3VLNA

Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
GESARSLGKGSAPPGPVPEGSIRIYSMRFSPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.
pubmed doi rcsb
molecule keywords Glutathione S-transferase omega-1
molecule tags Transferase
source organism Homo sapiens
total genus 91
structure length 239
sequence length 239
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vlnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vlnA01
5LCZA 1GRXA 2OE0A 1JHBA 1XW6A 1XOBA 4ZILA 2OACA 2C3NA 3MNGA 5J5NA 1MTCA 5B8AA 2CVKA 3PR8A 2IMFA 5JWRB 3VI5A 4EC0A 4DEJA 2O7KA 2VO4A 5GSTA 1SD9A 2H1GA 1DE2A 4Q5QA 3ZL5A 2PWJA 1K0MA 3TB2A 3G7JA 4J57E 2YZHA 1WWJA 1Z6NA 1UVZA 4YAPA 2JL4A 5ECMB 2C3TA 1EZKA 2EIRA 2FA4A 4XS1A 3QMXA 4N11A 4EDYA 2H6YA 1J0FA 3TRQA 2B5YA 1Y6EA 2CAIA 4F0BA 5FWGA 5ECOB 2H76A 4O5RA 2OADA 1A8YA 2V6KA 4YQUA 4BVYA 3UAPA 4IJIA 1EGOA 5G2ZA 3ZVJA 5CRGA 6GSXA 3QAGA 1BAYA 1SK0A 2H0IA 4MJCA 3A5WA 1GUKA 3EU3A 3FR9A 5ECNB 3ZVJD 2GZPA 3GTUB 18GSA 1M9AA 2HT9A 2PMTA 2GGTA 5D9WA 4JEDA 1URMA 1YKAA 1V2AA 4EVMA 1MD4A 3N9JA 4MZBA 4TR1A 1TJDA 2CVDA 2JZRA 3UBLA 4HEA2 3TCOA 3IPZA 1R7HA 3IR4A 3HHVA 1JZRA 1GNEA 2B7KA 2YJHA 4MF5A 5CREA 1FO5A 2F3MA 2PERA 4ZXGA 3RPPA 2PVQA 2CQ9A 3FR6A 2YV7A 1B4PA 1FW1A 1OC8A 3KP8A 4HS1A 5HR1A 1KNGA 1HNCA 3GKKA 1V9WA 4BWSA 4TVEA 4OFMA 2HXKA 2JU5A 4WEYA 2KLXA 4OO5A 5ECPB 2DIYA 1IYIA 3F0IA 2YWNA 4G2EA 2KP2A 2LEGA 17GSA 2R4VA 1UN2A 5DQYA 5KN0A 1FVKA 2FHEA 2VL9A 3LQ7A 3IOSA 4CDOA 4KGIA 5GAND 2WRTA 4FYUA 2K8SA 2VD0A 4ISDA 4JU5A 5AIXA 4G0KA 5ABRA 2WB9A 2M80A 1F2EA 3C1SA 1ZOFA 4ECIA 2LS5A 5A4VA 3QCPA 1GSUA 1XXUA 3LWAA 4GXZA 4ILFA 2HZEA 1OE8A 3CBUA 2LQOA 3TJJA 4ML6A 2NTOA 5G30A 3HZ8A 4MH3A 5B6MA 3IC4A 4MPFA 4PQHA 1KTEA 3P7XA 2I9HA 3RPNA 1F37A 3KZQA 3Q6OA 3S9FA 5CP1A 4EDZA 4TXVA 3ZIVA 1YZXA 2H1AA 1VF2A 4GSSA 3EVIA 1MDJA 4MF7A 2R6KA 2WULA 3FR3A 5IQYA 3PH9A 2XBQA 1YDKA 1HYUA 3CRUA 5IIZA 3DVXA 1TRUA 3LFLA 2RLIA 4IP6A 5GZZB 3VURA 1OVNA 1K0DA 1SJIA 1GSEA 2RIIA 1H75A 3APSA 3KH7A 5AISA 4O7HA 4NAXA 1PA3A 3W8JA 4WXTA 2DBCA 1OC3A 1T4ZA 1TDIA 3KTBA 1ZYQB 4JBBA 1N2AA 4XIHA 4FIWA 4K7OA 1PX7A 2O8VB 4RQXA 3CTGA 1PKWA 1MD3A 4EF0A 4K1FA 