3SWLA

Crystal structure analysis of h74a mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVATDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3swlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3swlA01
2EIOA 2GSTA 5ECLB 3CSJA 5HR1A 1TRSA 1ZYEA 3LWAA 4NHZA 4V1Ag 3EINA 3QAGA 2VL2A 2GS3A 3RHBA 5J9CA 2MMOA 2C3TA 3I43A 1RQMA 1H4OA 2K6VA 3D22A 2CVBA 2HRNA 4HUAA 1MDJA 2VM2A 2B5EA 4OCFA 3J7Yk 4GRFA 1TOFA 3HJOA 3L9SA 1QFNA 3Q19A 4LMWA 4MZWA 4MPGA 2OE0A 1UC7A 5ID2B 4Q5NA 1AUCA 2IN3A 4K0NA 1O73A 2YZHA 1ZMAA 1KBNA 3DKSA 4OD7A 5CRDA 4ZB6A 2GSSA 3UJ1A 1BYEA 2H75A 2VLVA 4ML6A 3ZMKA 4YAVA 2CVKA 4QQ7A 1K0DA 3F0IA 3HVXA 3M9JA 5B6MA 2GVPA 1J08A 2H76A 1SL2B 3F9UA 2CAIA 5HQPA 1ZCPA 2C3QA 2F9SA 4DVCA 4K7NA 3UVHA 5DAKB 4ECBA 4PNGA 2AUVA 4V2NA 1PD21 3GUSA 1U88A 2VL9A 3UAPA 14GSA 2K8SA 4Q5FA 4ZBBA 4XS1A 2WCIA 1URMA 4TXVA 4BPYA 1XW6A 1M7TA 3HA9A 5LNKe 2O85A 2XPDA 4XS6A 1DSBA 3G7JA 4OFMA 4PURA 2LJKA 4YQVA 1OYJA 2X64A 1OC8A 1ZYQB 1PSQA 1MD3A 5ECPB 5D96A 4K2DA 1HNCA 6GSYA 1GLQA 1AC1A 1T1VA 2CV4A 2EC4A 3FRCA 4JR6A 3US3A 2FY6A 3HD5A 2DIZA 4XTSA 4NMUA 4F9ZA 1FB6A 4XCSA 4ZIJA 3IA1A 4EL1A 12GSA 2HRFA 3QOUA 2LTKA 1ERUA 2E0QA 1K0MA 3GTUB 3VWVA 2DJ0A 2V32A 2H19A 1G0TA 1O85A 3EYTA 4MP4A 2VCXA 1JHBA 1OC9B 4GTUA 1RK4A 5GSTA 2IPAA 1VF2A 4AJ6A 1DUGA 5G31A 3DVWA 4HOJA 2A2RA 1Z5YE 1S3AA 2LJRA 2AB6A 2P31A 4DSRA 1G6WA 3KH7A 1B4QA 3UBLA 4KNDA 4X43A 5DALA 1ON4A 2IMFA 2L6CA 4MH2A 1QGVA 4O32A 17GSA 2H72A 4JE1A 5F06A 1A8LA 4OMVA 1GH2A 3QFBC 4L0WA 1JZWA 2LEGA 5GZZB 2LV3A 3FHKA 2YPMA 4G0KA 2DJJA 4K0GA 2R37A 3QFAC 3F6DA 4Q5QA 2KLXA 4ECJA 4GF0A 3W6GA 4GQCA 4FYCA 5CNWA 2IMEA 4G2EA 5IMFA 3IV4A 3HJMA 3UARA 1WWJA 2PGTA 4OCEA 3WT1A 1XXUA 2P5RA 3HVVA 3VI5A 1SD8A 4J57E 3DIEA 1EV9A 3FR3A 3VPQA 5IO0A 5DCHA 2JU5A 2O8VB 1GSSA 4IBPA 5DBQA 3VWXA 1X9WB 1GLPA 5DVBA 2DJ1A 1EWXA 1XWGA 2H1AA 3FZAA 3KMOA 2GTUA 1B48A 1K3YA 3WGDA 2C0GA 2FWFA 1FO5A 4HJMA 1JZDA 2P0GA 7GSSA 5CO3A 3GX0A 4IELA 4CHSA 2R3XA 3DD3A 4ZB8A 5DALB 4MJAA 2N5FA 1GNEA 2MBTA 4ECCA 3FYGA 2IFQA 3KGKA 4BA7A 1V2AA 1XVQA 2H1DA 4MDCA 1YZXA 2GQLA 1G7EA 1GULA 1PMTA 4XRAA 3TJBA 1XW9A 3ZFBA 4QL7A 1M0UA 3CRUA 2HRKA 3IE3A 4JU5A 1TP9A 2H66A 2X99A 3HVSA 3NOFA 5D9VA 3LJRA 1M9BA 2K18A 1LU4A 1PKZA 4XHMA 1X0RA 5A4WA 1UVZA 3I69A 2IMKA 3TRQA 1K3OA 3IC4A 4TOPA 3ZIJA 3EC3A 4ULXA 1GNWA 4TN8A 3IBHA 5IPHA 3GSSA 4POKA 3BJ5A 2C80A 3D5JA 5ECMB 2GDRA 2IIYA 1O8XA 4HU9A 3M1GA 2YWMA 1XOAA 3HZ8A 1T3BA 4K6XA 1GWCA 2MMZA 1OC3A 4MLYA 1FB0A 1CQHA 5DJLA 1WJKA 3DYRA 3ZVJA 1GSQA 1JZRA 2YV9A 2GT6A 3APSA 4YAPA 1DBYA 1A0FA 2OBKA 4F0BA 4K9ZA 5IQYA 2L4QA 3ZRDA 4Z7XA 3GURA 2DIYA 5AISA 3KIJA 2TRXA 2IFQB 1K0AA 1GUHA 2H8LA 5EL8A 1KEBA 1JZOA 1ERWA 4N0VA 1OE8A 3ME7A 3GKNA 2V1MA 2HRKB 4TR0A 4ZB9A 2BJXA 1K0OA 3QAVA 4IQAA 2MMNA 4ZL9A 1EP7A 4RI6A 5H5RA 4IW9A 4KCEA 1AW9A 3RDWA 4FYUA 4KH7A 1V9WA 4JR4A 3TB2A 4N11A 3GKXA 3FR9A 2H6ZA 2MYGA 3IC8A 3EU3A 3GL5A 4JRRA 5KN3A 1AAZA 2NVLA 1K0CA 3TKRA 4IP1A 5DCGA 1EOGA 4G19A 5GSSA 3PR8A 1YF0A 3VI7A 13GSA 1TDIA 1XWAA 3UIWA 6GSVA 2O89A 3KP8A 3TCOA 4ZBDA 2PPTA 1V98A 1OE7A 1Q98A 2JZRA 1U3IA 2VCQA 4OFTA 5ELAA 3ISOA 2FCHA 1FG4A 3FEUA 3F4TA 4HEA2 2VLUA 4OO5A 1O81A 4IHUA 4EO3A 2XPEA 4IJIA 1B8XA 4NWYA 5IPGA 4KDUA 2WULA 5IMCA 2V41A 1VF1A 4IKHA 5JCUA 4PUFC 4ISDA 4KGIA 2G0FA 4FQUA 22GSA 2FLSA 2WRTA 2L57A 2EIQA 2L5LA 4BVXB 2XC2A 2OJLA 4D73B 4YQUA 3E0UA 1GRXA 2FA4A 3ZREA 5HR0A 2HSNB 3S9FA 20GSA 2F8AA 1Z3EA 4MF5A 4J56E 4GSSA 2HQTA 5D9TA 5H5SA 3L4NA 4TR4A 2VCVA 1A0RP 2H1BA 2CAQA 4WXTA 2J9HA 4KF9A 1X5EA 5ELGA 4X0XA 3LQ7A 3TKSC 1WE0A 4ECIA 1C72A 3IAM2 4KDXA 2CQ9A 2X8CA 2M46A 4F82A 1EOHA 1TXXA 5AIVA 1EZKA 1GSYA 4E8HA 3GFKA 3I6AA 1T8EB 1A2LA 4EUYA 2B3SA 3GTUA 1AXDA 3L9VA 3BOAA 3AY8A 5A5KA 2X8HA 2KP2A 1IYHA 5ECKB 2F3MA 4MH3A 2DSAA 1GSFA 2FWHA 5HFKA 4EKZA 1TTZA 3N9JA 5BMUA 4HI7A 1Q4JA 3F8UA 1OC9A 3KJYA 3LGCA 3P7XA 1ACVA 2XBQA 2YN1A 4KW6A 3DEXA 5G30A 3D6IA 1U3AA 1YY7A 3G7IA 4OWYA 1VGLA 1QK8A 2PVOC 3APOA 1G7OA 4FO5A 3IPZA 1VF4A 3DWVA 3D0ZA 2EIRA 4G10A 2OE1A 5EY6A 5ECQB 5D8IA 3TRPA 2HZEA 3FY7A 5INYA 1VF3A 5F05A 2I3YA 1B4PA 4MF6A 2H01A 4MJBA 3Q18A 1OVNA 4WEYA 3M3MA 1TKDB 5CRGA 2QC7A 3RAZA 2H6YA 3CTFA 2JADA 2CX3A 2HRAA 2BMXA 2WDUA 5LD0A 4QL9A 3ERFA 5G5EA 4ZL8A 5DQYA 2YWOA 3ZMLA 3C8EA 3VFIA 2WFCA 4AJ7A 2K9FA 4K1FA 1GUMA 3FW2A 1SD9A 2H74A 3QCPA 3H79A 1DE2A 3HYPA 4HDEA 1WRYA 2DBCA 5AN1A 2GGTA 4TVEA 3ED3A 2R2JA 2VM1A 3GYKA 1QMVA 2KHPA 1J0FA 4NHWA 4KA0A 4O5RA 4BL7A 4MF7A 1GTBA 2PMTA 3TOUA 2H0HA 4WBRD 2TIRA 5GAPD 5ECIB 1R26A 3DGQA 1NSWA 5G1KA 4EE0A 2WJUA 3EURA 2TRCP 2VUPA 4RQRA 4E8EA 3LSZA 3QPMA 2YCDA 2HSHA 2OA7A 2HZEB 1SK0A 2VOCA 2NTOA 4NV2A 4POMA 3LYPA 5H5QA 1Z6NA 3KM6A 4IJ3A 2DC5A 4MK3A 2I81A 1XFLA 1W89A 1FVKA 3FZ9A 3U6VA 5HR2A 2GZPA 2LNTA 1GTUA 2H30A 4K7IA 2C8UA 1O8WA 3LEFA 1KTEA 3IRAA 5C04A 1A2JA 18GSA 2ZCTA 2GQKA 4GWRA 2LJAA 2IL3A 1H75A 4X1UA 4XS4A 1ZZYA 1LJRA 4GCIA 1XWBA 1GTAA 4HQSA 3RBTA 1BX9A 1SJIA 1GP1A 3TJGA 1HD2A 1XOBA 5D73A 5F0GA 2HT9A 2LQOA 1SL1B 3QDNA 4OFNA 4KUNA 3EVIA 3U5RE 2N5AA 2C3NA 5B8BA 2X8GA 5B7CA 5B8AA 4MABA 1QXHA 2CT6A 2VCWA 4XRDA 3PINA 5G5FA 4KCAA 3D4TA 1UA5A 4BL7B 3GA4A 3MNGA 4K7OA 3GV1A 5ECOB 3DMLA 1O6JA 2JL4A 5JCGA 1I5GA 3GX8A 2JSZA 3C1RA 4POLA 4ZBAA 3TOTA 4WBJA 3ERGA 2B1KA 3WT2A 2PU9C 1X9MB 1ABAA 1ZOFA 2B6MA 3DVXA 1YJ6A 3ZTLA 4NXIA 4CW9A 5IO2A 1YKCA 2GSQA 3R3EA 6GSSA 3KMNA 2B7KA 3CMIA 3QR6A 1MDKA 1Z7RA 2M72A 1F3AA 3G9BA 3KEBA 2YNXA 1FAAA 11GSA 1XIYA 4WKWA 3G7YA 2L6DA 2VCZA 1A24A 5J5NA 4TR3A 2RM6A 3TKQA 1NHOA 4H86A 5IM9A 5JWOB 3PPUA 3BBYA 2VLTA 3UMAA 5D93A 3GRXA 4POBA 4XS4B 3L78A 1WOUA 5G2ZA 2RUFA 2FUG2 4ZILA 1E2YA 3TKSE 3QMXA 1PGTA 16GSA 1M2AA 1ML6A 1U87A 2ES7A 1DE1A 2E2GA 3GKMA 1YEXA 3NIVA 2HLSA 2PBJA 3EU4A 3A2XA 3FKFA 4RUVA 4KSOA 3UVTA 1IYIA 1GSUA 3PH9A 1T00A 1JLWA 4IGJA 4V2MA 4EXJA 1ERTA 2HSMB 10GSA 9GSSA 5C00A 3CXGA 4LL1B 1BAYA 1R7HA 1SK2A 2WS2A 3KXOA 5DDLA 2KOKA 4BVXA 4TR1B 1YQ1A 2YP6A 4WETA 2FNOA 3EWLA 4D73A 4BWQA 1SL0B 3CBUA 5AGYA 1KNGA 1TK5B 4F0CA 3F6FA 3D21A 4WF4A 1PX7A 2RM5A 4GSTA 1XWCA 1EP8A 2F8FA 2DJ2A 5IMAA 1CQGA 1ILOA 1E6BA 1JLVA 3GL3A 6GSWA 3KP9A 5B6NA 5ECSA 5A4VA 2OE3A 2REMA 1BG5A 3RHCA 5JCWA 1O7UA 2GSRA 2WZ9A 2VL2C 3ZLPA 3JCML 4LA1A 2LQQA 3C71A 2LKUA 5ABRA 2H1GA 2HXKA 1YKAA 1X9SB 2PUKC 3H8QA 4PNFA 2OKAA 5CAXA 2LS5A 1M9AA 4IN0A 1XVWA 3IHQA 2RIIA 2HSYA 1TRUA 4G9HA 1WIKA 2YANA 6GSXA 3P2AA 2H70A 4PXOA 2LRNA 4MJEA 1K0NA 3A5WA 1AQVA 4KB3A 1WPIA 4DSSA 2YJ7A 4MZCA 4ZL7A 4IP6A 19GSA 1GUKA 2QSIA 5J4UA 4GXZA 6GSTA 3O76A 1HYUA 3O3TA 3IXRA 1GTIA 2V2GA 2R5GA 1TI3A 1K0BA 2DJ3A 2Z9SA 5F8BA 3A3TA 1OKDA 2XBIA 4G0IA 2LNSA 1I9DA 3GMFA 1MEKA 3TJJA 4L5OA 2MZCA 1XBSA 4K8MA 4EF0A 1LBKA 5HFGA 1SENA 3GN3A 3C73A 4I2UA 3TRXA 4FH8A 1N8JA 4NPBA 2HZFA 1GSEA 5JWRB 4O92A 1Y6EA 3ZVJD 3IAS2 3MAKA 5E59A 1R5AA 3WGXA 3MWHA 4PQ1A 2YJHA 2C1YA 3CSIA 2VCTA 2GT5A 2AAWA 3KZQA 2B5XA 3F4RA 2LUSA 3HZ4A 1EEMA 2VL3A 3VK9A 2YZUA 1SKSB 5D9XA 2CVDA 4L8EA 4WR4A 5IIZA 3N5OA 4PTSA 1VRSD 4O7HA 2HI7A 4DSSB 2E7PA 1SJ6A 3F63A 2JZSA 5FHIA 2P5QA 3BD2A 2VO4A 1PL1A 2BTOT 2DMLA 1MDIA 3WGEA 1PX6A 4I2TA 2CA8A 3C1SA 2VD0A 1U6TA 3FZ5A 2HYXA 2GZYA 3J7Yb 3EMPA 4I5QA 1V58A 5HR3A 2MBSA 1TRVA 3HJPA 3TJFA 2FGXA 4USSA 1S3DA 1J9BA 1EV4A 3KTLA 3TKSA 3GIXA 1FW1A 2H6XA 1WP0A 3QD9A 4AF2A 4WF5A 1ZGNA 2ZNMA 1MTCA 4ML1A 2NBSA 2H73A 5CYYA 5J41A 3VWWA 3C7MA 2LRCA 2V6KA 4HJ2A 1NW2A 2NPBA 3M8NA 4KDYA 2GLRA 5DQSA 1ST9A 1Z7PA 1AIUA 3ZYWA 3H1NA 5L71A 2GQMA 2VIMA 5LCZA 4PUAA 3LXTA 2C4JA 2FHEA 3LYKA 2A4VA 3QAWA 3ME8A 5D9WA 1QUWA 1BEDA 2HE3A 3HHVA 1ERVA 3UBKA 3LFLA 3OR5A 1B9YC 1XW5A 4F2IA 2AYTA 4KX4A 3P90A 4PQHA 5ECNB 3APQA 2QGVA 3F3RA 1AQXA 5IMVA 1T4YA 2N5BA 2FA8A 1JFUA 3R2QA 2RUEA 2I1UA 1EGOA 3TJKA 3F3QA 2IMIA 3IDVA 3UOMA 1F6MC 1NM3A 1THOA 3W8JA 2B1LA 5GAND 1GSDA 3A2WA 2AV4A 2R4VA 2RLIA 3H4KA 4JZQA 3LXZA 1SKRB 5ECRB 5J9BA 4N0ZA 4DSQA 2QKEA 2OADA 3I9V2 2VAFA 1YDKA 5IOWA 4BVYA 4FIWA 3SWLA 1K3LA 3IOSA 4I97A 4LMVA 1F2EA 2E2MA 1FHEA 1Z9HA 4MJCA 2YOIA 5FT3A 2ON5A 3W8SA 2LRTA 1TK8B 5F07A 5IMDA 1BJXA 2H71A 1B9XC 3SBCA 2I4AA 1YEPA 4JEDA 4MZBA 1XZOA 1MD4A 4TW5A 1W4VA 2J23A 2KUCA 4MCUA 3VWUA 1FOVA 3CSHA 1V40A 4ID0A 2C0EA 2IMDA 2GZZA 4I6XA 3CRTA 2PERA 1SKWB 4HU7A 3VPTA 4AJ8A 2A2SA 2FWGA 4RQXA 2PN8A 4IVFA 3UL3A 4GQFA 5IOXA 1TI1A 3CTGA 3NZNA 1V57A 5COHA 2XHFA 2DMMA 3WYWA 4V1Ap 3ZL5A 3EE2A 3D4MA 2O7KA 1EGRA 4N10A 1XPVA 4RI7A 2C0DA 2HSMA 2CX4A 4N30A 3GHAA 3K8NA 3GH9A 1UN2A 2YV7A 1M99A 2WGRA 4TR1A 4BVYB 2ALBA 4LLRA 2V6OA 1TU7A 4DEJA 1PKWA 3E9JB 1OAZA 5EPFA 2KP1A 4PGTA 1Y25A 2G2QA 3IK9A 1X5CA 1F9MA 4TXOA 3F4SA 2JACA 1R4WA 1TK0B 4J2FA 4EDZA 5A4UA 2HFDA 3KH9A 3LORA 2NDOA 4IS0A 4ILFA 3IK7A 5CP1A 2MMAA 2I9HA 2O87A 5KN2A 1TU8A 4P3YB 3RPPA 2H0GA 2FD3A 1A23A 3H93A 3HXSA 1TJDA 2WB9A 2VD1A 5ECHB 2UZ8A 5KEJA 5AIXA 2YWIA 2OACA 1X5DA 1A8YA 2B5YA 4IQ1A 3A2VA 1THXA 3MDKA 4KE3A 2ZUPA 2D2ZA 4G0LA 3KTBA 3TDGA 5HFIA 4TKYA 2JSYA 2DJKA 4L0UA 2IJYA 1PL2A 1GL8A 2R6KA 3ZFLA 3BCIA 3Q6OA 3PGTA 3GH6A 1XCCA 4EC0A 3V1WA 2L5OA 2FWEA 5CRHA 4MA9A 1M2DA 1HQOA 2OBIA 3ZITA 3DXBA 1XWKA 3CYNA 2CZ2A 3O6TA 3TKPA 1HNBA 5G1LA 3M0FA 4EVMA 3M9KA 1TRWA 2L4CA 3HY2A 4CDOA 3IR4A 4KSMA 2F51A 2B7JA 5CREA 4PQIA 3E3EA 3EMXA 3WD6A 4ZXGA 1EEJA 4WR5A 5JWQB 1PQNA 5CRWA 2K8VA 1PA3A 2L59A 4GLTA 4TXOB 1USBA 2ON7A 3FK8A 4F03A 2IWTA 1ZL9A 1Z6MA 4MMMA 4HZ4A 1A2MA 4XIHA 5KN1A 4HZ2A 2H0IA 1RW1A 1T4ZA 5E4WA 4ACSA 2AJQB 4L5LA 4YQMA 1G6YA 4KAEA 5IMZA 3GSTA 4Q5RA 1F3BA 2CZ3A 8GSSA 1SJZA 5ENUA 3TGZA 4LL4B 2JZTA 3Q74A 1PRXA 3VLNA 3L9UA 4BWSA 3GKKA 4AGSA 1AQWA 3HCZA 1YF1A 1SYXA 4NV5A 2PWJA 5DJMA 1M2BA 5ID2A 2AHEA 1NHYA 4I8BA 4GSNA 1HNAA 4FYBA 1F37A 3LG6A 1SU9A 5J3RA 1T7PB 1FVJA 1WMJA 5KN0A 4V2LA 3FZ4A 3GNJA 2LSTA 4HQZA 2PVQA 5FWGA 2C0FA 3DRNA 4HS1A 3HDCA 1QQ2A 1N2AA 2YWNA 3ERWA 3BCKA 6GSUA 3UEMA 3ZZXA 3MSZA 4JBBA 3RPNA 3L0HA 1TW9A 3TUEA 1SYRA 3KD0A 3VURA 1PN9A 3ZIVA 2HNLA 4OO4A 3KCMA 4YH2A 3FR6A 1BQ7A 4MPFA 1OKTA 4EDYA 3HKRA 5DAKA 1S3CA 2DLXA 1R5PA 4PX1A 2M80A 4TRXA 4NAXA 1SK1A 3P8WA 5EVOA
