3TOUA

Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
VMKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGALFDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVALRVEQTQRTPEQRSESWITRQHHKIDEALKAMSRGLADRTWCNGNHLTLADIAVGCALAYLDFRQPQVDWREQHANLAAFYTRIEKRPSFLETQPQAENLYFQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GLUTATHIONE S-TRANSFERASE from Ralstonia solanacearum
rcsb
molecule keywords Glutathione s-transferase protein
molecule tags Transferase
source organism Ralstonia solanacearum
total genus 76
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3touA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3touA01
1HNAA 4Q5FA 1BQ7A 5G2ZA 4V2MA 1TRVA 3EU3A 4JU5A 1S3CA 1WE0A 2H1AA 1XW6A 4KUNA 4MF5A 3DMLA 3IV4A 4K8MA 2LTKA 4L0UA 4KDXA 4CHSA 3GX0A 1Z7PA 1TI1A 3A2XA 2JU5A 1E2YA 3DVWA 4KDUA 1TKDB 3LSZA 3KMOA 1X9WB 4F0BA 4JR6A 2WFCA 3TOTA 3J7Yk 3GTUA 4BVXA 1ACVA 5GSSA 2HYXA 4F2IA 4EE0A 1TTZA 3BJ5A 4OWYA 3IR4A 5AISA 1K0MA 3APQA 3IAM2 3APOA 4HS1A 1ZL9A 2QC7A 3SWLA 4I2UA 5CAXA 3KXOA 3LQ7A 3W8SA 2H73A 5J3RA 10GSA 4KDYA 1GSYA 1A0FA 4GQCA 2KUCA 3BBYA 4QQ7A 19GSA 2ON5A 1Z5YE 3OR5A 1G7EA 1TDIA 3CMIA 4TXOB 3R2QA 1YEPA 5JCUA 3PH9A 1EOHA 1ERUA 2KP2A 5A4UA 1FHEA 5J9BA 4AJ6A 2VM1A 2HFDA 1TJDA 2DBCA 2VIMA 2HZFA 1YDKA 2JZSA 4O92A 3HHVA 1R4WA 4MLYA 5J4UA 1PRXA 2GT5A 3QFBC 5GZZB 1T00A 3EC3A 4POKA 4ZL8A 3GUSA 3LFLA 1YF1A 1YZXA 5F06A 1Z7RA 1AUCA 4HUAA 1YF0A 2B5YA 4DEJA 5CP1A 5ECIB 5IPHA 1TK5B 2K8SA 1MDIA 3IK9A 1M0UA 5G30A 4L5OA 4LLRA 5AN1A 2GDRA 1T8EB 1F9MA 1RQMA 5IO2A 4PNGA 9GSSA 1XWBA 4AF2A 3UL3A 1WP0A 4Q5NA 2B6MA 1U3IA 4E8HA 2YV9A 4EVMA 1UN2A 3I9V2 3ME8A 4ZB8A 1K0NA 4ZIJA 5HFKA 2X8HA 5LD0A 2H1GA 3H8QA 3CTFA 2G2QA 1V98A 4XCSA 1SL2B 3P7XA 4BPYA 3GN3A 1O81A 1GNWA 1EOGA 1XZOA 4F0CA 4IBPA 5AIXA 2K18A 3IA1A 5KN2A 2H8LA 4NHWA 2N5FA 3QCPA 3TUEA 1AC1A 4I6XA 5B6MA 2DC5A 3ZVJD 3TJKA 2HRAA 1X5CA 1TU7A 2KLXA 1SENA 1FOVA 2L5OA 1XBSA 3TRXA 1FG4A 2H0GA 3O76A 2AJQB 4J2FA 3KH9A 3EMXA 2M46A 1M9AA 1K0OA 1XPVA 4YQVA 2IMDA 17GSA 3ERFA 2H30A 1KNGA 3D22A 2BJXA 4FIWA 4HEA2 1WOUA 1PX6A 3HCZA 5DCHA 4IVFA 3TOUA 3GMFA 5KEJA 2VL9A 2H76A 5H5QA 3DIEA 2FLSA 4RQRA 3C1SA 2WGRA 3EYTA 4IGJA 1DE1A 4KB3A 1BJXA 4YAPA 2R3XA 3PPUA 2NBSA 3FK8A 4NHZA 3ZFBA 1SYXA 1GNEA 2YJ7A 3D6IA 4AGSA 5DCGA 3RPNA 4TN8A 1UA5A 4E8EA 4Z7XA 3WYWA 1V40A 5GSTA 4IP6A 2C80A 3RPPA 1ABAA 4TXVA 2VCXA 1GP1A 3ZZXA 2G0FA 2GZYA 4WKWA 2WJUA 4OFNA 5CNWA 2REMA 3TJJA 3LYPA 2CX4A 2GZZA 4HU7A 4I2TA 2OE1A 1V2AA 2LV3A 8GSSA 3CRTA 4G0KA 2FHEA 5ID2B 2O8VB 4QL7A 1T1VA 2YJHA 3WGXA 5DVBA 1MEKA 1ON4A 3TKPA 1XW9A 2B7KA 4MH2A 2ON7A 3O6TA 2H71A 1B9XC 5DBQA 3KTLA 1A2MA 4KE3A 2GVPA 4PUFC 2CAIA 5HR1A 1QGVA 1W4VA 2X8CA 3UMAA 4K0NA 1Z9HA 1V58A 1SKWB 5LNKe 4MPFA 3LYKA 1TRUA 4FYUA 2OKAA 2WRTA 2RM5A 4HOJA 4WF4A 5L71A 3G9BA 3GKKA 2E2MA 5IMFA 3BCKA 4IN0A 3KJYA 4L0WA 1XOBA 1R5AA 1NM3A 5CO3A 1QMVA 4N10A 3P8WA 2F51A 1F2EA 5INYA 3KM6A 3QPMA 5CRGA 1GUKA 3PR8A 1JLWA 3IE3A 2CT6A 1F3BA 3IRAA 3VLNA 3IHQA 1GRXA 6GSXA 3UAPA 3P90A 3UBKA 4MZCA 3GKXA 1PX7A 1BYEA 1PKZA 5EPFA 3CSJA 1GSDA 1RK4A 4TR0A 5ELGA 2DIYA 4PX1A 1E6BA 3UVTA 3TKSE 6GSVA 2CAQA 2RUEA 2CZ2A 2YV7A 4NV5A 2MMZA 4X0XA 4TR4A 1K3OA 1MDJA 2OA7A 1OVNA 4EKZA 3VURA 2FCHA 4WF5A 1ZYEA 5A4VA 2LNTA 3H79A 1K0AA 3IXRA 1G6WA 4G10A 2D2ZA 4RI7A 2JSZA 2OACA 3FZ5A 1XCCA 3UBLA 1IYHA 5G5EA 1R26A 1WRYA 2MMNA 2GQMA 1UVZA 1EEMA 5J9CA 5ABRA 4DSSA 4JZQA 4CW9A 2DMMA 5D9VA 2C1YA 3EINA 4FYBA 1GTBA 1ZOFA 1TRSA 13GSA 4ECIA 1T4YA 4JRRA 2I4AA 3F3QA 3DYRA 4GLTA 5D96A 1DUGA 1F37A 1SK1A 5B8BA 4K7NA 5IMCA 3DXBA 3D21A 4HZ2A 2HXKA 2QGVA 2PERA 2O89A 3GL3A 1J08A 1PMTA 3BD2A 1F6MC 3IOSA 5B8AA 2M72A 3GNJA 5J41A 1G0TA 1J9BA 4NWYA 5AGYA 4MJCA 4TR3A 2N5AA 3L4NA 2GT6A 1EEJA 4XTSA 1U87A 3M0FA 2WB9A 1WWJA 4HU9A 5IO0A 1LBKA 2MMAA 1HNCA 1M9BA 1V9WA 3GL5A 2DJ1A 1LU4A 4TW5A 2IJYA 3F4TA 4K0GA 1OKDA 4MA9A 1M2AA 3KZQA 2WZ9A 4G9HA 3QR6A 2QKEA 12GSA 5ECMB 4JE1A 5JCWA 1A0RP 1KTEA 1ZYQB 3GFKA 1H75A 3VWWA 2X64A 4PQIA 3RBTA 4OD7A 1PA3A 1TOFA 2YANA 2HLSA 2B5XA 5HFGA 2CVDA 1X9SB 3GA4A 1I9DA 3Q74A 4PUAA 4I97A 2FWHA 4BWSA 1OKTA 3D4TA 1A2JA 4OCFA 5D8IA 4IELA 3IBHA 3ZYWA 1M99A 1GSSA 2VLTA 5F07A 3LJRA 1BAYA 5FWGA 2VD0A 4XS4B 1THOA 1GSFA 20GSA 1VF2A 2VCWA 5D93A 4MDCA 5H5RA 1K3YA 3TKSA 3F9UA 3GIXA 3RHBA 3HVXA 1BX9A 1UC7A 3CSIA 2OE3A 5ECQB 1SKSB 4N0ZA 3C7MA 5JCGA 2OADA 1B9YC 1WJKA 1V57A 4PTSA 3APSA 2OBKA 4PXOA 2C8UA 5J5NA 3QAGA 3E0UA 2VD1A 3TKQA 2UZ8A 2XPDA 3KH7A 5DQSA 3CTGA 2L57A 4O5RA 4WETA 5G1LA 2WCIA 4F03A 5IMDA 3HJMA 4ZB9A 2LNSA 3EWLA 5HR0A 3FEUA 5DJMA 1AXDA 4XS4A 1GWCA 4MK3A 2O7KA 3A5WA 4K1FA 1Q4JA 4KCAA 2EIOA 1YQ1A 1U6TA 4GQFA 1F3AA 2H66A 4TRXA 2X99A 1Q98A 2OBIA 3CSHA 3MAKA 3VI7A 2CX3A 2CZ3A 2A2RA 3SBCA 4EDYA 4EF0A 3TKRA 5IIZA 2IMIA 2GQLA 2XC2A 4NXIA 1C72A 4ZILA 3BOAA 4X43A 2ES7A 4ECJA 2EC4A 2NPBA 2IPAA 1KEBA 1ZZYA 2YPMA 2C4JA 1XWAA 2A4VA 1AIUA 2FNOA 2CVBA 3VK9A 2CV4A 1ZGNA 1O85A 2HSYA 3L78A 4JBBA 1M2BA 1N2AA 4KW6A 4PURA 2XHFA 1JLVA 2TIRA 1AQVA 5E4WA 3E3EA 1CQHA 2NVLA 2IL3A 3IAS2 2TRCP 3LXTA 1XVQA 3A2WA 1HQOA 4K7OA 1B4PA 2HI7A 3Q18A 1O73A 5IOXA 2AHEA 3ZMKA 1GL8A 2LKUA 4KA0A 3GKNA 4NV2A 1RW1A 1USBA 4ZB6A 4ML6A 4MZBA 1J0FA 5H5SA 1OAZA 3TRPA 4HI7A 4IW9A 4L8EA 4HQZA 3QDNA 4AJ7A 1T4ZA 3H93A 3S9FA 2LJAA 3EURA 4IJIA 4P3YB 4WR4A 2RLIA 1X5DA 2O87A 4K2DA 2PVQA 4XS6A 3HYPA 3DWVA 4EUYA 6GSUA 4KNDA 4ISDA 3GHAA 4MJBA 1JZRA 3HZ4A 4RUVA 2LUSA 6GSSA 1NHOA 3IC4A 2R6KA 3D5JA 1XVWA 3L9UA 2JADA 4ID0A 3UOMA 3F0IA 3LXZA 3FW2A 2NDOA 2AV4A 2CVKA 2BTOT 2C0FA 3ZL5A 3KGKA 1T7PB 2OJLA 5DQYA 5B7CA 2YOIA 4POLA 4BWQA 2E7PA 1QQ2A 1QFNA 3M1GA 4Q5RA 2H70A 4IS0A 2C3QA 4NPBA 4WXTA 4K7IA 4KSMA 3H1NA 1JZWA 1B48A 4CDOA 5A5KA 3CYNA 2F8FA 1JZDA 1QK8A 4KSOA 1PL2A 4YAVA 5A4WA 1TI3A 3RHCA 2V1MA 1VF1A 4GF0A 3GH6A 2HZEA 2L4QA 2WULA 3WD6A 3HY2A 3GSSA 5COHA 1M2DA 4DVCA 1GULA 1MTCA 2FY6A 3FYGA 1FVKA 1Z6MA 1DSBA 5CREA 1TXXA 2VLUA 1GSQA 3QD9A 1OE8A 1SK0A 3RAZA 2VCVA 2V2GA 1NHYA 4KAEA 1OYJA 2PMTA 2H1DA 4G0IA 1AQXA 1CQGA 4V2LA 3GYKA 4MZWA 4JR4A 1PL1A 2MMOA 3H4KA 5DDLA 3KCMA 4HJ2A 4WEYA 6GSWA 2J23A 2LRCA 2F3MA 4LMWA 2J9HA 4PGTA 2LS5A 1Y6EA 3FKFA 2RUFA 3QAVA 3HVSA 4DSSB 1W89A 4V2NA 3KEBA 3ED3A 3ERGA 4BL7B 2FGXA 2MYGA 3C8EA 2H19A 2L6DA 1WPIA 1I5GA 2JL4A 2B5EA 3I6AA 2H6ZA 3O3TA 4BVYB 2HNLA 4XHMA 1YEXA 2IWTA 2GS3A 2C0EA 1QUWA 3HXSA 4NAXA 2C0DA 5DJLA 2DJ3A 4MH3A 2BMXA 4EXJA 1K0BA 2H6XA 1HD2A 3HDCA 3UARA 2IIYA 4OMVA 2HRKB 5HQPA 4YQUA 1MD4A 2XPEA 5ELAA 2ZUPA 1XWCA 5ECHB 4MF6A 1XFLA 2HSHA 3A2VA 3F6DA 2PN8A 4HQSA 5IMVA 1XWGA 2WS2A 1O8WA 1OC9B 4KH7A 14GSA 3ZFLA 4O7HA 4LMVA 2PBJA 2QSIA 1TK8B 4BL7A 3R3EA 1G6YA 2R37A 1EP7A 4WBJA 3N9JA 5ECKB 2AYTA 2IMKA 4X1UA 3KTBA 1FO5A 4BVYA 1GUMA 3DVXA 3HZ8A 3A3TA 5D9WA 4F9ZA 1U88A 2DSAA 4EO3A 4FYCA 2AUVA 1K0DA 3ZVJA 1ILOA 3VPQA 3U5RE 5C04A 4ZL7A 1O6JA 1OC8A 1NSWA 2HRFA 2AAWA 4ZL9A 2DJ0A 1MDKA 3C73A 3FR3A 1SL0B 2HRKA 3GSTA 4TR1A 2GGTA 4KF9A 3BCIA 1PN9A 2R2JA 1PKWA 2A2SA 4OO4A 2VL3A 3QOUA 4OFTA 1Z6NA 1SYRA 2V6OA 5CYYA 1OC9A 3VWXA 3G7JA 1ST9A 1SKRB 3HVVA 1URMA 1YKAA 3L9SA 3L9VA 1B8XA 1SD8A 2MBSA 1R5PA 5FT3A 2F9SA 5IMAA 2F8AA 1TP9A 2PVOC 3GV1A 4GCIA 2L4CA 2YWIA 4MF7A 2H75A 2YWNA 3C1RA 1BG5A 2L59A 2E0QA 4RI6A 16GSA 5GAPD 1EP8A 1B4QA 3N5OA 4HDEA 2DLXA 3W6GA 5F0GA 1WIKA 5CRWA 2N5BA 3EMPA 1TW9A 1SJZA 3UEMA 1SD9A 3PINA 1IYIA 4ZBDA 2LEGA 4ECBA 4XRAA 3CRUA 2V41A 3VI5A 1K0CA 3F3RA 3EU4A 3F8UA 2VOCA 3WGEA 1BEDA 1GSEA 1SJ6A 2PPTA 4POBA 3F6FA 2GZPA 2VM2A 2ZNMA 1X0RA 4YH2A 4I8BA 2I1UA 2K8VA 3NOFA 5FHIA 5JWQB 5ECNB 2VUPA 3JCML 2C3NA 3CBUA 1GLPA 1PGTA 2VAFA 4J56E 2GSSA 4ZBBA 1EV9A 4K9ZA 5LCZA 4N30A 4IJ3A 4G2EA 4HZ4A 5GAND 2LSTA 5JWOB 4GWRA 1VF4A 4WR5A 3NZNA 4I5QA 2IFQA 1VGLA 4PQ1A 2H74A 2VCTA 3KIJA 1GH2A 3F4SA 1YJ6A 1U3AA 5E59A 2HT9A 4MP4A 1VF3A 4ML1A 3KMNA 2XBQA 2FA4A 3UIWA 4MJEA 5ECPB 3DRNA 1GTUA 2YZUA 1EGRA 3TRQA 4GSSA 1XIYA 2YN1A 1O7UA 1HYUA 2HRNA 2P31A 1SU9A 3MWHA 3FR9A 3WT1A 1GTAA 3W8JA 4H86A 4HJMA 1OE7A 3LWAA 4N11A 2B1LA 4POMA 3VWUA 2EIRA 2PU9C 2H72A 4G19A 4FO5A 2R5GA 5IMZA 3ZMLA 3QAWA 2H1BA 2MZCA 2H6YA 3ZIJA 3D4MA 3ZREA 3KD0A 3FY7A 4JEDA 2FA8A 1TU8A 2IMFA 1QXHA 4ECCA 2H0IA 2DMLA 1N8JA 2E2GA 4XIHA 2KHPA 4USSA 1JZOA 4ACSA 2P0GA 2GSTA 4TXOA 4MPGA 5IPGA 1HNBA 3ME7A 3G7YA 3IC8A 2YNXA 1S3DA 3D0ZA 2CA8A 4IQ1A 1YKCA 2EIQA 18GSA 3QMXA 4L5LA 4QL9A 2VLVA 1ML6A 3LORA 1OC3A 2C3TA 2JACA 4K6XA 3ZITA 3HJOA 5HFIA 5KN0A 3K8NA 4LA1A 3M3MA 1T3BA 2I81A 1PD21 5CRDA 2IN3A 1LJRA 4ZBAA 4TKYA 4LL4B 4DSQA 2YWMA 5EY6A 2FWFA 2PUKC 4FH8A 1S3AA 3DKSA 2HZEB 2RM6A 2GLRA 4XS1A 4V1Ag 3MDKA 3TJGA 11GSA 4D73B 2RIIA 1GSUA 2LQQA 1FAAA 1G7OA 2LRTA 3EE2A 5DALB 2LRNA 5IM9A 5CRHA 2YCDA 2LJRA 1A24A 1EV4A 5KN3A 2GTUA 3ISOA 2ALBA 3US3A 2AB6A 5AIVA 4MABA 2M80A 1DBYA 3RDWA 2R4VA 1R7HA 1XW5A 4WBRD 3DD3A 2GQKA 6GSYA 3MSZA 2WDUA 2B7JA 3HJPA 5F05A 2H0HA 2LJKA 4F82A 5HR3A 1WMJA 1TRWA 2PGTA 1M7TA 3P2AA 1O8XA 5ECOB 3TGZA 3GRXA 3MNGA 5IOWA 3CXGA 2H01A 2PWJA 3WGDA 1A8LA 2JZTA 4GSNA 2DIZA 4MCUA 5BMUA 4D73A 2B3SA 1AW9A 5G31A 3ZTLA 1ZCPA 1FB6A 3FHKA 2HE3A 2HSMB 5DALA 5ECSA 2YP6A 3KP9A 4AJ8A 3DGQA 4ULXA 4KCEA 2L6CA 4XRDA 1SL1B 2ZCTA 2K6VA 4GTUA 3F4RA 1GUHA 1H4OA 1KBNA 2C0GA 3U6VA 3M8NA 2IMEA 3GX8A 3ZRDA 3TJBA 3I69A 4IP1A 3FZ4A 1ERVA 5JWRB 3J7Yb 5EL8A 2LQOA 3ZLPA 3F63A 3PGTA 3M9JA 3V1WA 3HKRA 5C00A 4NMUA 4KX4A 1GLQA 2DJ2A 4MJAA 3E9JB 2P5RA 3FZ9A 1GTIA 4N0VA 2YWOA 4PNFA 2NTOA 4KGIA 3TJFA 4J57E 4OCEA 2HSMA 2TRXA 5DAKB 1EWXA 3VWVA 3HD5A 1THXA 1VRSD 1FW1A 1Y25A 4MMMA 3UVHA 2K9FA 1PSQA 3C71A 3GKMA 6GSTA 4ZXGA 5KN1A 3FRCA 3VPTA 3M9KA 1K3LA 5ID2A 2HQTA 1A8YA 4OO5A 3EVIA 3NIVA 1AQWA 2DJKA 1MD3A 5D73A 2KOKA 4PQHA 4BA7A 2I3YA 2DJJA 5B6NA 4GSTA 3L0HA 1FB0A 1X5EA 5IQYA 4TR1B 4IKHA 3Q6OA 3WT2A 5ECLB 1ERWA 4EL1A 1FVJA 2CQ9A 4Q5QA 4EC0A 1Z3EA 2VCZA 2YZHA 2B1KA 4DSRA 22GSA 5ENUA 2V6KA 4RQXA 3AY8A 3TB2A 2FWEA 1YY7A 2VCQA 1EGOA 5DAKA 2X8GA 2O85A 3ZIVA 1SK2A 3IDVA 1ZMAA 4IHUA 2MBTA 1XWKA 5D9TA 1EZKA 1JFUA 2V32A 2Z9SA 3IPZA 5D9XA 2FUG2 4YQMA 3HA9A 4TOPA 2VL2C 1ERTA 4V1Ap 3DEXA 1X9MB 5G1KA 4GXZA 1PQNA 3G7IA 1XXUA 1A23A 3LEFA 2FD3A 4GRFA 2KP1A 7GSSA 5HR2A 2JZRA 2XBIA 3KP8A 2FWGA 3FR6A 5ECRB 5EVOA 3UJ1A 1NW2A 4FQUA 4ILFA 2L5LA 3I43A 2GSRA 4TVEA 1A2LA 3LGCA 3TCOA 3VFIA 1DE2A 5F8BA 4EDZA 3IK7A 4G0LA 4O32A 4IQAA 2OE0A 1TK0B 1AAZA 3GTUB 1JHBA 4BVXB 3ERWA 3TKSC 2GSQA 2JSYA 2I9HA 1XOAA 3GH9A 2HSNB 4LL1B 1SJIA 3FZAA 2VL2A 2VO4A 3GURA 5G5FA 4OFMA 3Q19A 3QFAC 3LG6A 2P5QA 3TDGA 2IFQB