2F9SA 2DJ3A 4NHZA 5ELAA 2LTKA 4YH2A 2GSQA 2HFDA 2IJYA 1M2AA 1SKWB 4K8MA 3HJOA 3CTFA 1XZOA 4XRAA 3IBHA 3GTUA 2R5GA 16GSA 4WF5A 4D73B 5ECQB 1X5CA 2H73A 1EV4A 22GSA 4POBA 3FKFA 3VWXA 1OYJA 1AW9A 2KHPA 1GTBA 3HKRA 2DJ2A 2H6ZA 1SJ6A 2B5EA 2RM6A 1YF1A 2H74A 2GQMA 5DJMA 3D21A 2IMEA 5G5FA 1G0TA 4TR3A 3VI7A 2WZ9A 3TOTA 1AQWA 1GTUA 2AJQB 1K0AA 2H0GA 4RQRA 2F8AA 2B3SA 5KEJA 5H5SA 1TOFA 3AY8A 2YOIA 2FY6A 2LQQA 5F07A 3TKPA 1UC7A 2HSNB 3DMLA 1MDKA 5D8IA 1PMTA 4MZWA 3FK8A 1TK0B 1TI1A 3BJ5A 4BVXB 2CA8A 1X9SB 1RW1A 1GTAA 3SBCA 3EINA 4HI7A 3I6AA 4K2DA 3R3EA 3CMIA 3GRXA 3D22A 3GMFA 1LU4A 4K7IA 4X1UA 2YZUA 2H1BA 4MMMA 3C71A 2WCIA 3I43A 4Q5NA 2GLRA 1DSBA 3MWHA 2ES7A 4DSRA 2B1LA 4ECJA 1T1VA 3FW2A 5E4WA 2OA7A 1EEMA 4V1Ag 1EP7A 3GKXA 1TK5B 2ZCTA 6GSVA 1BEDA 1NSWA 3EU4A 2MMNA 2FGXA 5ID2B 3ZIJA 1M2DA 3FY7A 1MEKA 4TOPA 1A0RP 3RAZA 4ZB6A 3MDKA 1PD21 4XHMA 4L5LA 2DIZA 3KXOA 1BX9A 4F2IA 1OKTA 4ECCA 1JZDA 1VRSD 4XTSA 1GH2A 3P90A 5IPGA 2J9HA 1T4YA 1X5DA 1I9DA 3FZ9A 1EEJA 2RUFA 3L4NA 2JZSA 3SWLA 1O81A 1U3AA 4EL1A 2LNSA 1GLPA 1JZWA 1O73A 1S3CA 1O85A 3WT2A 3NZNA 4MCUA 1GSFA 2BJXA 3DD3A 2GZZA 1PL2A 3QDNA 1V98A 1XW9A 5CYYA 1K0NA 3TDGA 2HI7A 3M9KA 1SK1A 2DMMA 4K7NA 1H4OA 3F8UA 3APOA 4LLRA 5AGYA 3VFIA 5DDLA 2LJAA 2F8FA 2HZFA 3C1RA 2GSSA 1ERUA 3O76A 2HE3A 3JCML 2KUCA 4I97A 1SYRA 4TN8A 4GLTA 4D73A 1R5PA 4K0NA 4OFNA 19GSA 2LV3A 4HZ2A 2KP1A 3Q18A 5CRDA 5IMZA 2GT5A 2BTOT 2H70A 1DUGA 1K3OA 3ZRDA 4V1Ap 5J4UA 4Q5FA 4XS4B 2A4VA 3QFAC 3HY2A 1JLWA 3QAWA 4TXOB 3QAVA 1QQ2A 4IJ3A 1M2BA 2H8LA 3KEBA 3EMXA 2MBSA 1OKDA 2H30A 2XBIA 5C04A 4QL9A 3IAM2 3HD5A 3ZFBA 2IL3A 3RHCA 1A2MA 2NDOA 1E2YA 2K6VA 1B8XA 2YWOA 2H19A 1U3IA 4BVXA 3IXRA 3O6TA 3PPUA 5DALB 3BCKA 4PX1A 5JCWA 3VPTA 3KH9A 2J23A 2QSIA 3BCIA 3W8SA 1SYXA 3D5JA 3EMPA 3IE3A 5CO3A 2LJRA 3H93A 4LA1A 2VUPA 4JRRA 2A2SA 3ZMLA 2XC2A 5IOXA 2VL3A 4HOJA 2FA8A 1CQGA 1V40A 2H1DA 2HRKA 2LKUA 4PNFA 4TW5A 2A2RA 3KMOA 5HR0A 1PSQA 4IS0A 4NV2A 1KBNA 5ECSA 4PTSA 3BD2A 1TW9A 3U6VA 1TI3A 1PL1A 3IC8A 3IDVA 4OD7A 1FHEA 1PQNA 1XW5A 3HVVA 2I81A 2P31A 2X8CA 2ALBA 5HR3A 2GQKA 2FUG2 3HCZA 5ID2A 3GL5A 4ECBA 3G9BA 2HLSA 5KN2A 1DBYA 3V1WA 4ID0A 1O6JA 4MZCA 