chains in the Genus database with same CATH superfamily
2EIOA 2GSTA 5ECLB 3CSJA 2X49A 5HR1A 1TRSA 1ZYEA 3LWAA 4NHZA 4V1Ag 3EINA 3QAGA 2VL2A 2GS3A 3RHBA 5J9CA 2MMOA 2C3TA 3I43A 1RQMA 1H4OA 2R0CA 2K6VA 3D22A 2CVBA 2HRNA 4HUAA 1MDJA 2VM2A 2B5EA 4OCFA 3J7Yk 4PI0C 4GRFA 1TOFA 3HJOA 3L9SA 1QFNA 4G01A 3Q19A 4LMWA 4MZWA 4MPGA 2OE0A 1UC7A 5ID2B 4Q5NA 5A34A 1AUCA 2IN3A 4K0NA 1O73A 2YZHA 1ZMAA 1KBNA 3DKSA 4OD7A 5CRDA 4ZB6A 2GSSA 3TU3B 3UJ1A 4A5PA 1BYEA 2H75A 2VLVA 4ML6A 3ZMKA 4YAVA 2CVKA 4QQ7A 1K0DA 3F0IA 3HVXA 3M9JA 5B6MA 2GVPA 1J08A 2H76A 1SL2B 1M3IA 3F9UA 2CAIA 4CY6A 4AKIA 5HQPA 1ZCPA 2C3QA 2F9SA 4DVCA 4K7NA 3UVHA 5DAKB 4ECBA 4PNGA 2AUVA 4V2NA 1PD21 3GUSA 1U88A 2VL9A 3UAPA 14GSA 2K8SA 4Q5FA 4ZBBA 4XS1A 2WCIA 1URMA 4TXVA 2A4HA 4BPYA 1XW6A 1M7TA 3HA9A 5LNKe 2O85A 2XPDA 4XS6A 1DSBA 3G7JA 4OFMA 4PURA 2LJKA 4YQVA 1OYJA 2X64A 1OC8A 1ZYQB 1PSQA 1MD3A 5ECPB 5D96A 4K2DA 1HNCA 6GSYA 1GLQA 1AC1A 1T1VA 2CV4A 2EC4A 3FRCA 5J4VA 4JR6A 3US3A 2FY6A 3HD5A 2DIZA 4XTSA 4NMUA 4F9ZA 1FB6A 4XCSA 4ZIJA 3IA1A 4EL1A 4AKXB 12GSA 2HRFA 3QOUA 2LTKA 1ERUA 2E0QA 1K0MA 3GTUB 3VWVA 2DJ0A 2V32A 2H19A 1G0TA 1PFOA 1O85A 3EYTA 4MP4A 5BMUB 2VCXA 1JHBA 1OC9B 4GTUA 1RK4A 5GSTA 2IPAA 1VF2A 4AJ6A 1DUGA 5G31A 3DVWA 4HOJA 2A2RA 1Z5YE 1S3AA 2LJRA 2AB6A 2WZSA 2P31A 4DSRA 1G6WA 3KH7A 1B4QA 3UBLA 4KNDA 4X43A 3MIXA 5DALA 1ON4A 2IMFA 2L6CA 4MH2A 1QGVA 4O32A 17GSA 2H72A 4JE1A 5F06A 1A8LA 4OMVA 3RGBC 3MYDA 1GH2A 1M3JA 3QFBC 4L0WA 1JZWA 2LEGA 5GZZB 2LV3A 3FHKA 2YPMA 4G0KA 2WVXA 4E68A 2DJJA 4K0GA 2R0GA 2R37A 3QFAC 3F6DA 4Q5QA 2KLXA 4ECJA 4GF0A 3W6GA 4GQCA 4FYCA 5CNWA 2IMEA 4G2EA 5IMFA 3IV4A 3HJMA 3UARA 1WWJA 2PGTA 4OCEA 3WT1A 1XXUA 2P5RA 3HVVA 3VI5A 1SD8A 4J57E 3DIEA 1EV9A 3FR3A 3VPQA 5IO0A 5DCHA 2JU5A 2O8VB 1GSSA 4IBPA 5DBQA 3VWXA 1X9WB 1GLPA 5DVBA 2DJ1A 1EWXA 1XWGA 2H1AA 3FZAA 3KMOA 2GTUA 1B48A 1K3YA 3WGDA 2C0GA 2FWFA 1FO5A 4HJMA 1JZDA 2P0GA 7GSSA 5CO3A 3GX0A 4IELA 4CHSA 4AKHA 2R3XA 3DD3A 4ZB8A 5DALB 4K5RA 4MJAA 2N5FA 1GNEA 2MBTA 4ECCA 3FYGA 2IFQA 3KGKA 4BA7A 1V2AA 1XVQA 2WVZA 2H1DA 4MDCA 1YZXA 2GQLA 1G7EA 1GULA 1PMTA 4XRAA 3TJBA 1XW9A 3ZFBA 4QL7A 1M0UA 3CRUA 2HRKA 3IE3A 4JU5A 1TP9A 2H66A 2OT3A 2X99A 1XG8A 3HVSA 3NOFA 5D9VA 3LJRA 1M9BA 2WW1A 2K18A 1LU4A 1PKZA 4XHMA 2O5VA 1X0RA 5A4WA 1UVZA 3I69A 2IMKA 3TRQA 1K3OA 3IC4A 5A5HB 4TOPA 3ZIJA 3EC3A 4ULXA 1GNWA 4TN8A 3IBHA 5IPHA 3GSSA 4POKA 3BJ5A 2C80A 3D5JA 5ECMB 2GDRA 2IIYA 1O8XA 4HU9A 2H1LA 2A2PA 3M1GA 2YWMA 1XOAA 3HZ8A 5KOWA 1T3BA 4K6XA 1GWCA 2MMZA 1OC3A 4MLYA 1FB0A 1CQHA 5DJLA 1WJKA 3DYRA 3ZVJA 1GSQA 1JZRA 2YV9A 2GT6A 3APSA 4YAPA 1DBYA 1A0FA 2OBKA 4F0BA 4K9ZA 5IQYA 2L4QA 3ZRDA 2DKIA 4Z7XA 3GURA 2VKZG 2DIYA 5AISA 3KIJA 2TRXA 2IFQB 1K0AA 1GUHA 3CQFA 2H8LA 5EL8A 1KEBA 1JZOA 1ERWA 4N0VA 1OE8A 3ME7A 3GKNA 1TXUA 2V1MA 2HRKB 4TR0A 4ZB9A 2BJXA 1BF5A 1K0OA 3QAVA 4IQAA 2MMNA 4ZL9A 4K2XA 1EP7A 4RI6A 4YKGA 5H5RA 4IW9A 4KCEA 1AW9A 3RDWA 4FYUA 4KH7A 1V9WA 4JR4A 3TB2A 4N11A 3GKXA 3FR9A 2H6ZA 2MYGA 3IC8A 3EU3A 3GL5A 4JRRA 5KN3A 1AAZA 2NVLA 1K0CA 3TKRA 4IP1A 5DCGA 1EOGA 4G19A 5GSSA 3PR8A 1YF0A 3VI7A 13GSA 1TDIA 1XWAA 3UIWA 6GSVA 2O89A 3KP8A 3TCOA 4ZBDA 2PPTA 1V98A 1OE7A 1Q98A 2JZRA 1U3IA 2VCQA 4OFTA 5ELAA 3ISOA 2FCHA 1FG4A 3FEUA 3F4TA 4HEA2 2VLUA 4OO5A 1O81A 4IHUA 4EO3A 2XPEA 4IJIA 1B8XA 4NWYA 5IPGA 4KDUA 2WULA 5IMCA 2V41A 1VF1A 4IKHA 5JCUA 4PUFC 4ISDA 4KGIA 2G0FA 4FQUA 22GSA 2FLSA 2WRTA 2L57A 2EIQA 2L5LA 3CHXC 4BVXB 2XC2A 2OJLA 4D73B 4YQUA 4ZB7A 3E0UA 1GRXA 2FA4A 3ZREA 1ZYNA 5HR0A 2HSNB 3S9FA 20GSA 2F8AA 1Z3EA 4MF5A 4J56E 4GSSA 2HQTA 5D9TA 5H5SA 3L4NA 4TR4A 2VCVA 1A0RP 4EIQA 2H1BA 2CAQA 4WXTA 2J9HA 4KF9A 1X5EA 5ELGA 3A5IA 4X0XA 3LQ7A 3TKSC 4Z2TA 1WE0A 4ECIA 1C72A 3IAM2 2EFCA 4KDXA 2CQ9A 2X8CA 2M46A 4F82A 1EOHA 1TXXA 5AIVA 1EZKA 1GSYA 4E8HA 3GFKA 3I6AA 1T8EB 4N3ZA 1A2LA 4EUYA 2B3SA 3GTUA 1AXDA 3L9VA 3BOAA 3AY8A 5A5KA 2X8HA 2KP2A 1IYHA 5ECKB 2F3MA 4MH3A 2DSAA 1GSFA 2FWHA 5HFKA 4EKZA 1TTZA 3N9JA 5BMUA 4HI7A 1Q4JA 3F8UA 4O5UA 1OC9A 2O36A 3KJYA 3LGCA 3P7XA 1ACVA 2XBQA 2YN1A 4KW6A 3DEXA 5G30A 3D6IA 1U3AA 1YY7A 3G7IA 4OWYA 1VGLA 1QK8A 2PVOC 3APOA 1G7OA 4FO5A 3IPZA 1VF4A 3DWVA 3D0ZA 2WVYA 2EIRA 4G10A 2OE1A 5EY6A 5ECQB 5D8IA 2EFDA 3TRPA 2HZEA 3FY7A 5INYA 1VF3A 2WW2A 5F05A 2I3YA 1B4PA 4MF6A 2H01A 2WW0A 4MJBA 3Q18A 1OVNA 4WEYA 3M3MA 1TKDB 5CRGA 2QC7A 3RAZA 2H6YA 3CTFA 4FXYP 2JADA 2CX3A 2HRAA 2BMXA 2WDUA 5LD0A 4QL9A 3ERFA 5G5EA 4ZL8A 5DQYA 4X4JA 2YWOA 3ZMLA 3C8EA 3VFIA 2WFCA 4AJ7A 2K9FA 4K1FA 1GUMA 3FW2A 1SD9A 2H74A 3QCPA 3H79A 1DE2A 3HYPA 4HDEA 1WRYA 2DBCA 5AN1A 2GGTA 4TVEA 3ED3A 2R2JA 2VM1A 3GYKA 1QMVA 2WW3A 2KHPA 1J0FA 4NHWA 4KA0A 1YEWC 4O5RA 4BL7A 4MF7A 1GTBA 2PMTA 3TOUA 2H0HA 4WBRD 2TIRA 5GAPD 5ECIB 1R26A 3DGQA 5A1NB 1NSWA 5G1KA 4EE0A 2WJUA 3EURA 1S4BP 2TRCP 2VUPA 4RQRA 4E8EA 3LSZA 3QPMA 2YCDA 2HSHA 2OA7A 2HZEB 1SK0A 2VOCA 2NTOA 4NV2A 4POMA 3LYPA 5H5QA 1Z6NA 3KM6A 4IJ3A 2DC5A 4MK3A 2I81A 1XFLA 1W89A 1FVKA 3FZ9A 3U6VA 4MNNA 5HR2A 4PHZC 2GZPA 2LNTA 1GTUA 2H30A 4K7IA 2C8UA 1O8WA 3LEFA 1KTEA 3IRAA 5C04A 1A2JA 18GSA 2ZCTA 2GQKA 4GWRA 5A5HA 2LJAA 2IL3A 1H75A 4X1UA 4XS4A 1ZZYA 1LJRA 4GCIA 1XWBA 1GTAA 4HQSA 3RBTA 1BX9A 1SJIA 1GP1A 3TJGA 1HD2A 1XOBA 5D73A 5F0GA 2HT9A 2LQOA 1SL1B 3QDNA 4OFNA 4KUNA 3EVIA 3U5RE 2N5AA 2C3NA 5B8BA 2X8GA 5B7CA 5B8AA 4MABA 1QXHA 2CT6A 2VCWA 4XRDA 3PINA 5G5FA 4KCAA 3D4TA 1UA5A 4BL7B 3GA4A 3MNGA 4K7OA 3GV1A 5ECOB 3DMLA 1O6JA 2JL4A 5JCGA 1I5GA 3GX8A 2JSZA 3C1RA 4POLA 4ZBAA 3TOTA 4WBJA 4QMKA 3ERGA 4BIKA 2B1KA 3WT2A 5KOXA 2PU9C 1X9MB 1ABAA 1ZOFA 2B6MA 3DVXA 1YJ6A 3ZTLA 4NXIA 4CW9A 5IO2A 1YKCA 2GSQA 3R3EA 6GSSA 3KMNA 2B7KA 3CMIA 3QR6A 1MDKA 1Z7RA 2M72A 1F3AA 3G9BA 3KEBA 2YNXA 1FAAA 11GSA 1XIYA 4WKWA 3G7YA 2L6DA 2VCZA 1A24A 5J5NA 4TR3A 2RM6A 3TKQA 5J47A 1NHOA 4H86A 5IM9A 5JWOB 3PPUA 3BBYA 2VLTA 3UMAA 5D93A 3GRXA 4POBA 4XS4B 3L78A 1WOUA 5G2ZA 2RUFA 2FUG2 4ZILA 1E2YA 3TKSE 3QMXA 1PGTA 2DKHA 16GSA 1M2AA 1ML6A 1U87A 2ES7A 1DE1A 2E2GA 1I1IP 3GKMA 1YEXA 3NIVA 2HLSA 2QA2A 2PBJA 3EU4A 3A2XA 3FKFA 4RUVA 4KSOA 3UVTA 1IYIA 1GSUA 3PH9A 1T00A 1JLWA 4IGJA 4V2MA 4Z2UA 4EXJA 1ERTA 2HSMB 10GSA 9GSSA 5C00A 3CXGA 2R0PA 4LL1B 1BAYA 1R7HA 1SK2A 2WS2A 3KXOA 5DDLA 2KOKA 4BVXA 4TR1B 1YQ1A 2YP6A 4WETA 2FNOA 3EWLA 4D73A 4BWQA 1SL0B 3CBUA 5AGYA 1KNGA 1TK5B 4F0CA 2HSNA 3F6FA 1SVLA 3D21A 1YVLA 4WF4A 3FMWA 1PX7A 2RM5A 4GSTA 1XWCA 1EP8A 2F8FA 2DJ2A 5IMAA 1CQGA 1ILOA 1E6BA 1JLVA 3GL3A 6GSWA 3KP9A 5B6NA 5ECSA 5A4VA 2OE3A 2REMA 1BG5A 3RHCA 5JCWA 4W66A 1O7UA 2GSRA 2WZ9A 2VL2C 3ZLPA 3JCML 4LA1A 2LQQA 3C71A 2LKUA 5ABRA 2H1GA 2HXKA 1YKAA 1X9SB 2PUKC 3H8QA 4PNFA 2OKAA 2EFEA 5CAXA 2LS5A 1M9AA 1XVWA 4IN0A 3IHQA 2RIIA 2HSYA 1TRUA 4G9HA 1WIKA 2YANA 2X4AA 6GSXA 3P2AA 2H70A 4PXOA 2LRNA 4MJEA 1K0NA 3A5WA 1AQVA 4KB3A 1WPIA 4DSSA 2YJ7A 4MZCA 4ZL7A 4IP6A 19GSA 1GUKA 1FOHA 2QSIA 5J4UA 4GXZA 6GSTA 3O76A 1HYUA 3O3TA 3IXRA 1GTIA 2V2GA 2R5GA 1TI3A 1K0BA 2DJ3A 2Z9SA 5F8BA 3A3TA 1OKDA 2XBIA 4G0IA 2LNSA 1I9DA 3GMFA 1MEKA 3TJJA 4GDFA 4L5OA 2MZCA 1XBSA 4K8MA 4EF0A 1LBKA 5HFGA 1SENA 3GN3A 3C73A 4I2UA 3TRXA 4FH8A 1N8JA 4NPBA 2HZFA 4O5QA 1GSEA 5JWRB 4O92A 1Y6EA 3ZVJD 3IAS2 3MAKA 5E59A 1R5AA 3WGXA 3MWHA 4PQ1A 2YJHA 2C1YA 3CSIA 2VCTA 2GT5A 2AAWA 3KZQA 2B5XA 3F4RA 2LUSA 3HZ4A 1EEMA 2VL3A 3VK9A 2YZUA 1SKSB 5D9XA 2CVDA 4L8EA 4WR4A 5IIZA 3N5OA 4PTSA 1VRSD 4O7HA 2HI7A 4DSSB 2E7PA 1SJ6A 3F63A 2JZSA 5FHIA 2P5QA 3BD2A 2VO4A 1PL1A 2BTOT 2DMLA 1MDIA 3WGEA 1PX6A 4I2TA 2CA8A 3C1SA 2VD0A 1U6TA 3FZ5A 2HYXA 1SVOA 2GZYA 5A1NA 3J7Yb 3EMPA 4I5QA 1V58A 5HR3A 2MBSA 1TRVA 3HJPA 3TJFA 2FGXA 4USSA 3EPTA 1S3DA 1J9BA 1EV4A 2QA1A 3KTLA 3TKSA 3GIXA 1FW1A 2H6XA 1WP0A 3QD9A 4AF2A 4WF5A 1SVMA 1ZGNA 2ZNMA 1MTCA 4ML1A 2NBSA 3IHGA 2H73A 5CYYA 5J41A 3VWWA 3C7MA 2LRCA 2V6KA 4HJ2A 1NW2A 2NPBA 3M8NA 4KDYA 4PI2C 2GLRA 4K5SA 5DQSA 1ST9A 4Z2RA 1Z7PA 1AIUA 3ZYWA 3H1NA 5L71A 2GQMA 2VIMA 5LCZA 4PUAA 3LXTA 2C4JA 2FHEA 3LYKA 2A4VA 3QAWA 3ME8A 5D9WA 1QUWA 1BEDA 2HE3A 3HHVA 5A34B 1ERVA 3UBKA 3LFLA 3OR5A 4HSCX 1B9YC 1XW5A 4F2IA 2AYTA 4KX4A 3P90A 4PQHA 5ECNB 3APQA 2QGVA 3F3RA 1AQXA 5IMVA 1T4YA 2N5BA 2FA8A 1JFUA 3R2QA 2RUEA 2I1UA 1EGOA 3TJKA 3F3QA 2IMIA 3IDVA 3UOMA 1F6MC 1NM3A 5J4YA 1THOA 3W8JA 2B1LA 5GAND 1GSDA 4YKFA 3A2WA 2AV4A 2R4VA 2RLIA 3H4KA 4JZQA 3LXZA 1SKRB 5ECRB 5J9BA 4N0ZA 4DSQA 2QKEA 2OADA 2UV8G 3I9V2 2VAFA 1YDKA 5IOWA 3CWGA 4BVYA 4FIWA 3HMJG 3SWLA 1K3LA 3IOSA 4I97A 4LMVA 1F2EA 2E2MA 1FHEA 1Z9HA 4MJCA 2YOIA 5FT3A 2ON5A 3W8SA 2LRTA 1TK8B 5F07A 5IMDA 1BJXA 2H71A 1B9XC 3SBCA 3RFRC 2I4AA 1YEPA 4JEDA 4MZBA 1XZOA 1MD4A 4TW5A 1W4VA 2J23A 2KUCA 4MCUA 3VWUA 1FOVA 3CSHA 1V40A 1Y1UA 1ZYPA 4ID0A 2C0EA 2IMDA 2O3EA 2GZZA 4I6XA 4ICYA 3CRTA 2PERA 1SKWB 4HU7A 3VPTA 4AJ8A 2A2SA 2FWGA 4RQXA 2PN8A 4IVFA 3UL3A 4GQFA 5IOXA 5J40A 1TI1A 1BG1A 3CTGA 3NZNA 1V57A 5COHA 2XHFA 2DMMA 3WYWA 4V1Ap 3ZL5A 3EE2A 3D4MA 2O7KA 1EGRA 4N10A 1XPVA 4RI7A 2C0DA 2HSMA 2CX4A 4N30A 3GHAA 3K8NA 3GH9A 1UN2A 2YV7A 1M99A 1S3RA 2WGRA 4TR1A 4BVYB 2ALBA 4LLRA 2V6OA 1TU7A 4DEJA 1PKWA 3E9JB 1OAZA 5EPFA 2WVXB 2KP1A 4PGTA 1Y25A 2G2QA 3IK9A 1X5CA 1F9MA 1PN0A 4TXOA 3F4SA 2JACA 1R4WA 1TK0B 4J2FA 4EDZA 5A4UA 2HFDA 3KH9A 3LORA 2NDOA 4IS0A 4ILFA 3IK7A 5CP1A 2MMAA 2I9HA 2O87A 5KN2A 1TU8A 4P3YB 3RPPA 2H0GA 2FD3A 1A23A 3H93A 3HXSA 1TJDA 2WB9A 2VD1A 5ECHB 2EFHA 2UZ8A 5KEJA 5AIXA 2YWIA 2OACA 1X5DA 1A8YA 2B5YA 4IQ1A 3A2VA 1THXA 3MDKA 4KE3A 2ZUPA 2D2ZA 4G0LA 3KTBA 3TDGA 5HFIA 4TKYA 2JSYA 2DJKA 4L0UA 2IJYA 1N25A 1PL2A 1GL8A 2R6KA 3ZFLA 3BCIA 3Q6OA 3PGTA 3GH6A 1XCCA 4EC0A 3V1WA 2L5OA 4AKGA 2FWEA 4CY8A 5CRHA 4MA9A 1M2DA 1HQOA 2OBIA 3ZITA 3DXBA 1XWKA 3CYNA 2CZ2A 3O6TA 3TKPA 1HNBA 3HVNA 5G1LA 3M0FA 4EVMA 3M9KA 1TRWA 2L4CA 3HY2A 4CDOA 3IR4A 4KSMA 3LW9A 2F51A 2B7JA 5BRTA 5CREA 4PQIA 3E3EA 3EMXA 3WD6A 4ZXGA 1EEJA 4WR5A 5JWQB 1PQNA 5CRWA 2K8VA 1PA3A 2L59A 4GLTA 4TXOB 1USBA 2ON7A 3FK8A 4F03A 2IWTA 1ZL9A 1Z6MA 4MMMA 4HZ4A 1A2MA 4XIHA 5KN1A 4HZ2A 2H0IA 1RW1A 1T4ZA 5E4WA 4ACSA 2AJQB 4L5LA 4YQMA 1G6YA 4KAEA 5IMZA 3GSTA 4Q5RA 1F3BA 2CZ3A 8GSSA 1SJZA 5ENUA 3TGZA 4LL4B 2JZTA 3Q74A 1PRXA 3VLNA 3L9UA 4BWSA 3GKKA 4AGSA 1AQWA 3HCZA 1YF1A 1SYXA 4NV5A 2PWJA 5DJMA 1M2BA 5ID2A 2AHEA 1NHYA 4I8BA 4GSNA 4EIPA 1HNAA 4FYBA 1F37A 3LG6A 1SU9A 5J3RA 1T7PB 1FVJA 1WMJA 5KN0A 4V2LA 3FZ4A 3GNJA 2LSTA 4HQZA 2PVQA 5FWGA 2C0FA 3DRNA 4HS1A 3HDCA 1QQ2A 1N2AA 2YWNA 3ERWA 3BCKA 6GSUA 3UEMA 3ZZXA 3MSZA 4JBBA 3RPNA 3L0HA 1TW9A 3TUEA 1SYRA 3KD0A 3VURA 1PN9A 3ZIVA 2HNLA 4OO4A 3KCMA 4YH2A 3FR6A 1BQ7A 4MPFA 1OKTA 4EDYA 3HKRA 5DAKA 1S3CA 2DLXA 1R5PA 4PX1A 2M80A 4TRXA 4NAXA 1SK1A 4AI6A 3P8WA 5EVOA