chains in the Genus database with same CATH superfamily
1HNAA 4Q5FA 1BQ7A 5BRTA 5G2ZA 4V2MA 1TRVA 3EU3A 4JU5A 1S3CA 1WE0A 2H1AA 1XW6A 4KUNA 4MF5A 3DMLA 3IV4A 4K8MA 2LTKA 4L0UA 2DKHA 4KDXA 4CHSA 3GX0A 1Z7PA 1TI1A 3A2XA 2JU5A 1E2YA 3DVWA 4KDUA 1TKDB 3LSZA 3KMOA 1X9WB 4F0BA 4JR6A 2WFCA 3TOTA 3HVNA 3J7Yk 3GTUA 4AKHA 4BVXA 1ACVA 5GSSA 2HYXA 4F2IA 4EE0A 1TTZA 3BJ5A 4OWYA 3IR4A 5AISA 1K0MA 3APQA 3IAM2 3APOA 4HS1A 1ZL9A 2QC7A 3SWLA 4W66A 4I2UA 5CAXA 2X4AA 3KXOA 3LQ7A 3W8SA 2H73A 5J3RA 10GSA 4KDYA 1GSYA 1A0FA 4GQCA 2KUCA 3BBYA 4QQ7A 19GSA 2ON5A 1Z5YE 3OR5A 1G7EA 1TDIA 3CMIA 4TXOB 3R2QA 1YEPA 5JCUA 3PH9A 1EOHA 4AKGA 1ERUA 2KP2A 5A4UA 1FHEA 5J9BA 4AJ6A 2VM1A 2HFDA 1TJDA 2DBCA 2VIMA 2HZFA 1YDKA 2JZSA 4O92A 3HHVA 1R4WA 4MLYA 5J4UA 1PRXA 2GT5A 3QFBC 2EFHA 5GZZB 1T00A 3EC3A 4POKA 4ZL8A 3GUSA 3LFLA 1YF1A 1YZXA 5F06A 1Z7RA 1AUCA 4HUAA 1YF0A 2B5YA 4DEJA 5CP1A 5A1NA 5ECIB 5IPHA 1TK5B 2K8SA 1MDIA 3IK9A 1M0UA 5G30A 4L5OA 1ZYNA 4LLRA 5AN1A 2GDRA 1T8EB 1F9MA 1RQMA 5IO2A 4PNGA 9GSSA 1XWBA 4AF2A 3UL3A 1WP0A 4Q5NA 2B6MA 1U3IA 4E8HA 2YV9A 4EVMA 1UN2A 3I9V2 3ME8A 4ZB8A 1K0NA 4ZIJA 5HFKA 2X8HA 4O5QA 5LD0A 2H1GA 3H8QA 3CTFA 2G2QA 1V98A 4XCSA 1SL2B 3P7XA 4BPYA 3GN3A 4FXYP 1O81A 1GNWA 1EOGA 1XZOA 4F0CA 4IBPA 5AIXA 2K18A 3IA1A 5KN2A 2H8LA 4NHWA 1S4BP 2N5FA 3QCPA 3TUEA 1AC1A 4AKIA 4I6XA 5B6MA 2WVXB 2DC5A 3ZVJD 1ZYPA 3TJKA 2HRAA 1X5CA 1TU7A 2KLXA 1SENA 1FOVA 2L5OA 1XBSA 3TRXA 1FG4A 2H0GA 3O76A 2AJQB 4J2FA 3KH9A 3EMXA 2M46A 1M9AA 1K0OA 1XPVA 4YQVA 2IMDA 17GSA 3ERFA 2H30A 1KNGA 3D22A 2BJXA 4FIWA 4HEA2 1S3RA 1WOUA 1PX6A 3HCZA 5DCHA 4IVFA 3TOUA 3GMFA 5KEJA 2VL9A 2H76A 5H5QA 2O3EA 3DIEA 2FLSA 4RQRA 3C1SA 2WGRA 3EYTA 4IGJA 1DE1A 4KB3A 1BJXA 4YAPA 2R3XA 3PPUA 2NBSA 3FK8A 4NHZA 3ZFBA 1SYXA 1GNEA 2YJ7A 3D6IA 4AGSA 5DCGA 3RPNA 4TN8A 1UA5A 4E8EA 4Z7XA 3WYWA 1V40A 5GSTA 4IP6A 2C80A 3RPPA 1ABAA 4TXVA 2VCXA 1GP1A 3ZZXA 2G0FA 2GZYA 4WKWA 2WJUA 2A4HA 4OFNA 5CNWA 2REMA 3TJJA 3LYPA 2CX4A 2GZZA 4HU7A 4I2TA 2OE1A 1V2AA 2LV3A 8GSSA 3CRTA 4G0KA 2FHEA 5ID2B 2O8VB 4QL7A 1T1VA 2YJHA 1SVOA 3WGXA 5DVBA 1MEKA 2A2PA 1ON4A 3TKPA 1XW9A 2B7KA 4MH2A 2ON7A 3O6TA 2H71A 1B9XC 5DBQA 3KTLA 1BG1A 1A2MA 1XG8A 4KE3A 2GVPA 4K2XA 4PUFC 2CAIA 5HR1A 1QGVA 1W4VA 2X8CA 3UMAA 1PFOA 4K0NA 2VKZG 1Z9HA 1V58A 1SKWB 5LNKe 1YEWC 4MPFA 3LYKA 1TRUA 4FYUA 2OKAA 4X4JA 2WRTA 2RM5A 4HOJA 4WF4A 5L71A 3G9BA 3GKKA 2E2MA 5IMFA 1N25A 3BCKA 4IN0A 3KJYA 4L0WA 1XOBA 1R5AA 1NM3A 5CO3A 1QMVA 4N10A 3P8WA 2F51A 1F2EA 5INYA 3KM6A 3QPMA 5CRGA 1GUKA 3PR8A 1JLWA 3IE3A 2CT6A 1F3BA 3IRAA 3VLNA 3IHQA 1GRXA 6GSXA 3UAPA 3P90A 3UBKA 4MZCA 3GKXA 1PX7A 1BYEA 1PKZA 5EPFA 3CSJA 1GSDA 1RK4A 4TR0A 5ELGA 2DIYA 4PX1A 1E6BA 3UVTA 4G01A 3TKSE 6GSVA 3MIXA 2CAQA 2RUEA 2CZ2A 2YV7A 4NV5A 2MMZA 4X0XA 4TR4A 1K3OA 1MDJA 2OA7A 1OVNA 4EKZA 3VURA 2FCHA 4WF5A 3CQFA 1ZYEA 5A4VA 2LNTA 3H79A 1K0AA 3IXRA 1G6WA 4G10A 2D2ZA 4RI7A 2JSZA 2OACA 3FZ5A 1XCCA 3UBLA 1IYHA 5G5EA 1R26A 1WRYA 2MMNA 2GQMA 1UVZA 1EEMA 5J9CA 5ABRA 4DSSA 4JZQA 4YKGA 4CW9A 2DMMA 5D9VA 2R0CA 2C1YA 3EINA 4FYBA 1GTBA 1ZOFA 1TRSA 13GSA 4ECIA 1T4YA 4JRRA 2I4AA 3F3QA 3DYRA 4GLTA 5D96A 1DUGA 1F37A 1SK1A 5B8BA 4K7NA 5IMCA 4Z2RA 3DXBA 3D21A 4HZ2A 2HXKA 2QGVA 2PERA 2O89A 3GL3A 1J08A 5J4YA 1PMTA 3BD2A 1F6MC 3IOSA 4N3ZA 2M72A 5B8AA 2WW0A 3GNJA 5J41A 4O5UA 1G0TA 1J9BA 4NWYA 5AGYA 3CHXC 4MJCA 4TR3A 2N5AA 3L4NA 2GT6A 1EEJA 4XTSA 5A5HA 1U87A 3M0FA 2WB9A 1WWJA 4HU9A 5IO0A 1LBKA 2MMAA 1HNCA 1M9BA 1V9WA 3GL5A 2DJ1A 1LU4A 4TW5A 2IJYA 3F4TA 4K0GA 1OKDA 4MA9A 1M2AA 3KZQA 3RGBC 2WZ9A 4G9HA 3QR6A 2QKEA 12GSA 5ECMB 4JE1A 5JCWA 1A0RP 1KTEA 2O36A 1ZYQB 3GFKA 1H75A 3VWWA 2X64A 2WVYA 4PQIA 3RBTA 4OD7A 1PA3A 1TOFA 2YANA 2HLSA 2B5XA 5HFGA 2CVDA 1X9SB 3GA4A 1I9DA 1M3JA 3Q74A 4PUAA 4I97A 2FWHA 4BWSA 1OKTA 3D4TA 1A2JA 4OCFA 5D8IA 4IELA 3IBHA 5J47A 3ZYWA 1M99A 1GSSA 2VLTA 5F07A 3LJRA 1BAYA 5FWGA 2VD0A 4XS4B 1THOA 1GSFA 20GSA 1VF2A 2VCWA 5D93A 4MDCA 5H5RA 1K3YA 3TKSA 3F9UA 4PI2C 3GIXA 3RHBA 3HVXA 1BX9A 1UC7A 3CSIA 2OE3A 5ECQB 1SKSB 4N0ZA 3C7MA 5JCGA 5A1NB 2OADA 1B9YC 1WJKA 1V57A 4PTSA 3APSA 2OBKA 4PXOA 2C8UA 5J5NA 3QAGA 3E0UA 2VD1A 3TKQA 2UZ8A 2XPDA 3KH7A 5DQSA 3CTGA 2L57A 4O5RA 3RFRC 4WETA 5G1LA 2WCIA 4F03A 5IMDA 3HJMA 4ZB9A 2LNSA 3EWLA 5HR0A 3FEUA 5DJMA 1AXDA 4XS4A 1GWCA 4MK3A 2O7KA 4K5SA 3A5WA 4K1FA 1Q4JA 4KCAA 2EIOA 1YQ1A 1U6TA 4GQFA 1F3AA 2H66A 4TRXA 2X99A 1Q98A 2OBIA 3CSHA 3MAKA 3VI7A 2CX3A 2CZ3A 2A2RA 3SBCA 4EDYA 4EF0A 3TKRA 5IIZA 2IMIA 2GQLA 2XC2A 4NXIA 1C72A 4ZILA 3A5IA 3BOAA 4X43A 2ES7A 4ECJA 3IHGA 2EC4A 2NPBA 2IPAA 1KEBA 1ZZYA 2YPMA 2C4JA 1XWAA 2A4VA 1AIUA 2FNOA 2CVBA 3VK9A 2CV4A 1ZGNA 1O85A 2HSYA 3L78A 4JBBA 1M2BA 1N2AA 4KW6A 4PURA 2XHFA 1JLVA 2TIRA 1AQVA 5E4WA 3E3EA 1CQHA 2NVLA 2IL3A 3IAS2 2TRCP 3LXTA 1XVQA 3A2WA 1HQOA 4K7OA 1B4PA 2HI7A 3Q18A 1O73A 5IOXA 2AHEA 3ZMKA 1GL8A 2LKUA 4KA0A 3GKNA 4NV2A 1RW1A 1USBA 4ZB6A 4ML6A 4MZBA 2O5VA 1J0FA 5H5SA 1OAZA 3TRPA 4HI7A 4IW9A 4L8EA 4HQZA 3QDNA 4AJ7A 1T4ZA 3H93A 3S9FA 2LJAA 3EURA 4IJIA 4P3YB 4WR4A 2RLIA 1X5DA 2O87A 4K2DA 2PVQA 4XS6A 3HYPA 3DWVA 4EUYA 6GSUA 4KNDA 4ISDA 3GHAA 4MJBA 1JZRA 3HZ4A 4RUVA 2LUSA 6GSSA 1NHOA 3IC4A 2R6KA 3D5JA 1XVWA 2WW1A 4BIKA 3L9UA 2JADA 4ID0A 3UOMA 3F0IA 3LXZA 3FW2A 2NDOA 2AV4A 2CVKA 2BTOT 2C0FA 3ZL5A 3KGKA 1T7PB 2OJLA 5A34A 5DQYA 5B7CA 2YOIA 4POLA 4BWQA 2E7PA 1QQ2A 1QFNA 3M1GA 4Q5RA 2H70A 4IS0A 2C3QA 4NPBA 4WXTA 4K7IA 4KSMA 3H1NA 1BF5A 1JZWA 1B48A 2R0GA 4CDOA 5A5KA 3CYNA 2F8FA 1JZDA 1QK8A 4KSOA 1PL2A 4YAVA 5A4WA 1TI3A 3RHCA 2V1MA 1VF1A 4YKFA 4GF0A 5KOXA 3GH6A 2HZEA 2L4QA 2WULA 3WD6A 3HY2A 3GSSA 4K5RA 5COHA 1M2DA 4DVCA 1GULA 1MTCA 2FY6A 3FYGA 2EFCA 1FVKA 1Z6MA 1DSBA 5CREA 1TXXA 2VLUA 1GSQA 3QD9A 1OE8A 1SK0A 3RAZA 2VCVA 2V2GA 1NHYA 4KAEA 1OYJA 2PMTA 2H1DA 4G0IA 1AQXA 1CQGA 1Y1UA 4V2LA 3GYKA 4MZWA 4JR4A 1PL1A 2MMOA 3H4KA 5DDLA 3KCMA 4HJ2A 4WEYA 6GSWA 2J23A 4AKXB 2LRCA 2F3MA 4E68A 4LMWA 2H1LA 2J9HA 4PGTA 2LS5A 1Y6EA 3FKFA 2RUFA 3QAVA 3HVSA 4DSSB 1W89A 4A5PA 4V2NA 3KEBA 3ED3A 3ERGA 4BL7B 2FGXA 2MYGA 3C8EA 2H19A 2L6DA 1WPIA 1I5GA 2JL4A 2B5EA 3I6AA 2H6ZA 3O3TA 4BVYB 2HNLA 2WZSA 4XHMA 1YEXA 2IWTA 2GS3A 2C0EA 1QUWA 3HXSA 4NAXA 2C0DA 5DJLA 2DJ3A 4MH3A 2BMXA 4EXJA 1K0BA 2H6XA 1HD2A 3HDCA 3UARA 2IIYA 4OMVA 2HRKB 5HQPA 4YQUA 5A5HB 1MD4A 2XPEA 5ELAA 2ZUPA 1XWCA 5ECHB 4MF6A 1XFLA 2HSHA 3A2VA 3F6DA 2PN8A 4HQSA 5IMVA 1XWGA 2WS2A 1O8WA 1OC9B 4KH7A 14GSA 3ZFLA 4O7HA 4LMVA 2PBJA 2QSIA 1TK8B 4BL7A 3R3EA 1G6YA 2R37A 1EP7A 4WBJA 3N9JA 5ECKB 2AYTA 2IMKA 4X1UA 3KTBA 1FO5A 4BVYA 1GUMA 3DVXA 3HZ8A 1PN0A 3A3TA 5D9WA 4F9ZA 1U88A 2DSAA 4EO3A 4FYCA 2AUVA 1K0DA 3ZVJA 1ILOA 3VPQA 3U5RE 5C04A 4Z2TA 4ZL7A 1O6JA 1OC8A 1NSWA 2HRFA 2AAWA 4ZL9A 2DJ0A 1MDKA 3C73A 3FR3A 1SL0B 2HRKA 3GSTA 4TR1A 2GGTA 4KF9A 3BCIA 1PN9A 3HMJG 2R2JA 1PKWA 2A2SA 4OO4A 2VL3A 3QOUA 4OFTA 1Z6NA 1SYRA 2V6OA 5CYYA 1OC9A 4EIPA 3VWXA 3G7JA 1ST9A 3EPTA 1SKRB 2UV8G 3HVVA 1URMA 1YKAA 3L9SA 3L9VA 1B8XA 1SD8A 2MBSA 1R5PA 5FT3A 2F9SA 5IMAA 2F8AA 1TP9A 2PVOC 3GV1A 4GCIA 2L4CA 2YWIA 4MF7A 2H75A 2YWNA 3C1RA 1BG5A 2L59A 2E0QA 4RI6A 16GSA 5GAPD 1EP8A 1B4QA 3N5OA 4HDEA 2DLXA 3W6GA 5F0GA 1WIKA 5CRWA 2N5BA 3EMPA 1TW9A 1SJZA 3UEMA 1SD9A 3PINA 4MNNA 1IYIA 4ZBDA 2LEGA 4ECBA 4XRAA 3CRUA 2V41A 3VI5A 1K0CA 3F3RA 3EU4A 5J4VA 3F8UA 2VOCA 3WGEA 4EIQA 1BEDA 1GSEA 1SJ6A 4AI6A 4GDFA 2PPTA 4POBA 3F6FA 2GZPA 2VM2A 2ZNMA 1X0RA 4YH2A 4I8BA 2I1UA 2K8VA 3NOFA 5FHIA 5JWQB 5ECNB 2VUPA 3JCML 2C3NA 3CBUA 1GLPA 1PGTA 2VAFA 4J56E 2EFEA 2GSSA 4ZBBA 1EV9A 4K9ZA 4CY6A 2HSNA 1I1IP 5LCZA 4N30A 4IJ3A 4G2EA 4HZ4A 5GAND 2LSTA 5JWOB 4GWRA 1VF4A 4WR5A 3NZNA 4I5QA 2IFQA 1VGLA 4PQ1A 2H74A 2VCTA 3KIJA 1FOHA 1GH2A 3F4SA 1YJ6A 1U3AA 2QA2A 5E59A 2HT9A 4MP4A 1VF3A 4ML1A 3KMNA 3TU3B 2XBQA 2FA4A 3UIWA 4MJEA 5ECPB 3DRNA 1GTUA 2YZUA 1EGRA 3TRQA 4GSSA 1XIYA 2YN1A 1O7UA 1HYUA 2HRNA 2P31A 1SU9A 3MWHA 3FR9A 3WT1A 1GTAA 3W8JA 4H86A 4HJMA 1OE7A 3LWAA 4N11A 2B1LA 4POMA 3VWUA 2EIRA 2PU9C 2H72A 4G19A 4FO5A 2R5GA 5IMZA 3ZMLA 3QAWA 2H1BA 2MZCA 2H6YA 3ZIJA 3D4MA 3ZREA 3KD0A 3FY7A 4JEDA 2FA8A 1TU8A 2IMFA 1QXHA 4ECCA 2H0IA 1SVLA 2DMLA 1N8JA 2E2GA 4XIHA 2KHPA 4USSA 1JZOA 4ACSA 2P0GA 2GSTA 4TXOA 4MPGA 5IPGA 1HNBA 3ME7A 3G7YA 3IC8A 2YNXA 1S3DA 3D0ZA 2CA8A 4IQ1A 4ZB7A 1YKCA 2EIQA 18GSA 3QMXA 4L5LA 1SVMA 4QL9A 2VLVA 1ML6A 3LORA 5A34B 1OC3A 2C3TA 2JACA 4K6XA 3ZITA 3LW9A 3HJOA 5HFIA 5KN0A 3K8NA 4LA1A 3M3MA 1T3BA 2I81A 1PD21 4CY8A 5CRDA 2IN3A 1LJRA 4ZBAA 4TKYA 4LL4B 4DSQA 1M3IA 2YWMA 5EY6A 2FWFA 4HSCX 2PUKC 4FH8A 1S3AA 2WW2A 3DKSA 2HZEB 2RM6A 2GLRA 4XS1A 4V1Ag 3MDKA 3TJGA 5BMUB 11GSA 4D73B 2RIIA 3FMWA 1GSUA 2LQQA 1FAAA 1G7OA 2LRTA 3EE2A 5DALB 2LRNA 5IM9A 5CRHA 2YCDA 2LJRA 1A24A 1EV4A 5KN3A 2GTUA 3ISOA 2EFDA 2ALBA 3US3A 2AB6A 5AIVA 4MABA 2M80A 1DBYA 3RDWA 2R4VA 1R7HA 1XW5A 4WBRD 3DD3A 2GQKA 6GSYA 3MSZA 2WDUA 2B7JA 3HJPA 5F05A 2H0HA 2LJKA 4F82A 2WVXA 5HR3A 1WMJA 1TRWA 2PGTA 1M7TA 3P2AA 1O8XA 5ECOB 3TGZA 3GRXA 3MNGA 5IOWA 