2VCWA 2CT6A 6GSWA 2IIYA 2RUEA 3M3MA 1Z3EA 5LD0A 5KN3A 3ERGA 2AHEA 4TRXA 5EL8A 5HFIA 3PINA 2FNOA 2HRNA 4OO4A 4MK3A 2AV4A 5G1KA 3P2AA 2VLVA 2OE1A 4AGSA 1TXXA 1GTIA 4F0CA 3CSJA 4ZL9A 1B9XC 2PGTA 1JFUA 3WGXA 4LL1B 3TGZA 14GSA 1GUMA 3IRAA 1SKSB 1YEXA 3C7MA 3HVSA 1TU8A 5ECLB 3GFKA 4KUNA 2K9FA 1J08A 6GSUA 4G10A 4XS6A 2N5FA 3NOFA 3KIJA 3QPMA 5COHA 5FT3A 3GX0A 4LMVA 4GF0A 3D0ZA 3IAS2 3F6DA 1QUWA 3UMAA 1T7PB 1A2JA 1WP0A 4HQSA 4POLA 3BBYA 3G7YA 2EC4A 2PVOC 3U5RE 2VCXA 4XS4A 1FAAA 1F9MA 2QC7A 4EUYA 1S3DA 2VIMA 4BWQA 4ZBDA 3LJRA 4N10A 1O8XA 5AIVA 1A24A 3ZFLA 1XWKA 3E0UA 4TXOA 3D6IA 3RBTA 1NHYA 3KJYA 1XWGA 1BJXA 3EWLA 4HZ4A 2I1UA 2ON7A 3EURA 3TJBA 4IQ1A 5IMCA 2TRCP 1AC1A 3VPQA 1UA5A 3DWVA 3L9VA 1Z7PA 3DRNA 3TJKA 4MF6A 4K0GA 5DALA 1EGRA 5LNKe 3GSTA 4EKZA 1XWCA 1PN9A 2V2GA 2IPAA 1JLVA 1YJ6A 2L59A 1RQMA 3M0FA 1QMVA 3UEMA 3BOAA 1GSDA 1A2LA 2VOCA 3ZREA 3QOUA 4TR0A 1A0FA 4N0ZA 3VWVA 4ZL7A 4KH7A 1WE0A 4KSOA 5J41A 4G0LA 4IGJA 2F51A 2VM1A 3ZITA 4MA9A 1EWXA 4ZL8A 3DKSA 3GA4A 2O85A 2DJ1A 3ED3A 3ZYWA 1JZOA 1A8LA 1EP8A 2CV4A 1YQ1A 4WR4A 4OCEA 4IKHA 1OE7A 3IA1A 3IK9A 2C0FA 1TRSA 1OC9B 1GUHA 3TKRA 1M0UA 2C80A 4QQ7A 2E2GA 3GX8A 2FD3A 1FB0A 4KAEA 1T3BA 2N5AA 3CXGA 3GH6A 4AJ6A 4NMUA 2C3QA 1PRXA 2C1YA 5GAPD 3ISOA 3TKSA 4WF4A 2B6MA 1SL2B 5G31A 1W4VA 1VF3A 1FVJA 3UARA 3WGDA 1GLQA 3LSZA 4ML1A 1DE1A 4Q5RA 1ERTA 4JR4A 1TTZA 3FYGA 4BA7A 1E6BA 4JR6A 4IVFA 2DJJA 4MJEA 2L5OA 2RM5A 1K3LA 1S3AA 4IW9A 3UL3A 1MDIA 3FZAA 2MMZA 1AIUA 2XPDA 4Z7XA 1TP9A 1IYHA 5ECKB 1NHOA 5FHIA 1G6WA 5F05A 3US3A 1HQOA 1ON4A 2HSHA 3F4TA 3ME8A 3DGQA 3UBKA 3EC3A 2GS3A 4MP4A 2YWMA 1ILOA 3IV4A 4I2UA 2BMXA 1CQHA 4I2TA 4JE1A 2MZCA 1FOVA 1HD2A 3MAKA 5ELGA 3D4TA 3L0HA 2QGVA 1X9WB 5EVOA 4AF2A 5D9TA 3DXBA 2H01A 1SD8A 4DSSB 3DEXA 2GVPA 4O92A 2LRTA 3GHAA 2AYTA 5D9XA 7GSSA 4GTUA 3H8QA 3FZ4A 3LXTA 1V57A 3H79A 2YJ7A 1Y25A 3WYWA 1ZYEA 1TU7A 2GSTA 3ERFA 2DMLA 5J9CA 2MBTA 3H1NA 1YY7A 2LRCA 5DBQA 1AQVA 5JCGA 5CAXA 4GQCA 3DYRA 1GSYA 1TK8B 3GUSA 3LYKA 4KX4A 1C72A 2WDUA 2IN3A 2E0QA 4HDEA 1Q4JA 2GTUA 4IBPA 1ZGNA 1K0OA 3IHQA 1K0CA 4MPGA 1YF0A 2JSYA 2B5XA 2VAFA 4MLYA 1OC9A 1XWAA 4GCIA 4OWYA 2CVBA 3LG6A 2YNXA 5DCHA 