chains in the Genus database with same CATH topology
2EIOA 2GSTA 5ECLB 3CSJA 2X49A 5HR1A 1TRSA 1ZYEA 3LWAA 4NHZA 4V1Ag 3EINA 3QAGA 2VL2A 2GS3A 3RHBA 5J9CA 2MMOA 2C3TA 3I43A 1RQMA 1H4OA 2R0CA 2K6VA 3D22A 2CVBA 2HRNA 4HUAA 1MDJA 2VM2A 2B5EA 4OCFA 3J7Yk 4GRFA 1TOFA 3HJOA 3L9SA 1QFNA 4G01A 3Q19A 4LMWA 4MZWA 4MPGA 2OE0A 1UC7A 5ID2B 4Q5NA 5A34A 1AUCA 2IN3A 4K0NA 1O73A 2YZHA 1ZMAA 1KBNA 3DKSA 4OD7A 5CRDA 4ZB6A 2GSSA 3TU3B 3UJ1A 4A5PA 1BYEA 2H75A 2VLVA 4ML6A 3ZMKA 4YAVA 2CVKA 4QQ7A 1K0DA 3F0IA 3HVXA 3M9JA 5B6MA 2GVPA 1J08A 2H76A 1SL2B 3F9UA 2CAIA 4CY6A 4AKIA 5HQPA 1ZCPA 2C3QA 2F9SA 4DVCA 4K7NA 3UVHA 5DAKB 4ECBA 4PNGA 2AUVA 4V2NA 1PD21 3GUSA 1U88A 2VL9A 3UAPA 14GSA 2K8SA 4Q5FA 4ZBBA 4XS1A 2WCIA 1URMA 4TXVA 2A4HA 4BPYA 1XW6A 1M7TA 3HA9A 5LNKe 2O85A 2XPDA 4XS6A 1DSBA 3G7JA 4OFMA 4PURA 2LJKA 4YQVA 1OYJA 2X64A 1OC8A 1ZYQB 1PSQA 1MD3A 5ECPB 5D96A 4K2DA 1HNCA 6GSYA 1GLQA 1AC1A 1T1VA 2CV4A 2EC4A 3FRCA 5J4VA 4JR6A 3US3A 2FY6A 3HD5A 2DIZA 4XTSA 4NMUA 4F9ZA 1FB6A 4XCSA 4ZIJA 3IA1A 4EL1A 4AKXB 12GSA 2HRFA 3QOUA 2LTKA 1ERUA 2E0QA 1K0MA 3GTUB 3VWVA 2DJ0A 2V32A 2H19A 1G0TA 1O85A 3EYTA 4MP4A 5BMUB 2VCXA 1JHBA 1OC9B 4GTUA 1RK4A 5GSTA 2IPAA 1VF2A 4AJ6A 1DUGA 5G31A 3DVWA 4HOJA 2A2RA 1Z5YE 1S3AA 2LJRA 2AB6A 2P31A 4DSRA 1G6WA 3KH7A 1B4QA 3UBLA 4KNDA 4X43A 3MIXA 5DALA 1ON4A 2IMFA 2L6CA 4MH2A 1QGVA 4O32A 17GSA 2H72A 4JE1A 5F06A 1A8LA 4OMVA 3MYDA 1GH2A 3QFBC 4L0WA 1JZWA 2LEGA 5GZZB 2LV3A 3FHKA 2YPMA 4G0KA 4E68A 2DJJA 4K0GA 2R0GA 2R37A 3QFAC 3F6DA 4Q5QA 2KLXA 4ECJA 4GF0A 3W6GA 4GQCA 4FYCA 5CNWA 2IMEA 4G2EA 5IMFA 3IV4A 3HJMA 3UARA 1WWJA 2PGTA 4OCEA 3WT1A 1XXUA 2P5RA 3HVVA 3VI5A 1SD8A 4J57E 3DIEA 1EV9A 3FR3A 3VPQA 5IO0A 5DCHA 2JU5A 2O8VB 1GSSA 4IBPA 5DBQA 3VWXA 1X9WB 1GLPA 5DVBA 2DJ1A 1EWXA 1XWGA 2H1AA 3FZAA 3KMOA 2GTUA 1B48A 1K3YA 3WGDA 2C0GA 2FWFA 1FO5A 4HJMA 1JZDA 2P0GA 7GSSA 5CO3A 3GX0A 4IELA 4CHSA 4AKHA 2R3XA 3DD3A 4ZB8A 5DALB 4K5RA 4MJAA 2N5FA 1GNEA 2MBTA 4ECCA 3FYGA 2IFQA 3KGKA 4BA7A 1V2AA 1XVQA 2H1DA 4MDCA 1YZXA 2GQLA 1G7EA 1GULA 1PMTA 4XRAA 3TJBA 1XW9A 3ZFBA 4QL7A 1M0UA 3CRUA 2HRKA 3IE3A 4JU5A 1TP9A 2H66A 2OT3A 2X99A 3HVSA 3NOFA 5D9VA 3LJRA 1M9BA 2K18A 1LU4A 1PKZA 4XHMA 2O5VA 1X0RA 5A4WA 1UVZA 3I69A 2IMKA 3TRQA 1K3OA 3IC4A 5A5HB 4TOPA 3ZIJA 3EC3A 4ULXA 1GNWA 4TN8A 3IBHA 5IPHA 3GSSA 4POKA 3BJ5A 2C80A 3D5JA 5ECMB 2GDRA 2IIYA 1O8XA 4HU9A 2H1LA 2A2PA 3M1GA 2YWMA 1XOAA 3HZ8A 5KOWA 1T3BA 4K6XA 1GWCA 2MMZA 1OC3A 4MLYA 1FB0A 1CQHA 5DJLA 1WJKA 3DYRA 3ZVJA 1GSQA 1JZRA 2YV9A 2GT6A 3APSA 4YAPA 1DBYA 1A0FA 2OBKA 4F0BA 4K9ZA 5IQYA 2L4QA 3ZRDA 2DKIA 4Z7XA 3GURA 2VKZG 2DIYA 5AISA 3KIJA 2TRXA 2IFQB 1K0AA 1GUHA 2H8LA 5EL8A 1KEBA 1JZOA 1ERWA 4N0VA 1OE8A 3ME7A 3GKNA 1TXUA 2V1MA 2HRKB 4TR0A 4ZB9A 2BJXA 1BF5A 1K0OA 3QAVA 4IQAA 2MMNA 4ZL9A 4K2XA 1EP7A 4RI6A 4YKGA 5H5RA 4IW9A 4KCEA 1AW9A 3RDWA 4FYUA 4KH7A 1V9WA 4JR4A 3TB2A 4N11A 3GKXA 3FR9A 2H6ZA 2MYGA 3IC8A 3EU3A 3GL5A 4JRRA 5KN3A 1AAZA 2NVLA 1K0CA 3TKRA 4IP1A 5DCGA 1EOGA 4G19A 5GSSA 3PR8A 1YF0A 3VI7A 13GSA 1TDIA 1XWAA 3UIWA 6GSVA 2O89A 3KP8A 3TCOA 4ZBDA 2PPTA 1V98A 1OE7A 1Q98A 2JZRA 1U3IA 2VCQA 4OFTA 5ELAA 3ISOA 2FCHA 1FG4A 3FEUA 3F4TA 4HEA2 2VLUA 4OO5A 1O81A 4IHUA 4EO3A 2XPEA 4IJIA 1B8XA 4NWYA 5IPGA 4KDUA 2WULA 5IMCA 2V41A 1VF1A 4IKHA 5JCUA 4PUFC 4ISDA 4KGIA 2G0FA 4FQUA 22GSA 2FLSA 2WRTA 2L57A 2EIQA 2L5LA 4BVXB 2XC2A 2OJLA 4D73B 4YQUA 4ZB7A 3E0UA 1GRXA 2FA4A 3ZREA 1ZYNA 5HR0A 2HSNB 3S9FA 20GSA 2F8AA 1Z3EA 4MF5A 4J56E 4GSSA 2HQTA 5D9TA 5H5SA 3L4NA 4TR4A 2VCVA 1A0RP 4EIQA 2H1BA 2CAQA 4WXTA 2J9HA 4KF9A 1X5EA 5ELGA 3A5IA 4X0XA 3LQ7A 3TKSC 4Z2TA 1WE0A 4ECIA 1C72A 3IAM2 2EFCA 4KDXA 2CQ9A 2X8CA 2M46A 4F82A 1EOHA 1TXXA 5AIVA 1EZKA 1GSYA 4E8HA 3GFKA 3I6AA 1T8EB 4N3ZA 1A2LA 4EUYA 2B3SA 3GTUA 1AXDA 3L9VA 3BOAA 3AY8A 5A5KA 2X8HA 2KP2A 1IYHA 5ECKB 2F3MA 4MH3A 2DSAA 1GSFA 2FWHA 5HFKA 4EKZA 1TTZA 3N9JA 5BMUA 4HI7A 1Q4JA 3F8UA 4O5UA 1OC9A 3KJYA 3LGCA 3P7XA 1ACVA 2XBQA 2YN1A 4KW6A 3DEXA 5G30A 3D6IA 1U3AA 1YY7A 3G7IA 4OWYA 1VGLA 1QK8A 2PVOC 3APOA 1G7OA 4FO5A 3IPZA 1VF4A 3DWVA 3D0ZA 2EIRA 4G10A 2OE1A 5EY6A 5ECQB 5D8IA 2EFDA 3TRPA 2HZEA 3FY7A 5INYA 1VF3A 5F05A 2I3YA 1B4PA 4MF6A 2H01A 4MJBA 3Q18A 1OVNA 4WEYA 3M3MA 1TKDB 5CRGA 2QC7A 3RAZA 2H6YA 3CTFA 2JADA 2CX3A 2HRAA 2BMXA 2WDUA 5LD0A 4QL9A 3ERFA 5G5EA 4ZL8A 5DQYA 4X4JA 2YWOA 3ZMLA 3C8EA 3VFIA 2WFCA 4AJ7A 2K9FA 4K1FA 1GUMA 3FW2A 1SD9A 2H74A 3QCPA 3H79A 1DE2A 3HYPA 4HDEA 1WRYA 2DBCA 5AN1A 2GGTA 4TVEA 3ED3A 2R2JA 2VM1A 3GYKA 1QMVA 2KHPA 1J0FA 4NHWA 4KA0A 4O5RA 4BL7A 4MF7A 1GTBA 2PMTA 3TOUA 2H0HA 4WBRD 2TIRA 5GAPD 5ECIB 1R26A 3DGQA 5A1NB 1NSWA 5G1KA 4EE0A 2WJUA 3EURA 2TRCP 2VUPA 4RQRA 4E8EA 3LSZA 3QPMA 2YCDA 2HSHA 2OA7A 2HZEB 1SK0A 2VOCA 2NTOA 4NV2A 4POMA 3LYPA 5H5QA 1Z6NA 3KM6A 4IJ3A 2DC5A 4MK3A 2I81A 1XFLA 1W89A 1FVKA 3FZ9A 3U6VA 4MNNA 5HR2A 2GZPA 2LNTA 1GTUA 2H30A 4K7IA 2C8UA 1O8WA 3LEFA 1KTEA 3IRAA 5C04A 1A2JA 18GSA 2ZCTA 2GQKA 4GWRA 5A5HA 2LJAA 2IL3A 1H75A 4X1UA 4XS4A 1ZZYA 1LJRA 4GCIA 1XWBA 1GTAA 4HQSA 3RBTA 1BX9A 1SJIA 1GP1A 3TJGA 1HD2A 1XOBA 5D73A 5F0GA 2HT9A 2LQOA 1SL1B 3QDNA 4OFNA 4KUNA 3EVIA 3U5RE 2N5AA 2C3NA 5B8BA 2X8GA 5B7CA 5B8AA 4MABA 1QXHA 2CT6A 2VCWA 4XRDA 3PINA 5G5FA 4KCAA 3D4TA 1UA5A 4BL7B 3GA4A 3MNGA 4K7OA 3GV1A 5ECOB 3DMLA 1O6JA 2JL4A 5JCGA 1I5GA 3GX8A 2JSZA 3C1RA 4POLA 4ZBAA 3TOTA 4WBJA 4QMKA 3ERGA 2B1KA 3WT2A 5KOXA 2PU9C 1X9MB 1ABAA 1ZOFA 2B6MA 3DVXA 1YJ6A 3ZTLA 4NXIA 4CW9A 5IO2A 1YKCA 2GSQA 3R3EA 6GSSA 3KMNA 2B7KA 3CMIA 3QR6A 1MDKA 1Z7RA 2M72A 1F3AA 3G9BA 3KEBA 2YNXA 1FAAA 11GSA 1XIYA 4WKWA 3G7YA 2L6DA 2VCZA 1A24A 5J5NA 4TR3A 2RM6A 3TKQA 5J47A 1NHOA 4H86A 5IM9A 5JWOB 3PPUA 3BBYA 2VLTA 3UMAA 5D93A 3GRXA 4POBA 4XS4B 3L78A 1WOUA 5G2ZA 2RUFA 2FUG2 4ZILA 1E2YA 3TKSE 3QMXA 1PGTA 2DKHA 16GSA 1M2AA 1ML6A 1U87A 2ES7A 1DE1A 2E2GA 3GKMA 1YEXA 3NIVA 2HLSA 2QA2A 2PBJA 3EU4A 3A2XA 3FKFA 4RUVA 4KSOA 3UVTA 1IYIA 1GSUA 3PH9A 1T00A 1JLWA 4IGJA 4V2MA 4Z2UA 4EXJA 1ERTA 2HSMB 10GSA 9GSSA 5C00A 3CXGA 2R0PA 4LL1B 1BAYA 1R7HA 1SK2A 2WS2A 3KXOA 5DDLA 2KOKA 4BVXA 4TR1B 1YQ1A 2YP6A 4WETA 2FNOA 3EWLA 4D73A 4BWQA 1SL0B 3CBUA 5AGYA 1KNGA 1TK5B 4F0CA 2HSNA 3F6FA 1SVLA 3D21A 1YVLA 4WF4A 3FMWA 1PX7A 2RM5A 4GSTA 1XWCA 1EP8A 2F8FA 2DJ2A 5IMAA 1CQGA 1ILOA 1E6BA 1JLVA 3GL3A 6GSWA 3KP9A 5B6NA 5ECSA 5A4VA 2OE3A 2REMA 1BG5A 3RHCA 5JCWA 4W66A 1O7UA 2GSRA 2WZ9A 2VL2C 3ZLPA 3JCML 4LA1A 2LQQA 3C71A 2LKUA 5ABRA 2H1GA 2HXKA 1YKAA 1X9SB 2PUKC 3H8QA 4PNFA 2OKAA 2EFEA 5CAXA 2LS5A 1M9AA 1XVWA 4IN0A 3IHQA 2RIIA 2HSYA 1TRUA 4G9HA 1WIKA 2YANA 2X4AA 6GSXA 3P2AA 2H70A 4PXOA 2LRNA 4MJEA 1K0NA 3A5WA 1AQVA 4KB3A 1WPIA 4DSSA 2YJ7A 4MZCA 4ZL7A 4IP6A 19GSA 1GUKA 1FOHA 2QSIA 5J4UA 4GXZA 6GSTA 3O76A 1HYUA 3O3TA 3IXRA 1GTIA 2V2GA 2R5GA 1TI3A 1K0BA 2DJ3A 2Z9SA 5F8BA 3A3TA 1OKDA 2XBIA 4G0IA 2LNSA 1I9DA 3GMFA 1MEKA 3TJJA 4GDFA 4L5OA 2MZCA 1XBSA 4K8MA 4EF0A 1LBKA 5HFGA 1SENA 3GN3A 3C73A 4I2UA 3TRXA 4FH8A 1N8JA 4NPBA 2HZFA 4O5QA 1GSEA 5JWRB 4O92A 1Y6EA 3ZVJD 3IAS2 3MAKA 5E59A 1R5AA 3WGXA 3MWHA 4PQ1A 2YJHA 2C1YA 3CSIA 2VCTA 2GT5A 2AAWA 3KZQA 2B5XA 3F4RA 2LUSA 3HZ4A 1EEMA 2VL3A 3VK9A 2YZUA 1SKSB 5D9XA 2CVDA 4L8EA 4WR4A 5IIZA 3N5OA 4PTSA 1VRSD 4O7HA 2HI7A 4DSSB 2E7PA 1SJ6A 3F63A 2JZSA 5FHIA 2P5QA 3BD2A 2VO4A 1PL1A 2BTOT 2DMLA 1MDIA 3WGEA 1PX6A 4I2TA 2CA8A 3C1SA 2VD0A 1U6TA 3FZ5A 2HYXA 1SVOA 2GZYA 5A1NA 3J7Yb 3EMPA 4I5QA 1V58A 5HR3A 2MBSA 1TRVA 3HJPA 3TJFA 2FGXA 4USSA 3EPTA 1S3DA 1J9BA 1EV4A 2QA1A 3KTLA 3TKSA 3GIXA 1FW1A 2H6XA 1WP0A 3QD9A 4AF2A 4WF5A 1SVMA 1ZGNA 2ZNMA 1MTCA 4ML1A 2NBSA 3IHGA 2H73A 5CYYA 5J41A 3VWWA 3C7MA 2LRCA 2V6KA 4HJ2A 1NW2A 2NPBA 3M8NA 4KDYA 2GLRA 4K5SA 5DQSA 1ST9A 4Z2RA 1Z7PA 1AIUA 3ZYWA 3H1NA 5L71A 2GQMA 2VIMA 5LCZA 4PUAA 3LXTA 2C4JA 2FHEA 3LYKA 2A4VA 3QAWA 3ME8A 5D9WA 1QUWA 1BEDA 2HE3A 3HHVA 5A34B 1ERVA 3UBKA 3LFLA 3OR5A 1B9YC 1XW5A 4F2IA 2AYTA 4KX4A 3P90A 4PQHA 5ECNB 3APQA 2QGVA 3F3RA 1AQXA 5IMVA 1T4YA 2N5BA 2FA8A 1JFUA 3R2QA 2RUEA 2I1UA 1EGOA 3TJKA 3F3QA 2IMIA 3IDVA 3UOMA 1F6MC 1NM3A 5J4YA 1THOA 3W8JA 2B1LA 5GAND 1GSDA 4YKFA 3A2WA 2AV4A 2R4VA 2RLIA 3H4KA 4JZQA 3LXZA 1SKRB 5ECRB 5J9BA 4N0ZA 4DSQA 2QKEA 2OADA 2UV8G 3I9V2 2VAFA 1YDKA 5IOWA 3CWGA 4BVYA 4FIWA 3HMJG 3SWLA 1K3LA 3IOSA 4I97A 4LMVA 1F2EA 2E2MA 1FHEA 1Z9HA 4MJCA 2YOIA 5FT3A 2ON5A 3W8SA 2LRTA 1TK8B 5F07A 5IMDA 1BJXA 2H71A 