4ICYA 3CXGA 2H01A 2PWJA 3WGDA 1A8LA 2JZTA 4GSNA 2DIZA 4MCUA 5BMUA 4D73A 2B3SA 1AW9A 5G31A 3ZTLA 1ZCPA 1FB6A 3FHKA 2HE3A 2HSMB 5DALA 5ECSA 2YP6A 3KP9A 4AJ8A 3DGQA 4ULXA 4KCEA 2L6CA 4XRDA 1SL1B 2ZCTA 2K6VA 4GTUA 3F4RA 5J40A 1GUHA 1H4OA 1KBNA 2C0GA 2R0PA 3U6VA 3M8NA 2IMEA 3GX8A 3ZRDA 3TJBA 4Z2UA 3I69A 4IP1A 3FZ4A 1ERVA 5JWRB 3J7Yb 5EL8A 2LQOA 3ZLPA 3F63A 3PGTA 2QA1A 3M9JA 3V1WA 4PHZC 3HKRA 5C00A 4NMUA 4KX4A 1GLQA 2DJ2A 4MJAA 3E9JB 2P5RA 2WW3A 3FZ9A 1GTIA 4N0VA 2YWOA 4PNFA 2NTOA 4KGIA 3TJFA 4J57E 4OCEA 2HSMA 2TRXA 5DAKB 1EWXA 3VWVA 3HD5A 1THXA 1VRSD 1FW1A 1Y25A 4MMMA 3UVHA 2K9FA 1PSQA 3C71A 3GKMA 6GSTA 4ZXGA 5KN1A 3FRCA 3VPTA 3M9KA 1K3LA 5ID2A 3CWGA 2HQTA 1A8YA 4OO5A 3EVIA 3NIVA 1AQWA 2DJKA 1MD3A 5D73A 2KOKA 4PQHA 4BA7A 2I3YA 2DJJA 5B6NA 4GSTA 3L0HA 1FB0A 1X5EA 5IQYA 4TR1B 4IKHA 3Q6OA 3WT2A 5ECLB 1ERWA 4EL1A 1FVJA 2CQ9A 1TXUA 4Q5QA 4EC0A 1Z3EA 2VCZA 2YZHA 2B1KA 4DSRA 22GSA 5ENUA 2V6KA 4RQXA 3AY8A 3TB2A 2FWEA 1YY7A 2VCQA 1EGOA 5DAKA 2X8GA 2O85A 3ZIVA 2WVZA 1SK2A 3IDVA 1ZMAA 4IHUA 2MBTA 1XWKA 5D9TA 1EZKA 1YVLA 1JFUA 2V32A 2Z9SA 3IPZA 5D9XA 2FUG2 2X49A 4YQMA 3HA9A 4TOPA 2VL2C 1ERTA 4V1Ap 3DEXA 1X9MB 5G1KA 4GXZA 5KOWA 1PQNA 2DKIA 3G7IA 1XXUA 1A23A 3LEFA 2FD3A 4GRFA 2KP1A 7GSSA 5HR2A 2JZRA 3MYDA 2XBIA 3KP8A 2FWGA 3FR6A 5ECRB 5EVOA 3UJ1A 1NW2A 4FQUA 4ILFA 2L5LA 3I43A 2GSRA 4TVEA 1A2LA 3LGCA 3TCOA 3VFIA 1DE2A 5F8BA 4EDZA 3IK7A 4G0LA 4PI0C 4O32A 4IQAA 2OE0A 4QMKA 1TK0B 1AAZA 3GTUB 1JHBA 4BVXB 3ERWA 3TKSC 2GSQA 2JSYA 2I9HA 1XOAA 3GH9A 2HSNB 4LL1B 1SJIA 3FZAA 2VL2A 2VO4A 3GURA 5G5FA 4OFMA 3Q19A 2OT3A 3QFAC 3LG6A 2P5QA 3TDGA 2IFQB
chains in the Genus database with same CATH topology
1HNAA 4Q5FA 1BQ7A 5BRTA 5G2ZA 4V2MA 1TRVA 3EU3A 4JU5A 1S3CA 1WE0A 2H1AA 1XW6A 4KUNA 4MF5A 3DMLA 3IV4A 4K8MA 2LTKA 4L0UA 2DKHA 4KDXA 4CHSA 3GX0A 1Z7PA 1TI1A 3A2XA 2JU5A 1E2YA 3DVWA 4KDUA 1TKDB 3LSZA 3KMOA 1X9WB 4F0BA 4JR6A 2WFCA 3TOTA 3J7Yk 3GTUA 4AKHA 4BVXA 1ACVA 5GSSA 2HYXA 4F2IA 4EE0A 1TTZA 3BJ5A 4OWYA 3IR4A 5AISA 1K0MA 3APQA 3IAM2 3APOA 4HS1A 1ZL9A 2QC7A 3SWLA 4W66A 4I2UA 5CAXA 2X4AA 3KXOA 3LQ7A 3W8SA 2H73A 5J3RA 10GSA 4KDYA 1GSYA 1A0FA 4GQCA 2KUCA 3BBYA 4QQ7A 19GSA 2ON5A 1Z5YE 3OR5A 1G7EA 1TDIA 3CMIA 4TXOB 3R2QA 1YEPA 5JCUA 3PH9A 1EOHA 4AKGA 1ERUA 2KP2A 5A4UA 1FHEA 5J9BA 4AJ6A 2VM1A 2HFDA 1TJDA 2DBCA 2VIMA 2HZFA 1YDKA 2JZSA 4O92A 3HHVA 1R4WA 4MLYA 5J4UA 1PRXA 2GT5A 3QFBC 2EFHA 5GZZB 1T00A 3EC3A 4POKA 4ZL8A 3GUSA 3LFLA 1YF1A 1YZXA 5F06A 1Z7RA 1AUCA 4HUAA 1YF0A 2B5YA 4DEJA 5CP1A 5A1NA 5ECIB 5IPHA 1TK5B 2K8SA 1MDIA 3IK9A 1M0UA 5G30A 4L5OA 1ZYNA 4LLRA 5AN1A 2GDRA 1T8EB 1F9MA 1RQMA 5IO2A 4PNGA 9GSSA 1XWBA 4AF2A 3UL3A 1WP0A 4Q5NA 2B6MA 1U3IA 4E8HA 2YV9A 4EVMA 1UN2A 3I9V2 3ME8A 4ZB8A 1K0NA 4ZIJA 5HFKA 2X8HA 4O5QA 5LD0A 2H1GA 3H8QA 3CTFA 2G2QA 1V98A 4XCSA 1SL2B 3P7XA 4BPYA 3GN3A 1O81A 1GNWA 1EOGA 1XZOA 4F0CA 4IBPA 5AIXA 2K18A 3IA1A 5KN2A 2H8LA 4NHWA 2N5FA 3QCPA 3TUEA 1AC1A 4AKIA 4I6XA 5B6MA 2DC5A 3ZVJD 1ZYPA 3TJKA 2HRAA 1X5CA 1TU7A 2KLXA 1SENA 1FOVA 2L5OA 1XBSA 3TRXA 1FG4A 2H0GA 3O76A 2AJQB 4J2FA 3KH9A 3EMXA 2M46A 1M9AA 1K0OA 1XPVA 4YQVA 2IMDA 17GSA 3ERFA 2H30A 1KNGA 3D22A 2BJXA 4FIWA 4HEA2 1WOUA 1PX6A 3HCZA 5DCHA 4IVFA 3TOUA 3GMFA 5KEJA 2VL9A 2H76A 5H5QA 3DIEA 2FLSA 4RQRA 3C1SA 2WGRA 3EYTA 4IGJA 1DE1A 4KB3A 1BJXA 4YAPA 2R3XA 3PPUA 2NBSA 3FK8A 4NHZA 3ZFBA 1SYXA 1GNEA 2YJ7A 3D6IA 4AGSA 5DCGA 3RPNA 4TN8A 1UA5A 4E8EA 4Z7XA 3WYWA 1V40A 5GSTA 4IP6A 2C80A 3RPPA 1ABAA 4TXVA 2VCXA 1GP1A 3ZZXA 2G0FA 2GZYA 4WKWA 2WJUA 2A4HA 4OFNA 5CNWA 2REMA 3TJJA 3LYPA 2CX4A 2GZZA 4HU7A 4I2TA 2OE1A 1V2AA 2LV3A 8GSSA 3CRTA 4G0KA 2FHEA 5ID2B 2O8VB 4QL7A 1T1VA 2YJHA 1SVOA 3WGXA 5DVBA 1MEKA 2A2PA 1ON4A 3TKPA 1XW9A 2B7KA 4MH2A 2ON7A 3O6TA 2H71A 1B9XC 5DBQA 3KTLA 1BG1A 1A2MA 4KE3A 2GVPA 4K2XA 4PUFC 2CAIA 5HR1A 1QGVA 1W4VA 2X8CA 3UMAA 4K0NA 2VKZG 1Z9HA 1V58A 1SKWB 5LNKe 4MPFA 3LYKA 1TRUA 4FYUA 2OKAA 4X4JA 2WRTA 2RM5A 4HOJA 4WF4A 5L71A 3G9BA 3GKKA 2E2MA 5IMFA 1N25A 3BCKA 4IN0A 3KJYA 4L0WA 1XOBA 1R5AA 1NM3A 5CO3A 1QMVA 4N10A 3P8WA 2F51A 1F2EA 5INYA 3KM6A 3QPMA 5CRGA 1GUKA 3PR8A 1JLWA 3IE3A 2CT6A 1F3BA 3IRAA 3VLNA 3IHQA 1GRXA 6GSXA 3UAPA 3P90A 3UBKA 4MZCA 3GKXA 1PX7A 1BYEA 1PKZA 5EPFA 3CSJA 1GSDA 1RK4A 4TR0A 5ELGA 2DIYA 4PX1A 1E6BA 3UVTA 4G01A 3TKSE 6GSVA 3MIXA 2CAQA 2RUEA 2CZ2A 2YV7A 4NV5A 2MMZA 4X0XA 4TR4A 1K3OA 1MDJA 2OA7A 1OVNA 4EKZA 3VURA 2FCHA 4WF5A 1ZYEA 5A4VA 2LNTA 3H79A 1K0AA 3IXRA 1G6WA 4G10A 2D2ZA 4RI7A 2JSZA 2OACA 3FZ5A 1XCCA 3UBLA 1IYHA 5G5EA 1R26A 1WRYA 2MMNA 2GQMA 1UVZA 1EEMA 5J9CA 5ABRA 4DSSA 4JZQA 4YKGA 4CW9A 2DMMA 5D9VA 2R0CA 2C1YA 3EINA 4FYBA 1GTBA 1ZOFA 1TRSA 13GSA 4ECIA 1T4YA 4JRRA 2I4AA 3F3QA 3DYRA 4GLTA 5D96A 1DUGA 1F37A 1SK1A 5B8BA 4K7NA 5IMCA 4Z2RA 3DXBA 3D21A 4HZ2A 2HXKA 2QGVA 2PERA 2O89A 3GL3A 1J08A 5J4YA 1PMTA 3BD2A 1F6MC 3IOSA 4N3ZA 2M72A 5B8AA 3GNJA 5J41A 4O5UA 1G0TA 1J9BA 4NWYA 5AGYA 4MJCA 4TR3A 2N5AA 3L4NA 2GT6A 1EEJA 4XTSA 5A5HA 1U87A 3M0FA 2WB9A 1WWJA 4HU9A 5IO0A 1LBKA 2MMAA 1HNCA 1M9BA 1V9WA 3GL5A 2DJ1A 1LU4A 4TW5A 2IJYA 3F4TA 4K0GA 1OKDA 4MA9A 1M2AA 3KZQA 2WZ9A 4G9HA 3QR6A 2QKEA 12GSA 5ECMB 4JE1A 5JCWA 1A0RP 1KTEA 1ZYQB 3GFKA 1H75A 3VWWA 2X64A 4PQIA 3RBTA 4OD7A 1PA3A 1TOFA 2YANA 2HLSA 2B5XA 5HFGA 2CVDA 1X9SB 3GA4A 1I9DA 3Q74A 4PUAA 4I97A 2FWHA 4BWSA 1OKTA 3D4TA 1A2JA 4OCFA 5D8IA 4IELA 3IBHA 5J47A 3ZYWA 1M99A 1GSSA 2VLTA 5F07A 3LJRA 1BAYA 5FWGA 2VD0A 4XS4B 1THOA 1GSFA 20GSA 1VF2A 2VCWA 5D93A 4MDCA 5H5RA 1K3YA 3TKSA 3F9UA 3GIXA 3RHBA 3HVXA 1BX9A 1UC7A 3CSIA 2OE3A 5ECQB 1SKSB 4N0ZA 3C7MA 5JCGA 5A1NB 2OADA 1B9YC 1WJKA 1V57A 4PTSA 3APSA 2OBKA 4PXOA 2C8UA 5J5NA 3QAGA 3E0UA 2VD1A 3TKQA 2UZ8A 2XPDA 3KH7A 5DQSA 3CTGA 2L57A 4O5RA 4WETA 5G1LA 2WCIA 4F03A 5IMDA 3HJMA 4ZB9A 2LNSA 3EWLA 5HR0A 3FEUA 5DJMA 1AXDA 4XS4A 1GWCA 4MK3A 2O7KA 4K5SA 3A5WA 4K1FA 1Q4JA 4KCAA 2EIOA 1YQ1A 1U6TA 4GQFA 1F3AA 2H66A 4TRXA 2X99A 1Q98A 2OBIA 3CSHA 3MAKA 3VI7A 2CX3A 2CZ3A 2A2RA 3SBCA 4EDYA 4EF0A 3TKRA 5IIZA 2IMIA 2GQLA 2XC2A 4NXIA 1C72A 4ZILA 3A5IA 3BOAA 4X43A 2ES7A 4ECJA 3IHGA 2EC4A 2NPBA 2IPAA 1KEBA 1ZZYA 2YPMA 2C4JA 1XWAA 2A4VA 1AIUA 2FNOA 2CVBA 3VK9A 2CV4A 1ZGNA 1O85A 2HSYA 3L78A 4JBBA 1M2BA 1N2AA 4KW6A 4PURA 2XHFA 1JLVA 2TIRA 1AQVA 5E4WA 3E3EA 1CQHA 2NVLA 2IL3A 3IAS2 2TRCP 3LXTA 1XVQA 3A2WA 1HQOA 4K7OA 1B4PA 2HI7A 3Q18A 1O73A 5IOXA 2AHEA 3ZMKA 1GL8A 2LKUA 4KA0A 3GKNA 4NV2A 1RW1A 1USBA 4ZB6A 4ML6A 4MZBA 2O5VA 1J0FA 5H5SA 1OAZA 3TRPA 4HI7A 4IW9A 4L8EA 4HQZA 3QDNA 4AJ7A 1T4ZA 3H93A 3S9FA 2LJAA 3EURA 4IJIA 4P3YB 4WR4A 2RLIA 1X5DA 2O87A 4K2DA 2PVQA 4XS6A 3HYPA 3DWVA 4EUYA 6GSUA 4KNDA 4ISDA 3GHAA 4MJBA 1JZRA 3HZ4A 4RUVA 2LUSA 6GSSA 1NHOA 3IC4A 2R6KA 3D5JA 1XVWA 3L9UA 2JADA 4ID0A 3UOMA 3F0IA 3LXZA 3FW2A 2NDOA 2AV4A 2CVKA 2BTOT 2C0FA 3ZL5A 3KGKA 1T7PB 2OJLA 5A34A 5DQYA 5B7CA 2YOIA 4POLA 4BWQA 2E7PA 1QQ2A 1QFNA 3M1GA 4Q5RA 2H70A 4IS0A 2C3QA 4NPBA 4WXTA 4K7IA 4KSMA 3H1NA 1BF5A 1JZWA 1B48A 2R0GA 4CDOA 5A5KA 3CYNA 2F8FA 1JZDA 1QK8A 4KSOA 1PL2A 4YAVA 5A4WA 1TI3A 3RHCA 2V1MA 1VF1A 4YKFA 4GF0A 5KOXA 3GH6A 2HZEA 2L4QA 2WULA 3WD6A 3HY2A 3GSSA 4K5RA 5COHA 1M2DA 4DVCA 1GULA 1MTCA 2FY6A 3FYGA 2EFCA 1FVKA 1Z6MA 1DSBA 5CREA 1TXXA 2VLUA 1GSQA 3QD9A 1OE8A 1SK0A 3RAZA 2VCVA 2V2GA 1NHYA 4KAEA 1OYJA 2PMTA 2H1DA 4G0IA 1AQXA 1CQGA 1Y1UA 4V2LA 3GYKA 4MZWA 4JR4A 1PL1A 2MMOA 3H4KA 5DDLA 3KCMA 4HJ2A 4WEYA 6GSWA 2J23A 4AKXB 2LRCA 2F3MA 4E68A 4LMWA 2H1LA 2J9HA 4PGTA 2LS5A 1Y6EA 3FKFA 2RUFA 3QAVA 3HVSA 4DSSB 1W89A 4A5PA 4V2NA 3KEBA 3ED3A 3ERGA 4BL7B 2FGXA 2MYGA 3C8EA 2H19A 2L6DA 1WPIA 1I5GA 2JL4A 2B5EA 3I6AA 2H6ZA 3O3TA 4BVYB 2HNLA 4XHMA 1YEXA 2IWTA 2GS3A 2C0EA 1QUWA 3HXSA 4NAXA 2C0DA 5DJLA 2DJ3A 4MH3A 2BMXA 4EXJA 1K0BA 2H6XA 1HD2A 3HDCA 3UARA 2IIYA 4OMVA 2HRKB 5HQPA 4YQUA 5A5HB 1MD4A 2XPEA 5ELAA 2ZUPA 1XWCA 5ECHB 4MF6A 1XFLA 2HSHA 3A2VA 3F6DA 2PN8A 4HQSA 5IMVA 1XWGA 2WS2A 1O8WA 1OC9B 4KH7A 14GSA 3ZFLA 4O7HA 4LMVA 2PBJA 2QSIA 1TK8B 4BL7A 3R3EA 1G6YA 2R37A 1EP7A 4WBJA 3N9JA 5ECKB 2AYTA 2IMKA 4X1UA 3KTBA 1FO5A 4BVYA 1GUMA 3DVXA 3HZ8A 1PN0A 3A3TA 5D9WA 4F9ZA 1U88A 2DSAA 4EO3A 4FYCA 2AUVA 1K0DA 3ZVJA 1ILOA 3VPQA 3U5RE 5C04A 4Z2TA 4ZL7A 1O6JA 1OC8A 1NSWA 2HRFA 2AAWA 4ZL9A 2DJ0A 1MDKA 3C73A 3FR3A 1SL0B 2HRKA 3GSTA 4TR1A 2GGTA 4KF9A 3BCIA 1PN9A 3HMJG 2R2JA 1PKWA 2A2SA 4OO4A 2VL3A 3QOUA 4OFTA 1Z6NA 1SYRA 2V6OA 5CYYA 1OC9A 4EIPA 3VWXA 3G7JA 1ST9A 3EPTA 1SKRB 2UV8G 3HVVA 1URMA 1YKAA 3L9SA 3L9VA 1B8XA 1SD8A 2MBSA 1R5PA 5FT3A 2F9SA 5IMAA 2F8AA 1TP9A 2PVOC 3GV1A 4GCIA 2L4CA 2YWIA 4MF7A 2H75A 2YWNA 3C1RA 1BG5A 2L59A 2E0QA 4RI6A 16GSA 5GAPD 1EP8A 1B4QA 3N5OA 4HDEA 2DLXA 3W6GA 5F0GA 1WIKA 5CRWA 2N5BA 3EMPA 1TW9A 1SJZA 3UEMA 1SD9A 3PINA 4MNNA 1IYIA 4ZBDA 2LEGA 4ECBA 4XRAA 3CRUA 2V41A 3VI5A 1K0CA 3F3RA 3EU4A 5J4VA 3F8UA 2VOCA 3WGEA 4EIQA 1BEDA 1GSEA 1SJ6A 4AI6A 4GDFA 2PPTA 4POBA 3F6FA 2GZPA 2VM2A 2ZNMA 1X0RA 4YH2A 4I8BA 2I1UA 2K8VA 3NOFA 5FHIA 5JWQB 5ECNB 2VUPA 3JCML 2C3NA 3CBUA 1GLPA 1PGTA 2VAFA 4J56E 2EFEA 2GSSA 4ZBBA 1EV9A 4K9ZA 4CY6A 2HSNA 5LCZA 4N30A 4IJ3A 4G2EA 4HZ4A 5GAND 2LSTA 5JWOB 4GWRA 1VF4A 4WR5A 3NZNA 4I5QA 2IFQA 1VGLA 4PQ1A 2H74A 3KIJA 2VCTA 1FOHA 1GH2A 3F4SA 1YJ6A 1U3AA 2QA2A 5E59A 2HT9A 4MP4A 1VF3A 4ML1A 3KMNA 3TU3B 2XBQA 2FA4A 3UIWA 4MJEA 5ECPB 3DRNA 1GTUA 2YZUA 1EGRA 3TRQA 4GSSA 1XIYA 2YN1A 1O7UA 1HYUA 2HRNA 2P31A 1SU9A 3MWHA 3FR9A 3WT1A 1GTAA 3W8JA 4H86A 4HJMA 1OE7A 3LWAA 4N11A 2B1LA 4POMA 3VWUA 2EIRA 2PU9C 2H72A 4G19A 4FO5A 2R5GA 5IMZA 3ZMLA 3QAWA 2H1BA 2MZCA 2H6YA 3ZIJA 3D4MA 3ZREA 3KD0A 3FY7A 4JEDA 2FA8A 1TU8A 2IMFA 1QXHA 4ECCA 2H0IA 1SVLA 2DMLA 1N8JA 2E2GA 4XIHA 2KHPA 4USSA 1JZOA 4ACSA 2P0GA 2GSTA 4TXOA 4MPGA 5IPGA 1HNBA 3ME7A 3G7YA 3IC8A 