1ABAA 1B9YC 2CX4A 2FCHA 4RI7A 1PGTA 2X99A 4GSNA 2YWIA 2YN1A 2VCZA 2VD1A 1GL8A 3LORA 3F9UA 2IWTA 10GSA 3F4RA 12GSA 4YQVA 1AXDA 3D4MA 3TUEA 2V41A 2CX3A 3GN3A 4BL7B 5L71A 3VWWA 2L5LA 5JWOB 3H4KA 2ZUPA 1F3AA 1F6MC 2H6XA 1GULA 1X0RA 3HYPA 3CSIA 1U6TA 5F06A 2X8GA 4GRFA 4QL7A 2DC5A 5HR2A 5D93A 1GSQA 1AUCA 2I3YA 1TKDB 2PU9C 5CRWA 3KGKA 2O89A 5DAKB 1XCCA 3TKQA 3GURA 3ZTLA 2JADA 4KF9A 1AQXA 3QFBC 3IK7A 4PNGA 4L5OA 1G6YA 5IPHA 1R5AA 2M46A 3GIXA 4PUFC 3GL3A 4HJMA 5DJLA 5ECRB 5IMFA 4YAVA 5C00A 1TRWA 1I5GA 2P0GA 2VLTA 3GYKA 3UJ1A 1HNAA 4DSSA 1THXA 1USBA 5CRHA 1HNBA 5A5KA 3TKSE 4X43A 2HRAA 4I5QA 3HVXA 1T00A 6GSTA 2XHFA 1XBSA 2MMAA 4CW9A 2OJLA 4K6XA 1TRVA 2VM2A 1SK2A 2OBKA 5G1LA 1K0BA 1WJKA 2IFQB 5D96A 5IMVA 5J3RA 4ZB8A 2JACA 3UVTA 8GSSA 2YANA 3GKNA 1U88A 3ME7A 1SL0B 4WBRD 4V2LA 3M1GA 3HJMA 1NW2A 4KDYA 1X5EA 1EOGA 3HDCA 5B8BA 1QGVA 4FH8A 2JZTA 4J2FA 4HUAA 2HNLA 1XPVA 2H71A 4FYCA 3KD0A 1K3YA 2XPEA 4N0VA 4MDCA 1M9BA 4AJ7A 4ZBBA 2FWEA 1ST9A 4FYBA 3WT1A 2O87A 3LEFA 1LBKA 3LGCA 2VL2A 2P5RA 1BG5A 2MMOA 2OE3A 5IMAA 4NHWA 2X8HA 2Z9SA 2V32A 2HQTA 1PKZA 4GQFA 2AAWA 11GSA 3TKSC 5B7CA 4NXIA 3VLNA 5H5RA 5IO2A 5IO0A 2CAQA 3M8NA 1M7TA 4V2NA 1GP1A 1ACVA 3F4SA 3QD9A 3L9SA 4OCFA 5H5QA 4MABA 3CSHA 3GV1A 4POKA 4G9HA 2WFCA 5JWQB 1U87A 1A23A 2IMDA 3FRCA 2H66A 4PUAA 1VGLA 4RI6A 3E9JB 3RHBA 4KDUA 1AAZA 5HFGA 4BL7A 3ZZXA 2NVLA 1WRYA 3F3QA 1ZMAA 5JCUA 2E7PA 2HSYA 2K18A 2CZ3A 2LSTA 1SKRB 2R2JA 4MJAA 4ZBAA 1GSSA 2LRNA 1ERWA 3WD6A 3GNJA 4KDXA 2YCDA 1SJZA 2WGRA 4E8EA 4G0IA 5DAKA 1R26A 3KM6A 4PURA 3WGEA 5IMDA 3TOUA 4OMVA 3KMNA 3Q19A 5F0GA 5KN1A 9GSSA 4USSA 4IQAA 5HQPA 1XVWA 2EIOA 3TRPA 3L9UA 2GDRA 4CHSA 1BYEA 1XOAA 4RUVA 4NWYA 2KOKA 2UZ8A 4DSQA 4PXOA 3FEUA 5G5EA 4KCEA 4J56E 2HSMB 2FLSA 2M72A 2L4QA 4KW6A 2PBJA 4IP1A 2I4AA 2YP6A 2JSZA 2YPMA 2TIRA 2L6DA 3F3RA 4KCAA 2C0EA 2WJUA 5B6NA 3OR5A 1XVQA 3F63A 5IOWA 3R2QA 2IFQA 1SENA 2V1MA 4HQZA 4L0UA 3QR6A 1Z7RA 4G19A 1G7OA 4GSTA 2FWFA 2C8UA 3GH9A 3KTLA 1KEBA 4V2MA 3UVHA 1WPIA 4NPBA 4MJBA 2GZYA 2NBSA 3C73A 2PN8A 5HFKA 4MH2A 1QK8A 4TR4A 2GQLA 5BMUA 4FO5A 4F9ZA 2VCVA 1J9BA 4IELA 1QFNA 3UOMA 1WIKA 3I69A 3RDWA 1VF1A 3FZ5A 2IMIA 