1B9XC 3SBCA 2I4AA 1YEPA 4JEDA 4MZBA 1XZOA 1MD4A 4TW5A 1W4VA 2J23A 2KUCA 4MCUA 3VWUA 1FOVA 3CSHA 1V40A 1Y1UA 1ZYPA 4ID0A 2C0EA 2IMDA 2GZZA 4I6XA 4ICYA 3CRTA 2PERA 1SKWB 4HU7A 3VPTA 4AJ8A 2A2SA 2FWGA 4RQXA 2PN8A 4IVFA 3UL3A 4GQFA 5IOXA 5J40A 1TI1A 1BG1A 3CTGA 3NZNA 1V57A 5COHA 2XHFA 2DMMA 3WYWA 4V1Ap 3ZL5A 3EE2A 3D4MA 2O7KA 1EGRA 4N10A 1XPVA 4RI7A 2C0DA 2HSMA 2CX4A 4N30A 3GHAA 3K8NA 3GH9A 1UN2A 2YV7A 1M99A 2WGRA 4TR1A 4BVYB 2ALBA 4LLRA 2V6OA 1TU7A 4DEJA 1PKWA 3E9JB 1OAZA 5EPFA 2KP1A 4PGTA 1Y25A 2G2QA 3IK9A 1X5CA 1F9MA 1PN0A 4TXOA 3F4SA 2JACA 1R4WA 1TK0B 4J2FA 4EDZA 5A4UA 2HFDA 3KH9A 3LORA 2NDOA 4IS0A 4ILFA 3IK7A 5CP1A 2MMAA 2I9HA 2O87A 5KN2A 1TU8A 4P3YB 3RPPA 2H0GA 2FD3A 1A23A 3H93A 3HXSA 1TJDA 2WB9A 2VD1A 5ECHB 2EFHA 2UZ8A 5KEJA 5AIXA 2YWIA 2OACA 1X5DA 1A8YA 2B5YA 4IQ1A 3A2VA 1THXA 3MDKA 4KE3A 2ZUPA 2D2ZA 4G0LA 3KTBA 3TDGA 5HFIA 4TKYA 2JSYA 2DJKA 4L0UA 2IJYA 1N25A 1PL2A 1GL8A 2R6KA 3ZFLA 3BCIA 3Q6OA 3PGTA 3GH6A 1XCCA 4EC0A 3V1WA 2L5OA 4AKGA 2FWEA 4CY8A 5CRHA 4MA9A 1M2DA 1HQOA 2OBIA 3ZITA 3DXBA 1XWKA 3CYNA 2CZ2A 3O6TA 3TKPA 1HNBA 5G1LA 3M0FA 4EVMA 3M9KA 1TRWA 2L4CA 3HY2A 4CDOA 3IR4A 4KSMA 3LW9A 2F51A 2B7JA 5BRTA 5CREA 4PQIA 3E3EA 3EMXA 3WD6A 4ZXGA 1EEJA 4WR5A 5JWQB 1PQNA 5CRWA 2K8VA 1PA3A 2L59A 4GLTA 4TXOB 1USBA 2ON7A 3FK8A 4F03A 2IWTA 1ZL9A 1Z6MA 4MMMA 4HZ4A 1A2MA 4XIHA 5KN1A 4HZ2A 2H0IA 1RW1A 1T4ZA 5E4WA 4ACSA 2AJQB 4L5LA 4YQMA 1G6YA 4KAEA 5IMZA 3GSTA 4Q5RA 1F3BA 2CZ3A 8GSSA 1SJZA 5ENUA 3TGZA 4LL4B 2JZTA 3Q74A 1PRXA 3VLNA 3L9UA 4BWSA 3GKKA 4AGSA 1AQWA 3HCZA 1YF1A 1SYXA 4NV5A 2PWJA 5DJMA 1M2BA 5ID2A 2AHEA 1NHYA 4I8BA 4GSNA 4EIPA 1HNAA 4FYBA 1F37A 3LG6A 1SU9A 5J3RA 1T7PB 1FVJA 1WMJA 5KN0A 4V2LA 3FZ4A 3GNJA 2LSTA 4HQZA 2PVQA 5FWGA 2C0FA 3DRNA 4HS1A 3HDCA 1QQ2A 1N2AA 2YWNA 3ERWA 3BCKA 6GSUA 3UEMA 3ZZXA 3MSZA 4JBBA 3RPNA 3L0HA 1TW9A 3TUEA 1SYRA 3KD0A 3VURA 1PN9A 3ZIVA 2HNLA 4OO4A 3KCMA 4YH2A 3FR6A 1BQ7A 4MPFA 1OKTA 4EDYA 3HKRA 5DAKA 1S3CA 2DLXA 1R5PA 4PX1A 2M80A 4TRXA 4NAXA 1SK1A 4AI6A 3P8WA 5EVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIO A;  2GST A;  5ECL B;  3CSJ A;  5HR1 A;  1TRS A;  1ZYE A;  3LWA A;  4NHZ A;  4V1A g;  3EIN A;  3QAG A;  2VL2 A;  2GS3 A;  3RHB A;  5J9C A;  2MMO A;  2C3T A;  3I43 A;  1RQM A;  1H4O A;  2K6V A;  3D22 A;  2CVB A;  2HRN A;  4HUA A;  1MDJ A;  2VM2 A;  2B5E A;  4OCF A;  3J7Y k;  4GRF A;  1TOF A;  3HJO A;  3L9S A;  1QFN A;  3Q19 A;  4LMW A;  4MZW A;  4MPG A;  2OE0 A;  1UC7 A;  5ID2 B;  4Q5N A;  1AUC A;  2IN3 A;  4K0N A;  1O73 A;  2YZH A;  1ZMA A;  1KBN A;  3DKS A;  4OD7 A;  5CRD A;  4ZB6 A;  2GSS A;  3UJ1 A;  1BYE A;  2H75 A;  2VLV A;  4ML6 A;  3ZMK A;  4YAV A;  2CVK A;  4QQ7 A;  1K0D A;  3F0I A;  3HVX A;  3M9J A;  5B6M A;  2GVP A;  1J08 A;  2H76 A;  1SL2 B;  3F9U A;  2CAI A;  5HQP A;  1ZCP A;  2C3Q A;  2F9S A;  4DVC A;  4K7N A;  3UVH A;  5DAK B;  4ECB A;  4PNG A;  2AUV A;  4V2N A;  1PD2 1;  3GUS A;  1U88 A;  2VL9 A;  3UAP A;  14GS A;  2K8S A;  4Q5F A;  4ZBB A;  4XS1 A;  2WCI A;  1URM A;  4TXV A;  4BPY A;  1XW6 A;  1M7T A;  3HA9 A;  5LNK e;  2O85 A;  2XPD A;  4XS6 A;  1DSB A;  3G7J A;  4OFM A;  4PUR A;  2LJK A;  4YQV A;  1OYJ A;  2X64 A;  1OC8 A;  1ZYQ B;  1PSQ A;  1MD3 A;  5ECP B;  5D96 A;  4K2D A;  1HNC A;  6GSY A;  1GLQ A;  1AC1 A;  1T1V A;  2CV4 A;  2EC4 A;  3FRC A;  4JR6 A;  3US3 A;  2FY6 A;  3HD5 A;  2DIZ A;  4XTS A;  4NMU A;  4F9Z A;  1FB6 A;  4XCS A;  4ZIJ A;  3IA1 A;  4EL1 A;  12GS A;  2HRF A;  3QOU A;  2LTK A;  1ERU A;  2E0Q A;  1K0M A;  3GTU B;  3VWV A;  2DJ0 A;  2V32 A;  2H19 A;  1G0T A;  1O85 A;  3EYT A;  4MP4 A;  2VCX A;  1JHB A;  1OC9 B;  4GTU A;  1RK4 A;  5GST A;  2IPA A;  1VF2 A;  4AJ6 A;  1DUG A;  5G31 A;  3DVW A;  4HOJ A;  2A2R A;  1Z5Y E;  1S3A A;  2LJR A;  2AB6 A;  2P31 A;  4DSR A;  1G6W A;  3KH7 A;  1B4Q A;  3UBL A;  4KND A;  4X43 A;  5DAL A;  1ON4 A;  2IMF A;  2L6C A;  4MH2 A;  1QGV A;  4O32 A;  17GS A;  2H72 A;  4JE1 A;  5F06 A;  1A8L A;  4OMV A;  1GH2 A;  3QFB C;  4L0W A;  1JZW A;  2LEG A;  5GZZ B;  2LV3 A;  3FHK A;  2YPM A;  4G0K A;  2DJJ A;  4K0G A;  2R37 A;  3QFA C;  3F6D A;  4Q5Q A;  2KLX A;  4ECJ A;  4GF0 A;  3W6G A;  4GQC A;  4FYC A;  5CNW A;  2IME A;  4G2E A;  5IMF A;  3IV4 A;  3HJM A;  3UAR A;  1WWJ A;  2PGT A;  4OCE A;  3WT1 A;  1XXU A;  2P5R A;  3HVV A;  3VI5 A;  1SD8 A;  4J57 E;  3DIE A;  1EV9 A;  3FR3 A;  3VPQ A;  5IO0 A;  5DCH A;  2JU5 A;  2O8V B;  1GSS A;  4IBP A;  5DBQ A;  3VWX A;  1X9W B;  1GLP A;  5DVB A;  2DJ1 A;  1EWX A;  1XWG A;  2H1A A;  3FZA A;  3KMO A;  2GTU A;  1B48 A;  1K3Y A;  3WGD A;  2C0G A;  2FWF A;  1FO5 A;  4HJM A;  1JZD A;  2P0G A;  7GSS A;  5CO3 A;  3GX0 A;  4IEL A;  4CHS A;  2R3X A;  3DD3 A;  4ZB8 A;  5DAL B;  4MJA A;  2N5F A;  1GNE A;  2MBT A;  4ECC A;  3FYG A;  2IFQ A;  3KGK A;  4BA7 A;  1V2A A;  1XVQ A;  2H1D A;  4MDC A;  1YZX A;  2GQL A;  1G7E A;  1GUL A;  1PMT A;  4XRA A;  3TJB A;  1XW9 A;  3ZFB A;  4QL7 A;  1M0U A;  3CRU A;  2HRK A;  3IE3 A;  4JU5 A;  1TP9 A;  2H66 A;  2X99 A;  3HVS A;  3NOF A;  5D9V A;  3LJR A;  1M9B A;  2K18 A;  1LU4 A;  1PKZ A;  4XHM A;  1X0R A;  5A4W A;  1UVZ A;  3I69 A;  2IMK A;  3TRQ A;  1K3O A;  3IC4 A;  4TOP A;  3ZIJ A;  3EC3 A;  4ULX A;  1GNW A;  4TN8 A;  3IBH A;  5IPH A;  3GSS A;  4POK A;  3BJ5 A;  2C80 A;  3D5J A;  5ECM B;  2GDR A;  2IIY A;  1O8X A;  4HU9 A;  3M1G A;  2YWM A;  1XOA A;  3HZ8 A;  1T3B A;  4K6X A;  1GWC A;  2MMZ A;  1OC3 A;  4MLY A;  1FB0 A;  1CQH A;  5DJL A;  1WJK A;  3DYR A;  3ZVJ A;  1GSQ A;  1JZR A;  2YV9 A;  2GT6 A;  3APS A;  4YAP A;  1DBY A;  1A0F A;  2OBK A;  4F0B A;  4K9Z A;  5IQY A;  2L4Q A;  3ZRD A;  4Z7X A;  3GUR A;  2DIY A;  5AIS A;  3KIJ A;  2TRX A;  2IFQ B;  1K0A A;  1GUH A;  2H8L A;  5EL8 A;  1KEB A;  1JZO A;  1ERW A;  4N0V A;  1OE8 A;  3ME7 A;  3GKN A;  2V1M A;  2HRK B;  4TR0 A;  4ZB9 A;  2BJX A;  1K0O A;  3QAV A;  4IQA A;  2MMN A;  4ZL9 A;  1EP7 A;  4RI6 A;  5H5R A;  4IW9 A;  4KCE A;  1AW9 A;  3RDW A;  4FYU A;  4KH7 A;  1V9W A;  4JR4 A;  3TB2 A;  4N11 A;  3GKX A;  3FR9 A;  2H6Z A;  2MYG A;  3IC8 A;  3EU3 A;  3GL5 A;  4JRR A;  5KN3 A;  1AAZ A;  2NVL A;  1K0C A;  3TKR A;  4IP1 A;  5DCG A;  1EOG A;  4G19 A;  5GSS A;  3PR8 A;  1YF0 A;  3VI7 A;  13GS A;  1TDI A;  1XWA A;  3UIW A;  6GSV A;  2O89 A;  3KP8 A;  3TCO A;  4ZBD A;  2PPT A;  1V98 A;  1OE7 A;  1Q98 A;  2JZR A;  1U3I A;  2VCQ A;  4OFT A;  5ELA A;  3ISO A;  2FCH A;  1FG4 A;  3FEU A;  3F4T A;  4HEA 2;  2VLU A;  4OO5 A;  1O81 A;  4IHU A;  4EO3 A;  2XPE A;  4IJI A;  1B8X A;  4NWY A;  5IPG A;  4KDU A;  2WUL A;  5IMC A;  2V41 A;  1VF1 A;  4IKH A;  5JCU A;  4PUF C;  4ISD A;  4KGI A;  2G0F A;  4FQU A;  22GS A;  2FLS A;  2WRT A;  2L57 A;  2EIQ A;  2L5L A;  4BVX B;  2XC2 A;  2OJL A;  4D73 B;  4YQU A;  3E0U A;  1GRX A;  2FA4 A;  3ZRE A;  5HR0 A;  2HSN B;  3S9F A;  20GS A;  2F8A A;  1Z3E A;  4MF5 A;  4J56 E;  4GSS A;  2HQT A;  5D9T A;  5H5S A;  3L4N A;  4TR4 A;  2VCV A;  1A0R P;  2H1B A;  2CAQ A;  4WXT A;  2J9H A;  4KF9 A;  1X5E A;  5ELG A;  4X0X A;  3LQ7 A;  3TKS C;  1WE0 A;  4ECI A;  1C72 A;  3IAM 2;  4KDX A;  2CQ9 A;  2X8C A;  2M46 A;  4F82 A;  1EOH A;  1TXX A;  5AIV A;  1EZK A;  1GSY A;  4E8H A;  3GFK A;  3I6A A;  1T8E B;  1A2L A;  4EUY A;  2B3S A;  3GTU A;  1AXD A;  3L9V A;  3BOA A;  3AY8 A;  5A5K A;  2X8H A;  2KP2 A;  1IYH A;  5ECK B;  2F3M A;  4MH3 A;  2DSA A;  1GSF A;  2FWH A;  5HFK A;  4EKZ A;  1TTZ A;  3N9J A;  5BMU A;  4HI7 A;  1Q4J A;  3F8U A;  1OC9 A;  3KJY A;  3LGC A;  3P7X A;  1ACV A;  2XBQ A;  2YN1 A;  4KW6 A;  3DEX A;  5G30 A;  3D6I A;  1U3A A;  1YY7 A;  3G7I A;  4OWY A;  1VGL A;  1QK8 A;  2PVO C;  3APO A;  1G7O A;  4FO5 A;  3IPZ A;  1VF4 A;  3DWV A;  3D0Z A;  2EIR A;  4G10 A;  2OE1 A;  5EY6 A;  5ECQ B;  5D8I A;  3TRP A;  2HZE A;  3FY7 A;  5INY A;  1VF3 A;  5F05 A;  2I3Y A;  1B4P A;  4MF6 A;  2H01 A;  4MJB A;  3Q18 A;  1OVN A;  4WEY A;  3M3M A;  1TKD B;  5CRG A;  2QC7 A;  3RAZ A;  2H6Y A;  3CTF A;  2JAD A;  2CX3 A;  2HRA A;  2BMX A;  2WDU A;  5LD0 A;  4QL9 A;  3ERF A;  5G5E A;  4ZL8 A;  5DQY A;  2YWO A;  3ZML A;  3C8E A;  3VFI A;  2WFC A;  4AJ7 A;  2K9F A;  4K1F A;  1GUM A;  3FW2 A;  1SD9 A;  2H74 A;  3QCP A;  3H79 A;  1DE2 A;  3HYP A;  4HDE A;  1WRY A;  2DBC A;  5AN1 A;  2GGT A;  4TVE A;  3ED3 A;  2R2J A;  2VM1 A;  3GYK A;  1QMV A;  2KHP A;  1J0F A;  4NHW A;  4KA0 A;  4O5R A;  4BL7 A;  4MF7 A;  1GTB A;  2PMT A;  3TOU A;  2H0H A;  4WBR D;  2TIR A;  5GAP D;  5ECI B;  1R26 A;  3DGQ A;  1NSW A;  5G1K A;  4EE0 A;  2WJU A;  3EUR A;  2TRC P;  2VUP A;  4RQR A;  4E8E A;  3LSZ A;  3QPM A;  2YCD A;  2HSH A;  2OA7 A;  2HZE B;  1SK0 A;  2VOC A;  2NTO A;  4NV2 A;  4POM A;  3LYP A;  5H5Q A;  1Z6N A;  3KM6 A;  4IJ3 A;  2DC5 A;  4MK3 A;  2I81 A;  1XFL A;  1W89 A;  1FVK A;  3FZ9 A;  3U6V A;  5HR2 A;  2GZP A;  2LNT A;  1GTU A;  2H30 A;  4K7I A;  2C8U A;  1O8W A;  3LEF A;  1KTE A;  3IRA A;  5C04 A;  1A2J A;  18GS A;  2ZCT A;  2GQK A;  4GWR A;  2LJA A;  2IL3 A;  1H75 A;  4X1U A;  4XS4 A;  1ZZY A;  1LJR A;  4GCI A;  1XWB A;  1GTA A;  4HQS A;  3RBT A;  1BX9 A;  1SJI A;  1GP1 A;  3TJG A;  1HD2 A;  1XOB A;  5D73 A;  5F0G A;  2HT9 A;  2LQO A;  1SL1 B;  3QDN A;  4OFN A;  4KUN A;  3EVI A;  3U5R E;  2N5A A;  2C3N A;  5B8B A;  2X8G A;  5B7C A;  5B8A A;  4MAB A;  1QXH A;  2CT6 A;  2VCW A;  4XRD A;  3PIN A;  5G5F A;  4KCA A;  3D4T A;  1UA5 A;  4BL7 B;  3GA4 A;  3MNG A;  4K7O A;  3GV1 A;  5ECO B;  3DML A;  1O6J A;  2JL4 A;  5JCG A;  1I5G A;  3GX8 A;  2JSZ A;  3C1R A;  4POL A;  4ZBA A;  3TOT A;  4WBJ A;  3ERG