2YNXA 1S3DA 3D0ZA 2CA8A 4IQ1A 4ZB7A 1YKCA 2EIQA 18GSA 3QMXA 4L5LA 1SVMA 4QL9A 2VLVA 1ML6A 3LORA 5A34B 1OC3A 2C3TA 2JACA 4K6XA 3ZITA 3LW9A 3HJOA 5HFIA 5KN0A 3K8NA 4LA1A 3M3MA 1T3BA 2I81A 1PD21 4CY8A 5CRDA 2IN3A 1LJRA 4ZBAA 4TKYA 4LL4B 4DSQA 2YWMA 5EY6A 2FWFA 2PUKC 4FH8A 1S3AA 3DKSA 2HZEB 2RM6A 2GLRA 4XS1A 4V1Ag 3MDKA 3TJGA 5BMUB 11GSA 4D73B 2RIIA 3FMWA 1GSUA 2LQQA 1FAAA 1G7OA 2LRTA 3EE2A 5DALB 2LRNA 5IM9A 5CRHA 2YCDA 2LJRA 1A24A 1EV4A 5KN3A 2GTUA 3ISOA 2EFDA 2ALBA 3US3A 2AB6A 5AIVA 4MABA 2M80A 1DBYA 3RDWA 2R4VA 1R7HA 1XW5A 4WBRD 3DD3A 2GQKA 6GSYA 3MSZA 2WDUA 2B7JA 3HJPA 5F05A 2H0HA 2LJKA 4F82A 5HR3A 1WMJA 1TRWA 2PGTA 1M7TA 3P2AA 1O8XA 5ECOB 3TGZA 3GRXA 3MNGA 5IOWA 4ICYA 3CXGA 2H01A 2PWJA 3WGDA 1A8LA 2JZTA 4GSNA 2DIZA 4MCUA 5BMUA 4D73A 2B3SA 1AW9A 5G31A 3ZTLA 1ZCPA 1FB6A 3FHKA 2HE3A 2HSMB 5DALA 5ECSA 2YP6A 3KP9A 4AJ8A 3DGQA 4ULXA 4KCEA 2L6CA 4XRDA 1SL1B 2ZCTA 2K6VA 4GTUA 3F4RA 5J40A 1GUHA 1H4OA 1KBNA 2C0GA 2R0PA 3U6VA 3M8NA 2IMEA 3GX8A 3ZRDA 3TJBA 4Z2UA 3I69A 4IP1A 3FZ4A 1ERVA 5JWRB 3J7Yb 5EL8A 2LQOA 3ZLPA 3F63A 3PGTA 2QA1A 3M9JA 3V1WA 3HKRA 5C00A 4NMUA 4KX4A 1GLQA 2DJ2A 4MJAA 3E9JB 2P5RA 3FZ9A 1GTIA 4N0VA 2YWOA 4PNFA 2NTOA 4KGIA 3TJFA 4J57E 4OCEA 2HSMA 2TRXA 5DAKB 1EWXA 3VWVA 3HD5A 1THXA 1VRSD 1FW1A 1Y25A 4MMMA 3UVHA 2K9FA 1PSQA 3C71A 3GKMA 6GSTA 4ZXGA 5KN1A 3FRCA 3VPTA 3M9KA 1K3LA 5ID2A 3CWGA 2HQTA 1A8YA 4OO5A 3EVIA 3NIVA 1AQWA 2DJKA 1MD3A 5D73A 2KOKA 4PQHA 4BA7A 2I3YA 2DJJA 5B6NA 4GSTA 3L0HA 1FB0A 1X5EA 5IQYA 4TR1B 4IKHA 3Q6OA 3WT2A 5ECLB 1ERWA 4EL1A 1FVJA 2CQ9A 1TXUA 4Q5QA 4EC0A 1Z3EA 2VCZA 2YZHA 2B1KA 4DSRA 22GSA 5ENUA 2V6KA 4RQXA 3AY8A 3TB2A 2FWEA 1YY7A 2VCQA 1EGOA 5DAKA 2X8GA 2O85A 3ZIVA 1SK2A 3IDVA 1ZMAA 4IHUA 2MBTA 1XWKA 5D9TA 1EZKA 1YVLA 1JFUA 2V32A 2Z9SA 3IPZA 5D9XA 2FUG2 2X49A 4YQMA 3HA9A 4TOPA 2VL2C 1ERTA 4V1Ap 3DEXA 1X9MB 5G1KA 4GXZA 5KOWA 1PQNA 2DKIA 3G7IA 1XXUA 1A23A 3LEFA 2FD3A 4GRFA 2KP1A 7GSSA 5HR2A 3MYDA 2JZRA 2XBIA 3KP8A 2FWGA 3FR6A 5ECRB 5EVOA 3UJ1A 1NW2A 4FQUA 4ILFA 2L5LA 3I43A 2GSRA 4TVEA 1A2LA 3LGCA 3TCOA 3VFIA 1DE2A 5F8BA 4EDZA 3IK7A 4G0LA 4O32A 4IQAA 2OE0A 4QMKA 1TK0B 1AAZA 3GTUB 1JHBA 4BVXB 3ERWA 3TKSC 2GSQA 2JSYA 2I9HA 1XOAA 3GH9A 2HSNB 4LL1B 1SJIA 3FZAA 2VL2A 2VO4A 3GURA 5G5FA 4OFMA 3Q19A 2OT3A 3QFAC 3LG6A 2P5QA 3TDGA 2IFQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNA A;  4Q5F A;  1BQ7 A;  5G2Z A;  4V2M A;  1TRV A;  3EU3 A;  4JU5 A;  1S3C A;  1WE0 A;  2H1A A;  1XW6 A;  4KUN A;  4MF5 A;  3DML A;  3IV4 A;  4K8M A;  2LTK A;  4L0U A;  4KDX A;  4CHS A;  3GX0 A;  1Z7P A;  1TI1 A;  3A2X A;  2JU5 A;  1E2Y A;  3DVW A;  4KDU A;  1TKD B;  3LSZ A;  3KMO A;  1X9W B;  4F0B A;  4JR6 A;  2WFC A;  3TOT A;  3J7Y k;  3GTU A;  4BVX A;  1ACV A;  5GSS A;  2HYX A;  4F2I A;  4EE0 A;  1TTZ A;  3BJ5 A;  4OWY A;  3IR4 A;  5AIS A;  1K0M A;  3APQ A;  3IAM 2;  3APO A;  4HS1 A;  1ZL9 A;  2QC7 A;  3SWL A;  4I2U A;  5CAX A;  3KXO A;  3LQ7 A;  3W8S A;  2H73 A;  5J3R A;  10GS A;  4KDY A;  1GSY A;  1A0F A;  4GQC A;  2KUC A;  3BBY A;  4QQ7 A;  19GS A;  2ON5 A;  1Z5Y E;  3OR5 A;  1G7E A;  1TDI A;  3CMI A;  4TXO B;  3R2Q A;  1YEP A;  5JCU A;  3PH9 A;  1EOH A;  1ERU A;  2KP2 A;  5A4U A;  1FHE A;  5J9B A;  4AJ6 A;  2VM1 A;  2HFD A;  1TJD A;  2DBC A;  2VIM A;  2HZF A;  1YDK A;  2JZS A;  4O92 A;  3HHV A;  1R4W A;  4MLY A;  5J4U A;  1PRX A;  2GT5 A;  3QFB C;  5GZZ B;  1T00 A;  3EC3 A;  4POK A;  4ZL8 A;  3GUS A;  3LFL A;  1YF1 A;  1YZX A;  5F06 A;  1Z7R A;  1AUC A;  4HUA A;  1YF0 A;  2B5Y A;  4DEJ A;  5CP1 A;  5ECI B;  5IPH A;  1TK5 B;  2K8S A;  1MDI A;  3IK9 A;  1M0U A;  5G30 A;  4L5O A;  4LLR A;  5AN1 A;  2GDR A;  1T8E B;  1F9M A;  1RQM A;  5IO2 A;  4PNG A;  9GSS A;  1XWB A;  4AF2 A;  3UL3 A;  1WP0 A;  4Q5N A;  2B6M A;  1U3I A;  4E8H A;  2YV9 A;  4EVM A;  1UN2 A;  3I9V 2;  3ME8 A;  4ZB8 A;  1K0N A;  4ZIJ A;  5HFK A;  2X8H A;  5LD0 A;  2H1G A;  3H8Q A;  3CTF A;  2G2Q A;  1V98 A;  4XCS A;  1SL2 B;  3P7X A;  4BPY A;  3GN3 A;  1O81 A;  1GNW A;  1EOG A;  1XZO A;  4F0C A;  4IBP A;  5AIX A;  2K18 A;  3IA1 A;  5KN2 A;  2H8L A;  4NHW A;  2N5F A;  3QCP A;  3TUE A;  1AC1 A;  4I6X A;  5B6M A;  2DC5 A;  3ZVJ D;  3TJK A;  2HRA A;  1X5C A;  1TU7 A;  2KLX A;  1SEN A;  1FOV A;  2L5O A;  1XBS A;  3TRX A;  1FG4 A;  2H0G A;  3O76 A;  2AJQ B;  4J2F A;  3KH9 A;  3EMX A;  2M46 A;  1M9A A;  1K0O A;  1XPV A;  4YQV A;  2IMD A;  17GS A;  3ERF A;  2H30 A;  1KNG A;  3D22 A;  2BJX A;  4FIW A;  4HEA 2;  1WOU A;  1PX6 A;  3HCZ A;  5DCH A;  4IVF A;  3TOU A;  3GMF A;  5KEJ A;  2VL9 A;  2H76 A;  5H5Q A;  3DIE A;  2FLS A;  4RQR A;  3C1S A;  2WGR A;  3EYT A;  4IGJ A;  1DE1 A;  4KB3 A;  1BJX A;  4YAP A;  2R3X A;  3PPU A;  2NBS A;  3FK8 A;  4NHZ A;  3ZFB A;  1SYX A;  1GNE A;  2YJ7 A;  3D6I A;  4AGS A;  5DCG A;  3RPN A;  4TN8 A;  1UA5 A;  4E8E A;  4Z7X A;  3WYW A;  1V40 A;  5GST A;  4IP6 A;  2C80 A;  3RPP A;  1ABA A;  4TXV A;  2VCX A;  1GP1 A;  3ZZX A;  2G0F A;  2GZY A;  4WKW A;  2WJU A;  4OFN A;  5CNW A;  2REM A;  3TJJ A;  3LYP A;  2CX4 A;  2GZZ A;  4HU7 A;  4I2T A;  2OE1 A;  1V2A A;  2LV3 A;  8GSS A;  3CRT A;  4G0K A;  2FHE A;  5ID2 B;  2O8V B;  4QL7 A;  1T1V A;  2YJH A;  3WGX A;  5DVB A;  1MEK A;  1ON4 A;  3TKP A;  1XW9 A;  2B7K A;  4MH2 A;  2ON7 A;  3O6T A;  2H71 A;  1B9X C;  5DBQ A;  3KTL A;  1A2M A;  4KE3 A;  2GVP A;  4PUF C;  2CAI A;  5HR1 A;  1QGV A;  1W4V A;  2X8C A;  3UMA A;  4K0N A;  1Z9H A;  1V58 A;  1SKW B;  5LNK e;  4MPF A;  3LYK A;  1TRU A;  4FYU A;  2OKA A;  2WRT A;  2RM5 A;  4HOJ A;  4WF4 A;  5L71 A;  3G9B A;  3GKK A;  2E2M A;  5IMF A;  3BCK A;  4IN0 A;  3KJY A;  4L0W A;  1XOB A;  1R5A A;  1NM3 A;  5CO3 A;  1QMV A;  4N10 A;  3P8W A;  2F51 A;  1F2E A;  5INY A;  3KM6 A;  3QPM A;  5CRG A;  1GUK A;  3PR8 A;  1JLW A;  3IE3 A;  2CT6 A;  1F3B A;  3IRA A;  3VLN A;  3IHQ A;  1GRX A;  6GSX A;  3UAP A;  3P90 A;  3UBK A;  4MZC A;  3GKX A;  1PX7 A;  1BYE A;  1PKZ A;  5EPF A;  3CSJ A;  1GSD A;  1RK4 A;  4TR0 A;  5ELG A;  2DIY A;  4PX1 A;  1E6B A;  3UVT A;  3TKS E;  6GSV A;  2CAQ A;  2RUE A;  2CZ2 A;  2YV7 A;  4NV5 A;  2MMZ A;  4X0X A;  4TR4 A;  1K3O A;  1MDJ A;  2OA7 A;  1OVN A;  4EKZ A;  3VUR A;  2FCH A;  4WF5 A;  1ZYE A;  5A4V A;  2LNT A;  3H79 A;  1K0A A;  3IXR A;  1G6W A;  4G10 A;  2D2Z A;  4RI7 A;  2JSZ A;  2OAC A;  3FZ5 A;  1XCC A;  3UBL A;  1IYH A;  5G5E A;  1R26 A;  1WRY A;  2MMN A;  2GQM A;  1UVZ A;  1EEM A;  5J9C A;  5ABR A;  4DSS A;  4JZQ A;  4CW9 A;  2DMM A;  5D9V A;  2C1Y A;  3EIN A;  4FYB A;  1GTB A;  1ZOF A;  1TRS A;  13GS A;  4ECI A;  1T4Y A;  4JRR A;  2I4A A;  3F3Q A;  3DYR A;  4GLT A;  5D96 A;  1DUG A;  1F37 A;  1SK1 A;  5B8B A;  4K7N A;  5IMC A;  3DXB A;  3D21 A;  4HZ2 A;  2HXK A;  2QGV A;  2PER A;  2O89 A;  3GL3 A;  1J08 A;  1PMT A;  3BD2 A;  1F6M C;  3IOS A;  5B8A A;  2M72 A;  3GNJ A;  5J41 A;  1G0T A;  1J9B A;  4NWY A;  5AGY A;  4MJC A;  4TR3 A;  2N5A A;  3L4N A;  2GT6 A;  1EEJ A;  4XTS A;  1U87 A;  3M0F A;  2WB9 A;  1WWJ A;  4HU9 A;  5IO0 A;  1LBK A;  2MMA A;  1HNC A;  1M9B A;  1V9W A;  3GL5 A;  2DJ1 A;  1LU4 A;  4TW5 A;  2IJY A;  3F4T A;  4K0G A;  1OKD A;  4MA9 A;  1M2A A;  3KZQ A;  2WZ9 A;  4G9H A;  3QR6 A;  2QKE A;  12GS A;  5ECM B;  4JE1 A;  5JCW A;  1A0R P;  1KTE A;  1ZYQ B;  3GFK A;  1H75 A;  3VWW A;  2X64 A;  4PQI A;  3RBT A;  4OD7 A;  1PA3 A;  1TOF A;  2YAN A;  2HLS A;  2B5X A;  5HFG A;  2CVD A;  1X9S B;  3GA4 A;  1I9D A;  3Q74 A;  4PUA A;  4I97 A;  2FWH A;  4BWS A;  1OKT A;  3D4T A;  1A2J A;  4OCF A;  5D8I A;  4IEL A;  3IBH A;  3ZYW A;  1M99 A;  1GSS A;  2VLT A;  5F07 A;  3LJR A;  1BAY A;  5FWG A;  2VD0 A;  4XS4 B;  1THO A;  1GSF A;  20GS A;  1VF2 A;  2VCW A;  5D93 A;  4MDC A;  5H5R A;  1K3Y A;  3TKS A;  3F9U A;  3GIX A;  3RHB A;  3HVX A;  1BX9 A;  1UC7 A;  3CSI A;  2OE3 A;  5ECQ B;  1SKS B;  4N0Z A;  3C7M A;  5JCG A;  2OAD A;  1B9Y C;  1WJK A;  1V57 A;  4PTS A;  3APS A;  2OBK A;  4PXO A;  2C8U A;  5J5N A;  3QAG A;  3E0U A;  2VD1 A;  3TKQ A;  2UZ8 A;  2XPD A;  3KH7 A;  5DQS A;  3CTG A;  2L57 A;  4O5R A;  4WET A;  5G1L A;  2WCI A;  4F03 A;  5IMD A;  3HJM A;  4ZB9 A;  2LNS A;  3EWL A;  5HR0 A;  3FEU A;  5DJM A;  1AXD A;  4XS4 A;  1GWC A;  4MK3 A;  2O7K A;  3A5W A;  4K1F A;  1Q4J A;  4KCA A;  2EIO A;  1YQ1 A;  1U6T A;  4GQF A;  1F3A A;  2H66 A;  4TRX A;  2X99 A;  1Q98 A;  2OBI A;  3CSH A;  3MAK A;  3VI7 A;  2CX3 A;  2CZ3 A;  2A2R A;  3SBC A;  4EDY A;  4EF0 A;  3TKR A;  5IIZ A;  2IMI A;  2GQL A;  2XC2 A;  4NXI A;  1C72 A;  4ZIL A;  3BOA A;  4X43 A;  2ES7 A;  4ECJ A;  2EC4 A;  2NPB A;  2IPA A;  1KEB A;  1ZZY A;  2YPM A;  2C4J A;  1XWA A;  2A4V A;  1AIU A;  2FNO A;  2CVB A;  3VK9 A;  2CV4 A;  1ZGN A;  1O85 A;  2HSY A;  3L78 A;  4JBB A;  1M2B A;  1N2A A;  4KW6 A;  4PUR A;  2XHF A;  1JLV A;  2TIR A;  1AQV A;  5E4W A;  3E3E A;  1CQH A;  2NVL A;  2IL3 A;  3IAS 2;  2TRC P;  3LXT A;  1XVQ A;  3A2W A;  1HQO A;  4K7O A;  1B4P A;  2HI7 A;  3Q18 A;  1O73 A;  5IOX A;  2AHE A;  3ZMK A;  1GL8 A;  2LKU A;  4KA0 A;  3GKN A;  4NV2 A;  1RW1 A;  1USB A;  4ZB6 A;  4ML6 A;  4MZB A;  1J0F A;  5H5S A;  1OAZ A;  3TRP A;  4HI7 A;  4IW9 A;  4L8E A;  4HQZ A;  3QDN A;  4AJ7 A;  1T4Z A;  3H93 A;  3S9F A;  2LJA A;  3EUR A;  4IJI A;  4P3Y B;  4WR4 A;  2RLI A;  1X5D A;  2O87 A;  4K2D A;  2PVQ A;  4XS6 A;  3HYP A;  3DWV A;  4EUY A;  6GSU A;  4KND A;  4ISD A;  3GHA A;  4MJB A;  1JZR A;  3HZ4 A;  4RUV A;  2LUS A;  6GSS A;  1NHO A;  3IC4 A;  2R6K A;  3D5J A;  1XVW A;  3L9U A;  2JAD A;  4ID0 A;  3UOM A;  3F0I A;  3LXZ A;  3FW2 A;  2NDO A;  2AV4 A;  2CVK A;  2BTO T;  2C0F A;  3ZL5 A;  3KGK