4RQR A;  3TJB A;  5JWQ B;  5CAX A;  3ZML A;  2WZ9 A;  1GLQ A;  1XWK A;  2YJH A;  4N30 A;  5HR0 A;  1K0B A;  5G31 A;  4ILF A;  4GRF A;  4V2M A;  5G5E A;  5A34 A;  5A1N A;  1OYJ A;  3GST A;  13GS A;  5ECI B;  2ON5 A;  3GN3 A;  2CAI A;  1FOH A;  2F8F A;  4HOJ A;  4IP1 A;  1XWB A;  4EF0 A;  5A4U A;  2YOI A;  3LGC A;  19GS A;  3LW9 A;  4CY8 A;  1PSQ A;  3KEB A;  2X8G A;  4WBJ A;  3VWX A;  3H1N A;  2PVQ A;  1S4B P;  4MAB A;  1FOV A;  1Z7P A;  1JZO A;  1CQG A;  2OE0 A;  2DKI A;  5GSS A;  1LBK A;  2IMI A;  3KZQ A;  2H70 A;  4WEY A;  1GTU A;  5D9V A;  3APS A;  1GSY A;  5DAK B;  3CHX C;  4YKG A;  3RFR C;  3HDC A;  3RAZ A;  2FWG A;  2R0G A;  3QPM A;  4K7O A;  1T00 A;  5CNW A;  5G30 A;  1TKD B;  3ME8 A;  1EV4 A;  1E6B A;  5A5H A;  4JU5 A;  4MF5 A;  4FYB A;  4WF4 A;  4ZB6 A;  4Z2R A;  3E9J B;  3DKS A;  3C7M A;  5C04 A;  1HNB A;  1QFN A;  3UOM A;  2V41 A;  3RHC A;  3QAG A;  4YQV A;  1E2Y A;  1FVK A;  5KOW A;  5DCG A;  1TU7 A;  1PMT A;  1RW1 A;  2VL3 A;  3IC8 A;  4NPB A;  4K5R A;  2DJK A;  4ZB7 A;  3LG6 A;  17GS A;  5KEJ A;  4K8M A;  1PX6 A;  1ACV A;  1ZYQ B;  5IPH A;  3GRX A;  3NIV A;  1EZK A;  3LEF A;  3F63 A;  12GS A;  5CRD A;  3DD3 A;  2KOK A;  1EGR A;  3MSZ A;  3RDW A;  4OFN A;  3TKS E;  1AAZ A;  3VPQ A;  1V58 A;  2YNX A;  3C73 A;  3VUR A;  1YEW C;  5F06 A;  1I5G A;  5KN1 A;  5ID2 A;  4FIW A;  2FA4 A;  1Z3E A;  2IFQ A;  2GSR A;  5E4W A;  3L9S A;  5B8A A;  1GUK A;  3QR6 A;  2C0D A;  1A23 A;  3CSJ A;  4WF5 A;  2NPB A;  1VF4 A;  3P7X A;  4FYU A;  2R3X A;  4NV5 A;  4K6X A;  4L5O A;  3KXO A;  2G2Q A;  4PNF A;  2B7J A;  4G01 A;  1XPV A;  4KAE A;  4G0L A;  1QMV A;  2ALB A;  4K1F A;  1SJI A;  3Q74 A;  2OBI A;  2HSN B;  1HQO A;  1XWG A;  4MH2 A;  3P2A A;  4F0C A;  4EUY A;  3SBC A;  4IVF A;  2RUF A;  3ZTL A;  2PUK C;  1GSU A;  4Z2U A;  2YN1 A;  4AJ7 A;  1OKD A;  2BMX A;  4HZ4 A;  4TXO B;  3IHG A;  2M46 A;  4O7H A;  1SEN A;  3GHA A;  3ZZX A;  4ECI A;  4F9Z A;  3FY7 A;  3F4T A;  3NOF A;  2B5Y A;  3DWV A;  4MNN A;  4MCU A;  4MLY A;  3MYD A;  1OC3 A;  3DIE A;  1TI3 A;  3A5I A;  1W89 A;  2H66 A;  3O6T A;  1K0N A;  4TKY A;  1NHY A;  3TKS C;  4AJ8 A;  4KDY A;  1FB0 A;  2CVB A;  2RLI A;  3A2W A;  1JZW A;  4K7N A;  4EIP A;  5HFK A;  2HZE A;  4FO5 A;  1MEK A;  1GNE A;  4KB3 A;  2VM2 A;  5GAN D;  3LYP A;  2FWE A;  4LL1 B;  4DSS B;  3WYW A;  1M7T A;  2GZP A;  1O8X A;  3GX0 A;  3ISO A;  3M8N A;  5IMA A;  4QMK A;  2N5B A;  5IOW A;  3CMI A;  2VL2 C;  5CO3 A;  2HSY A;  5DQY A;  2YZH A;  1WWJ A;  1S3D A;  1SL0 B;  1XWA A;  1GSQ A;  4JRR A;  1WE0 A;  1SL2 B;  5FT3 A;  2CA8 A;  1KNG A;  2PVO C;  2GSQ A;  4AI6 A;  2CVK A;  2WB9 