A;  2B1K A;  3WT2 A;  2PU9 C;  1X9M B;  1ABA A;  1ZOF A;  2B6M A;  3DVX A;  1YJ6 A;  3ZTL A;  4NXI A;  4CW9 A;  5IO2 A;  1YKC A;  2GSQ A;  3R3E A;  6GSS A;  3KMN A;  2B7K A;  3CMI A;  3QR6 A;  1MDK A;  1Z7R A;  2M72 A;  1F3A A;  3G9B A;  3KEB A;  2YNX A;  1FAA A;  11GS A;  1XIY A;  4WKW A;  3G7Y A;  2L6D A;  2VCZ A;  1A24 A;  5J5N A;  4TR3 A;  2RM6 A;  3TKQ A;  1NHO A;  4H86 A;  5IM9 A;  5JWO B;  3PPU A;  3BBY A;  2VLT A;  3UMA A;  5D93 A;  3GRX A;  4POB A;  4XS4 B;  3L78 A;  1WOU A;  5G2Z A;  2RUF A;  2FUG 2;  4ZIL A;  1E2Y A;  3TKS E;  3QMX A;  1PGT A;  16GS A;  1M2A A;  1ML6 A;  1U87 A;  2ES7 A;  1DE1 A;  2E2G A;  3GKM A;  1YEX A;  3NIV A;  2HLS A;  2PBJ A;  3EU4 A;  3A2X A;  3FKF A;  4RUV A;  4KSO A;  3UVT A;  1IYI A;  1GSU A;  3PH9 A;  1T00 A;  1JLW A;  4IGJ A;  4V2M A;  4EXJ A;  1ERT A;  2HSM B;  10GS A;  9GSS A;  5C00 A;  3CXG A;  4LL1 B;  1BAY A;  1R7H A;  1SK2 A;  2WS2 A;  3KXO A;  5DDL A;  2KOK A;  4BVX A;  4TR1 B;  1YQ1 A;  2YP6 A;  4WET A;  2FNO A;  3EWL A;  4D73 A;  4BWQ A;  1SL0 B;  3CBU A;  5AGY A;  1KNG A;  1TK5 B;  4F0C A;  3F6F A;  3D21 A;  4WF4 A;  1PX7 A;  2RM5 A;  4GST A;  1XWC A;  1EP8 A;  2F8F A;  2DJ2 A;  5IMA A;  1CQG A;  1ILO A;  1E6B A;  1JLV A;  3GL3 A;  6GSW A;  3KP9 A;  5B6N A;  5ECS A;  5A4V A;  2OE3 A;  2REM A;  1BG5 A;  3RHC A;  5JCW A;  1O7U A;  2GSR A;  2WZ9 A;  2VL2 C;  3ZLP A;  3JCM L;  4LA1 A;  2LQQ A;  3C71 A;  2LKU A;  5ABR A;  2H1G A;  2HXK A;  1YKA A;  1X9S B;  2PUK C;  3H8Q A;  4PNF A;  2OKA A;  5CAX A;  2LS5 A;  1M9A A;  4IN0 A;  1XVW A;  3IHQ A;  2RII A;  2HSY A;  1TRU A;  4G9H A;  1WIK A;  2YAN A;  6GSX A;  3P2A A;  2H70 A;  4PXO A;  2LRN A;  4MJE A;  1K0N A;  3A5W A;  1AQV A;  4KB3 A;  1WPI A;  4DSS A;  2YJ7 A;  4MZC A;  4ZL7 A;  4IP6 A;  19GS A;  1GUK A;  2QSI A;  5J4U A;  4GXZ A;  6GST A;  3O76 A;  1HYU A;  3O3T A;  3IXR A;  1GTI A;  2V2G A;  2R5G A;  1TI3 A;  1K0B A;  2DJ3 A;  2Z9S A;  5F8B A;  3A3T A;  1OKD A;  2XBI A;  4G0I A;  2LNS A;  1I9D A;  3GMF A;  1MEK A;  3TJJ A;  4L5O A;  2MZC A;  1XBS A;  4K8M A;  4EF0 A;  1LBK A;  5HFG A;  1SEN A;  3GN3 A;  3C73 A;  4I2U A;  3TRX A;  4FH8 A;  1N8J A;  4NPB A;  2HZF A;  1GSE A;  5JWR B;  4O92 A;  1Y6E A;  3ZVJ D;  3IAS 2;  3MAK A;  5E59 A;  1R5A A;  3WGX A;  3MWH A;  4PQ1 A;  2YJH A;  2C1Y A;  3CSI A;  2VCT A;  2GT5 A;  2AAW A;  3KZQ A;  2B5X A;  3F4R A;  2LUS A;  3HZ4 A;  1EEM A;  2VL3 A;  3VK9 A;  2YZU A;  1SKS B;  5D9X A;  2CVD A;  4L8E A;  4WR4 A;  5IIZ A;  3N5O A;  4PTS A;  1VRS D;  4O7H A;  2HI7 A;  4DSS B;  2E7P A;  1SJ6 A;  3F63 A;  2JZS A;  5FHI A;  2P5Q A;  3BD2 A;  2VO4 A;  1PL1 A;  2BTO T;  2DML A;  1MDI A;  3WGE A;  1PX6 A;  4I2T A;  2CA8 A;  3C1S A;  2VD0 A;  1U6T A;  3FZ5 A;  2HYX A;  2GZY A;  3J7Y b;  3EMP A;  4I5Q A;  1V58 A;  5HR3 A;  2MBS A;  1TRV A;  3HJP A;  3TJF A;  2FGX A;  4USS A;  1S3D A;  1J9B A;  1EV4 A;  3KTL A;  3TKS A;  3GIX A;  1FW1 A;  2H6X A;  1WP0 A;  3QD9 A;  4AF2 A;  4WF5 A;  1ZGN A;  2ZNM A;  1MTC A;  4ML1 A;  2NBS A;  2H73 A;  5CYY A;  5J41 A;  3VWW A;  3C7M A;  2LRC A;  2V6K A;  4HJ2 A;  1NW2 A;  2NPB A;  3M8N A;  4KDY A;  2GLR A;  5DQS A;  1ST9 A;  1Z7P A;  1AIU A;  3ZYW A;  3H1N A;  5L71 A;  2GQM A;  2VIM A;  5LCZ A;  4PUA A;  3LXT A;  2C4J A;  2FHE A;  3LYK A;  2A4V A;  3QAW A;  3ME8 A;  5D9W A;  1QUW A;  1BED A;  2HE3 A;  3HHV A;  1ERV A;  3UBK A;  3LFL A;  3OR5 A;  1B9Y C;  1XW5 A;  4F2I A;  2AYT A;  4KX4 A;  3P90 A;  4PQH A;  5ECN B;  3APQ A;  2QGV A;  3F3R A;  1AQX A;  5IMV A;  1T4Y A;  2N5B A;  2FA8 A;  1JFU A;  3R2Q A;  2RUE A;  2I1U A;  1EGO A;  3TJK A;  3F3Q A;  2IMI A;  3IDV A;  3UOM A;  1F6M C;  1NM3 A;  1THO A;  3W8J A;  2B1L A;  5GAN D;  1GSD A;  3A2W A;  2AV4 A;  2R4V A;  2RLI A;  3H4K A;  4JZQ A;  3LXZ A;  1SKR B;  5ECR B;  5J9B A;  4N0Z A;  4DSQ A;  2QKE A;  2OAD A;  3I9V 2;  2VAF A;  1YDK A;  5IOW A;  4BVY A;  4FIW A;  3SWL A;  1K3L A;  3IOS A;  4I97 A;  4LMV A;  1F2E A;  2E2M A;  1FHE A;  1Z9H A;  4MJC A;  2YOI A;  5FT3 A;  2ON5 A;  3W8S A;  2LRT A;  1TK8 B;  5F07 A;  5IMD A;  1BJX A;  2H71 A;  1B9X C;  3SBC A;  2I4A A;  1YEP A;  4JED A;  4MZB A;  1XZO A;  1MD4 A;  4TW5 A;  1W4V A;  2J23 A;  2KUC A;  4MCU A;  3VWU A;  1FOV A;  3CSH A;  1V40 A;  4ID0 A;  2C0E A;  2IMD A;  2GZZ A;  4I6X A;  3CRT A;  2PER A;  1SKW B;  4HU7 A;  3VPT A;  4AJ8 A;  2A2S A;  2FWG A;  4RQX A;  2PN8 A;  4IVF A;  3UL3 A;  4GQF A;  5IOX A;  1TI1 A;  3CTG A;  3NZN A;  1V57 A;  5COH A;  2XHF A;  2DMM A;  3WYW A;  4V1A p;  3ZL5 A;  3EE2 A;  3D4M A;  2O7K A;  1EGR A;  4N10 A;  1XPV A;  4RI7 A;  2C0D A;  2HSM A;  2CX4 A;  4N30 A;  3GHA A;  3K8N A;  3GH9 A;  1UN2 A;  2YV7 A;  1M99 A;  2WGR A;  4TR1 A;  4BVY B;  2ALB A;  4LLR A;  2V6O A;  1TU7 A;  4DEJ A;  1PKW A;  3E9J B;  1OAZ A;  5EPF A;  2KP1 A;  4PGT A;  1Y25 A;  2G2Q A;  3IK9 A;  1X5C A;  1F9M A;  4TXO A;  3F4S A;  2JAC A;  1R4W A;  1TK0 B;  4J2F A;  4EDZ A;  5A4U A;  2HFD A;  3KH9 A;  3LOR A;  2NDO A;  4IS0 A;  4ILF A;  3IK7 A;  5CP1 A;  2MMA A;  2I9H A;  2O87 A;  5KN2 A;  1TU8 A;  4P3Y B;  3RPP A;  2H0G A;  2FD3 A;  1A23 A;  3H93 A;  3HXS A;  1TJD A;  2WB9 A;  2VD1 A;  5ECH B;  2UZ8 A;  5KEJ A;  5AIX A;  2YWI A;  2OAC A;  1X5D A;  1A8Y A;  2B5Y A;  4IQ1 A;  3A2V A;  1THX A;  3MDK A;  4KE3 A;  2ZUP A;  2D2Z A;  4G0L A;  3KTB A;  3TDG A;  5HFI A;  4TKY A;  2JSY A;  2DJK A;  4L0U A;  2IJY A;  1PL2 A;  1GL8 A;  2R6K A;  3ZFL A;  3BCI A;  3Q6O A;  3PGT A;  3GH6 A;  1XCC A;  4EC0 A;  3V1W A;  2L5O A;  2FWE A;  5CRH A;  4MA9 A;  1M2D A;  1HQO A;  2OBI A;  3ZIT A;  3DXB A;  1XWK A;  3CYN A;  2CZ2 A;  3O6T A;  3TKP A;  1HNB A;  5G1L A;  3M0F A;  4EVM A;  3M9K A;  1TRW A;  2L4C A;  3HY2 A;  4CDO A;  3IR4 A;  4KSM A;  2F51 A;  2B7J A;  5CRE A;  4PQI A;  3E3E A;  3EMX A;  3WD6 A;  4ZXG A;  1EEJ A;  4WR5 A;  5JWQ B;  1PQN A;  5CRW A;  2K8V A;  1PA3 A;  2L59 A;  4GLT A;  4TXO B;  1USB A;  2ON7 A;  3FK8 A;  4F03 A;  2IWT A;  1ZL9 A;  1Z6M A;  4MMM A;  4HZ4 A;  1A2M A;  4XIH A;  5KN1 A;  4HZ2 A;  2H0I A;  1RW1 A;  1T4Z A;  5E4W A;  4ACS A;  2AJQ B;  4L5L A;  4YQM A;  1G6Y A;  4KAE A;  5IMZ A;  3GST A;  4Q5R A;  1F3B A;  2CZ3 A;  8GSS A;  1SJZ A;  5ENU A;  3TGZ A;  4LL4 B;  2JZT A;  3Q74 A;  1PRX A;  3VLN A;  3L9U A;  4BWS A;  3GKK A;  4AGS A;  1AQW A;  3HCZ A;  1YF1 A;  1SYX A;  4NV5 A;  2PWJ A;  5DJM A;  1M2B A;  5ID2 A;  2AHE A;  1NHY A;  4I8B A;  4GSN A;  1HNA A;  4FYB A;  1F37 A;  3LG6 A;  1SU9 A;  5J3R A;  1T7P B;  1FVJ A;  1WMJ A;  5KN0 A;  4V2L A;  3FZ4 A;  3GNJ A;  2LST A;  4HQZ A;  2PVQ A;  5FWG A;  2C0F A;  3DRN A;  4HS1 A;  3HDC A;  1QQ2 A;  1N2A A;  2YWN A;  3ERW A;  3BCK A;  6GSU A;  3UEM A;  3ZZX A;  3MSZ A;  4JBB A;  3RPN A;  3L0H A;  1TW9 A;  3TUE A;  1SYR A;  3KD0 A;  3VUR A;  1PN9 A;  3ZIV A;  2HNL A;  4OO4 A;  3KCM A;  4YH2 A;  3FR6 A;  1BQ7 A;  4MPF A;  1OKT A;  4EDY A;  3HKR A;  5DAK A;  1S3C A;  2DLX A;  1R5P A;  4PX1 A;  2M80 A;  4TRX A;  4NAX A;  1SK1 A;  3P8W A;  5EVO A; 
#chains in the Genus database with same CATH topology
 2EIO A;  2GST A;  5ECL B;  3CSJ A;  2X49 A;  5HR1 A;  1TRS A;  1ZYE A;  3LWA A;  4NHZ A;  4V1A g;  3EIN A;  3QAG A;  2VL2 A;  2GS3 A;  3RHB A;  5J9C A;  2MMO A;  2C3T A;  3I43 A;  1RQM A;  1H4O A;  2R0C A;  2K6V A;  3D22 A;  2CVB A;  2HRN A;  4HUA A;  1MDJ A;  2VM2 A;  2B5E A;  4OCF A;  3J7Y k;  4PI0 C;  4GRF A;  1TOF A;  3HJO A;  3L9S A;  1QFN A;  4G01 A;  3Q19 A;  4LMW A;  4MZW A;  4MPG A;  2OE0 A;  1UC7 A;  5ID2 B;  4Q5N A;  5A34 A;  1AUC A;  2IN3 A;  4K0N A;  1O73 A;  2YZH A;  1ZMA A;  1KBN A;  3DKS A;  4OD7 A;  5CRD A;  4ZB6 A;  2GSS A;  3TU3 B;  3UJ1 A;  4A5P A;  1BYE A;  2H75 A;  2VLV A;  4ML6 A;  3ZMK A;  4YAV A;  2CVK A;  4QQ7 A;  1K0D A;  3F0I A;  3HVX A;  3M9J A;  5B6M A;  2GVP A;  1J08 A;  2H76 A;  1SL2 B;  1M3I A;  3F9U A;  2CAI A;  4CY6 A;  4AKI A;  5HQP A;  1ZCP A;  2C3Q A;  2F9S A;  4DVC A;  4K7N A;  3UVH A;  5DAK B;  4ECB A;  4PNG A;  2AUV A;  4V2N A;  1PD2 1;  3GUS A;  1U88 A;  2VL9 A;  3UAP A;  14GS A;  2K8S A;  4Q5F A;  4ZBB A;  4XS1 A;  2WCI A;  1URM A;  4TXV A;  2A4H A;  4BPY A;  1XW6 A;  1M7T A;  3HA9 A;  5LNK e;  2O85 A;  2XPD A;  4XS6 A;  1DSB A;  3G7J A;  4OFM A;  4PUR A;  2LJK A;  4YQV A;  1OYJ A;  2X64 A;  1OC8 A;  1ZYQ B;  1PSQ A;  1MD3 A;  5ECP B;  5D96 A;  4K2D A;  1HNC A;  6GSY A;  1GLQ A;  1AC1 A;  1T1V A;  2CV4 A;  2EC4 A;  3FRC A;  5J4V A;  4JR6 A;  3US3 A;  2FY6 A;  3HD5 A;  2DIZ A;  4XTS A;  4NMU A;  4F9Z A;  1FB6 A;  4XCS A;  4ZIJ A;  3IA1 A;  4EL1 A;  4AKX B;  12GS A;  2HRF A;  3QOU A;  2LTK A;  1ERU A;  2E0Q A;  1K0M A;  3GTU B;  3VWV A;  2DJ0 A;  2V32 A;  2H19 A;  1G0T A;  1PFO A;  1O85 A;  3EYT A;  4MP4 A;  5BMU B;  2VCX A;  1JHB A;  1OC9 B;  4GTU A;  1RK4 A;  5GST A;  2IPA A;  1VF2 A;  4AJ6 A;  1DUG A;  5G31 A;  3DVW A;  4HOJ A;  2A2R A;  1Z5Y E;  1S3A A;  2LJR A;  2AB6 A;  2WZS A;  2P31 A;  4DSR A;  1G6W A;  3KH7 A;  1B4Q A;  3UBL A;  4KND A;  4X43 A;  3MIX A;  5DAL A;  1ON4 A;  2IMF A;  2L6C A;  4MH2 A;  1QGV A;  4O32 A;  17GS A;  2H72 A;  4JE1 A;  5F06 A;  1A8L A;  4OMV A;  3RGB C;  3MYD A;  1GH2 A;  1M3J A;  3QFB C;  4L0W A;  1JZW A;  2LEG A;  5GZZ B;  2LV3 A;  3FHK A;  2YPM A;  4G0K A;  2WVX A;  4E68 A;  2DJJ A;  4K0G A;  2R0G A;  2R37 A;  3QFA C;  3F6D A;  4Q5Q A;  2KLX A;  4ECJ A;  4GF0 A;  3W6G A;  4GQC A;  4FYC A;  5CNW A;  2IME A;  4G2E A;  5IMF A;  3IV4 A;  3HJM A;  3UAR A;  1WWJ A;  2PGT A;  4OCE A;  3WT1 A;  1XXU A;  2P5R A;  