A;  1T7P B;  2OJL A;  5DQY A;  5B7C A;  2YOI A;  4POL A;  4BWQ A;  2E7P A;  1QQ2 A;  1QFN A;  3M1G A;  4Q5R A;  2H70 A;  4IS0 A;  2C3Q A;  4NPB A;  4WXT A;  4K7I A;  4KSM A;  3H1N A;  1JZW A;  1B48 A;  4CDO A;  5A5K A;  3CYN A;  2F8F A;  1JZD A;  1QK8 A;  4KSO A;  1PL2 A;  4YAV A;  5A4W A;  1TI3 A;  3RHC A;  2V1M A;  1VF1 A;  4GF0 A;  3GH6 A;  2HZE A;  2L4Q A;  2WUL A;  3WD6 A;  3HY2 A;  3GSS A;  5COH A;  1M2D A;  4DVC A;  1GUL A;  1MTC A;  2FY6 A;  3FYG A;  1FVK A;  1Z6M A;  1DSB A;  5CRE A;  1TXX A;  2VLU A;  1GSQ A;  3QD9 A;  1OE8 A;  1SK0 A;  3RAZ A;  2VCV A;  2V2G A;  1NHY A;  4KAE A;  1OYJ A;  2PMT A;  2H1D A;  4G0I A;  1AQX A;  1CQG A;  4V2L A;  3GYK A;  4MZW A;  4JR4 A;  1PL1 A;  2MMO A;  3H4K A;  5DDL A;  3KCM A;  4HJ2 A;  4WEY A;  6GSW A;  2J23 A;  2LRC A;  2F3M A;  4LMW A;  2J9H A;  4PGT A;  2LS5 A;  1Y6E A;  3FKF A;  2RUF A;  3QAV A;  3HVS A;  4DSS B;  1W89 A;  4V2N A;  3KEB A;  3ED3 A;  3ERG A;  4BL7 B;  2FGX A;  2MYG A;  3C8E A;  2H19 A;  2L6D A;  1WPI A;  1I5G A;  2JL4 A;  2B5E A;  3I6A A;  2H6Z A;  3O3T A;  4BVY B;  2HNL A;  4XHM A;  1YEX A;  2IWT A;  2GS3 A;  2C0E A;  1QUW A;  3HXS A;  4NAX A;  2C0D A;  5DJL A;  2DJ3 A;  4MH3 A;  2BMX A;  4EXJ A;  1K0B A;  2H6X A;  1HD2 A;  3HDC A;  3UAR A;  2IIY A;  4OMV A;  2HRK B;  5HQP A;  4YQU A;  1MD4 A;  2XPE A;  5ELA A;  2ZUP A;  1XWC A;  5ECH B;  4MF6 A;  1XFL A;  2HSH A;  3A2V A;  3F6D A;  2PN8 A;  4HQS A;  5IMV A;  1XWG A;  2WS2 A;  1O8W A;  1OC9 B;  4KH7 A;  14GS A;  3ZFL A;  4O7H A;  4LMV A;  2PBJ A;  2QSI A;  1TK8 B;  4BL7 A;  3R3E A;  1G6Y A;  2R37 A;  1EP7 A;  4WBJ A;  3N9J A;  5ECK B;  2AYT A;  2IMK A;  4X1U A;  3KTB A;  1FO5 A;  4BVY A;  1GUM A;  3DVX A;  3HZ8 A;  3A3T A;  5D9W A;  4F9Z A;  1U88 A;  2DSA A;  4EO3 A;  4FYC A;  2AUV A;  1K0D A;  3ZVJ A;  1ILO A;  3VPQ A;  3U5R E;  5C04 A;  4ZL7 A;  1O6J A;  1OC8 A;  1NSW A;  2HRF A;  2AAW A;  4ZL9 A;  2DJ0 A;  1MDK A;  3C73 A;  3FR3 A;  1SL0 B;  2HRK A;  3GST A;  4TR1 A;  2GGT A;  4KF9 A;  3BCI A;  1PN9 A;  2R2J A;  1PKW A;  2A2S A;  4OO4 A;  2VL3 A;  3QOU A;  4OFT A;  1Z6N A;  1SYR A;  2V6O A;  5CYY A;  1OC9 A;  3VWX A;  3G7J A;  1ST9 A;  1SKR B;  3HVV A;  1URM A;  1YKA A;  3L9S A;  3L9V A;  1B8X A;  1SD8 A;  2MBS A;  1R5P A;  5FT3 A;  2F9S A;  5IMA A;  2F8A A;  1TP9 A;  2PVO C;  3GV1 A;  4GCI A;  2L4C A;  2YWI A;  4MF7 A;  2H75 A;  2YWN A;  3C1R A;  1BG5 A;  2L59 A;  2E0Q A;  4RI6 A;  16GS A;  5GAP D;  1EP8 A;  1B4Q A;  3N5O A;  4HDE A;  2DLX A;  3W6G A;  5F0G A;  1WIK A;  5CRW A;  2N5B A;  3EMP A;  1TW9 A;  1SJZ A;  3UEM A;  1SD9 A;  3PIN A;  1IYI A;  4ZBD A;  2LEG A;  4ECB A;  4XRA A;  3CRU A;  2V41 A;  3VI5 A;  1K0C A;  3F3R A;  3EU4 A;  3F8U A;  2VOC A;  3WGE A;  1BED A;  1GSE A;  1SJ6 A;  2PPT A;  4POB A;  3F6F A;  2GZP A;  2VM2 A;  2ZNM A;  1X0R A;  4YH2 A;  4I8B A;  2I1U A;  2K8V A;  3NOF A;  5FHI A;  5JWQ B;  5ECN B;  2VUP A;  3JCM L;  2C3N A;  3CBU A;  1GLP A;  1PGT A;  2VAF A;  4J56 E;  2GSS A;  4ZBB A;  1EV9 A;  4K9Z A;  5LCZ A;  4N30 A;  4IJ3 A;  4G2E A;  4HZ4 A;  5GAN D;  2LST A;  5JWO B;  4GWR A;  1VF4 A;  4WR5 A;  3NZN A;  4I5Q A;  2IFQ A;  1VGL A;  4PQ1 A;  2H74 A;  2VCT A;  3KIJ A;  1GH2 A;  3F4S A;  1YJ6 A;  1U3A A;  5E59 A;  2HT9 A;  4MP4 A;  1VF3 A;  4ML1 A;  3KMN A;  2XBQ A;  2FA4 A;  3UIW A;  4MJE A;  5ECP B;  3DRN A;  1GTU A;  2YZU A;  1EGR A;  3TRQ A;  4GSS A;  1XIY A;  2YN1 A;  1O7U A;  1HYU A;  2HRN A;  2P31 A;  1SU9 A;  3MWH A;  3FR9 A;  3WT1 A;  1GTA A;  3W8J A;  4H86 A;  4HJM A;  1OE7 A;  3LWA A;  4N11 A;  2B1L A;  4POM A;  3VWU A;  2EIR A;  2PU9 C;  2H72 A;  4G19 A;  4FO5 A;  2R5G A;  5IMZ A;  3ZML A;  3QAW A;  2H1B A;  2MZC A;  2H6Y A;  3ZIJ A;  3D4M A;  3ZRE A;  3KD0 A;  3FY7 A;  4JED A;  2FA8 A;  1TU8 A;  2IMF A;  1QXH A;  4ECC A;  2H0I A;  2DML A;  1N8J A;  2E2G A;  4XIH A;  2KHP A;  4USS A;  1JZO A;  4ACS A;  2P0G A;  2GST A;  4TXO A;  4MPG A;  5IPG A;  1HNB A;  3ME7 A;  3G7Y A;  3IC8 A;  2YNX A;  1S3D A;  3D0Z A;  2CA8 A;  4IQ1 A;  1YKC A;  2EIQ A;  18GS A;  3QMX A;  4L5L A;  4QL9 A;  2VLV A;  1ML6 A;  3LOR A;  1OC3 A;  2C3T A;  2JAC A;  4K6X A;  3ZIT A;  3HJO A;  5HFI A;  5KN0 A;  3K8N A;  4LA1 A;  3M3M A;  1T3B A;  2I81 A;  1PD2 1;  5CRD A;  2IN3 A;  1LJR A;  4ZBA A;  4TKY A;  4LL4 B;  4DSQ A;  2YWM A;  5EY6 A;  2FWF A;  2PUK C;  4FH8 A;  1S3A A;  3DKS A;  2HZE B;  2RM6 A;  2GLR A;  4XS1 A;  4V1A g;  3MDK A;  3TJG A;  11GS A;  4D73 B;  2RII A;  1GSU A;  2LQQ A;  1FAA A;  1G7O A;  2LRT A;  3EE2 A;  5DAL B;  2LRN A;  5IM9 A;  5CRH A;  2YCD A;  2LJR A;  1A24 A;  1EV4 A;  5KN3 A;  2GTU A;  3ISO A;  2ALB A;  3US3 A;  2AB6 A;  5AIV A;  4MAB A;  2M80 A;  1DBY A;  3RDW A;  2R4V A;  1R7H A;  1XW5 A;  4WBR D;  3DD3 A;  2GQK A;  6GSY A;  3MSZ A;  2WDU A;  2B7J A;  3HJP A;  5F05 A;  2H0H A;  2LJK A;  4F82 A;  5HR3 A;  1WMJ A;  1TRW A;  2PGT A;  1M7T A;  3P2A A;  1O8X A;  5ECO B;  3TGZ A;  3GRX A;  3MNG A;  5IOW A;  3CXG A;  2H01 A;  2PWJ A;  3WGD A;  1A8L A;  2JZT A;  4GSN A;  2DIZ A;  4MCU A;  5BMU A;  4D73 A;  2B3S A;  1AW9 A;  5G31 A;  3ZTL A;  1ZCP A;  1FB6 A;  3FHK A;  2HE3 A;  2HSM B;  5DAL A;  5ECS A;  2YP6 A;  3KP9 A;  4AJ8 A;  3DGQ A;  4ULX A;  4KCE A;  2L6C A;  4XRD A;  1SL1 B;  2ZCT A;  2K6V A;  4GTU A;  3F4R A;  1GUH A;  1H4O A;  1KBN A;  2C0G A;  3U6V A;  3M8N A;  2IME A;  3GX8 A;  3ZRD A;  3TJB A;  3I69 A;  4IP1 A;  3FZ4 A;  1ERV A;  5JWR B;  3J7Y b;  5EL8 A;  2LQO A;  3ZLP A;  3F63 A;  3PGT A;  3M9J A;  3V1W A;  3HKR A;  5C00 A;  4NMU A;  4KX4 A;  1GLQ A;  2DJ2 A;  4MJA A;  3E9J B;  2P5R A;  3FZ9 A;  1GTI A;  4N0V A;  2YWO A;  4PNF A;  2NTO A;  4KGI A;  3TJF A;  4J57 E;  4OCE A;  2HSM A;  2TRX A;  5DAK B;  1EWX A;  3VWV A;  3HD5 A;  1THX A;  1VRS D;  1FW1 A;  1Y25 A;  4MMM A;  3UVH A;  2K9F A;  1PSQ A;  3C71 A;  3GKM A;  6GST A;  4ZXG A;  5KN1 A;  3FRC A;  3VPT A;  3M9K A;  1K3L A;  5ID2 A;  2HQT A;  1A8Y A;  4OO5 A;  3EVI A;  3NIV A;  1AQW A;  2DJK A;  1MD3 A;  5D73 A;  2KOK A;  4PQH A;  4BA7 A;  2I3Y A;  2DJJ A;  5B6N A;  4GST A;  3L0H A;  1FB0 A;  1X5E A;  5IQY A;  4TR1 B;  4IKH A;  3Q6O A;  3WT2 A;  5ECL B;  1ERW A;  4EL1 A;  1FVJ A;  2CQ9 A;  4Q5Q A;  4EC0 A;  1Z3E A;  2VCZ A;  2YZH A;  2B1K A;  4DSR A;  22GS A;  5ENU A;  2V6K A;  4RQX A;  3AY8 A;  3TB2 A;  2FWE A;  1YY7 A;  2VCQ A;  1EGO A;  5DAK A;  2X8G A;  2O85 A;  3ZIV A;  1SK2 A;  3IDV A;  1ZMA A;  4IHU A;  2MBT A;  1XWK A;  5D9T A;  1EZK A;  1JFU A;  2V32 A;  2Z9S A;  3IPZ A;  5D9X A;  2FUG 2;  4YQM A;  3HA9 A;  4TOP A;  2VL2 C;  1ERT A;  4V1A p;  3DEX A;  1X9M B;  5G1K A;  4GXZ A;  1PQN A;  3G7I A;  1XXU A;  1A23 A;  3LEF A;  2FD3 A;  4GRF A;  2KP1 A;  7GSS A;  5HR2 A;  2JZR A;  2XBI A;  3KP8 A;  2FWG A;  3FR6 A;  5ECR B;  5EVO A;  3UJ1 A;  1NW2 A;  4FQU A;  4ILF A;  2L5L A;  3I43 A;  2GSR A;  4TVE A;  1A2L A;  3LGC A;  3TCO A;  3VFI A;  1DE2 A;  5F8B A;  4EDZ A;  3IK7 A;  4G0L A;  4O32 A;  4IQA A;  2OE0 A;  1TK0 B;  1AAZ A;  3GTU B;  1JHB A;  4BVX B;  3ERW A;  3TKS C;  2GSQ A;  2JSY A;  2I9H A;  1XOA A;  3GH9 A;  2HSN B;  4LL1 B;  1SJI A;  3FZA A;  2VL2 A;  2VO4 A;  3GUR A;  5G5F A;  4OFM A;  3Q19 A;  3QFA C;  3LG6 A;  2P5Q A;  3TDG A;  2IFQ B; 
#chains in the Genus database with same CATH topology
 1HNA A;  4Q5F A;  1BQ7 A;  5BRT A;  5G2Z A;  4V2M A;  1TRV A;  3EU3 A;  4JU5 A;  1S3C A;  1WE0 A;  2H1A A;  1XW6 A;  4KUN A;  4MF5 A;  3DML A;  3IV4 A;  4K8M A;  2LTK A;  4L0U A;  2DKH A;  4KDX A;  4CHS A;  3GX0 A;  1Z7P A;  1TI1 A;  3A2X A;  2JU5 A;  1E2Y A;  3DVW A;  4KDU A;  1TKD B;  3LSZ A;  3KMO A;  1X9W B;  4F0B A;  4JR6 A;  2WFC A;  3TOT A;  3HVN A;  3J7Y k;  3GTU A;  4AKH A;  4BVX A;  1ACV A;  5GSS A;  2HYX A;  4F2I A;  4EE0 A;  1TTZ A;  3BJ5 A;  4OWY A;  3IR4 A;  5AIS A;  1K0M A;  3APQ A;  3IAM 2;  3APO A;  4HS1 A;  1ZL9 A;  2QC7 A;  3SWL A;  4W66 A;  4I2U A;  5CAX A;  2X4A A;  3KXO A;  3LQ7 A;  3W8S A;  2H73 A;  5J3R A;  10GS A;  4KDY A;  1GSY A;  1A0F A;  4GQC A;  2KUC A;  3BBY A;  4QQ7 A;  19GS A;  2ON5 A;  1Z5Y E;  3OR5 A;  1G7E A;  1TDI A;  3CMI A;  4TXO B;  3R2Q A;  1YEP A;  5JCU A;  3PH9 A;  1EOH A;  4AKG A;  1ERU A;  2KP2 A;  5A4U A;  1FHE A;  5J9B A;  4AJ6 A;  2VM1 A;  2HFD A;  1TJD A;  2DBC A;  2VIM A;  2HZF A;  1YDK A;  2JZS A;  4O92 A;  3HHV A;  1R4W A;  4MLY A;  5J4U A;  1PRX A;  2GT5 A;  3QFB C;  2EFH A;  5GZZ B;  1T00 A;  3EC3 A;  4POK A;  4ZL8 A;  3GUS A;  3LFL A;  1YF1 A;  1YZX A;  5F06 A;  1Z7R A;  1AUC A;  4HUA A;  1YF0 A;  2B5Y A;  4DEJ A;  5CP1 A;  5A1N A;  5ECI B;  5IPH A;  1TK5 B;  2K8S A;  1MDI A;  3IK9 A;  1M0U A;  5G30 A;  4L5O A;  1ZYN A;  4LLR A;  5AN1 A;  2GDR A;  1T8E B;  1F9M A;  1RQM A;  5IO2 A;  4PNG A;  9GSS A;  1XWB A;  4AF2 A;  3UL3 A;  1WP0 A;  4Q5N A;  2B6M A;  1U3I A;  4E8H A;  2YV9 A;  4EVM A;  1UN2 A;  3I9V 2;  3ME8 A;  4ZB8 A;  1K0N A;  4ZIJ A;  5HFK A;  2X8H A;  4O5Q A;  5LD0 A;  2H1G A;  3H8Q A;  3CTF A;  2G2Q A;  1V98 A;  4XCS A;  1SL2 B;  3P7X A;  4BPY A;  3GN3 A;  4FXY P;  1O81 A;  1GNW A;  1EOG A;  1XZO A;  4F0C A;  4IBP A;  5AIX A;  2K18 A;  3IA1 A;  5KN2 A;  2H8L A;  4NHW A;  1S4B P;  2N5F A;  3QCP A;  3TUE A;  1AC1 A;  4AKI A;  4I6X A;  5B6M A;  2WVX B;  2DC5 A;  3ZVJ D;  1ZYP A;  3TJK A;  2HRA A;  1X5C A;  1TU7 A;  2KLX A;  1SEN A;  1FOV A;  2L5O A;  1XBS A;  3TRX A;  1FG4 A;  2H0G A;  3O76 A;  2AJQ B;  4J2F A;  3KH9 A;  3EMX A;  2M46 A;  1M9A A;  1K0O A;  1XPV A;  4YQV A;  2IMD A;  17GS A;  3ERF A;  2H30 A;  1KNG A;  3D22 A;  2BJX A;  4FIW A;  4HEA 2;  1S3R A;  