3KP9A 4WETA 2B7JA 2D2ZA 3EE2A 4DVCA 2DJKA 4WKWA 3ZLPA 2E2MA 2VCTA 1GWCA 2OKAA 1N8JA 4XRDA 1WOUA 4F03A 4L0WA 5AN1A 2P5QA 3EYTA 4HU9A 2K8VA 2DJ0A 5INYA 2R37A 1B48A 3LXZA 2AB6A 3FHKA 4POMA 5IM9A 3E3EA 1NM3A 1RK4A 4LL4B 2FWHA 2REMA 4OFTA 1V58A 4AJ8A 4PGTA 3TJGA 2V6OA 4EO3A 1EOHA 1ZCPA 4IHUA 20GSA 3HXSA 2DSAA 4L8EA 3UIWA 1SL1B 4PQIA 3MSZA 1Q98A 4X0XA 3N5OA 3J7Yk 3VK9A 2N5BA 4P3YB 4ZIJA 4ZB9A 2VLUA 3O3TA 2L6CA 4NV5A 1YKCA 5ECHB 2WS2A 2TRXA 13GSA 4H86A 1G7EA 2R3XA 1XWBA 2DLXA 3HA9A 2HRKB 3A2WA 2HRFA 4FQUA 1SU9A 2ZNMA 2G0FA 3APQA 2B1KA 1XIYA 3KCMA 1B4QA 3LYPA 2AUVA 3VWUA 4ACSA 1W89A 3F6FA 5D73A 5ENUA 3ZMKA 2X64A 2L4CA 1ZZYA 4WR5A 4JZQA 2G2QA 3A2VA 5DVBA 1EV9A 4BVYB 1BQ7A 2HSMA 5A4UA 1XFLA 4HJ2A 3A3TA 4KNDA 5DQSA 1FB6A 4IN0A 2CZ2A 2H75A 3PGTA 4I6XA 4KB3A 3DVWA 1Z9HA 4YQMA 1T8EB 3J7Yb 2QKEA 4ULXA 5EY6A 4F82A 4GWRA 1OAZA 3GSSA 4N30A 2H72A 3HJPA 1WMJA 4TR1B 2HYXA 3M9JA 4TKYA 1THOA 4EXJA 5J9BA 2GSRA 2C0DA 2LNTA 1ZL9A 1X9MB 6GSYA 3Q74A 2PPTA 3C8EA 2C0GA 1LJRA 5CNWA 1YEPA 2EIQA 2VL2C 1M99A 3ERWA 5EPFA 1O8WA 1GNWA 4E8HA 3A2XA 4BPYA 2IMKA 4KA0A 1ERVA 5ECIB 3W6GA 3G7IA 2MYGA 1VF4A 2YV9A 3CYNA 5E59A 4EE0A 3P8WA 5D9VA 2L57A 3NIVA 3DIEA 3TRXA 5GSSA 1Z5YE 1FG4A 2OBIA 4XCSA 3CRTA 3TJFA 2H0HA 2FWGA 1F3BA 4O32A 1R4WA 2C4JA 4K9ZA 4I8BA 2ON5A 4LMWA 2HZEB 1PX6A 3GKMA 2LUSA 3I9V2 1ML6A 2LJKA 5F8BA 4KSMA 1QXHA 3L78A 6GSSA 4KE3A 2PUKC 2NPBA 4WBJA 3HZ4A 2GT6A 5A4WA 2VCQA 4HU7A 3K8NA 4PQ1A 1Z6MA 1O7UA 5DCGA
chains in the Genus database with same CATH superfamily
5LCZA 1GRXA 2OE0A 1JHBA 1XW6A 1XOBA 4ZILA 2OACA 2C3NA 3MNGA 5J5NA 1MTCA 5B8AA 2CVKA 3PR8A 2IMFA 5JWRB 3VI5A 4EC0A 4DEJA 2O7KA 2VO4A 5GSTA 1SD9A 2H1GA 1DE2A 4Q5QA 3ZL5A 2PWJA 1K0MA 3TB2A 3G7JA 4J57E 2YZHA 1WWJA 1Z6NA 4PI2C 1UVZA 3HVNA 4YAPA 2JL4A 5ECMB 2C3TA 1EZKA 2EIRA 2FA4A 4XS1A 3QMXA 4N11A 4EDYA 2H6YA 1J0FA 3TRQA 2B5YA 1Y6EA 2CAIA 4F0BA 5FWGA 5ECOB 2H76A 4O5RA 2OADA 1A8YA 2O3EA 2V6KA 4YQUA 4BVYA 3UAPA 4IJIA 1EGOA 1FOHA 5G2ZA 3ZVJA 3EPTA 5CRGA 6GSXA 3QAGA 1BAYA 1SK0A 2H0IA 4MJCA 3A5WA 1GUKA 3EU3A 3FR9A 5ECNB 3ZVJD 2GZPA 2A4HA 3GTUB 2QA1A 18GSA 4GDFA 1M9AA 2HT9A 2PMTA 2GGTA 5D9WA 4JEDA 1URMA 1YKAA 