3HVV A;  3VI5 A;  1SD8 A;  4J57 E;  3DIE A;  1EV9 A;  3FR3 A;  3VPQ A;  5IO0 A;  5DCH A;  2JU5 A;  2O8V B;  1GSS A;  4IBP A;  5DBQ A;  3VWX A;  1X9W B;  1GLP A;  5DVB A;  2DJ1 A;  1EWX A;  1XWG A;  2H1A A;  3FZA A;  3KMO A;  2GTU A;  1B48 A;  1K3Y A;  3WGD A;  2C0G A;  2FWF A;  1FO5 A;  4HJM A;  1JZD A;  2P0G A;  7GSS A;  5CO3 A;  3GX0 A;  4IEL A;  4CHS A;  4AKH A;  2R3X A;  3DD3 A;  4ZB8 A;  5DAL B;  4K5R A;  4MJA A;  2N5F A;  1GNE A;  2MBT A;  4ECC A;  3FYG A;  2IFQ A;  3KGK A;  4BA7 A;  1V2A A;  1XVQ A;  2WVZ A;  2H1D A;  4MDC A;  1YZX A;  2GQL A;  1G7E A;  1GUL A;  1PMT A;  4XRA A;  3TJB A;  1XW9 A;  3ZFB A;  4QL7 A;  1M0U A;  3CRU A;  2HRK A;  3IE3 A;  4JU5 A;  1TP9 A;  2H66 A;  2OT3 A;  2X99 A;  1XG8 A;  3HVS A;  3NOF A;  5D9V A;  3LJR A;  1M9B A;  2WW1 A;  2K18 A;  1LU4 A;  1PKZ A;  4XHM A;  2O5V A;  1X0R A;  5A4W A;  1UVZ A;  3I69 A;  2IMK A;  3TRQ A;  1K3O A;  3IC4 A;  5A5H B;  4TOP A;  3ZIJ A;  3EC3 A;  4ULX A;  1GNW A;  4TN8 A;  3IBH A;  5IPH A;  3GSS A;  4POK A;  3BJ5 A;  2C80 A;  3D5J A;  5ECM B;  2GDR A;  2IIY A;  1O8X A;  4HU9 A;  2H1L A;  2A2P A;  3M1G A;  2YWM A;  1XOA A;  3HZ8 A;  5KOW A;  1T3B A;  4K6X A;  1GWC A;  2MMZ A;  1OC3 A;  4MLY A;  1FB0 A;  1CQH A;  5DJL A;  1WJK A;  3DYR A;  3ZVJ A;  1GSQ A;  1JZR A;  2YV9 A;  2GT6 A;  3APS A;  4YAP A;  1DBY A;  1A0F A;  2OBK A;  4F0B A;  4K9Z A;  5IQY A;  2L4Q A;  3ZRD A;  2DKI A;  4Z7X A;  3GUR A;  2VKZ G;  2DIY A;  5AIS A;  3KIJ A;  2TRX A;  2IFQ B;  1K0A A;  1GUH A;  3CQF A;  2H8L A;  5EL8 A;  1KEB A;  1JZO A;  1ERW A;  4N0V A;  1OE8 A;  3ME7 A;  3GKN A;  1TXU A;  2V1M A;  2HRK B;  4TR0 A;  4ZB9 A;  2BJX A;  1BF5 A;  1K0O A;  3QAV A;  4IQA A;  2MMN A;  4ZL9 A;  4K2X A;  1EP7 A;  4RI6 A;  4YKG A;  5H5R A;  4IW9 A;  4KCE A;  1AW9 A;  3RDW A;  4FYU A;  4KH7 A;  1V9W A;  4JR4 A;  3TB2 A;  4N11 A;  3GKX A;  3FR9 A;  2H6Z A;  2MYG A;  3IC8 A;  3EU3 A;  3GL5 A;  4JRR A;  5KN3 A;  1AAZ A;  2NVL A;  1K0C A;  3TKR A;  4IP1 A;  5DCG A;  1EOG A;  4G19 A;  5GSS A;  3PR8 A;  1YF0 A;  3VI7 A;  13GS A;  1TDI A;  1XWA A;  3UIW A;  6GSV A;  2O89 A;  3KP8 A;  3TCO A;  4ZBD A;  2PPT A;  1V98 A;  1OE7 A;  1Q98 A;  2JZR A;  1U3I A;  2VCQ A;  4OFT A;  5ELA A;  3ISO A;  2FCH A;  1FG4 A;  3FEU A;  3F4T A;  4HEA 2;  2VLU A;  4OO5 A;  1O81 A;  4IHU A;  4EO3 A;  2XPE A;  4IJI A;  1B8X A;  4NWY A;  5IPG A;  4KDU A;  2WUL A;  5IMC A;  2V41 A;  1VF1 A;  4IKH A;  5JCU A;  4PUF C;  4ISD A;  4KGI A;  2G0F A;  4FQU A;  22GS A;  2FLS A;  2WRT A;  2L57 A;  2EIQ A;  2L5L A;  3CHX C;  4BVX B;  2XC2 A;  2OJL A;  4D73 B;  4YQU A;  4ZB7 A;  3E0U A;  1GRX A;  2FA4 A;  3ZRE A;  1ZYN A;  5HR0 A;  2HSN B;  3S9F A;  20GS A;  2F8A A;  1Z3E A;  4MF5 A;  4J56 E;  4GSS A;  2HQT A;  5D9T A;  5H5S A;  3L4N A;  4TR4 A;  2VCV A;  1A0R P;  4EIQ A;  2H1B A;  2CAQ A;  4WXT A;  2J9H A;  4KF9 A;  1X5E A;  5ELG A;  3A5I A;  4X0X A;  3LQ7 A;  3TKS C;  4Z2T A;  1WE0 A;  4ECI A;  1C72 A;  3IAM 2;  2EFC A;  4KDX A;  2CQ9 A;  2X8C A;  2M46 A;  4F82 A;  1EOH A;  1TXX A;  5AIV A;  1EZK A;  1GSY A;  4E8H A;  3GFK A;  3I6A A;  1T8E B;  4N3Z A;  1A2L A;  4EUY A;  2B3S A;  3GTU A;  1AXD A;  3L9V A;  3BOA A;  3AY8 A;  5A5K A;  2X8H A;  2KP2 A;  1IYH A;  5ECK B;  2F3M A;  4MH3 A;  2DSA A;  1GSF A;  2FWH A;  5HFK A;  4EKZ A;  1TTZ A;  3N9J A;  5BMU A;  4HI7 A;  1Q4J A;  3F8U A;  4O5U A;  1OC9 A;  2O36 A;  3KJY A;  3LGC A;  3P7X A;  1ACV A;  2XBQ A;  2YN1 A;  4KW6 A;  3DEX A;  5G30 A;  3D6I A;  1U3A A;  1YY7 A;  3G7I A;  4OWY A;  1VGL A;  1QK8 A;  2PVO C;  3APO A;  1G7O A;  4FO5 A;  3IPZ A;  1VF4 A;  3DWV A;  3D0Z A;  2WVY A;  2EIR A;  4G10 A;  2OE1 A;  5EY6 A;  5ECQ B;  5D8I A;  2EFD A;  3TRP A;  2HZE A;  3FY7 A;  5INY A;  1VF3 A;  2WW2 A;  5F05 A;  2I3Y A;  1B4P A;  4MF6 A;  2H01 A;  2WW0 A;  4MJB A;  3Q18 A;  1OVN A;  4WEY A;  3M3M A;  1TKD B;  5CRG A;  2QC7 A;  3RAZ A;  2H6Y A;  3CTF A;  4FXY P;  2JAD A;  2CX3 A;  2HRA A;  2BMX A;  2WDU A;  5LD0 A;  4QL9 A;  3ERF A;  5G5E A;  4ZL8 A;  5DQY A;  4X4J A;  2YWO A;  3ZML A;  3C8E A;  3VFI A;  2WFC A;  4AJ7 A;  2K9F A;  4K1F A;  1GUM A;  3FW2 A;  1SD9 A;  2H74 A;  3QCP A;  3H79 A;  1DE2 A;  3HYP A;  4HDE A;  1WRY A;  2DBC A;  5AN1 A;  2GGT A;  4TVE A;  3ED3 A;  2R2J A;  2VM1 A;  3GYK A;  1QMV A;  2WW3 A;  2KHP A;  1J0F A;  4NHW A;  4KA0 A;  1YEW C;  4O5R A;  4BL7 A;  4MF7 A;  1GTB A;  2PMT A;  3TOU A;  2H0H A;  4WBR D;  2TIR A;  5GAP D;  5ECI B;  1R26 A;  3DGQ A;  5A1N B;  1NSW A;  5G1K A;  4EE0 A;  2WJU A;  3EUR A;  1S4B P;  2TRC P;  2VUP A;  4RQR A;  4E8E A;  3LSZ A;  3QPM A;  2YCD A;  2HSH A;  2OA7 A;  2HZE B;  1SK0 A;  2VOC A;  2NTO A;  4NV2 A;  4POM A;  3LYP A;  5H5Q A;  1Z6N A;  3KM6 A;  4IJ3 A;  2DC5 A;  4MK3 A;  2I81 A;  1XFL A;  1W89 A;  1FVK A;  3FZ9 A;  3U6V A;  4MNN A;  5HR2 A;  4PHZ C;  2GZP A;  2LNT A;  1GTU A;  2H30 A;  4K7I A;  2C8U A;  1O8W A;  3LEF A;  1KTE A;  3IRA A;  5C04 A;  1A2J A;  18GS A;  2ZCT A;  2GQK A;  4GWR A;  5A5H A;  2LJA A;  2IL3 A;  1H75 A;  4X1U A;  4XS4 A;  1ZZY A;  1LJR A;  4GCI A;  1XWB A;  1GTA A;  4HQS A;  3RBT A;  1BX9 A;  1SJI A;  1GP1 A;  3TJG A;  1HD2 A;  1XOB A;  5D73 A;  5F0G A;  2HT9 A;  2LQO A;  1SL1 B;  3QDN A;  4OFN A;  4KUN A;  3EVI A;  3U5R E;  2N5A A;  2C3N A;  5B8B A;  2X8G A;  5B7C A;  5B8A A;  4MAB A;  1QXH A;  2CT6 A;  2VCW A;  4XRD A;  3PIN A;  5G5F A;  4KCA A;  3D4T A;  1UA5 A;  4BL7 B;  3GA4 A;  3MNG A;  4K7O A;  3GV1 A;  5ECO B;  3DML A;  1O6J A;  2JL4 A;  5JCG A;  1I5G A;  3GX8 A;  2JSZ A;  3C1R A;  4POL A;  4ZBA A;  3TOT A;  4WBJ A;  4QMK A;  3ERG A;  4BIK A;  2B1K A;  3WT2 A;  5KOX A;  2PU9 C;  1X9M B;  1ABA A;  1ZOF A;  2B6M A;  3DVX A;  1YJ6 A;  3ZTL A;  4NXI A;  4CW9 A;  5IO2 A;  1YKC A;  2GSQ A;  3R3E A;  6GSS A;  3KMN A;  2B7K A;  3CMI A;  3QR6 A;  1MDK A;  1Z7R A;  2M72 A;  1F3A A;  3G9B A;  3KEB A;  2YNX A;  1FAA A;  11GS A;  1XIY A;  4WKW A;  3G7Y A;  2L6D A;  2VCZ A;  1A24 A;  5J5N A;  4TR3 A;  2RM6 A;  3TKQ A;  5J47 A;  1NHO A;  4H86 A;  5IM9 A;  5JWO B;  3PPU A;  3BBY A;  2VLT A;  3UMA A;  5D93 A;  3GRX A;  4POB A;  4XS4 B;  3L78 A;  1WOU A;  5G2Z A;  2RUF A;  2FUG 2;  4ZIL A;  1E2Y A;  3TKS E;  3QMX A;  1PGT A;  2DKH A;  16GS A;  1M2A A;  1ML6 A;  1U87 A;  2ES7 A;  1DE1 A;  2E2G A;  1I1I P;  3GKM A;  1YEX A;  3NIV A;  2HLS A;  2QA2 A;  2PBJ A;  3EU4 A;  3A2X A;  3FKF A;  4RUV A;  4KSO A;  3UVT A;  1IYI A;  1GSU A;  3PH9 A;  1T00 A;  1JLW A;  4IGJ A;  4V2M A;  4Z2U A;  4EXJ A;  1ERT A;  2HSM B;  10GS A;  9GSS A;  5C00 A;  3CXG A;  2R0P A;  4LL1 B;  1BAY A;  1R7H A;  1SK2 A;  2WS2 A;  3KXO A;  5DDL A;  2KOK A;  4BVX A;  4TR1 B;  1YQ1 A;  2YP6 A;  4WET A;  2FNO A;  3EWL A;  4D73 A;  4BWQ A;  1SL0 B;  3CBU A;  5AGY A;  1KNG A;  1TK5 B;  4F0C A;  2HSN A;  3F6F A;  1SVL A;  3D21 A;  1YVL A;  4WF4 A;  3FMW A;  1PX7 A;  2RM5 A;  4GST A;  1XWC A;  1EP8 A;  2F8F A;  2DJ2 A;  5IMA A;  1CQG A;  1ILO A;  1E6B A;  1JLV A;  3GL3 A;  6GSW A;  3KP9 A;  5B6N A;  5ECS A;  5A4V A;  2OE3 A;  2REM A;  1BG5 A;  3RHC A;  5JCW A;  4W66 A;  1O7U A;  2GSR A;  2WZ9 A;  2VL2 C;  3ZLP A;  3JCM L;  4LA1 A;  2LQQ A;  3C71 A;  2LKU A;  5ABR A;  2H1G A;  2HXK A;  1YKA A;  1X9S B;  2PUK C;  3H8Q A;  4PNF A;  2OKA A;  2EFE A;  5CAX A;  2LS5 A;  1M9A A;  1XVW A;  4IN0 A;  3IHQ A;  2RII A;  2HSY A;  1TRU A;  4G9H A;  1WIK A;  2YAN A;  2X4A A;  6GSX A;  3P2A A;  2H70 A;  4PXO A;  2LRN A;  4MJE A;  1K0N A;  3A5W A;  1AQV A;  4KB3 A;  1WPI A;  4DSS A;  2YJ7 A;  4MZC A;  4ZL7 A;  4IP6 A;  19GS A;  1GUK A;  1FOH A;  2QSI A;  5J4U A;  4GXZ A;  6GST A;  3O76 A;  1HYU A;  3O3T A;  3IXR A;  1GTI A;  2V2G A;  2R5G A;  1TI3 A;  1K0B A;  2DJ3 A;  2Z9S A;  5F8B A;  3A3T A;  1OKD A;  2XBI A;  4G0I A;  2LNS A;  1I9D A;  3GMF A;  1MEK A;  3TJJ A;  4GDF A;  4L5O A;  2MZC A;  1XBS A;  4K8M A;  4EF0 A;  1LBK A;  5HFG A;  1SEN A;  3GN3 A;  3C73 A;  4I2U A;  3TRX A;  4FH8 A;  1N8J A;  4NPB A;  2HZF A;  4O5Q A;  1GSE A;  5JWR B;  4O92 A;  1Y6E A;  3ZVJ D;  3IAS 2;  3MAK A;  5E59 A;  1R5A A;  3WGX A;  3MWH A;  4PQ1 A;  2YJH A;  2C1Y A;  3CSI A;  2VCT A;  2GT5 A;  2AAW A;  3KZQ A;  2B5X A;  3F4R A;  2LUS A;  3HZ4 A;  1EEM A;  2VL3 A;  3VK9 A;  2YZU A;  1SKS B;  5D9X A;  2CVD A;  4L8E A;  4WR4 A;  5IIZ A;  3N5O A;  4PTS A;  1VRS D;  4O7H A;  2HI7 A;  4DSS B;  2E7P A;  1SJ6 A;  3F63 A;  2JZS A;  5FHI A;  2P5Q A;  3BD2 A;  2VO4 A;  1PL1 A;  2BTO T;  2DML A;  1MDI A;  3WGE A;  1PX6 A;  4I2T A;  2CA8 A;  3C1S A;  2VD0 A;  1U6T A;  3FZ5 A;  2HYX A;  1SVO A;  2GZY A;  5A1N A;  3J7Y b;  3EMP A;  4I5Q A;  1V58 A;  5HR3 A;  2MBS A;  1TRV A;  3HJP A;  3TJF A;  2FGX A;  4USS A;  3EPT A;  1S3D A;  1J9B A;  1EV4 A;  2QA1 A;  3KTL A;  3TKS A;  3GIX A;  1FW1 A;  2H6X A;  1WP0 A;  3QD9 A;  4AF2 A;  4WF5 A;  1SVM A;  1ZGN A;  2ZNM A;  1MTC A;  4ML1 A;  2NBS A;  3IHG A;  2H73 A;  5CYY A;  5J41 A;  3VWW A;  3C7M A;  2LRC A;  2V6K A;  4HJ2 A;  1NW2 A;  2NPB A;  3M8N A;  4KDY A;  4PI2 C;  2GLR A;  4K5S A;  5DQS A;  1ST9 A;  4Z2R A;  1Z7P A;  1AIU A;  3ZYW A;  3H1N A;  5L71 A;  2GQM A;  2VIM A;  5LCZ A;  4PUA A;  3LXT A;  2C4J A;  2FHE A;  3LYK A;  2A4V A;  3QAW A;  3ME8 A;  5D9W A;  1QUW A;  1BED A;  2HE3 A;  3HHV A;  5A34 B;  1ERV A;  3UBK A;  3LFL A;  3OR5 A;  4HSC X;  1B9Y C;  1XW5 A;  4F2I A;  2AYT A;  4KX4 A;  3P90 A;  4PQH A;  5ECN B;  3APQ A;  2QGV A;  3F3R A;  1AQX A;  5IMV A;  1T4Y A;  2N5B A;  2FA8 A;  1JFU A;  3R2Q A;  2RUE A;  2I1U A;  1EGO