1WOU A;  1PX6 A;  3HCZ A;  5DCH A;  4IVF A;  3TOU A;  3GMF A;  5KEJ A;  2VL9 A;  2H76 A;  5H5Q A;  2O3E A;  3DIE A;  2FLS A;  4RQR A;  3C1S A;  2WGR A;  3EYT A;  4IGJ A;  1DE1 A;  4KB3 A;  1BJX A;  4YAP A;  2R3X A;  3PPU A;  2NBS A;  3FK8 A;  4NHZ A;  3ZFB A;  1SYX A;  1GNE A;  2YJ7 A;  3D6I A;  4AGS A;  5DCG A;  3RPN A;  4TN8 A;  1UA5 A;  4E8E A;  4Z7X A;  3WYW A;  1V40 A;  5GST A;  4IP6 A;  2C80 A;  3RPP A;  1ABA A;  4TXV A;  2VCX A;  1GP1 A;  3ZZX A;  2G0F A;  2GZY A;  4WKW A;  2WJU A;  2A4H A;  4OFN A;  5CNW A;  2REM A;  3TJJ A;  3LYP A;  2CX4 A;  2GZZ A;  4HU7 A;  4I2T A;  2OE1 A;  1V2A A;  2LV3 A;  8GSS A;  3CRT A;  4G0K A;  2FHE A;  5ID2 B;  2O8V B;  4QL7 A;  1T1V A;  2YJH A;  1SVO A;  3WGX A;  5DVB A;  1MEK A;  2A2P A;  1ON4 A;  3TKP A;  1XW9 A;  2B7K A;  4MH2 A;  2ON7 A;  3O6T A;  2H71 A;  1B9X C;  5DBQ A;  3KTL A;  1BG1 A;  1A2M A;  1XG8 A;  4KE3 A;  2GVP A;  4K2X A;  4PUF C;  2CAI A;  5HR1 A;  1QGV A;  1W4V A;  2X8C A;  3UMA A;  1PFO A;  4K0N A;  2VKZ G;  1Z9H A;  1V58 A;  1SKW B;  5LNK e;  1YEW C;  4MPF A;  3LYK A;  1TRU A;  4FYU A;  2OKA A;  4X4J A;  2WRT A;  2RM5 A;  4HOJ A;  4WF4 A;  5L71 A;  3G9B A;  3GKK A;  2E2M A;  5IMF A;  1N25 A;  3BCK A;  4IN0 A;  3KJY A;  4L0W A;  1XOB A;  1R5A A;  1NM3 A;  5CO3 A;  1QMV A;  4N10 A;  3P8W A;  2F51 A;  1F2E A;  5INY A;  3KM6 A;  3QPM A;  5CRG A;  1GUK A;  3PR8 A;  1JLW A;  3IE3 A;  2CT6 A;  1F3B A;  3IRA A;  3VLN A;  3IHQ A;  1GRX A;  6GSX A;  3UAP A;  3P90 A;  3UBK A;  4MZC A;  3GKX A;  1PX7 A;  1BYE A;  1PKZ A;  5EPF A;  3CSJ A;  1GSD A;  1RK4 A;  4TR0 A;  5ELG A;  2DIY A;  4PX1 A;  1E6B A;  3UVT A;  4G01 A;  3TKS E;  6GSV A;  3MIX A;  2CAQ A;  2RUE A;  2CZ2 A;  2YV7 A;  4NV5 A;  2MMZ A;  4X0X A;  4TR4 A;  1K3O A;  1MDJ A;  2OA7 A;  1OVN A;  4EKZ A;  3VUR A;  2FCH A;  4WF5 A;  3CQF A;  1ZYE A;  5A4V A;  2LNT A;  3H79 A;  1K0A A;  3IXR A;  1G6W A;  4G10 A;  2D2Z A;  4RI7 A;  2JSZ A;  2OAC A;  3FZ5 A;  1XCC A;  3UBL A;  1IYH A;  5G5E A;  1R26 A;  1WRY A;  2MMN A;  2GQM A;  1UVZ A;  1EEM A;  5J9C A;  5ABR A;  4DSS A;  4JZQ A;  4YKG A;  4CW9 A;  2DMM A;  5D9V A;  2R0C A;  2C1Y A;  3EIN A;  4FYB A;  1GTB A;  1ZOF A;  1TRS A;  13GS A;  4ECI A;  1T4Y A;  4JRR A;  2I4A A;  3F3Q A;  3DYR A;  4GLT A;  5D96 A;  1DUG A;  1F37 A;  1SK1 A;  5B8B A;  4K7N A;  5IMC A;  4Z2R A;  3DXB A;  3D21 A;  4HZ2 A;  2HXK A;  2QGV A;  2PER A;  2O89 A;  3GL3 A;  1J08 A;  5J4Y A;  1PMT A;  3BD2 A;  1F6M C;  3IOS A;  4N3Z A;  2M72 A;  5B8A A;  2WW0 A;  3GNJ A;  5J41 A;  4O5U A;  1G0T A;  1J9B A;  4NWY A;  5AGY A;  3CHX C;  4MJC A;  4TR3 A;  2N5A A;  3L4N A;  2GT6 A;  1EEJ A;  4XTS A;  5A5H A;  1U87 A;  3M0F A;  2WB9 A;  1WWJ A;  4HU9 A;  5IO0 A;  1LBK A;  2MMA A;  1HNC A;  1M9B A;  1V9W A;  3GL5 A;  2DJ1 A;  1LU4 A;  4TW5 A;  2IJY A;  3F4T A;  4K0G A;  1OKD A;  4MA9 A;  1M2A A;  3KZQ A;  3RGB C;  2WZ9 A;  4G9H A;  3QR6 A;  2QKE A;  12GS A;  5ECM B;  4JE1 A;  5JCW A;  1A0R P;  1KTE A;  2O36 A;  1ZYQ B;  3GFK A;  1H75 A;  3VWW A;  2X64 A;  2WVY A;  4PQI A;  3RBT A;  4OD7 A;  1PA3 A;  1TOF A;  2YAN A;  2HLS A;  2B5X A;  5HFG A;  2CVD A;  1X9S B;  3GA4 A;  1I9D A;  1M3J A;  3Q74 A;  4PUA A;  4I97 A;  2FWH A;  4BWS A;  1OKT A;  3D4T A;  1A2J A;  4OCF A;  5D8I A;  4IEL A;  3IBH A;  5J47 A;  3ZYW A;  1M99 A;  1GSS A;  2VLT A;  5F07 A;  3LJR A;  1BAY A;  5FWG A;  2VD0 A;  4XS4 B;  1THO A;  1GSF A;  20GS A;  1VF2 A;  2VCW A;  5D93 A;  4MDC A;  5H5R A;  1K3Y A;  3TKS A;  3F9U A;  4PI2 C;  3GIX A;  3RHB A;  3HVX A;  1BX9 A;  1UC7 A;  3CSI A;  2OE3 A;  5ECQ B;  1SKS B;  4N0Z A;  3C7M A;  5JCG A;  5A1N B;  2OAD A;  1B9Y C;  1WJK A;  1V57 A;  4PTS A;  3APS A;  2OBK A;  4PXO A;  2C8U A;  5J5N A;  3QAG A;  3E0U A;  2VD1 A;  3TKQ A;  2UZ8 A;  2XPD A;  3KH7 A;  5DQS A;  3CTG A;  2L57 A;  4O5R A;  3RFR C;  4WET A;  5G1L A;  2WCI A;  4F03 A;  5IMD A;  3HJM A;  4ZB9 A;  2LNS A;  3EWL A;  5HR0 A;  3FEU A;  5DJM A;  1AXD A;  4XS4 A;  1GWC A;  4MK3 A;  2O7K A;  4K5S A;  3A5W A;  4K1F A;  1Q4J A;  4KCA A;  2EIO A;  1YQ1 A;  1U6T A;  4GQF A;  1F3A A;  2H66 A;  4TRX A;  2X99 A;  1Q98 A;  2OBI A;  3CSH A;  3MAK A;  3VI7 A;  2CX3 A;  2CZ3 A;  2A2R A;  3SBC A;  4EDY A;  4EF0 A;  3TKR A;  5IIZ A;  2IMI A;  2GQL A;  2XC2 A;  4NXI A;  1C72 A;  4ZIL A;  3A5I A;  3BOA A;  4X43 A;  2ES7 A;  4ECJ A;  3IHG A;  2EC4 A;  2NPB A;  2IPA A;  1KEB A;  1ZZY A;  2YPM A;  2C4J A;  1XWA A;  2A4V A;  1AIU A;  2FNO A;  2CVB A;  3VK9 A;  2CV4 A;  1ZGN A;  1O85 A;  2HSY A;  3L78 A;  4JBB A;  1M2B A;  1N2A A;  4KW6 A;  4PUR A;  2XHF A;  1JLV A;  2TIR A;  1AQV A;  5E4W A;  3E3E A;  1CQH A;  2NVL A;  2IL3 A;  3IAS 2;  2TRC P;  3LXT A;  1XVQ A;  3A2W A;  1HQO A;  4K7O A;  1B4P A;  2HI7 A;  3Q18 A;  1O73 A;  5IOX A;  2AHE A;  3ZMK A;  1GL8 A;  2LKU A;  4KA0 A;  3GKN A;  4NV2 A;  1RW1 A;  1USB A;  4ZB6 A;  4ML6 A;  4MZB A;  2O5V A;  1J0F A;  5H5S A;  1OAZ A;  3TRP A;  4HI7 A;  4IW9 A;  4L8E A;  4HQZ A;  3QDN A;  4AJ7 A;  1T4Z A;  3H93 A;  3S9F A;  2LJA A;  3EUR A;  4IJI A;  4P3Y B;  4WR4 A;  2RLI A;  1X5D A;  2O87 A;  4K2D A;  2PVQ A;  4XS6 A;  3HYP A;  3DWV A;  4EUY A;  6GSU A;  4KND A;  4ISD A;  3GHA A;  4MJB A;  1JZR A;  3HZ4 A;  4RUV A;  2LUS A;  6GSS A;  1NHO A;  3IC4 A;  2R6K A;  3D5J A;  1XVW A;  2WW1 A;  4BIK A;  3L9U A;  2JAD A;  4ID0 A;  3UOM A;  3F0I A;  3LXZ A;  3FW2 A;  2NDO A;  2AV4 A;  2CVK A;  2BTO T;  2C0F A;  3ZL5 A;  3KGK A;  1T7P B;  2OJL A;  5A34 A;  5DQY A;  5B7C A;  2YOI A;  4POL A;  4BWQ A;  2E7P A;  1QQ2 A;  1QFN A;  3M1G A;  4Q5R A;  2H70 A;  4IS0 A;  2C3Q A;  4NPB A;  4WXT A;  4K7I A;  4KSM A;  3H1N A;  1BF5 A;  1JZW A;  1B48 A;  2R0G A;  4CDO A;  5A5K A;  3CYN A;  2F8F A;  1JZD A;  1QK8 A;  4KSO A;  1PL2 A;  4YAV A;  5A4W A;  1TI3 A;  3RHC A;  2V1M A;  1VF1 A;  4YKF A;  4GF0 A;  5KOX A;  3GH6 A;  2HZE A;  2L4Q A;  2WUL A;  3WD6 A;  3HY2 A;  3GSS A;  4K5R A;  5COH A;  1M2D A;  4DVC A;  1GUL A;  1MTC A;  2FY6 A;  3FYG A;  2EFC A;  1FVK A;  1Z6M A;  1DSB A;  5CRE A;  1TXX A;  2VLU A;  1GSQ A;  3QD9 A;  1OE8 A;  1SK0 A;  3RAZ A;  2VCV A;  2V2G A;  1NHY A;  4KAE A;  1OYJ A;  2PMT A;  2H1D A;  4G0I A;  1AQX A;  1CQG A;  1Y1U A;  4V2L A;  3GYK A;  4MZW A;  4JR4 A;  1PL1 A;  2MMO A;  3H4K A;  5DDL A;  3KCM A;  4HJ2 A;  4WEY A;  6GSW A;  2J23 A;  4AKX B;  2LRC A;  2F3M A;  4E68 A;  4LMW A;  2H1L A;  2J9H A;  4PGT A;  2LS5 A;  1Y6E A;  3FKF A;  2RUF A;  3QAV A;  3HVS A;  4DSS B;  1W89 A;  4A5P A;  4V2N A;  3KEB A;  3ED3 A;  3ERG A;  4BL7 B;  2FGX A;  2MYG A;  3C8E A;  2H19 A;  2L6D A;  1WPI A;  1I5G A;  2JL4 A;  2B5E A;  3I6A A;  2H6Z A;  3O3T A;  4BVY B;  2HNL A;  2WZS A;  4XHM A;  1YEX A;  2IWT A;  2GS3 A;  2C0E A;  1QUW A;  3HXS A;  4NAX A;  2C0D A;  5DJL A;  2DJ3 A;  4MH3 A;  2BMX A;  4EXJ A;  1K0B A;  2H6X A;  1HD2 A;  3HDC A;  3UAR A;  2IIY A;  4OMV A;  2HRK B;  5HQP A;  4YQU A;  5A5H B;  1MD4 A;  2XPE A;  5ELA A;  2ZUP A;  1XWC A;  5ECH B;  4MF6 A;  1XFL A;  2HSH A;  3A2V A;  3F6D A;  2PN8 A;  4HQS A;  5IMV A;  1XWG A;  2WS2 A;  1O8W A;  1OC9 B;  4KH7 A;  14GS A;  3ZFL A;  4O7H A;  4LMV A;  2PBJ A;  2QSI A;  1TK8 B;  4BL7 A;  3R3E A;  1G6Y A;  2R37 A;  1EP7 A;  4WBJ A;  3N9J A;  5ECK B;  2AYT A;  2IMK A;  4X1U A;  3KTB A;  1FO5 A;  4BVY A;  1GUM A;  3DVX A;  3HZ8 A;  1PN0 A;  3A3T A;  5D9W A;  4F9Z A;  1U88 A;  2DSA A;  4EO3 A;  4FYC A;  2AUV A;  1K0D A;  3ZVJ A;  1ILO A;  3VPQ A;  3U5R E;  5C04 A;  4Z2T A;  4ZL7 A;  1O6J A;  1OC8 A;  1NSW A;  2HRF A;  2AAW A;  4ZL9 A;  2DJ0 A;  1MDK A;  3C73 A;  3FR3 A;  1SL0 B;  2HRK A;  3GST A;  4TR1 A;  2GGT A;  4KF9 A;  3BCI A;  1PN9 A;  3HMJ G;  2R2J A;  1PKW A;  2A2S A;  4OO4 A;  2VL3 A;  3QOU A;  4OFT A;  1Z6N A;  1SYR A;  2V6O A;  5CYY A;  1OC9 A;  4EIP A;  3VWX A;  3G7J A;  1ST9 A;  3EPT A;  1SKR B;  2UV8 G;  3HVV A;  1URM A;  1YKA A;  3L9S A;  3L9V A;  1B8X A;  1SD8 A;  2MBS A;  1R5P A;  5FT3 A;  2F9S A;  5IMA A;  2F8A A;  1TP9 A;  2PVO C;  3GV1 A;  4GCI A;  2L4C A;  2YWI A;  4MF7 A;  2H75 A;  2YWN A;  3C1R A;  1BG5 A;  2L59 A;  2E0Q A;  4RI6 A;  16GS A;  5GAP D;  1EP8 A;  1B4Q A;  3N5O A;  4HDE A;  2DLX A;  3W6G A;  5F0G A;  1WIK A;  5CRW A;  2N5B A;  3EMP A;  1TW9 A;  1SJZ A;  3UEM A;  1SD9 A;  3PIN A;  4MNN A;  1IYI A;  4ZBD A;  2LEG A;  4ECB A;  4XRA A;  3CRU A;  2V41 A;  3VI5 A;  1K0C A;  3F3R A;  3EU4 A;  5J4V A;  3F8U A;  2VOC A;  3WGE A;  4EIQ A;  1BED A;  1GSE A;  1SJ6 A;  4AI6 A;  4GDF A;  2PPT A;  4POB A;  3F6F A;  2GZP A;  2VM2 A;  2ZNM A;  1X0R A;  4YH2 A;  4I8B A;  2I1U A;  2K8V A;  3NOF A;  5FHI A;  5JWQ B;  5ECN B;  2VUP A;  3JCM L;  2C3N A;  3CBU A;  1GLP A;  1PGT A;  2VAF A;  4J56 E;  2EFE A;  2GSS A;  4ZBB A;  1EV9 A;  4K9Z A;  4CY6 A;  2HSN A;  1I1I P;  5LCZ A;  4N30 A;  4IJ3 A;  4G2E A;  4HZ4 A;  5GAN D;  2LST A;  5JWO B;  4GWR A;  1VF4 A;  4WR5 A;  3NZN A;  4I5Q A;  2IFQ A;  1VGL A;  4PQ1 A;  2H74 A;  2VCT A;  3KIJ A;  1FOH A;  1GH2 A;  3F4S A;  1YJ6 A;  1U3A A;  2QA2 A;  5E59 A;  2HT9 A;  4MP4 A;  1VF3 A;  4ML1 A;  3KMN A;  3TU3 B;  2XBQ A;  2FA4 A;  3UIW A;  4MJE A;  5ECP B;  3DRN A;  1GTU A;  2YZU A;  1EGR A;  3TRQ A;  4GSS A;  1XIY A;  2YN1 A;  1O7U A;  1HYU A;  2HRN A;  2P31 A;  1SU9 A;  3MWH A;  3FR9 A;  3WT1 A;  1GTA A;  3W8J A;  4H86 A;  4HJM A;  1OE7 A;  3LWA A;  4N11 A;  2B1L A;  4POM A;  3VWU A;  2EIR A;  2PU9 C;  2H72 A;  4G19 A;  4FO5 A;  2R5G A;  5IMZ A;  3ZML A;  3QAW A;  2H1B A;  2MZC A;  2H6Y A;  3ZIJ A;  3D4M A;  3ZRE A;  3KD0 A;  3FY7 A;  4JED A;  2FA8 A;  1TU8 