A;  3BCK A;  4LA1 A;  4ZL7 A;  3HHV A;  3DRN A;  3DYR A;  1EOG A;  1ZOF A;  2OA7 A;  1GSF A;  4FH8 A;  3TUE A;  2C3Q A;  3FZ9 A;  18GS A;  5J4V A;  5IQY A;  3KH7 A;  4HEA 2;  4I97 A;  3Q18 A;  2XBQ A;  2X99 A;  1FAA A;  1MD3 A;  4PX1 A;  3HZ4 A;  4MP4 A;  2I9H A;  1MD4 A;  1V98 A;  2EIO A;  5F0G A;  4P3Y B;  4AF2 A;  4ULX A;  2C0F A;  3E0U A;  3R3E A;  4MF7 A;  2LRC A;  3UJ1 A;  3I43 A;  3G7J A;  3P90 A;  3ZYW A;  3GIX A;  4PUF C;  4CDO A;  5HFG A;  4A5P A;  5KOX A;  3FKF A;  4G2E A;  2CQ9 A;  1AW9 A;  2X49 A;  2CX4 A;  4KE3 A;  4X43 A;  2HSM A;  4ZB8 A;  3VWV A;  1M2A A;  1Z6N A;  3QCP A;  3FZA A;  5D9W A;  3L78 A;  3KP8 A;  5D9X A;  1KTE A;  1S3R A;  5DCH A;  2O85 A;  3EC3 A;  1A24 A;  1JLW A;  4ACS A;  4QL9 A;  2FWH A;  1ABA A;  5AGY A;  3NZN A;  1EOH A;  1WIK A;  3ZFL A;  1HD2 A;  4MZB A;  3VFI A;  1JLV A;  1XOA A;  1HNC A;  4KH7 A;  3WD6 A;  2AJQ B;  3WT1 A;  3F4R A;  1BG1 A;  1XW9 A;  4POB A;  1ILO A;  4J2F A;  1NHO A;  1GTI A;  1IYI A;  3L0H A;  4K0N A;  5G5F A;  3KMN A;  2WW1 A;  2UZ8 A;  5F05 A;  1UVZ A;  4HZ2 A;  3KMO A;  3FEU A;  3BD2 A;  1SKR B;  4GSS A;  2P31 A;  1SVO A;  1ZCP A;  1TRW A;  3IE3 A;  1AXD A;  1U87 A;  2WUL A;  2CT6 A;  2CZ3 A;  3E3E A;  2H74 A;  5GST A;  1SL1 B;  4N0V A;  1K0M A;  2VKZ G;  4G9H A;  2N5F A;  3APQ A;  1GTB A;  2LUS A;  3N5O A;  4X0X A;  4ISD A;  2DJ0 A;  2HRK B;  1U6T A;  1XWC A;  4WKW A;  1Z7R A;  2B1L A;  2LJA A;  3UVT A;  4HUA A;  1OC8 A;  1TK0 B;  3Q6O A;  2R0C A;  2ZNM A;  3L9U A;  4HU7 A;  5CP1 A;  2R4V A;  1MTC A;  4YQU A;  2LJK A;  2PBJ A;  3VWU A;  2UV8 G;  3EUR A;  1FO5 A;  3Q19 A;  4CHS A;  4OCF A;  3M9K A;  5H5S A;  4DVC A;  3HJM A;  3EMX A;  4AKX B;  2K8V A;  2DJ2 A;  3TU3 B;  1Z6M A;  1RQM A;  2RM6 A;  5HR1 A;  4MMM A;  4HI7 A;  2H71 A;  3HVN A;  5BMU B;  5B8B A;  4PUR A;  2FCH A;  5ECR B;  2H72 A;  2GDR A;  2DMM A;  4EXJ A;  4PTS A;  2O87 A;  4K2X A;  4F2I A;  2PPT A;  2A4V A;  1XG8 A;  2MBT A;  2IIY A;  3FR6 A;  1OAZ A;  5IPG A;  5B6M A;  3CTF A;  3ZL5 A;  4MK3 A;  1PFO A;  4MDC A;  1T4Z A;  2R2J A;  5ECH B;  2IJY A;  3F4S A;  4PQI A;  1DE2 A;  3CTG A;  3FRC A;  1OC9 A;  3ZRD A;  2B5X A;  2OJL A;  3QFA C;  5FHI A;  4USS A;  1YJ6 A;  4G0K A;  5JCU A;  4D73 B;  2V6K A;  1AIU A;  3H8Q A;  1J08 A;  2L6C A;  2GS3 A;  3GTU B;  2DBC A;  4K5S A;  4N0Z A;  5HQP A;  2QSI A;  1HYU A;  3QAV A;  3CRT A;  2IMK A;  3QDN A;  4E8E A;  3LFL A;  4WXT A;  3HCZ A;  3TRP A;  1Y25 A;  5J47 A;  4MJC A;  2B5E A;  2C1Y A;  3PR8 A;  2L5L A;  3IOS A;  4KCE A;  1X9W B;  2DC5 A;  1ZL9 A;  4AKH A;  3QD9 A;  6GSV A;  2F3M A;  3FR3 A;  2L57 A;  1YF1 A;  4I6X A;  2LV3 