1V2AA 4EVMA 1MD4A 3N9JA 4MZBA 4TR1A 1TJDA 2CVDA 2JZRA 3UBLA 4HEA2 3TCOA 3IPZA 1R7HA 3IR4A 3HHVA 1JZRA 1GNEA 2B7KA 2YJHA 4MF5A 5CREA 1FO5A 2F3MA 2PERA 4ZXGA 3RPPA 2PVQA 4YKFA 2CQ9A 3FR6A 2YV7A 1B4PA 1FW1A 1OC8A 3KP8A 4HS1A 5HR1A 1KNGA 1HNCA 3GKKA 1V9WA 4BWSA 4TVEA 4OFMA 2HXKA 2JU5A 4WEYA 2KLXA 4OO5A 5ECPB 2DIYA 1IYIA 3F0IA 2YWNA 4G2EA 2KP2A 2LEGA 17GSA 2R4VA 1UN2A 5DQYA 5KN0A 1FVKA 2FHEA 2VL9A 3LQ7A 3IOSA 4CDOA 4KGIA 5GAND 2WRTA 4FYUA 2K8SA 2VD0A 4ISDA 5A34B 4JU5A 5AIXA 4G0KA 5ABRA 2WB9A 2M80A 1F2EA 3C1SA 1ZOFA 4ECIA 2LS5A 5A4VA 3QCPA 1GSUA 1XXUA 3LWAA 4GXZA 4ILFA 2HZEA 1OE8A 3CBUA 2LQOA 3TJJA 4ML6A 2NTOA 5G30A 3HZ8A 4MH3A 5B6MA 3IC4A 4MPFA 4PQHA 1KTEA 3P7XA 2I9HA 3RPNA 1F37A 3KZQA 3Q6OA 3S9FA 5CP1A 4EDZA 4TXVA 3ZIVA 4EIQA 1YZXA 2H1AA 1VF2A 4GSSA 2X4AA 3EVIA 1MDJA 4MF7A 2R6KA 2WULA 3FR3A 5IQYA 3PH9A 2XBQA 1YDKA 1HYUA 3CRUA 5J47A 5IIZA 3DVXA 1TRUA 3LFLA 2RLIA 4IP6A 5GZZB 3VURA 1OVNA 1K0DA 1SJIA 1GSEA 2RIIA 1H75A 3APSA 3KH7A 2H1LA 5AISA 4O7HA 4NAXA 1PA3A 3W8JA 4WXTA 2DBCA 1OC3A 1T4ZA 1TDIA 3KTBA 4FXYP 1ZYQB 4JBBA 1N2AA 4XIHA 4FIWA 4K7OA 1PX7A 2O8VB 4RQXA 3CTGA 1PKWA 1MD3A 4EF0A 4K1FA 2F9SA 2DJ3A 4NHZA 5ELAA 2LTKA 4O5QA 4YH2A 2GSQA 2HFDA 2IJYA 1M2AA 1SKWB 4K8MA 3HJOA 3CTFA 1XZOA 4XRAA 3IBHA 3GTUA 2R5GA 16GSA 2DKIA 2WVXB 4WF5A 4D73B 5ECQB 1X5CA 2H73A 1EV4A 22GSA 4POBA 3FKFA 3VWXA 1OYJA 1AW9A 2KHPA 1GTBA 3HKRA 2DJ2A 2H6ZA 3IHGA 1SJ6A 2B5EA 2RM6A 1YF1A 2H74A 2GQMA 5DJMA 3D21A 2IMEA 5G5FA 1G0TA 4TR3A 3VI7A 2WZ9A 3TOTA 1AQWA 1GTUA 2AJQB 1K0AA 2H0GA 4RQRA 2F8AA 2B3SA 5KEJA 5H5SA 1TOFA 3AY8A 2YOIA 2FY6A 2LQQA 5F07A 5A5HB 3TKPA 1UC7A 2HSNB 3DMLA 4BIKA 1MDKA 5D8IA 1PMTA 2EFDA 4MZWA 3FK8A 1TK0B 1TI1A 3BJ5A 4BVXB 2CA8A 1X9SB 5A34A 1RW1A 1GTAA 3SBCA 3EINA 4HI7A 3I6AA 2WW2A 1SVLA 4K2DA 3R3EA 3CMIA 3GRXA 3D22A 3GMFA 1LU4A 4K7IA 4X1UA 2YZUA 2H1BA 4MMMA 3C71A 2WCIA 3I43A 3HMJG 4Q5NA 2GLRA 1DSBA 3MWHA 2ES7A 4DSRA 2B1LA 4ECJA 1T1VA 3FW2A 5E4WA 2OA7A 1EEMA 4V1Ag 1EP7A 3GKXA 1TK5B 2ZCTA 6GSVA 1BEDA 1NSWA 3EU4A 2MMNA 2O5VA 2FGXA 5ID2B 3ZIJA 1M2DA 3FY7A 1MEKA 4TOPA 1A0RP 3RAZA 4ZB6A 3MDKA 4A5PA 1PD21 1YVLA 4XHMA 4PHZC 4L5LA 2DIZA 3KXOA 1BX9A 4F2IA 