A;  2IMF A;  1QXH A;  4ECC A;  2H0I A;  1SVL A;  2DML A;  1N8J A;  2E2G A;  4XIH A;  2KHP A;  4USS A;  1JZO A;  4ACS A;  2P0G A;  2GST A;  4TXO A;  4MPG A;  5IPG A;  1HNB A;  3ME7 A;  3G7Y A;  3IC8 A;  2YNX A;  1S3D A;  3D0Z A;  2CA8 A;  4IQ1 A;  4ZB7 A;  1YKC A;  2EIQ A;  18GS A;  3QMX A;  4L5L A;  1SVM A;  4QL9 A;  2VLV A;  1ML6 A;  3LOR A;  5A34 B;  1OC3 A;  2C3T A;  2JAC A;  4K6X A;  3ZIT A;  3LW9 A;  3HJO A;  5HFI A;  5KN0 A;  3K8N A;  4LA1 A;  3M3M A;  1T3B A;  2I81 A;  1PD2 1;  4CY8 A;  5CRD A;  2IN3 A;  1LJR A;  4ZBA A;  4TKY A;  4LL4 B;  4DSQ A;  1M3I A;  2YWM A;  5EY6 A;  2FWF A;  4HSC X;  2PUK C;  4FH8 A;  1S3A A;  2WW2 A;  3DKS A;  2HZE B;  2RM6 A;  2GLR A;  4XS1 A;  4V1A g;  3MDK A;  3TJG A;  5BMU B;  11GS A;  4D73 B;  2RII A;  3FMW A;  1GSU A;  2LQQ A;  1FAA A;  1G7O A;  2LRT A;  3EE2 A;  5DAL B;  2LRN A;  5IM9 A;  5CRH A;  2YCD A;  2LJR A;  1A24 A;  1EV4 A;  5KN3 A;  2GTU A;  3ISO A;  2EFD A;  2ALB A;  3US3 A;  2AB6 A;  5AIV A;  4MAB A;  2M80 A;  1DBY A;  3RDW A;  2R4V A;  1R7H A;  1XW5 A;  4WBR D;  3DD3 A;  2GQK A;  6GSY A;  3MSZ A;  2WDU A;  2B7J A;  3HJP A;  5F05 A;  2H0H A;  2LJK A;  4F82 A;  2WVX A;  5HR3 A;  1WMJ A;  1TRW A;  2PGT A;  1M7T A;  3P2A A;  1O8X A;  5ECO B;  3TGZ A;  3GRX A;  3MNG A;  5IOW A;  4ICY A;  3CXG A;  2H01 A;  2PWJ A;  3WGD A;  1A8L A;  2JZT A;  4GSN A;  2DIZ A;  4MCU A;  5BMU A;  4D73 A;  2B3S A;  1AW9 A;  5G31 A;  3ZTL A;  1ZCP A;  1FB6 A;  3FHK A;  2HE3 A;  2HSM B;  5DAL A;  5ECS A;  2YP6 A;  3KP9 A;  4AJ8 A;  3DGQ A;  4ULX A;  4KCE A;  2L6C A;  4XRD A;  1SL1 B;  2ZCT A;  2K6V A;  4GTU A;  3F4R A;  5J40 A;  1GUH A;  1H4O A;  1KBN A;  2C0G A;  2R0P A;  3U6V A;  3M8N A;  2IME A;  3GX8 A;  3ZRD A;  3TJB A;  4Z2U A;  3I69 A;  4IP1 A;  3FZ4 A;  1ERV A;  5JWR B;  3J7Y b;  5EL8 A;  2LQO A;  3ZLP A;  3F63 A;  3PGT A;  2QA1 A;  3M9J A;  3V1W A;  4PHZ C;  3HKR A;  5C00 A;  4NMU A;  4KX4 A;  1GLQ A;  2DJ2 A;  4MJA A;  3E9J B;  2P5R A;  2WW3 A;  3FZ9 A;  1GTI A;  4N0V A;  2YWO A;  4PNF A;  2NTO A;  4KGI A;  3TJF A;  4J57 E;  4OCE A;  2HSM A;  2TRX A;  5DAK B;  1EWX A;  3VWV A;  3HD5 A;  1THX A;  1VRS D;  1FW1 A;  1Y25 A;  4MMM A;  3UVH A;  2K9F A;  1PSQ A;  3C71 A;  3GKM A;  6GST A;  4ZXG A;  5KN1 A;  3FRC A;  3VPT A;  3M9K A;  1K3L A;  5ID2 A;  3CWG A;  2HQT A;  1A8Y A;  4OO5 A;  3EVI A;  3NIV A;  1AQW A;  2DJK A;  1MD3 A;  5D73 A;  2KOK A;  4PQH A;  4BA7 A;  2I3Y A;  2DJJ A;  5B6N A;  4GST A;  3L0H A;  1FB0 A;  1X5E A;  5IQY A;  4TR1 B;  4IKH A;  3Q6O A;  3WT2 A;  5ECL B;  1ERW A;  4EL1 A;  1FVJ A;  2CQ9 A;  1TXU A;  4Q5Q A;  4EC0 A;  1Z3E A;  2VCZ A;  2YZH A;  2B1K A;  4DSR A;  22GS A;  5ENU A;  2V6K A;  4RQX A;  3AY8 A;  3TB2 A;  2FWE A;  1YY7 A;  2VCQ A;  1EGO A;  5DAK A;  2X8G A;  2O85 A;  3ZIV A;  2WVZ A;  1SK2 A;  3IDV A;  1ZMA A;  4IHU A;  2MBT A;  1XWK A;  5D9T A;  1EZK A;  1YVL A;  1JFU A;  2V32 A;  2Z9S A;  3IPZ A;  5D9X A;  2FUG 2;  2X49 A;  4YQM A;  3HA9 A;  4TOP A;  2VL2 C;  1ERT A;  4V1A p;  3DEX A;  1X9M B;  5G1K A;  4GXZ A;  5KOW A;  1PQN A;  2DKI A;  3G7I A;  1XXU A;  1A23 A;  3LEF A;  2FD3 A;  4GRF A;  2KP1 A;  7GSS A;  5HR2 A;  2JZR A;  3MYD A;  2XBI A;  3KP8 A;  2FWG A;  3FR6 A;  5ECR B;  5EVO A;  3UJ1 A;  1NW2 A;  4FQU A;  4ILF A;  2L5L A;  3I43 A;  2GSR A;  4TVE A;  1A2L A;  3LGC A;  3TCO A;  3VFI A;  1DE2 A;  5F8B A;  4EDZ A;  3IK7 A;  4G0L A;  4PI0 C;  4O32 A;  4IQA A;  2OE0 A;  4QMK A;  1TK0 B;  1AAZ A;  3GTU B;  1JHB A;  4BVX B;  3ERW A;  3TKS C;  2GSQ A;  2JSY A;  2I9H A;  1XOA A;  3GH9 A;  2HSN B;  4LL1 B;  1SJI A;  3FZA A;  2VL2 A;  2VO4 A;  3GUR A;  5G5F A;  4OFM A;  3Q19 A;  2OT3 A;  3QFA C;  3LG6 A;  2P5Q A;  3TDG A;  2IFQ B; 
#chains in the Genus database with same CATH homology
 1HNA A;  4Q5F A;  1BQ7 A;  5BRT A;  5G2Z A;  4V2M A;  1TRV A;  3EU3 A;  4JU5 A;  1S3C A;  1WE0 A;  2H1A A;  1XW6 A;  4KUN A;  4MF5 A;  3DML A;  3IV4 A;  4K8M A;  2LTK A;  4L0U A;  2DKH A;  4KDX A;  4CHS A;  3GX0 A;  1Z7P A;  1TI1 A;  3A2X A;  2JU5 A;  1E2Y A;  3DVW A;  4KDU A;  1TKD B;  3LSZ A;  3KMO A;  1X9W B;  4F0B A;  4JR6 A;  2WFC A;  3TOT A;  3J7Y k;  3GTU A;  4AKH A;  4BVX A;  1ACV A;  5GSS A;  2HYX A;  4F2I A;  4EE0 A;  1TTZ A;  3BJ5 A;  4OWY A;  3IR4 A;  5AIS A;  1K0M A;  3APQ A;  3IAM 2;  3APO A;  4HS1 A;  1ZL9 A;  2QC7 A;  3SWL A;  4W66 A;  4I2U A;  5CAX A;  2X4A A;  3KXO A;  3LQ7 A;  3W8S A;  2H73 A;  5J3R A;  10GS A;  4KDY A;  1GSY A;  1A0F A;  4GQC A;  2KUC A;  3BBY A;  4QQ7 A;  19GS A;  2ON5 A;  1Z5Y E;  3OR5 A;  1G7E A;  1TDI A;  3CMI A;  4TXO B;  3R2Q A;  1YEP A;  5JCU A;  3PH9 A;  1EOH A;  4AKG A;  1ERU A;  2KP2 A;  5A4U A;  1FHE A;  5J9B A;  4AJ6 A;  2VM1 A;  2HFD A;  1TJD A;  2DBC A;  2VIM A;  2HZF A;  1YDK A;  2JZS A;  4O92 A;  3HHV A;  1R4W A;  4MLY A;  5J4U A;  1PRX A;  2GT5 A;  3QFB C;  2EFH A;  5GZZ B;  1T00 A;  3EC3 A;  4POK A;  4ZL8 A;  3GUS A;  3LFL A;  1YF1 A;  1YZX A;  5F06 A;  1Z7R A;  1AUC A;  4HUA A;  1YF0 A;  2B5Y A;  4DEJ A;  5CP1 A;  5A1N A;  5ECI B;  5IPH A;  1TK5 B;  2K8S A;  1MDI A;  3IK9 A;  1M0U A;  5G30 A;  4L5O A;  1ZYN A;  4LLR A;  5AN1 A;  2GDR A;  1T8E B;  1F9M A;  1RQM A;  5IO2 A;  4PNG A;  9GSS A;  1XWB A;  4AF2 A;  3UL3 A;  1WP0 A;  4Q5N A;  2B6M A;  1U3I A;  4E8H A;  2YV9 A;  4EVM A;  1UN2 A;  3I9V 2;  3ME8 A;  4ZB8 A;  1K0N A;  4ZIJ A;  5HFK A;  2X8H A;  4O5Q A;  5LD0 A;  2H1G A;  3H8Q A;  3CTF A;  2G2Q A;  1V98 A;  4XCS A;  1SL2 B;  3P7X A;  4BPY A;  3GN3 A;  1O81 A;  1GNW A;  1EOG A;  1XZO A;  4F0C A;  4IBP A;  5AIX A;  2K18 A;  3IA1 A;  5KN2 A;  2H8L A;  4NHW A;  2N5F A;  3QCP A;  3TUE A;  1AC1 A;  4AKI A;  4I6X A;  5B6M A;  2DC5 A;  3ZVJ D;  1ZYP A;  3TJK A;  2HRA A;  1X5C A;  1TU7 A;  2KLX A;  1SEN A;  1FOV A;  2L5O A;  1XBS A;  3TRX A;  1FG4 A;  2H0G A;  3O76 A;  2AJQ B;  4J2F A;  3KH9 A;  3EMX A;  2M46 A;  1M9A A;  1K0O A;  1XPV A;  4YQV A;  2IMD A;  17GS A;  3ERF A;  2H30 A;  1KNG A;  3D22 A;  2BJX A;  4FIW A;  4HEA 2;  1WOU A;  1PX6 A;  3HCZ A;  5DCH A;  4IVF A;  3TOU A;  3GMF A;  5KEJ A;  2VL9 A;  2H76 A;  5H5Q A;  3DIE A;  2FLS A;  4RQR A;  3C1S A;  2WGR A;  3EYT A;  4IGJ A;  1DE1 A;  4KB3 A;  1BJX A;  4YAP A;  2R3X A;  3PPU A;  2NBS A;  3FK8 A;  4NHZ A;  3ZFB A;  1SYX A;  1GNE A;  2YJ7 A;  3D6I A;  4AGS A;  5DCG A;  3RPN A;  4TN8 A;  1UA5 A;  4E8E A;  4Z7X A;  3WYW A;  1V40 A;  5GST A;  4IP6 A;  2C80 A;  3RPP A;  1ABA A;  4TXV A;  2VCX A;  1GP1 A;  3ZZX A;  2G0F A;  2GZY A;  4WKW A;  2WJU A;  2A4H A;  4OFN A;  5CNW A;  2REM A;  3TJJ A;  3LYP A;  2CX4 A;  2GZZ A;  4HU7 A;  4I2T A;  2OE1 A;  1V2A A;  2LV3 A;  8GSS A;  3CRT A;  4G0K A;  2FHE A;  5ID2 B;  2O8V B;  4QL7 A;  1T1V A;  2YJH A;  1SVO A;  3WGX A;  5DVB A;  1MEK A;  2A2P A;  1ON4 A;  3TKP A;  1XW9 A;  2B7K A;  4MH2 A;  2ON7 A;  3O6T A;  2H71 A;  1B9X C;  5DBQ A;  3KTL A;  1BG1 A;  1A2M A;  4KE3 A;  2GVP A;  4K2X A;  4PUF C;  2CAI A;  5HR1 A;  1QGV A;  1W4V A;  2X8C A;  3UMA A;  4K0N A;  2VKZ G;  1Z9H A;  1V58 A;  1SKW B;  5LNK e;  4MPF A;  3LYK A;  1TRU A;  4FYU A;  2OKA A;  4X4J A;  2WRT A;  2RM5 A;  4HOJ A;  4WF4 A;  5L71 A;  3G9B A;  3GKK A;  2E2M A;  5IMF A;  1N25 A;  3BCK A;  4IN0 A;  3KJY A;  4L0W A;  1XOB A;  1R5A A;  1NM3 A;  5CO3 A;  1QMV A;  4N10 A;  3P8W A;  2F51 A;  1F2E A;  5INY A;  3KM6 A;  3QPM A;  5CRG A;  1GUK A;  3PR8 A;  1JLW A;  3IE3 A;  2CT6 A;  1F3B A;  3IRA A;  3VLN A;  3IHQ A;  1GRX A;  6GSX A;  3UAP A;  3P90 A;  3UBK A;  4MZC A;  3GKX A;  1PX7 A;  1BYE A;  1PKZ A;  5EPF A;  3CSJ A;  1GSD A;  1RK4 A;  4TR0 A;  5ELG A;  2DIY A;  4PX1 A;  1E6B A;  3UVT A;  4G01 A;  3TKS E;  6GSV A;  3MIX A;  2CAQ A;  2RUE A;  2CZ2 A;  2YV7 A;  4NV5 A;  2MMZ A;  4X0X A;  4TR4 A;  1K3O A;  1MDJ A;  2OA7 A;  1OVN A;  4EKZ A;  3VUR A;  2FCH A;  4WF5 A;  1ZYE A;  5A4V A;  2LNT A;  3H79 A;  1K0A A;  3IXR A;  1G6W A;  4G10 A;  2D2Z A;  4RI7 A;  2JSZ A;  2OAC A;  3FZ5 A;  1XCC A;  3UBL A;  1IYH A;  5G5E A;  1R26 A;  1WRY A;  2MMN A;  2GQM A;  1UVZ A;  1EEM A;  5J9C A;  5ABR A;  4DSS A;  4JZQ A;  4YKG A;  4CW9 A;  2DMM A;  5D9V A;  2R0C A;  2C1Y A;  3EIN A;  4FYB A;  1GTB A;  1ZOF A;  1TRS A;  13GS A;  4ECI A;  1T4Y A;  4JRR A;  2I4A A;  3F3Q A;  3DYR A;  4GLT A;  5D96 A;  1DUG A;  1F37 A;  1SK1 A;  5B8B A;  4K7N A;  5IMC A;  4Z2R A;  3DXB A;  3D21 A;  4HZ2 A;  2HXK A;  2QGV A;  2PER A;  2O89 A;  3GL3 A;  1J08 A;  5J4Y A;  1PMT A;  3BD2 A;  1F6M C;  3IOS A;  4N3Z A;  2M72 A;  5B8A A;  3GNJ A;  5J41 A;  4O5U A;  1G0T A;  1J9B A;  4NWY A;  5AGY A;  4MJC A;  4TR3 A;  2N5A A;  3L4N A;  2GT6 A;  1EEJ A;  4XTS A;  5A5H A;  1U87 A;  3M0F A;  2WB9 A;  1WWJ A;  4HU9 A;  5IO0 A;  1LBK A;  2MMA A;  1HNC A;  1M9B A;  1V9W A;  3GL5 A;  2DJ1 A;  1LU4 A;  4TW5 A;  2IJY A;  3F4T A;  4K0G A;  1OKD A;  4MA9 A;  1M2A A;  3KZQ A;  2WZ9 A;  4G9H A;  3QR6 A;  2QKE A;  12GS A;  5ECM B;  4JE1 A;  5JCW A;  1A0R P;  1KTE A;  1ZYQ B;  3GFK A;  1H75 A;  3VWW A;  2X64 A;  4PQI A;  3RBT A;  4OD7 A;  1PA3 A;  1TOF A;  2YAN A;  2HLS A;  2B5X A;  5HFG A;  2CVD A;  1X9S B;  3GA4 A;  1I9D A;  3Q74 A;  4PUA A;  4I97 A;  2FWH A;  4BWS A;  1OKT A;  3D4T A;  1A2J A;  4OCF A;  5D8I A;  4IEL A;  3IBH A;  5J47 A;  3ZYW A;  1M99 A;  1GSS A;  2VLT A;  5F07 A;  3LJR A;  1BAY A;  5FWG A;  2VD0 A;  4XS4 B;  1THO A;  1GSF A;  20GS A;  1VF2 A;  2VCW A;  5D93 A;  4MDC A;  5H5R A;  1K3Y A;  3TKS A;  3F9U A;  3GIX A;  3RHB A;  3HVX A;  1BX9 A;  1UC7 A;  3CSI A;  2OE3 A;  5ECQ B;  1SKS B;  4N0Z A;  3C7M A;  5JCG A;  5A1N B;  2OAD A;  