A;  4W66 A;  4G19 A;  4ZIL A;  1ML6 A;  4EL1 A;  2AAW A;  1PKW A;  1X9M B;  3TJG A;  1N2A A;  5ELA A;  2REM A;  3TKR A;  1HNA A;  4OO5 A;  5DAL A;  4JE1 A;  4IBP A;  2HSH A;  5D9T A;  3EVI A;  4GLT A;  2PER A;  2JAD A;  3GV1 A;  1TK8 B;  3S9F A;  3F9U A;  4LMW A;  4ML1 A;  1T3B A;  2WVX A;  4JED A;  3I9V 2;  2VL9 A;  4WBR D;  2H1G A;  1A2M A;  1QK8 A;  3TRQ A;  5KN0 A;  2C3N A;  3HYP A;  4PQH A;  2LRN A;  2I3Y A;  2VLU A;  2AHE A;  2P0G A;  2H1A A;  2WS2 A;  4HSC X;  1R4W A;  2H76 A;  4XS1 A;  1DUG A;  2C0E A;  2R0P A;  3HJP A;  3OR5 A; 
#chains in the Genus database with same CATH homology
 4KF9 A;  3EU3 A;  4K2D A;  2HQT A;  3GYK A;  1K3L A;  5J4U A;  5IMV A;  1AQX A;  6GSY A;  2LS5 A;  2DSA A;  4EIQ A;  2HZF A;  1X0R A;  4KDU A;  3FHK A;  3KD0 A;  2R5G A;  3G9B A;  2LEG A;  3D21 A;  5ECS A;  2V1M A;  1AQW A;  1T4Y A;  4PNG A;  2YV9 A;  2G0F A;  3WGX A;  5J40 A;  1XCC A;  2CAQ A;  1Z9H A;  4WET A;  4ZBA A;  3EWL A;  3UIW A;  2OKA A;  3UMA A;  1W4V A;  1GTA A;  4MJE A;  3GKK A;  5EY6 A;  3HJO A;  2B6M A;  4N10 A;  2XPE A;  1MDI A;  1UC7 A;  1O7U A;  1BF5 A;  1PGT A;  1T7P B;  5A1N B;  3IXR A;  1PKZ A;  4XCS A;  3M1G A;  4RQX A;  3QOU A;  4GF0 A;  5D8I A;  5D73 A;  1R7H A;  4AGS A;  1Z5Y E;  4BA7 A;  5AIS A;  2L59 A;  1X5E A;  4IN0 A;  1FHE A;  1EP8 A;  3QAW A;  14GS A;  4JR6 A;  2C80 A;  2YWM A;  3GFK A;  5DVB A;  2FLS A;  4L0U A;  3U5R E;  3EMP A;  1TOF A;  4YH2 A;  2FY6 A;  3FZ5 A;  1AUC A;  3N9J A;  1GLP A;  1SU9 A;  1VF2 A;  2IMF A;  2LST A;  4BVY A;  3F3Q A;  3GUS A;  5LNK e;  4POL A;  1O85 A;  1NW2 A;  4RI6 A;  5HR3 A;  3ZLP A;  1S3C A;  5IMZ A;  2YCD A;  2D2Z A;  4E68 A;  3CBU A;  2VLV A;  1ZGN A;  5ECK B;  2CVD A;  3IC4 A;  4NHW A;  2GZY A;  2IL3 A;  6GSW A;  3F3R A;  1PL1 A;  1K0D A;  4OFM A;  6GSS A;  4CW9 A;  1F37 A;  4HJ2 A;  3C1R A;  2HXK A;  2K6V A;  3GKN A;  5IO0 A;  2IN3 A;  1GSS A;  2CZ2 A;  4MF6 A;  4TXV A;  2O5V A;  4KDX A;  3U6V A;  3LWA A;  1EV9 A;  3C1S A;  1R26 A;  2E2M A;  1TRS A;  5A5H B;  1AQV A;  2GQK A;  5ECO B;  4OD7 A;  1I9D A;  2ON7 A;  2L5O A;  4V1A g;  3IRA A;  2BJX A;  2AYT A;  3SWL A;  4I2U A;  3MAK A;  3ERW A;  2C3T A;  4AJ6 A;  4POK A;  2QGV A;  4IGJ A;  3GX8 A;  4O5R A;  4TVE A;  3F6D A;  3QFB C;  4HJM A;  4N11 A;  5CRG A;  3TB2 A;  4NAX A;  4XS6 A;  5IMF A;  1XBS A;  2JZS A;  2VCX A;  4QL7 A;  1MDK A;  2L4C A;  4JZQ A;  1WP0 A;  3EE2 A;  5ID2 B;  1KBN A;  1XVQ A;  2IFQ B;  1O8W A;  3BCI A;  1EEM A;  3MWH A;  3G7I A;  3HVS A;  2CV4 A;  3ZIV A;  1DBY A;  3ZIJ A;  5DJM A;  1YKA A;  2DJJ A;  1JZD A;  4K7I A;  4ECC A;  4DEJ A;  4OCE A;  4EVM A;  3TOT A;  