1OKTA 4ECCA 1JZDA 1VRSD 4XTSA 1GH2A 3P90A 5IPGA 2J9HA 1T4YA 1X5DA 1I9DA 3A5IA 3FZ9A 1EEJA 2RUFA 3L4NA 4AKGA 2JZSA 3SWLA 4K2XA 1O81A 1U3AA 4EL1A 2LNSA 1GLPA 1JZWA 1O73A 1S3CA 1O85A 3WT2A 3NZNA 4MCUA 1I1IP 1GSFA 2BJXA 3DD3A 2GZZA 1PL2A 3QDNA 1V98A 1XW9A 5CYYA 1K0NA 3TDGA 2HI7A 3M9KA 1SK1A 2DMMA 5J40A 4K7NA 1H4OA 3F8UA 3APOA 4LLRA 5AGYA 3VFIA 5DDLA 2LJAA 2F8FA 2HZFA 3C1RA 2GSSA 1ERUA 1SVMA 3O76A 2HE3A 3JCML 2KUCA 4I97A 1SYRA 4TN8A 4GLTA 4D73A 1R5PA 4K0NA 4OFNA 19GSA 2LV3A 4HZ2A 2KP1A 3Q18A 5CRDA 5IMZA 2GT5A 2BTOT 2H70A 1DUGA 1K3OA 3ZRDA 4V1Ap 5J4UA 4Q5FA 4XS4B 2A4VA 3QFAC 3HY2A 1JLWA 3QAWA 4TXOB 3QAVA 1QQ2A 4IJ3A 1M2BA 2H8LA 1Y1UA 3KEBA 1S4BP 3EMXA 2MBSA 1OKDA 2H30A 2XBIA 5C04A 4QL9A 3IAM2 3HD5A 3ZFBA 2IL3A 3RHCA 1A2MA 2NDOA 2HSNA 1E2YA 2K6VA 1B8XA 5A1NB 2YWOA 2H19A 1U3IA 2EFCA 4BVXA 3IXRA 3O6TA 4W66A 3PPUA 5DALB 3BCKA 4PX1A 5JCWA 3VPTA 3KH9A 2J23A 2QSIA 3BCIA 3W8SA 1SYXA 3D5JA 3EMPA 3IE3A 5CO3A 2LJRA 3H93A 4LA1A 2VUPA 4JRRA 2A2SA 3ZMLA 5J4YA 2XC2A 5IOXA 2VL3A 4HOJA 2FA8A 1CQGA 1V40A 2H1DA 2HRKA 2LKUA 4PNFA 4TW5A 2A2RA 3KMOA 5HR0A 1PSQA 4IS0A 4NV2A 1KBNA 5ECSA 4PTSA 3BD2A 2OT3A 1TW9A 3U6VA 1TI3A 1PL1A 3IC8A 3IDVA 4OD7A 1FHEA 1BG1A 1PQNA 1XW5A 3HVVA 2I81A 2P31A 2X8CA 2ALBA 5HR3A 2GQKA 2FUG2 3HCZA 5ID2A 3GL5A 4ECBA 3G9BA 2HLSA 5KN2A 1DBYA 3V1WA 4ID0A 1O6JA 4MZCA 3MIXA 2VCWA 2CT6A 6GSWA 2IIYA 2RUEA 3M3MA 1Z3EA 5LD0A 5KN3A 3ERGA 2AHEA 4TRXA 5EL8A 5HFIA 3PINA 2FNOA 2HRNA 4OO4A 4MK3A 2AV4A 5G1KA 3P2AA 2VLVA 2OE1A 4AGSA 1TXXA 1GTIA 4F0CA 3CSJA 4ZL9A 1B9XC 2PGTA 1JFUA 3WGXA 4LL1B 3TGZA 14GSA 1GUMA 3IRAA 1SKSB 1YEXA 3C7MA 3HVSA 1TU8A 5ECLB 3GFKA 4KUNA 2K9FA 1J08A 6GSUA 4G10A 4XS6A 2N5FA 3NOFA 3KIJA 3QPMA 5COHA 5FT3A 3GX0A 4LMVA 4GF0A 3D0ZA 3IAS2 3F6DA 1QUWA 3UMAA 1T7PB 1A2JA 1WP0A 4HQSA 4POLA 3BBYA 3G7YA 2EC4A 2PVOC 3U5RE 2VCXA 4XS4A 1FAAA 1F9MA 2QC7A 4EUYA 1S3DA 2VIMA 4BWQA 4ZBDA 3LJRA 4N10A 1O8XA 5AIVA 1A24A 3ZFLA 1XWKA 3E0UA 2EFEA 4TXOA 3D6IA 3RBTA 1NHYA 3KJYA 1XWGA 1BJXA 3EWLA 4HZ4A 2I1UA 2EFHA 2ON7A 3EURA 3TJBA 2R0PA 4IQ1A 5IMCA 2TRCP 1AC1A 3VPQA 1UA5A 3DWVA 3L9VA 1Z7PA 3DRNA 5A1NA 3TJKA 4MF6A 4K0GA 5DALA 1EGRA 5LNKe 3GSTA 