1B9Y C;  1WJK A;  1V57 A;  4PTS A;  3APS A;  2OBK A;  4PXO A;  2C8U A;  5J5N A;  3QAG A;  3E0U A;  2VD1 A;  3TKQ A;  2UZ8 A;  2XPD A;  3KH7 A;  5DQS A;  3CTG A;  2L57 A;  4O5R A;  4WET A;  5G1L A;  2WCI A;  4F03 A;  5IMD A;  3HJM A;  4ZB9 A;  2LNS A;  3EWL A;  5HR0 A;  3FEU A;  5DJM A;  1AXD A;  4XS4 A;  1GWC A;  4MK3 A;  2O7K A;  4K5S A;  3A5W A;  4K1F A;  1Q4J A;  4KCA A;  2EIO A;  1YQ1 A;  1U6T A;  4GQF A;  1F3A A;  2H66 A;  4TRX A;  2X99 A;  1Q98 A;  2OBI A;  3CSH A;  3MAK A;  3VI7 A;  2CX3 A;  2CZ3 A;  2A2R A;  3SBC A;  4EDY A;  4EF0 A;  3TKR A;  5IIZ A;  2IMI A;  2GQL A;  2XC2 A;  4NXI A;  1C72 A;  4ZIL A;  3A5I A;  3BOA A;  4X43 A;  2ES7 A;  4ECJ A;  3IHG A;  2EC4 A;  2NPB A;  2IPA A;  1KEB A;  1ZZY A;  2YPM A;  2C4J A;  1XWA A;  2A4V A;  1AIU A;  2FNO A;  2CVB A;  3VK9 A;  2CV4 A;  1ZGN A;  1O85 A;  2HSY A;  3L78 A;  4JBB A;  1M2B A;  1N2A A;  4KW6 A;  4PUR A;  2XHF A;  1JLV A;  2TIR A;  1AQV A;  5E4W A;  3E3E A;  1CQH A;  2NVL A;  2IL3 A;  3IAS 2;  2TRC P;  3LXT A;  1XVQ A;  3A2W A;  1HQO A;  4K7O A;  1B4P A;  2HI7 A;  3Q18 A;  1O73 A;  5IOX A;  2AHE A;  3ZMK A;  1GL8 A;  2LKU A;  4KA0 A;  3GKN A;  4NV2 A;  1RW1 A;  1USB A;  4ZB6 A;  4ML6 A;  4MZB A;  2O5V A;  1J0F A;  5H5S A;  1OAZ A;  3TRP A;  4HI7 A;  4IW9 A;  4L8E A;  4HQZ A;  3QDN A;  4AJ7 A;  1T4Z A;  3H93 A;  3S9F A;  2LJA A;  3EUR A;  4IJI A;  4P3Y B;  4WR4 A;  2RLI A;  1X5D A;  2O87 A;  4K2D A;  2PVQ A;  4XS6 A;  3HYP A;  3DWV A;  4EUY A;  6GSU A;  4KND A;  4ISD A;  3GHA A;  4MJB A;  1JZR A;  3HZ4 A;  4RUV A;  2LUS A;  6GSS A;  1NHO A;  3IC4 A;  2R6K A;  3D5J A;  1XVW A;  3L9U A;  2JAD A;  4ID0 A;  3UOM A;  3F0I A;  3LXZ A;  3FW2 A;  2NDO A;  2AV4 A;  2CVK A;  2BTO T;  2C0F A;  3ZL5 A;  3KGK A;  1T7P B;  2OJL A;  5A34 A;  5DQY A;  5B7C A;  2YOI A;  4POL A;  4BWQ A;  2E7P A;  1QQ2 A;  1QFN A;  3M1G A;  4Q5R A;  2H70 A;  4IS0 A;  2C3Q A;  4NPB A;  4WXT A;  4K7I A;  4KSM A;  3H1N A;  1BF5 A;  1JZW A;  1B48 A;  2R0G A;  4CDO A;  5A5K A;  3CYN A;  2F8F A;  1JZD A;  1QK8 A;  4KSO A;  1PL2 A;  4YAV A;  5A4W A;  1TI3 A;  3RHC A;  2V1M A;  1VF1 A;  4YKF A;  4GF0 A;  5KOX A;  3GH6 A;  2HZE A;  2L4Q A;  2WUL A;  3WD6 A;  3HY2 A;  3GSS A;  4K5R A;  5COH A;  1M2D A;  4DVC A;  1GUL A;  1MTC A;  2FY6 A;  3FYG A;  2EFC A;  1FVK A;  1Z6M A;  1DSB A;  5CRE A;  1TXX A;  2VLU A;  1GSQ A;  3QD9 A;  1OE8 A;  1SK0 A;  3RAZ A;  2VCV A;  2V2G A;  1NHY A;  4KAE A;  1OYJ A;  2PMT A;  2H1D A;  4G0I A;  1AQX A;  1CQG A;  1Y1U A;  4V2L A;  3GYK A;  4MZW A;  4JR4 A;  1PL1 A;  2MMO A;  3H4K A;  5DDL A;  3KCM A;  4HJ2 A;  4WEY A;  6GSW A;  2J23 A;  4AKX B;  2LRC A;  2F3M A;  4E68 A;  4LMW A;  2H1L A;  2J9H A;  4PGT A;  2LS5 A;  1Y6E A;  3FKF A;  2RUF A;  3QAV A;  3HVS A;  4DSS B;  1W89 A;  4A5P A;  4V2N A;  3KEB A;  3ED3 A;  3ERG A;  4BL7 B;  2FGX A;  2MYG A;  3C8E A;  2H19 A;  2L6D A;  1WPI A;  1I5G A;  2JL4 A;  2B5E A;  3I6A A;  2H6Z A;  3O3T A;  4BVY B;  2HNL A;  4XHM A;  1YEX A;  2IWT A;  2GS3 A;  2C0E A;  1QUW A;  3HXS A;  4NAX A;  2C0D A;  5DJL A;  2DJ3 A;  4MH3 A;  2BMX A;  4EXJ A;  1K0B A;  2H6X A;  1HD2 A;  3HDC A;  3UAR A;  2IIY A;  4OMV A;  2HRK B;  5HQP A;  4YQU A;  5A5H B;  1MD4 A;  2XPE A;  5ELA A;  2ZUP A;  1XWC A;  5ECH B;  4MF6 A;  1XFL A;  2HSH A;  3A2V A;  3F6D A;  2PN8 A;  4HQS A;  5IMV A;  1XWG A;  2WS2 A;  1O8W A;  1OC9 B;  4KH7 A;  14GS A;  3ZFL A;  4O7H A;  4LMV A;  2PBJ A;  2QSI A;  1TK8 B;  4BL7 A;  3R3E A;  1G6Y A;  2R37 A;  1EP7 A;  4WBJ A;  3N9J A;  5ECK B;  2AYT A;  2IMK A;  4X1U A;  3KTB A;  1FO5 A;  4BVY A;  1GUM A;  3DVX A;  3HZ8 A;  1PN0 A;  3A3T A;  5D9W A;  4F9Z A;  1U88 A;  2DSA A;  4EO3 A;  4FYC A;  2AUV A;  1K0D A;  3ZVJ A;  1ILO A;  3VPQ A;  3U5R E;  5C04 A;  4Z2T A;  4ZL7 A;  1O6J A;  1OC8 A;  1NSW A;  2HRF A;  2AAW A;  4ZL9 A;  2DJ0 A;  1MDK A;  3C73 A;  3FR3 A;  1SL0 B;  2HRK A;  3GST A;  4TR1 A;  2GGT A;  4KF9 A;  3BCI A;  1PN9 A;  3HMJ G;  2R2J A;  1PKW A;  2A2S A;  4OO4 A;  2VL3 A;  3QOU A;  4OFT A;  1Z6N A;  1SYR A;  2V6O A;  5CYY A;  1OC9 A;  4EIP A;  3VWX A;  3G7J A;  1ST9 A;  3EPT A;  1SKR B;  2UV8 G;  3HVV A;  1URM A;  1YKA A;  3L9S A;  3L9V A;  1B8X A;  1SD8 A;  2MBS A;  1R5P A;  5FT3 A;  2F9S A;  5IMA A;  2F8A A;  1TP9 A;  2PVO C;  3GV1 A;  4GCI A;  2L4C A;  2YWI A;  4MF7 A;  2H75 A;  2YWN A;  3C1R A;  1BG5 A;  2L59 A;  2E0Q A;  4RI6 A;  16GS A;  5GAP D;  1EP8 A;  1B4Q A;  3N5O A;  4HDE A;  2DLX A;  3W6G A;  5F0G A;  1WIK A;  5CRW A;  2N5B A;  3EMP A;  1TW9 A;  1SJZ A;  3UEM A;  1SD9 A;  3PIN A;  4MNN A;  1IYI A;  4ZBD A;  2LEG A;  4ECB A;  4XRA A;  3CRU A;  2V41 A;  3VI5 A;  1K0C A;  3F3R A;  3EU4 A;  5J4V A;  3F8U A;  2VOC A;  3WGE A;  4EIQ A;  1BED A;  1GSE A;  1SJ6 A;  4AI6 A;  4GDF A;  2PPT A;  4POB A;  3F6F A;  2GZP A;  2VM2 A;  2ZNM A;  1X0R A;  4YH2 A;  4I8B A;  2I1U A;  2K8V A;  3NOF A;  5FHI A;  5JWQ B;  5ECN B;  2VUP A;  3JCM L;  2C3N A;  3CBU A;  1GLP A;  1PGT A;  2VAF A;  4J56 E;  2EFE A;  2GSS A;  4ZBB A;  1EV9 A;  4K9Z A;  4CY6 A;  2HSN A;  5LCZ A;  4N30 A;  4IJ3 A;  4G2E A;  4HZ4 A;  5GAN D;  2LST A;  5JWO B;  4GWR A;  1VF4 A;  4WR5 A;  3NZN A;  4I5Q A;  2IFQ A;  1VGL A;  4PQ1 A;  2H74 A;  3KIJ A;  2VCT A;  1FOH A;  1GH2 A;  3F4S A;  1YJ6 A;  1U3A A;  2QA2 A;  5E59 A;  2HT9 A;  4MP4 A;  1VF3 A;  4ML1 A;  3KMN A;  3TU3 B;  2XBQ A;  2FA4 A;  3UIW A;  4MJE A;  5ECP B;  3DRN A;  1GTU A;  2YZU A;  1EGR A;  3TRQ A;  4GSS A;  1XIY A;  2YN1 A;  1O7U A;  1HYU A;  2HRN A;  2P31 A;  1SU9 A;  3MWH A;  3FR9 A;  3WT1 A;  1GTA A;  3W8J A;  4H86 A;  4HJM A;  1OE7 A;  3LWA A;  4N11 A;  2B1L A;  4POM A;  3VWU A;  2EIR A;  2PU9 C;  2H72 A;  4G19 A;  4FO5 A;  2R5G A;  5IMZ A;  3ZML A;  3QAW A;  2H1B A;  2MZC A;  2H6Y A;  3ZIJ A;  3D4M A;  3ZRE A;  3KD0 A;  3FY7 A;  4JED A;  2FA8 A;  1TU8 A;  2IMF A;  1QXH A;  4ECC A;  2H0I A;  1SVL A;  2DML A;  1N8J A;  2E2G A;  4XIH A;  2KHP A;  4USS A;  1JZO A;  4ACS A;  2P0G A;  2GST A;  4TXO A;  4MPG A;  5IPG A;  1HNB A;  3ME7 A;  3G7Y A;  3IC8 A;  2YNX A;  1S3D A;  3D0Z A;  2CA8 A;  4IQ1 A;  4ZB7 A;  1YKC A;  2EIQ A;  18GS A;  3QMX A;  4L5L A;  1SVM A;  4QL9 A;  2VLV A;  1ML6 A;  3LOR A;  5A34 B;  1OC3 A;  2C3T A;  2JAC A;  4K6X A;  3ZIT A;  3LW9 A;  3HJO A;  5HFI A;  5KN0 A;  3K8N A;  4LA1 A;  3M3M A;  1T3B A;  2I81 A;  1PD2 1;  4CY8 A;  5CRD A;  2IN3 A;  1LJR A;  4ZBA A;  4TKY A;  4LL4 B;  4DSQ A;  2YWM A;  5EY6 A;  2FWF A;  2PUK C;  4FH8 A;  1S3A A;  3DKS A;  2HZE B;  2RM6 A;  2GLR A;  4XS1 A;  4V1A g;  3MDK A;  3TJG A;  5BMU B;  11GS A;  4D73 B;  2RII A;  3FMW A;  1GSU A;  2LQQ A;  1FAA A;  1G7O A;  2LRT A;  3EE2 A;  5DAL B;  2LRN A;  5IM9 A;  5CRH A;  2YCD A;  2LJR A;  1A24 A;  1EV4 A;  5KN3 A;  2GTU A;  3ISO A;  2EFD A;  2ALB A;  3US3 A;  2AB6 A;  5AIV A;  4MAB A;  2M80 A;  1DBY A;  3RDW A;  2R4V A;  1R7H A;  1XW5 A;  4WBR D;  3DD3 A;  2GQK A;  6GSY A;  3MSZ A;  2WDU A;  2B7J A;  3HJP A;  5F05 A;  2H0H A;  2LJK A;  4F82 A;  5HR3 A;  1WMJ A;  1TRW A;  2PGT A;  1M7T A;  3P2A A;  1O8X A;  5ECO B;  3TGZ A;  3GRX A;  3MNG A;  5IOW A;  4ICY A;  3CXG A;  2H01 A;  2PWJ A;  3WGD A;  1A8L A;  2JZT A;  4GSN A;  2DIZ A;  4MCU A;  5BMU A;  4D73 A;  2B3S A;  1AW9 A;  5G31 A;  3ZTL A;  1ZCP A;  1FB6 A;  3FHK A;  2HE3 A;  2HSM B;  5DAL A;  5ECS A;  2YP6 A;  3KP9 A;  4AJ8 A;  3DGQ A;  4ULX A;  4KCE A;  2L6C A;  4XRD A;  1SL1 B;  2ZCT A;  2K6V A;  4GTU A;  3F4R A;  5J40 A;  1GUH A;  1H4O A;  1KBN A;  2C0G A;  2R0P A;  3U6V A;  3M8N A;  2IME A;  3GX8 A;  3ZRD A;  3TJB A;  4Z2U A;  3I69 A;  4IP1 A;  3FZ4 A;  1ERV A;  5JWR B;  3J7Y b;  5EL8 A;  2LQO A;  3ZLP A;  3F63 A;  3PGT A;  2QA1 A;  3M9J A;  3V1W A;  3HKR A;  5C00 A;  4NMU A;  4KX4 A;  1GLQ A;  2DJ2 A;  4MJA A;  3E9J B;  2P5R A;  3FZ9 A;  1GTI A;  4N0V A;  2YWO A;  4PNF A;  2NTO A;  4KGI A;  3TJF A;  4J57 E;  4OCE A;  2HSM A;  2TRX A;  5DAK B;  1EWX A;  3VWV A;  3HD5 A;  1THX A;  1VRS D;  1FW1 A;  1Y25 A;  4MMM A;  3UVH A;  2K9F A;  1PSQ A;  3C71 A;  3GKM A;  6GST A;  4ZXG A;  5KN1 A;  3FRC A;  3VPT A;  3M9K A;  1K3L A;  5ID2 A;  3CWG A;  2HQT A;  1A8Y A;  4OO5 A;  3EVI A;  3NIV A;  1AQW A;  2DJK A;  1MD3 A;  5D73 A;  2KOK A;  4PQH A;  4BA7 A;  2I3Y A;  2DJJ A;  5B6N A;  4GST A;  3L0H A;  1FB0 A;  1X5E A;  5IQY A;  4TR1 B;  4IKH A;  3Q6O A;  3WT2 A;  5ECL B;  1ERW A;  4EL1 A;  1FVJ A;  2CQ9 A;  1TXU A;  4Q5Q A;  4EC0 A;  1Z3E A;  2VCZ A;  2YZH A;  2B1K A;  4DSR A;  22GS A;  5ENU A;  2V6K A;  4RQX A;  3AY8 A;  3TB2 A;  2FWE A;  1YY7 A;  2VCQ A;  1EGO A;  5DAK A;  2X8G A;  2O85 A;  3ZIV A;  1SK2 A;  3IDV A;  1ZMA A;  4IHU A;  2MBT A;  1XWK A;  5D9T A;  1EZK A;  1YVL A;  1JFU A;  2V32 A;  2Z9S A;  3IPZ A;  5D9X A;  2FUG 2;  2X49 A;  4YQM A;  3HA9 A;  4TOP A;  2VL2 C;  1ERT A;  4V1A p;  3DEX A;  1X9M B;  5G1K A;  4GXZ A;  5KOW A;  1PQN A;  2DKI A;  3G7I A;  1XXU A;  1A23 A;  3LEF A;  2FD3 A;  4GRF A;  2KP1 A;  7GSS A;  5HR2 A;  3MYD A;  2JZR A;  2XBI A;  3KP8 A;  2FWG A;  3FR6 A;  5ECR B;  5EVO A;  3UJ1 A;  1NW2 A;  4FQU A;  4ILF A;  2L5L A;  3I43 A;  2GSR A;  4TVE A;  1A2L A;  3LGC A;  3TCO A;  3VFI A;  1DE2 A;  5F8B A;  4EDZ A;  3IK7 A;  4G0L A;  4O32 A;  4IQA A;  2OE0 A;  4QMK A;  1TK0 B;  1AAZ A;  3GTU B;  1JHB A;  4BVX B;  3ERW A;  3TKS C;  2GSQ A;  2JSY A;  2I9H A;  1XOA A;  3GH9 A;  2HSN B;  4LL1 B;  1SJI A;  3FZA A;  2VL2 A;  2VO4 A;  3GUR A;  5G5F A;  4OFM A;  3Q19 A;  2OT3 A;  3QFA C;  3LG6 A;  2P5Q A;  3TDG A;  2IFQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...