2QA2 A;  2YZU A;  4EC0 A;  1SKS B;  3BJ5 A;  2C8U A;  4KGI A;  4LLR A;  1BG5 A;  2OBK A;  2BTO T;  1XFL A;  2TRX A;  4JBB A;  4XIH A;  1USB A;  4XRD A;  1A2J A;  3DEX A;  1K3Y A;  2X8H A;  1GNW A;  3BOA A;  1XW6 A;  4GST A;  3MDK A;  2PGT A;  3LQ7 A;  5FWG A;  2WCI A;  2HLS A;  2JSZ A;  4RI7 A;  1TU8 A;  1ZYP A;  4HS1 A;  4NHZ A;  3IDV A;  3GH6 A;  2VCQ A;  1JHB A;  1YF0 A;  1SJ6 A;  5IMC A;  1UA5 A;  1PRX A;  4BL7 A;  3VLN A;  3TJJ A;  4TN8 A;  5DDL A;  3O76 A;  3HA9 A;  3W8J A;  1XW5 A;  2TRC P;  3A2X A;  3KM6 A;  1SK1 A;  5ECQ B;  1ERW A;  1TW9 A;  2L4Q A;  1ERT A;  2EFE A;  2HZE B;  2IWT A;  2GGT A;  3UEM A;  4IJ3 A;  3HD5 A;  4ZL8 A;  1ZMA A;  4KX4 A;  4OWY A;  5H5Q A;  3F8U A;  1DE1 A;  2DIY A;  1TJD A;  3D4M A;  2JL4 A;  4YKF A;  1K0A A;  3UVH A;  1OKT A;  3HY2 A;  2O89 A;  3TCO A;  5AN1 A;  1K3O A;  1EGO A;  2VO4 A;  1FW1 A;  3M9J A;  5IMD A;  1EP7 A;  4MA9 A;  2A2R A;  2VAF A;  2HRF A;  2FHE A;  5A4W A;  2YJ7 A;  3KGK A;  3KCM A;  3TJK A;  1U3A A;  1OE8 A;  1Q4J A;  5GAP D;  4NWY A;  3IA1 A;  4AKG A;  2VM1 A;  4TR1 A;  2GQL A;  9GSS A;  3D4T A;  4O92 A;  1GUH A;  4DSR A;  4XS4 A;  2GQM A;  4MPG A;  1O6J A;  3F0I A;  3PH9 A;  1WJK A;  2HFD A;  2MMZ A;  3WGD A;  2DJ1 A;  4Q5F A;  4BVX A;  4F03 A;  4KSM A;  1A0F A;  2MBS A;  3RHB A;  3RBT A;  2GTU A;  5D96 A;  3ZVJ A;  4O32 A;  1TRV A;  1G6Y A;  2B1K A;  3FW2 A;  3TRX A;  4XTS A;  1YKC A;  2YV7 A;  4MZW A;  2B3S A;  4PQ1 A;  2VCW A;  1OVN A;  4GWR A;  2YWN A;  2EIR A;  3LOR A;  1SD9 A;  7GSS A;  1V40 A;  3GSS A;  3CYN A;  4G0I A;  4HU9 A;  3QMX A;  1RK4 A;  4IEL A;  3IHQ A;  2HSM B;  3ME7 A;  1SK0 A;  3DVX A;  3RPN A;  5AIX A;  3RPP A;  3ZMK A;  5J4Y A;  1NSW A;  2V6O A;  3TGZ A;  1WMJ A;  2X8C A;  1GRX A;  2QA1 A;  4E8H A;  1YZX A;  2EFC A;  3J7Y b;  1GUM A;  1TRU A;  1PD2 1;  1VGL A;  1YQ1 A;  4XRA A;  1O81 A;  4F0B A;  1QXH A;  1NM3 A;  3PGT A;  3FK8 A;  4ZBB A;  1SVL A;  3VPT A;  2H30 A;  2KP1 A;  1ZYN A;  3VWW A;  5B6N A;  1IYH A;  1F2E A;  5DAK A;  2HYX A;  22GS A;  1TK5 B;  3UAR A;  4O5U A;  1SVM A;  1M9A A;  5J9B A;  1B9X C;  3KP9 A;  2JZR A;  4HQZ A;  4YAV A;  3C8E A;  1M9B A;  4I5Q A;  3J7Y k;  2XC2 A;  1XOB A;  3L9V A;  3IV4 A;  3UL3 A;  1GP1 A;  1THX A;  1QGV A;  4V1A p;  4F82 A;  1GH2 A;  4GCI A;  1PA3 A;  4J57 E;  3CWG A;  3R2Q A;  1LJR A;  3EYT A;  1GL8 A;  6GSU A;  2LJR A;  3VI7 A;  3TOU A;  3CSH A;  3A2V A;  1R5P A;  5DQS A;  4AKI A;  3US3 A;  4TR0 A;  5L71 A;  4NXI A;  4Q5N A;  4GXZ A;  3D5J A;  1DSB A;  2JAC A;  1WOU A;  3M3M A;  5A4V A;  2HE3 A;  1THO A;  3FYG A;  5KN2 A;  3PIN A;  4K0G A;  5GZZ B;  2QKE A;  3ZRE