A;  3TJK A;  3F3Q A;  2IMI A;  3IDV A;  3UOM A;  1F6M C;  1NM3 A;  5J4Y A;  1THO A;  3W8J A;  2B1L A;  5GAN D;  1GSD A;  4YKF A;  3A2W A;  2AV4 A;  2R4V A;  2RLI A;  3H4K A;  4JZQ A;  3LXZ A;  1SKR B;  5ECR B;  5J9B A;  4N0Z A;  4DSQ A;  2QKE A;  2OAD A;  2UV8 G;  3I9V 2;  2VAF A;  1YDK A;  5IOW A;  3CWG A;  4BVY A;  4FIW A;  3HMJ G;  3SWL A;  1K3L A;  3IOS A;  4I97 A;  4LMV A;  1F2E A;  2E2M A;  1FHE A;  1Z9H A;  4MJC A;  2YOI A;  5FT3 A;  2ON5 A;  3W8S A;  2LRT A;  1TK8 B;  5F07 A;  5IMD A;  1BJX A;  2H71 A;  1B9X C;  3SBC A;  3RFR C;  2I4A A;  1YEP A;  4JED A;  4MZB A;  1XZO A;  1MD4 A;  4TW5 A;  1W4V A;  2J23 A;  2KUC A;  4MCU A;  3VWU A;  1FOV A;  3CSH A;  1V40 A;  1Y1U A;  1ZYP A;  4ID0 A;  2C0E A;  2IMD A;  2O3E A;  2GZZ A;  4I6X A;  4ICY A;  3CRT A;  2PER A;  1SKW B;  4HU7 A;  3VPT A;  4AJ8 A;  2A2S A;  2FWG A;  4RQX A;  2PN8 A;  4IVF A;  3UL3 A;  4GQF A;  5IOX A;  5J40 A;  1TI1 A;  1BG1 A;  3CTG A;  3NZN A;  1V57 A;  5COH A;  2XHF A;  2DMM A;  3WYW A;  4V1A p;  3ZL5 A;  3EE2 A;  3D4M A;  2O7K A;  1EGR A;  4N10 A;  1XPV A;  4RI7 A;  2C0D A;  2HSM A;  2CX4 A;  4N30 A;  3GHA A;  3K8N A;  3GH9 A;  1UN2 A;  2YV7 A;  1M99 A;  1S3R A;  2WGR A;  4TR1 A;  4BVY B;  2ALB A;  4LLR A;  2V6O A;  1TU7 A;  4DEJ A;  1PKW A;  3E9J B;  1OAZ A;  5EPF A;  2WVX B;  2KP1 A;  4PGT A;  1Y25 A;  2G2Q A;  3IK9 A;  1X5C A;  1F9M A;  1PN0 A;  4TXO A;  3F4S A;  2JAC A;  1R4W A;  1TK0 B;  4J2F A;  4EDZ A;  5A4U A;  2HFD A;  3KH9 A;  3LOR A;  2NDO A;  4IS0 A;  4ILF A;  3IK7 A;  5CP1 A;  2MMA A;  2I9H A;  2O87 A;  5KN2 A;  1TU8 A;  4P3Y B;  3RPP A;  2H0G A;  2FD3 A;  1A23 A;  3H93 A;  3HXS A;  1TJD A;  2WB9 A;  2VD1 A;  5ECH B;  2EFH A;  2UZ8 A;  5KEJ A;  5AIX A;  2YWI A;  2OAC A;  1X5D A;  1A8Y A;  2B5Y A;  4IQ1 A;  3A2V A;  1THX A;  3MDK A;  4KE3 A;  2ZUP A;  2D2Z A;  4G0L A;  3KTB A;  3TDG A;  5HFI A;  4TKY A;  2JSY A;  2DJK A;  4L0U A;  2IJY A;  1N25 A;  1PL2 A;  1GL8 A;  2R6K A;  3ZFL A;  3BCI A;  3Q6O A;  3PGT A;  3GH6 A;  1XCC A;  4EC0 A;  3V1W A;  2L5O A;  4AKG A;  2FWE A;  4CY8 A;  5CRH A;  4MA9 A;  1M2D A;  1HQO A;  2OBI A;  3ZIT A;  3DXB A;  1XWK A;  3CYN A;  2CZ2 A;  3O6T A;  3TKP A;  1HNB A;  3HVN A;  5G1L A;  3M0F A;  4EVM A;  3M9K A;  1TRW A;  2L4C A;  3HY2 A;  4CDO A;  3IR4 A;  4KSM A;  3LW9 A;  2F51 A;  2B7J A;  5BRT A;  5CRE A;  4PQI A;  3E3E A;  3EMX A;  3WD6 A;  4ZXG A;  1EEJ A;  4WR5 A;  5JWQ B;  1PQN A;  5CRW A;  2K8V A;  1PA3 A;  2L59 A;  4GLT A;  4TXO B;  1USB A;  2ON7 A;  3FK8 A;  4F03 A;  2IWT A;  1ZL9 A;  1Z6M A;  4MMM A;  4HZ4 A;  1A2M A;  4XIH A;  5KN1 A;  4HZ2 A;  2H0I A;  1RW1 A;  1T4Z A;  5E4W A;  4ACS A;  2AJQ B;  4L5L A;  4YQM A;  1G6Y A;  4KAE A;  5IMZ A;  3GST A;  4Q5R A;  1F3B A;  2CZ3 A;  8GSS A;  1SJZ A;  5ENU A;  3TGZ A;  4LL4 B;  2JZT A;  3Q74 A;  1PRX A;  3VLN A;  3L9U A;  4BWS A;  3GKK A;  4AGS A;  1AQW A;  3HCZ A;  1YF1 A;  1SYX A;  4NV5 A;  2PWJ A;  5DJM A;  1M2B A;  5ID2 A;  2AHE A;  1NHY A;  4I8B A;  4GSN A;  4EIP A;  1HNA A;  4FYB A;  1F37 A;  3LG6 A;  1SU9 A;  5J3R A;  1T7P B;  1FVJ A;  1WMJ A;  5KN0 A;  4V2L A;  3FZ4 A;  3GNJ A;  2LST A;  4HQZ A;  2PVQ A;  5FWG A;  2C0F A;  3DRN A;  4HS1 A;  3HDC A;  1QQ2 A;  1N2A A;  2YWN A;  3ERW A;  3BCK A;  6GSU A;  3UEM A;  3ZZX A;  3MSZ A;  4JBB A;  3RPN A;  3L0H A;  1TW9 A;  3TUE A;  1SYR A;  3KD0 A;  3VUR A;  1PN9 A;  3ZIV A;  2HNL A;  4OO4 A;  3KCM A;  4YH2 A;  3FR6 A;  1BQ7 A;  4MPF A;  1OKT A;  4EDY A;  3HKR A;  5DAK A;  1S3C A;  2DLX A;  1R5P A;  4PX1 A;  2M80 A;  4TRX A;  4NAX A;  1SK1 A;  4AI6 A;  3P8W A;  5EVO A; 
#chains in the Genus database with same CATH homology
 2EIO A;  2GST A;  5ECL B;  3CSJ A;  2X49 A;  5HR1 A;  1TRS A;  1ZYE A;  3LWA A;  4NHZ A;  4V1A g;  3EIN A;  3QAG A;  2VL2 A;  2GS3 A;  3RHB A;  5J9C A;  2MMO A;  2C3T A;  3I43 A;  1RQM A;  1H4O A;  2R0C A;  2K6V A;  3D22 A;  2CVB A;  2HRN A;  4HUA A;  1MDJ A;  2VM2 A;  2B5E A;  4OCF A;  3J7Y k;  4GRF A;  1TOF A;  3HJO A;  3L9S A;  1QFN A;  4G01 A;  3Q19 A;  4LMW A;  4MZW A;  4MPG A;  2OE0 A;  1UC7 A;  5ID2 B;  4Q5N A;  5A34 A;  1AUC A;  2IN3 A;  4K0N A;  1O73 A;  2YZH A;  1ZMA A;  1KBN A;  3DKS A;  4OD7 A;  5CRD A;  4ZB6 A;  2GSS A;  3TU3 B;  3UJ1 A;  4A5P A;  1BYE A;  2H75 A;  2VLV A;  4ML6 A;  3ZMK A;  4YAV A;  2CVK A;  4QQ7 A;  1K0D A;  3F0I A;  3HVX A;  3M9J A;  5B6M A;  2GVP A;  1J08 A;  2H76 A;  1SL2 B;  3F9U A;  2CAI A;  4CY6 A;  4AKI A;  5HQP A;  1ZCP A;  2C3Q A;  2F9S A;  4DVC A;  4K7N A;  3UVH A;  5DAK B;  4ECB A;  4PNG A;  2AUV A;  4V2N A;  1PD2 1;  3GUS A;  1U88 A;  2VL9 A;  3UAP A;  14GS A;  2K8S A;  4Q5F A;  4ZBB A;  4XS1 A;  2WCI A;  1URM A;  4TXV A;  2A4H A;  4BPY A;  1XW6 A;  1M7T A;  3HA9 A;  5LNK e;  2O85 A;  2XPD A;  4XS6 A;  1DSB A;  3G7J A;  4OFM A;  4PUR A;  2LJK A;  4YQV A;  1OYJ A;  2X64 A;  1OC8 A;  1ZYQ B;  1PSQ A;  1MD3 A;  5ECP B;  5D96 A;  4K2D A;  1HNC A;  6GSY A;  1GLQ A;  1AC1 A;  1T1V A;  2CV4 A;  2EC4 A;  3FRC A;  5J4V A;  4JR6 A;  3US3 A;  2FY6 A;  3HD5 A;  2DIZ A;  4XTS A;  4NMU A;  4F9Z A;  1FB6 A;  4XCS A;  4ZIJ A;  3IA1 A;  4EL1 A;  4AKX B;  12GS A;  2HRF A;  3QOU A;  2LTK A;  1ERU A;  2E0Q A;  1K0M A;  3GTU B;  3VWV A;  2DJ0 A;  2V32 A;  2H19 A;  1G0T A;  1O85 A;  3EYT A;  4MP4 A;  5BMU B;  2VCX A;  1JHB A;  1OC9 B;  4GTU A;  1RK4 A;  5GST A;  2IPA A;  1VF2 A;  4AJ6 A;  1DUG A;  5G31 A;  3DVW A;  4HOJ A;  2A2R A;  1Z5Y E;  1S3A A;  2LJR A;  2AB6 A;  2P31 A;  4DSR A;  1G6W A;  3KH7 A;  1B4Q A;  3UBL A;  4KND A;  4X43 A;  3MIX A;  5DAL A;  1ON4 A;  2IMF A;  2L6C A;  4MH2 A;  1QGV A;  4O32 A;  17GS A;  2H72 A;  4JE1 A;  5F06 A;  1A8L A;  4OMV A;  3MYD A;  1GH2 A;  3QFB C;  4L0W A;  1JZW A;  2LEG A;  5GZZ B;  2LV3 A;  3FHK A;  2YPM A;  4G0K A;  4E68 A;  2DJJ A;  4K0G A;  2R0G A;  2R37 A;  3QFA C;  3F6D A;  4Q5Q A;  2KLX A;  4ECJ A;  4GF0 A;  3W6G A;  4GQC A;  4FYC A;  5CNW A;  2IME A;  4G2E A;  5IMF A;  3IV4 A;  3HJM A;  3UAR A;  1WWJ A;  2PGT A;  4OCE A;  3WT1 A;  1XXU A;  2P5R A;  3HVV A;  3VI5 A;  1SD8 A;  4J57 E;  3DIE A;  1EV9 A;  3FR3 A;  3VPQ A;  5IO0 A;  5DCH A;  2JU5 A;  2O8V B;  1GSS A;  4IBP A;  5DBQ A;  3VWX A;  1X9W B;  1GLP A;  5DVB A;  2DJ1 A;  1EWX A;  1XWG A;  2H1A A;  3FZA A;  3KMO A;  2GTU A;  1B48 A;  1K3Y A;  3WGD A;  2C0G A;  2FWF A;  1FO5 A;  4HJM A;  1JZD A;  2P0G A;  7GSS A;  5CO3 A;  3GX0 A;  4IEL A;  4CHS A;  4AKH A;  2R3X A;  3DD3 A;  4ZB8 A;  5DAL B;  4K5R A;  4MJA A;  2N5F A;  1GNE A;  2MBT A;  4ECC A;  3FYG A;  2IFQ A;  3KGK A;  4BA7 A;  1V2A A;  1XVQ A;  2H1D A;  4MDC A;  1YZX A;  2GQL A;  1G7E A;  1GUL A;  1PMT A;  4XRA A;  3TJB A;  1XW9 A;  3ZFB A;  4QL7 A;  1M0U A;  3CRU A;  2HRK A;  3IE3 A;  4JU5 A;  1TP9 A;  2H66 A;  2OT3 A;  2X99 A;  3HVS A;  3NOF A;  5D9V A;  3LJR A;  1M9B A;  2K18 A;  1LU4 A;  1PKZ A;  4XHM A;  2O5V A;  1X0R A;  5A4W A;  1UVZ A;  3I69 A;  2IMK A;  3TRQ A;  1K3O A;  3IC4 A;  5A5H B;  4TOP A;  3ZIJ A;  3EC3 A;  4ULX A;  1GNW A;  4TN8 A;  3IBH A;  5IPH A;  3GSS A;  4POK A;  3BJ5 A;  2C80 A;  3D5J A;  5ECM B;  2GDR A;  2IIY A;  1O8X A;  4HU9 A;  2H1L A;  2A2P A;  3M1G A;  2YWM A;  1XOA A;  3HZ8 A;  5KOW A;  1T3B A;  4K6X A;  1GWC A;  2MMZ A;  1OC3 A;  4MLY A;  1FB0 A;  1CQH A;  5DJL A;  1WJK A;  3DYR A;  3ZVJ A;  1GSQ A;  1JZR A;  2YV9 A;  2GT6 A;  3APS A;  4YAP A;  1DBY A;  1A0F A;  2OBK A;  4F0B A;  4K9Z A;  5IQY A;  2L4Q A;  3ZRD A;  2DKI A;  4Z7X A;  3GUR A;  2VKZ G;  2DIY A;  5AIS A;  3KIJ A;  2TRX A;  2IFQ B;  1K0A A;  1GUH A;  2H8L A;  5EL8 A;  1KEB A;  1JZO A;  1ERW A;  4N0V A;  1OE8 A;  3ME7 A;  3GKN A;  1TXU A;  2V1M A;  2HRK B;  4TR0 A;  4ZB9 A;  2BJX A;  1BF5 A;  1K0O A;  3QAV A;  4IQA A;  2MMN A;  4ZL9 A;  4K2X A;  1EP7 A;  4RI6 A;  4YKG A;  5H5R A;  4IW9 A;  4KCE A;  1AW9 A;  3RDW A;  4FYU A;  4KH7 A;  1V9W A;  4JR4 A;  3TB2 A;  4N11 A;  3GKX A;  3FR9 A;  2H6Z A;  2MYG A;  3IC8 A;  3EU3 A;  3GL5 A;  4JRR A;  5KN3 A;  1AAZ A;  2NVL A;  1K0C A;  3TKR A;  4IP1 A;  5DCG A;  1EOG A;  4G19 A;  5GSS A;  3PR8 A;  1YF0 A;  3VI7 A;  13GS A;  1TDI A;  1XWA A;  3UIW A;  6GSV A;  2O89 A;  3KP8 A;  3TCO A;  4ZBD A;  2PPT A;  1V98 A;  1OE7 A;  1Q98 A;  2JZR A;  1U3I A;  2VCQ A;  4OFT A;  5ELA A;  3ISO A;  2FCH A;  1FG4 A;  3FEU A;  3F4T A;  4HEA 2;  2VLU A;  4OO5 A;  1O81 A;  4IHU A;  4EO3 A;  2XPE A;  4IJI A;  1B8X A;  4NWY A;  5IPG A;  4KDU A;  2WUL A;  5IMC A;  2V41 A;  1VF1 A;  4IKH A;  5JCU A;  4PUF C;  4ISD A;  4KGI A;  2G0F A;  4FQU A;  22GS A;  2FLS A;  2WRT A;  2L57 A;  2EIQ A;  2L5L A;  4BVX B;  2XC2 A;  2OJL A;  4D73 B;  4YQU A;  4ZB7 A;  3E0U A;  1GRX A;  2FA4 A;  3ZRE A;  1ZYN A;  5HR0 A;  2HSN B;  3S9F A;  20GS A;  2F8A A;  1Z3E A;  4MF5 A;  4J56 E;  4GSS A;  2HQT A;  5D9T A;  5H5S A;  3L4N A;  4TR4 A;  2VCV A;  1A0R P;  4EIQ A;  2H1B A;  2CAQ A;  4WXT A;  2J9H A;  4KF9 A;  1X5E A;  5ELG A;  3A5I A;  4X0X A;  3LQ7 A;  3TKS C;  4Z2T A;  1WE0 A;  4ECI A;  1C72 A;  3IAM 2;  2EFC A;  4KDX A;  2CQ9 A;  2X8C A;  2M46 A;  4F82 A;  1EOH A;  1TXX A;  5AIV A;  1EZK A;  1GSY A;  4E8H A;  3GFK A;  3I6A A;  1T8E B;  4N3Z A;  1A2L A;  4EUY A;  2B3S A;  3GTU A;  1AXD A;  3L9V A;  3BOA A;  3AY8 A;  5A5K A;  2X8H A;  2KP2 A;  1IYH A;  5ECK B;  2F3M A;  4MH3 A;  2DSA A;  1GSF A;  2FWH A;  5HFK A;  4EKZ A;  1TTZ A;  3N9J A;  5BMU A;  4HI7 A;  1Q4J A;  3F8U A;  4O5U A;  1OC9 A;  3KJY A;  3LGC A;  3P7X A;  1ACV A;  2XBQ A;  2YN1 A;  4KW6 A;  3DEX A;  5G30 A;  3D6I A;  