A;  2VOC A;  2HI7 A;  4MJB A;  5ECP B;  2H75 A;  1TDI A;  2FA8 A;  4Z7X A;  2EFH A;  4ICY A;  3GNJ A;  3KTL A;  2OE3 A;  3P8W A;  1G6W A;  3TDG A;  1CQH A;  1ERV A;  1N8J A;  2GST A;  3HMJ G;  1MDJ A;  2CX3 A;  2N5A A;  2FWF A;  1Y6E A;  3HVV A;  2I4A A;  3ZIT A;  4ZL9 A;  4EDZ A;  2LQO A;  1GUL A;  4IS0 A;  1F9M A;  1BYE A;  2HSN A;  1GWC A;  2LRT A;  5JWR B;  4MJA A;  1AC1 A;  1V57 A;  2JU5 A;  3EIN A;  2VIM A;  1VRS D;  4N3Z A;  1WPI A;  3H4K A;  4FQU A;  4OMV A;  1OC9 B;  5IOX A;  4DSQ A;  2MYG A;  1XXU A;  1A8L A;  1H75 A;  3KH9 A;  2KLX A;  4O5Q A;  2A2P A;  2IPA A;  2VD1 A;  3ED3 A;  4TXO A;  4KUN A;  4ML6 A;  3ERG A;  5J5N A;  2OE1 A;  1H4O A;  1B4Q A;  2EFD A;  5KN3 A;  1B4P A;  2XHF A;  4TR4 A;  4IW9 A;  5EL8 A;  3V1W A;  4J56 E;  4V2N A;  5JWO B;  2VUP A;  2OAD A;  4EKZ A;  2F9S A;  5AIV A;  5EVO A;  3TKQ A;  5A34 B;  2AUV A;  5CYY A;  2H0G A;  1EWX A;  2PWJ A;  3GA4 A;  2H6Y A;  3DXB A;  5G1L A;  5A5K A;  2FNO A;  1M2D A;  2I81 A;  3GUR A;  3D6I A;  1X9S B;  1K0C A;  1ERU A;  1SYX A;  4L8E A;  4G10 A;  2WFC A;  2ES7 A;  2MMO A;  1ON4 A;  2F8A A;  2YP6 A;  5DAL B;  4FYC A;  4TOP A;  4DSS A;  3K8N A;  5ENU A;  2OAC A;  2DML A;  3TJF A;  5D93 A;  4EO3 A;  4L0W A;  4POM A;  1G0T A;  3PPU A;  3DML A;  3W8S A;  2H73 A;  1ZZY A;  5JCG A;  3G7Y A;  2E7P A;  4IJI A;  3VK9 A;  1BAY A;  3IBH A;  3I6A A;  4IKH A;  1FB6 A;  4ZB9 A;  5CRE A;  2NBS A;  3UBK A;  4YAP A;  5IM9 A;  2GZZ A;  1XZO A;  2J9H A;  1GSE A;  3BBY A;  4MPF A;  3C71 A;  3KJY A;  2DLX A;  2HT9 A;  3ZFB A;  3IR4 A;  1BQ7 A;  3GL3 A;  1VF3 A;  2GT5 A;  4OFT A;  1SK2 A;  2Z9S A;  2H01 A;  4I2T A;  4PXO A;  4EE0 A;  2NDO A;  3TKP A;  1YEP A;  3H93 A;  1TP9 A;  2PN8 A;  1J9B A;  5HFI A;  3ZVJ D;  2HRA A;  3FR9 A;  2E2G A;  2H6X A;  4NV2 A;  5J9C A;  1PQN A;  5CRH A;  5INY A;  1PL2 A;  2O8V B;  3APO A;  4Q5Q A;  3GMF A;  1ZYE A;  2K18 A;  4MZC A;  5COH A;  4GQC A;  2X64 A;  4KA0 A;  5J3R A;  2FUG 2;  4IQ1 A;  1U3I A;  2HNL A;  4LMV A;  5H5R A;  2PMT A;  1LU4 A;  1J0F A;  4WR5 A;  8GSS A;  4BPY A;  1F3B A;  3CRU A;  2TIR A;  3LXT A;  4OO4 A;  1JFU A;  2H19 A;  4BVY B;  4IHU A;  2EC4 A;  3GKM A;  2R6K A;  1Y1U A;  4WR4 A;  5DBQ A;  2IMD A;  1G7O A;  4KW6 A;  3LSZ A;  2H1B A;  1S3A A;  3JCM L;  4EDY A;  2H1D A;  1X5C A;  1A0R P;  1A2L A;  3M0F A;  2P5Q A;  1M2B A;  2FGX A;  3H79 A;  4X4J A;  2AV4 A;  4CY6 A;  4ID0 A;  2WDU A;  2I1U A;  2E0Q A;  1YY7 A;  4TRX A;  4I8B A;  3DGQ A;  4ECJ A;  2A4H A;  2H0I A;  1SKW B;  4TW5 A;  1M99 A;  3GKX A;  5ABR A;  1K0O A;  2KHP A;  3GL5 A;  4KND A;  1BJX A;  4KCA A;  5F8B A;  1OE7 A;  2O7K A;  10GS A;  1UN2 A;  2RII A;  1B9Y C;  2LNS A;  1FG4 A;  2DJ3 A;  2M72 A;  5EPF A;  2C4J A;  3I69 A;  4L5L A;  4HQS A;  2K9F A;  4Z2T A;  1N25 A;  2HRK A;  1URM A;  2A2S A;  4TR3 A;  3MNG A;  3A5W A;  6GST A;  5LD0 A;  1T1V A;  5IIZ A;  2OT3 A;  2RM5 A;  1TXU A;  4LL4 B;  2F51 A;  3IPZ A;  2VCZ A;  2HRN A;  1BED A;  2AB6 A;  3D22 A;  2LNT A;  2NTO A;  1ST9 A;  1Q98 A;  1PN9 A;  1B8X A;  4BWQ A;  4H86 A;  1GSD A;  1QUW A;  2H6Z A;  2PU9 C;  2YWI A;  5G2Z A;  2KUC A;  1V9W A;  2WJU A;  4ECB A;  2FD3 A;  3KTB A;  5BMU A;  2XBI A;  3UBL A;  5LCZ A;  2XPD A;  1X5D A;  1YVL A;  5B7C A;  4GSN A;  5IO2 A;  1B48 A;  3TKS A;  2H1L A;  5ECN B;  4NMU A;  2L6D A;  1SYR A;  2LTK A;  1SD8 A;  2J23 A;  5CRW A;  3FZ4 A;  1A8Y A;  3MIX A;  1G7E A;  3HXS A;  2GVP A;  1YDK A;  5J41 A;  2WGR A;  1TTZ A;  5ECM B;  2YPM A;  2LKU A;  1YEX A;  3O3T A;  2NVL A;  2EIQ A;  2B7K A;  2MZC A;  3CXG A;  2K8S A;  1JZR A;  4YQM A;  5DJL A;  3IAS 2;  5JCW A;  2MMN A;  4D73 A;  2VLT A;  3GTU A;  4QQ7 A;  3DVW A;  3EPT A;  1PX7 A;  3IK9 A;  2VL2 A;  2H8L A;  2GSS A;  1WRY A;  4X1U A;  1BX9 A;  1XIY A;  2QC7 A;  2MMA A;  3A3T A;  4Q5R A;  4ZBD A;  16GS A;  4RUV A;  4BL7 B;  3VI5 A;  4GDF A;  3FMW A;  1VF1 A;  1SJZ A;  3LYK A;  1F6M C;  3EU4 A;  3GH9 A;  4KSO A;  11GS A;  4XHM A;  1XVW A;  3LJR A;  2VCV A;  1T8E B;  4GTU A;  2VCT A;  2M80 A;  2X4A A;  2GT6 A;  2YWO A;  1QQ2 A;  3D0Z A;  1C72 A;  1TI1 A;  4PUA A;  5ECL B;  5BRT A;  2V32 A;  1KEB A;  1TXX A;  2ZCT A;  20GS A;  2GLR A;  4JR4 A;  5F07 A;  4IP6 A;  3WT2 A;  5HR2 A;  2IME A;  3HZ8 A;  2JSY A;  1O73 A;  3KIJ A;  2JZT A;  1U88 A;  4V2L A;  3HVX A;  2V2G A;  4ZIJ A;  2WRT A;  3UAP A;  2DIZ A;  2KP2 A;  5G1K A;  3F6F A;  3W6G A;  2R37 A;  1F3A A;  5E59 A;  3IK7 A;  5C00 A;  4TR1 B;  2RUE A;  3IAM 2;  3CSI A;  1PN0 A;  3HKR A;  4IQA A;  3AY8 A;  4HDE A;  2VD0 A;  2C0G A;  4XS4 B;  4MH3 A;  1FVJ A;  3L4N A;  6GSX A;  3LXZ A;  3WGE A;  2ZUP A;  2YAN A;  4BWS A;  2DKH A;  4GQF A;  4PGT A;  2P5R A;  2LQQ A;  4BVX B;  1M0U A;  3ERF A;  4K9Z A;  1R5A A;  5ELG A;  1V2A A;  4ZXG A;  1EEJ A;  2H0H A;  4RQR A;  3TJB A;  5JWQ B;  5CAX A;  3ZML A;  2WZ9 A;  1GLQ A;  1XWK A;  2YJH A;  4N30 A;  5HR0 A;  1K0B A;  5G31 A;  4ILF A;  4GRF A;  4V2M A;  5G5E A;  5A34 A;  5A1N A;  1OYJ A;  3GST A;  13GS A;  5ECI B;  2ON5 A;  3GN3 A;  2CAI A;  1FOH A;  2F8F A;  4HOJ A;  4IP1 A;  1XWB A;  4EF0 A;  5A4U A;  2YOI A;  3LGC A;  19GS A;  3LW9 A;  4CY8 A;  1PSQ A;  3KEB A;  2X8G A;  4WBJ A;  3VWX A;  3H1N A;  2PVQ A;  4MAB A;  1FOV A;  1Z7P A;  1JZO A;  1CQG A;  2OE0 A;  2DKI A;  5GSS A;  1LBK A;  2IMI A;  