1U3A A;  1YY7 A;  3G7I A;  4OWY A;  1VGL A;  1QK8 A;  2PVO C;  3APO A;  1G7O A;  4FO5 A;  3IPZ A;  1VF4 A;  3DWV A;  3D0Z A;  2EIR A;  4G10 A;  2OE1 A;  5EY6 A;  5ECQ B;  5D8I A;  2EFD A;  3TRP A;  2HZE A;  3FY7 A;  5INY A;  1VF3 A;  5F05 A;  2I3Y A;  1B4P A;  4MF6 A;  2H01 A;  4MJB A;  3Q18 A;  1OVN A;  4WEY A;  3M3M A;  1TKD B;  5CRG A;  2QC7 A;  3RAZ A;  2H6Y A;  3CTF A;  2JAD A;  2CX3 A;  2HRA A;  2BMX A;  2WDU A;  5LD0 A;  4QL9 A;  3ERF A;  5G5E A;  4ZL8 A;  5DQY A;  4X4J A;  2YWO A;  3ZML A;  3C8E A;  3VFI A;  2WFC A;  4AJ7 A;  2K9F A;  4K1F A;  1GUM A;  3FW2 A;  1SD9 A;  2H74 A;  3QCP A;  3H79 A;  1DE2 A;  3HYP A;  4HDE A;  1WRY A;  2DBC A;  5AN1 A;  2GGT A;  4TVE A;  3ED3 A;  2R2J A;  2VM1 A;  3GYK A;  1QMV A;  2KHP A;  1J0F A;  4NHW A;  4KA0 A;  4O5R A;  4BL7 A;  4MF7 A;  1GTB A;  2PMT A;  3TOU A;  2H0H A;  4WBR D;  2TIR A;  5GAP D;  5ECI B;  1R26 A;  3DGQ A;  5A1N B;  1NSW A;  5G1K A;  4EE0 A;  2WJU A;  3EUR A;  2TRC P;  2VUP A;  4RQR A;  4E8E A;  3LSZ A;  3QPM A;  2YCD A;  2HSH A;  2OA7 A;  2HZE B;  1SK0 A;  2VOC A;  2NTO A;  4NV2 A;  4POM A;  3LYP A;  5H5Q A;  1Z6N A;  3KM6 A;  4IJ3 A;  2DC5 A;  4MK3 A;  2I81 A;  1XFL A;  1W89 A;  1FVK A;  3FZ9 A;  3U6V A;  4MNN A;  5HR2 A;  2GZP A;  2LNT A;  1GTU A;  2H30 A;  4K7I A;  2C8U A;  1O8W A;  3LEF A;  1KTE A;  3IRA A;  5C04 A;  1A2J A;  18GS A;  2ZCT A;  2GQK A;  4GWR A;  5A5H A;  2LJA A;  2IL3 A;  1H75 A;  4X1U A;  4XS4 A;  1ZZY A;  1LJR A;  4GCI A;  1XWB A;  1GTA A;  4HQS A;  3RBT A;  1BX9 A;  1SJI A;  1GP1 A;  3TJG A;  1HD2 A;  1XOB A;  5D73 A;  5F0G A;  2HT9 A;  2LQO A;  1SL1 B;  3QDN A;  4OFN A;  4KUN A;  3EVI A;  3U5R E;  2N5A A;  2C3N A;  5B8B A;  2X8G A;  5B7C A;  5B8A A;  4MAB A;  1QXH A;  2CT6 A;  2VCW A;  4XRD A;  3PIN A;  5G5F A;  4KCA A;  3D4T A;  1UA5 A;  4BL7 B;  3GA4 A;  3MNG A;  4K7O A;  3GV1 A;  5ECO B;  3DML A;  1O6J A;  2JL4 A;  5JCG A;  1I5G A;  3GX8 A;  2JSZ A;  3C1R A;  4POL A;  4ZBA A;  3TOT A;  4WBJ A;  4QMK A;  3ERG A;  2B1K A;  3WT2 A;  5KOX A;  2PU9 C;  1X9M B;  1ABA A;  1ZOF A;  2B6M A;  3DVX A;  1YJ6 A;  3ZTL A;  4NXI A;  4CW9 A;  5IO2 A;  1YKC A;  2GSQ A;  3R3E A;  6GSS A;  3KMN A;  2B7K A;  3CMI A;  3QR6 A;  1MDK A;  1Z7R A;  2M72 A;  1F3A A;  3G9B A;  3KEB A;  2YNX A;  1FAA A;  11GS A;  1XIY A;  4WKW A;  3G7Y A;  2L6D A;  2VCZ A;  1A24 A;  5J5N A;  4TR3 A;  2RM6 A;  3TKQ A;  5J47 A;  1NHO A;  4H86 A;  5IM9 A;  5JWO B;  3PPU A;  3BBY A;  2VLT A;  3UMA A;  5D93 A;  3GRX A;  4POB A;  4XS4 B;  3L78 A;  1WOU A;  5G2Z A;  2RUF A;  2FUG 2;  4ZIL A;  1E2Y A;  3TKS E;  3QMX A;  1PGT A;  2DKH A;  16GS A;  1M2A A;  1ML6 A;  1U87 A;  2ES7 A;  1DE1 A;  2E2G A;  3GKM A;  1YEX A;  3NIV A;  2HLS A;  2QA2 A;  2PBJ A;  3EU4 A;  3A2X A;  3FKF A;  4RUV A;  4KSO A;  3UVT A;  1IYI A;  1GSU A;  3PH9 A;  1T00 A;  1JLW A;  4IGJ A;  4V2M A;  4Z2U A;  4EXJ A;  1ERT A;  2HSM B;  10GS A;  9GSS A;  5C00 A;  3CXG A;  2R0P A;  4LL1 B;  1BAY A;  1R7H A;  1SK2 A;  2WS2 A;  3KXO A;  5DDL A;  2KOK A;  4BVX A;  4TR1 B;  1YQ1 A;  2YP6 A;  4WET A;  2FNO A;  3EWL A;  4D73 A;  4BWQ A;  1SL0 B;  3CBU A;  5AGY A;  1KNG A;  1TK5 B;  4F0C A;  2HSN A;  3F6F A;  1SVL A;  3D21 A;  1YVL A;  4WF4 A;  3FMW A;  1PX7 A;  2RM5 A;  4GST A;  1XWC A;  1EP8 A;  2F8F A;  2DJ2 A;  5IMA A;  1CQG A;  1ILO A;  1E6B A;  1JLV A;  3GL3 A;  6GSW A;  3KP9 A;  5B6N A;  5ECS A;  5A4V A;  2OE3 A;  2REM A;  1BG5 A;  3RHC A;  5JCW A;  4W66 A;  1O7U A;  2GSR A;  2WZ9 A;  2VL2 C;  3ZLP A;  3JCM L;  4LA1 A;  2LQQ A;  3C71 A;  2LKU A;  5ABR A;  2H1G A;  2HXK A;  1YKA A;  1X9S B;  2PUK C;  3H8Q A;  4PNF A;  2OKA A;  2EFE A;  5CAX A;  2LS5 A;  1M9A A;  1XVW A;  4IN0 A;  3IHQ A;  2RII A;  2HSY A;  1TRU A;  4G9H A;  1WIK A;  2YAN A;  2X4A A;  6GSX A;  3P2A A;  2H70 A;  4PXO A;  2LRN A;  4MJE A;  1K0N A;  3A5W A;  1AQV A;  4KB3 A;  1WPI A;  4DSS A;  2YJ7 A;  4MZC A;  4ZL7 A;  4IP6 A;  19GS A;  1GUK A;  1FOH A;  2QSI A;  5J4U A;  4GXZ A;  6GST A;  3O76 A;  1HYU A;  3O3T A;  3IXR A;  1GTI A;  2V2G A;  2R5G A;  1TI3 A;  1K0B A;  2DJ3 A;  2Z9S A;  5F8B A;  3A3T A;  1OKD A;  2XBI A;  4G0I A;  2LNS A;  1I9D A;  3GMF A;  1MEK A;  3TJJ A;  4GDF A;  4L5O A;  2MZC A;  1XBS A;  4K8M A;  4EF0 A;  1LBK A;  5HFG A;  1SEN A;  3GN3 A;  3C73 A;  4I2U A;  3TRX A;  4FH8 A;  1N8J A;  4NPB A;  2HZF A;  4O5Q A;  1GSE A;  5JWR B;  4O92 A;  1Y6E A;  3ZVJ D;  3IAS 2;  3MAK A;  5E59 A;  1R5A A;  3WGX A;  3MWH A;  4PQ1 A;  2YJH A;  2C1Y A;  3CSI A;  2VCT A;  2GT5 A;  2AAW A;  3KZQ A;  2B5X A;  3F4R A;  2LUS A;  3HZ4 A;  1EEM A;  2VL3 A;  3VK9 A;  2YZU A;  1SKS B;  5D9X A;  2CVD A;  4L8E A;  4WR4 A;  5IIZ A;  3N5O A;  4PTS A;  1VRS D;  4O7H A;  2HI7 A;  4DSS B;  2E7P A;  1SJ6 A;  3F63 A;  2JZS A;  5FHI A;  2P5Q A;  3BD2 A;  2VO4 A;  1PL1 A;  2BTO T;  2DML A;  1MDI A;  3WGE A;  1PX6 A;  4I2T A;  2CA8 A;  3C1S A;  2VD0 A;  1U6T A;  3FZ5 A;  2HYX A;  1SVO A;  2GZY A;  5A1N A;  3J7Y b;  3EMP A;  4I5Q A;  1V58 A;  5HR3 A;  2MBS A;  1TRV A;  3HJP A;  3TJF A;  2FGX A;  4USS A;  3EPT A;  1S3D A;  1J9B A;  1EV4 A;  2QA1 A;  3KTL A;  3TKS A;  3GIX A;  1FW1 A;  2H6X A;  1WP0 A;  3QD9 A;  4AF2 A;  4WF5 A;  1SVM A;  1ZGN A;  2ZNM A;  1MTC A;  4ML1 A;  2NBS A;  3IHG A;  2H73 A;  5CYY A;  5J41 A;  3VWW A;  3C7M A;  2LRC A;  2V6K A;  4HJ2 A;  1NW2 A;  2NPB A;  3M8N A;  4KDY A;  2GLR A;  4K5S A;  5DQS A;  1ST9 A;  4Z2R A;  1Z7P A;  1AIU A;  3ZYW A;  3H1N A;  5L71 A;  2GQM A;  2VIM A;  5LCZ A;  4PUA A;  3LXT A;  2C4J A;  2FHE A;  3LYK A;  2A4V A;  3QAW A;  3ME8 A;  5D9W A;  1QUW A;  1BED A;  2HE3 A;  3HHV A;  5A34 B;  1ERV A;  3UBK A;  3LFL A;  3OR5 A;  1B9Y C;  1XW5 A;  4F2I A;  2AYT A;  4KX4 A;  3P90 A;  4PQH A;  5ECN B;  3APQ A;  2QGV A;  3F3R A;  1AQX A;  5IMV A;  1T4Y A;  2N5B A;  2FA8 A;  1JFU A;  3R2Q A;  2RUE A;  2I1U A;  1EGO A;  3TJK A;  3F3Q A;  2IMI A;  3IDV A;  3UOM A;  1F6M C;  1NM3 A;  5J4Y A;  1THO A;  3W8J A;  2B1L A;  5GAN D;  1GSD A;  4YKF A;  3A2W A;  2AV4 A;  2R4V A;  2RLI A;  3H4K A;  4JZQ A;  3LXZ A;  1SKR B;  5ECR B;  5J9B A;  4N0Z A;  4DSQ A;  2QKE A;  2OAD A;  2UV8 G;  3I9V 2;  2VAF A;  1YDK A;  5IOW A;  3CWG A;  4BVY A;  4FIW A;  3HMJ G;  3SWL A;  1K3L A;  3IOS A;  4I97 A;  4LMV A;  1F2E A;  2E2M A;  1FHE A;  1Z9H A;  4MJC A;  2YOI A;  5FT3 A;  2ON5 A;  3W8S A;  2LRT A;  1TK8 B;  5F07 A;  5IMD A;  1BJX A;  2H71 A;  1B9X C;  3SBC A;  2I4A A;  1YEP A;  4JED A;  4MZB A;  1XZO A;  1MD4 A;  4TW5 A;  1W4V A;  2J23 A;  2KUC A;  4MCU A;  3VWU A;  1FOV A;  3CSH A;  1V40 A;  1Y1U A;  1ZYP A;  4ID0 A;  2C0E A;  2IMD A;  2GZZ A;  4I6X A;  4ICY A;  3CRT A;  2PER A;  1SKW B;  4HU7 A;  3VPT A;  4AJ8 A;  2A2S A;  2FWG A;  4RQX A;  2PN8 A;  4IVF A;  3UL3 A;  4GQF A;  5IOX A;  5J40 A;  1TI1 A;  1BG1 A;  3CTG A;  3NZN A;  1V57 A;  5COH A;  2XHF A;  2DMM A;  3WYW A;  4V1A p;  3ZL5 A;  3EE2 A;  3D4M A;  2O7K A;  1EGR A;  4N10 A;  1XPV A;  4RI7 A;  2C0D A;  2HSM A;  2CX4 A;  4N30 A;  3GHA A;  3K8N A;  3GH9 A;  1UN2 A;  2YV7 A;  1M99 A;  2WGR A;  4TR1 A;  4BVY B;  2ALB A;  4LLR A;  2V6O A;  1TU7 A;  4DEJ A;  1PKW A;  3E9J B;  1OAZ A;  5EPF A;  2KP1 A;  4PGT A;  1Y25 A;  2G2Q A;  3IK9 A;  1X5C A;  1F9M A;  1PN0 A;  4TXO A;  3F4S A;  2JAC A;  1R4W A;  1TK0 B;  4J2F A;  4EDZ A;  5A4U A;  2HFD A;  3KH9 A;  3LOR A;  2NDO A;  4IS0 A;  4ILF A;  3IK7 A;  5CP1 A;  2MMA A;  2I9H A;  2O87 A;  5KN2 A;  1TU8 A;  4P3Y B;  3RPP A;  2H0G A;  2FD3 A;  1A23 A;  3H93 A;  3HXS A;  1TJD A;  2WB9 A;  2VD1 A;  5ECH B;  2EFH A;  2UZ8 A;  5KEJ A;  5AIX A;  2YWI A;  2OAC A;  1X5D A;  1A8Y A;  2B5Y A;  4IQ1 A;  3A2V A;  1THX A;  3MDK A;  4KE3 A;  2ZUP A;  2D2Z A;  4G0L A;  3KTB A;  3TDG A;  5HFI A;  4TKY A;  2JSY A;  2DJK A;  4L0U A;  2IJY A;  1N25 A;  1PL2 A;  1GL8 A;  2R6K A;  3ZFL A;  3BCI A;  3Q6O A;  3PGT A;  3GH6 A;  1XCC A;  4EC0 A;  3V1W A;  2L5O A;  4AKG A;  2FWE A;  4CY8 A;  5CRH A;  4MA9 A;  1M2D A;  1HQO A;  2OBI A;  3ZIT A;  3DXB A;  1XWK A;  3CYN A;  2CZ2 A;  3O6T A;  3TKP A;  1HNB A;  5G1L A;  3M0F A;  4EVM A;  3M9K A;  1TRW A;  2L4C A;  3HY2 A;  4CDO A;  3IR4 A;  4KSM A;  3LW9 A;  2F51 A;  2B7J A;  5BRT A;  5CRE A;  4PQI A;  3E3E A;  3EMX A;  3WD6 A;  4ZXG A;  1EEJ A;  4WR5 A;  5JWQ B;  1PQN A;  5CRW A;  2K8V A;  1PA3 A;  2L59 A;  4GLT A;  4TXO B;  1USB A;  2ON7 A;  3FK8 A;  4F03 A;  2IWT A;  1ZL9 A;  1Z6M A;  4MMM A;  4HZ4 A;  1A2M A;  4XIH A;  5KN1 A;  4HZ2 A;  2H0I A;  1RW1 A;  1T4Z A;  5E4W A;  4ACS A;  2AJQ B;  4L5L A;  4YQM A;  1G6Y A;  4KAE A;  5IMZ A;  3GST A;  4Q5R A;  1F3B A;  2CZ3 A;  8GSS A;  1SJZ A;  5ENU A;  3TGZ A;  4LL4 B;  2JZT A;  3Q74 A;  1PRX A;  3VLN A;  3L9U A;  4BWS A;  3GKK A;  4AGS A;  1AQW A;  3HCZ A;  1YF1 A;  1SYX A;  4NV5 A;  2PWJ A;  5DJM A;  1M2B A;  5ID2 A;  2AHE A;  1NHY A;  4I8B A;  4GSN A;  4EIP A;  1HNA A;  4FYB A;  1F37 A;  3LG6 A;  1SU9 A;  5J3R A;  1T7P B;  1FVJ A;  1WMJ A;  5KN0 A;  4V2L A;  3FZ4 A;  3GNJ A;  2LST A;  4HQZ A;  2PVQ A;  5FWG A;  2C0F A;  3DRN A;  4HS1 A;  3HDC A;  1QQ2 A;  1N2A A;  2YWN A;  3ERW A;  3BCK A;  6GSU A;  3UEM A;  3ZZX A;  3MSZ A;  4JBB A;  3RPN A;  3L0H A;  1TW9 A;  3TUE A;  1SYR A;  3KD0 A;  3VUR A;  1PN9 A;  3ZIV A;  2HNL A;  4OO4 A;  3KCM A;  4YH2 A;  3FR6 A;  1BQ7 A;  4MPF A;  1OKT A;  4EDY A;  3HKR A;  5DAK A;  1S3C A;  2DLX A;  1R5P A;  4PX1 A;  2M80 A;  4TRX A;  4NAX A;  1SK1 A;  4AI6 A;  3P8W A;  5EVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...