3KZQ A;  2H70 A;  4WEY A;  1GTU A;  5D9V A;  3APS A;  1GSY A;  5DAK B;  4YKG A;  3HDC A;  3RAZ A;  2FWG A;  2R0G A;  3QPM A;  4K7O A;  1T00 A;  5CNW A;  5G30 A;  1TKD B;  3ME8 A;  1EV4 A;  1E6B A;  5A5H A;  4JU5 A;  4MF5 A;  4FYB A;  4WF4 A;  4ZB6 A;  4Z2R A;  3E9J B;  3DKS A;  3C7M A;  5C04 A;  1HNB A;  1QFN A;  3UOM A;  2V41 A;  3RHC A;  3QAG A;  4YQV A;  1E2Y A;  1FVK A;  5KOW A;  5DCG A;  1TU7 A;  1PMT A;  1RW1 A;  2VL3 A;  3IC8 A;  4NPB A;  4K5R A;  2DJK A;  4ZB7 A;  3LG6 A;  17GS A;  5KEJ A;  4K8M A;  1PX6 A;  1ACV A;  1ZYQ B;  5IPH A;  3GRX A;  3NIV A;  1EZK A;  3LEF A;  3F63 A;  12GS A;  5CRD A;  3DD3 A;  2KOK A;  1EGR A;  3MSZ A;  3RDW A;  4OFN A;  3TKS E;  1AAZ A;  3VPQ A;  1V58 A;  2YNX A;  3C73 A;  3VUR A;  5F06 A;  1I5G A;  5KN1 A;  5ID2 A;  4FIW A;  2FA4 A;  1Z3E A;  2IFQ A;  2GSR A;  5E4W A;  3L9S A;  5B8A A;  1GUK A;  3QR6 A;  2C0D A;  1A23 A;  3CSJ A;  4WF5 A;  2NPB A;  1VF4 A;  3P7X A;  4FYU A;  2R3X A;  4NV5 A;  4K6X A;  4L5O A;  3KXO A;  2G2Q A;  4PNF A;  2B7J A;  4G01 A;  1XPV A;  4KAE A;  4G0L A;  1QMV A;  2ALB A;  4K1F A;  1SJI A;  3Q74 A;  2OBI A;  2HSN B;  1HQO A;  1XWG A;  4MH2 A;  3P2A A;  4F0C A;  4EUY A;  3SBC A;  4IVF A;  2RUF A;  3ZTL A;  2PUK C;  1GSU A;  4Z2U A;  2YN1 A;  4AJ7 A;  1OKD A;  2BMX A;  4HZ4 A;  4TXO B;  3IHG A;  2M46 A;  4O7H A;  1SEN A;  3GHA A;  3ZZX A;  4ECI A;  4F9Z A;  3FY7 A;  3F4T A;  3NOF A;  2B5Y A;  3DWV A;  4MNN A;  4MCU A;  4MLY A;  3MYD A;  1OC3 A;  3DIE A;  1TI3 A;  3A5I A;  1W89 A;  2H66 A;  3O6T A;  1K0N A;  4TKY A;  1NHY A;  3TKS C;  4AJ8 A;  4KDY A;  1FB0 A;  2CVB A;  2RLI A;  3A2W A;  1JZW A;  4K7N A;  4EIP A;  5HFK A;  2HZE A;  4FO5 A;  1MEK A;  1GNE A;  4KB3 A;  2VM2 A;  5GAN D;  3LYP A;  2FWE A;  4LL1 B;  4DSS B;  3WYW A;  1M7T A;  2GZP A;  1O8X A;  3GX0 A;  3ISO A;  3M8N A;  5IMA A;  4QMK A;  2N5B A;  5IOW A;  3CMI A;  2VL2 C;  5CO3 A;  2HSY A;  5DQY A;  2YZH A;  1WWJ A;  1S3D A;  1SL0 B;  1XWA A;  1GSQ A;  4JRR A;  1WE0 A;  1SL2 B;  5FT3 A;  2CA8 A;  1KNG A;  2PVO C;  2GSQ A;  4AI6 A;  2CVK A;  2WB9 A;  3BCK A;  4LA1 A;  4ZL7 A;  3HHV A;  3DRN A;  3DYR A;  1EOG A;  1ZOF A;  2OA7 A;  1GSF A;  4FH8 A;  3TUE A;  2C3Q A;  3FZ9 A;  18GS A;  5J4V A;  5IQY A;  3KH7 A;  4HEA 2;  4I97 A;  3Q18 A;  2XBQ A;  2X99 A;  1FAA A;  1MD3 A;  4PX1 A;  3HZ4 A;  4MP4 A;  2I9H A;  1MD4 A;  1V98 A;  2EIO A;  5F0G A;  4P3Y B;  4AF2 A;  4ULX A;  2C0F A;  3E0U A;  3R3E A;  4MF7 A;  2LRC A;  3UJ1 A;  3I43 A;  3G7J A;  3P90 A;  3ZYW A;  3GIX A;  4PUF C;  4CDO A;  5HFG A;  4A5P A;  5KOX A;  3FKF A;  4G2E A;  2CQ9 A;  1AW9 A;  2X49 A;  2CX4 A;  4KE3 A;  4X43 A;  2HSM A;  4ZB8 A;  3VWV A;  1M2A A;  1Z6N A;  3QCP A;  3FZA A;  5D9W A;  3L78 A;  3KP8 A;  5D9X A;  1KTE A;  5DCH A;  2O85 A;  3EC3 A;  1A24 A;  1JLW A;  4ACS A;  4QL9 A;  2FWH A;  1ABA A;  5AGY A;  3NZN A;  1EOH A;  1WIK A;  3ZFL A;  1HD2 A;  4MZB A;  3VFI A;  1JLV A;  1XOA A;  1HNC A;  4KH7 A;  3WD6 A;  2AJQ B;  3WT1 A;  3F4R A;  1BG1 A;  1XW9 A;  4POB A;  1ILO A;  4J2F A;  1NHO A;  1GTI A;  1IYI A;  3L0H A;  4K0N A;  5G5F A;  3KMN A;  2UZ8 A;  5F05 A;  1UVZ A;  4HZ2 A;  3KMO A;  3FEU A;  3BD2 A;  1SKR B;  4GSS A;  2P31 A;  1SVO A;  1ZCP A;  1TRW A;  3IE3 A;  1AXD A;  1U87 A;  2WUL A;  2CT6 A;  2CZ3 A;  3E3E A;  2H74 A;  5GST A;  1SL1 B;  4N0V A;  1K0M A;  2VKZ G;  4G9H A;  2N5F A;  3APQ A;  1GTB A;  2LUS A;  3N5O A;  4X0X A;  4ISD A;  2DJ0 A;  2HRK B;  1U6T A;  1XWC A;  4WKW A;  1Z7R A;  2B1L A;  2LJA A;  3UVT A;  4HUA A;  1OC8 A;  1TK0 B;  3Q6O A;  2R0C A;  2ZNM A;  3L9U A;  4HU7 A;  5CP1 A;  2R4V A;  1MTC A;  4YQU A;  2LJK A;  2PBJ A;  3VWU A;  2UV8 G;  3EUR A;  1FO5 A;  3Q19 A;  4CHS A;  4OCF A;  3M9K A;  5H5S A;  4DVC A;  3HJM A;  3EMX A;  4AKX B;  2K8V A;  2DJ2 A;  3TU3 B;  1Z6M A;  1RQM A;  2RM6 A;  5HR1 A;  4MMM A;  4HI7 A;  2H71 A;  5BMU B;  5B8B A;  4PUR A;  2FCH A;  5ECR B;  2H72 A;  2GDR A;  2DMM A;  4EXJ A;  4PTS A;  2O87 A;  4K2X A;  4F2I A;  2PPT A;  2A4V A;  2MBT A;  2IIY A;  3FR6 A;  1OAZ A;  5IPG A;  5B6M A;  3CTF A;  3ZL5 A;  4MK3 A;  4MDC A;  1T4Z A;  2R2J A;  5ECH B;  2IJY A;  3F4S A;  4PQI A;  1DE2 A;  3CTG A;  3FRC A;  1OC9 A;  3ZRD A;  2B5X A;  2OJL A;  3QFA C;  5FHI A;  4USS A;  1YJ6 A;  4G0K A;  5JCU A;  4D73 B;  2V6K A;  1AIU A;  3H8Q A;  1J08 A;  2L6C A;  2GS3 A;  3GTU B;  2DBC A;  4K5S A;  4N0Z A;  5HQP A;  2QSI A;  1HYU A;  3QAV A;  3CRT A;  2IMK A;  3QDN A;  4E8E A;  3LFL A;  4WXT A;  3HCZ A;  3TRP A;  1Y25 A;  5J47 A;  4MJC A;  2B5E A;  2C1Y A;  3PR8 A;  2L5L A;  3IOS A;  4KCE A;  1X9W B;  2DC5 A;  1ZL9 A;  4AKH A;  3QD9 A;  6GSV A;  2F3M A;  3FR3 A;  2L57 A;  1YF1 A;  4I6X A;  2LV3 A;  4W66 A;  4G19 A;  4ZIL A;  1ML6 A;  4EL1 A;  2AAW A;  1PKW A;  1X9M B;  3TJG A;  1N2A A;  5ELA A;  2REM A;  3TKR A;  1HNA A;  4OO5 A;  5DAL A;  4JE1 A;  4IBP A;  2HSH A;  5D9T A;  3EVI A;  4GLT A;  2PER A;  2JAD A;  3GV1 A;  1TK8 B;  3S9F A;  3F9U A;  4LMW A;  4ML1 A;  1T3B A;  4JED A;  3I9V 2;  2VL9 A;  4WBR D;  2H1G A;  1A2M A;  1QK8 A;  3TRQ A;  5KN0 A;  2C3N A;  3HYP A;  4PQH A;  2LRN A;  2I3Y A;  2VLU A;  2AHE A;  2P0G A;  2H1A A;  2WS2 A;  1R4W A;  2H76 A;  4XS1 A;  1DUG A;  2C0E A;  2R0P A;  3HJP A;  3OR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...