4EKZA 1XWCA 1PN9A 2V2GA 2IPAA 1JLVA 1YJ6A 2L59A 1RQMA 3M0FA 1XG8A 1QMVA 3UEMA 3BOAA 1GSDA 1A2LA 2VOCA 3ZREA 3QOUA 4TR0A 1A0FA 4N0ZA 3VWVA 4ZL7A 4KH7A 1WE0A 4KSOA 5J41A 4G0LA 4IGJA 2F51A 2VM1A 3ZITA 4MA9A 1EWXA 4ZL8A 3DKSA 3GA4A 2O85A 2DJ1A 3ED3A 3ZYWA 1TXUA 1JZOA 1A8LA 1EP8A 1SVOA 2CV4A 1YQ1A 4WR4A 4OCEA 4IKHA 1OE7A 3IA1A 3IK9A 2C0FA 1TRSA 1OC9B 1GUHA 3TKRA 1M0UA 2C80A 4QQ7A 2E2GA 3GX8A 2FD3A 1FB0A 4KAEA 1T3BA 2N5AA 3CXGA 4O5UA 3GH6A 4AJ6A 4NMUA 2C3QA 1PRXA 2C1YA 5GAPD 3ISOA 3TKSA 4WF4A 2B6MA 1SL2B 4K5RA 5G31A 1W4VA 1VF3A 1FVJA 3UARA 3WGDA 1GLQA 2X49A 3LSZA 4ML1A 1DE1A 4Q5RA 1ERTA 4JR4A 1TTZA 3FYGA 4BA7A 1E6BA 4JR6A 4IVFA 2DJJA 4MJEA 2L5OA 2RM5A 1K3LA 1S3AA 4IW9A 3UL3A 1MDIA 3FZAA 2MMZA 1AIUA 2XPDA 4Z7XA 1TP9A 1IYHA 5ECKB 1NHOA 5FHIA 1G6WA 5F05A 3US3A 1HQOA 1ON4A 2HSHA 3F4TA 3ME8A 3DGQA 3UBKA 3EC3A 2GS3A 4MP4A 2YWMA 1ILOA 3IV4A 4I2UA 2BMXA 1CQHA 4I2TA 4JE1A 2MZCA 1FOVA 1HD2A 3MAKA 5ELGA 3D4TA 3L0HA 2QGVA 1X9WB 4CY6A 5EVOA 4YKGA 4AF2A 5D9TA 3DXBA 2H01A 1SD8A 4DSSB 3DEXA 2GVPA 4O92A 2LRTA 3GHAA 2A2PA 2AYTA 5D9XA 7GSSA 4GTUA 3H8QA 3FZ4A 3LXTA 1V57A 3H79A 2YJ7A 1Y25A 3WYWA 1ZYEA 1TU7A 2GSTA 4Z2UA 3ERFA 2DMLA 5J9CA 2MBTA 3H1NA 1YY7A 2LRCA 5DBQA 5BRTA 1AQVA 5JCGA 4CY8A 5CAXA 4GQCA 3DYRA 1GSYA 4K5SA 1TK8B 3GUSA 3LYKA 4KX4A 1C72A 2WDUA 3RFRC 2IN3A 2E0QA 4HDEA 1Q4JA 2GTUA 4IBPA 1ZGNA 1K0OA 3IHQA 1S3RA 1K0CA 4MPGA 1YF0A 2JSYA 2B5XA 2VAFA 4AI6A 4MLYA 1OC9A 2O36A 1XWAA 4GCIA 1M3IA 4OWYA 1ZYPA 2CVBA 3TU3B 3LG6A 2YNXA 5DCHA 1ABAA 1B9YC 1N25A 2CX4A 2FCHA 4RI7A 1PGTA 2X99A 4GSNA 2YWIA 2WVXA 2YN1A 2VCZA 2VD1A 1GL8A 3LORA 3F9UA 2IWTA 10GSA 3F4RA 12GSA 4YQVA 1AXDA 3D4MA 5KOWA 3TUEA 2V41A 4PI0C 2CX3A 3GN3A 4BL7B 5L71A 3VWWA 2L5LA 5JWOB 3H4KA 2ZUPA 1F3AA 1F6MC 2H6XA 1GULA 1X0RA 3HYPA 3CSIA 1U6TA 5F06A 2X8GA 4GRFA 4QL7A 2DC5A 5HR2A 5D93A 1GSQA 1AUCA 2I3YA 1TKDB 2PU9C 5CRWA 3KGKA 5A5HA 5DAKB 2O89A 1XCCA 3TKQA 3GURA 3ZTLA 2JADA 4KF9A 1AQXA 3QFBC 3IK7A 4PNGA 4L5OA 1G6YA 5IPHA 1R5AA 2M46A 3GIXA 4PUFC 3GL3A 4HJMA 5DJLA 1YEWC 5ECRB 5IMFA 4YAVA 5C00A 1TRWA 1I5GA 2P0GA 2VLTA 3GYKA 3UJ1A 1HNAA 4DSSA 1THXA 1USBA 5CRHA 1HNBA 5A5KA 3TKSE 4X43A 2HRAA 4I5QA 3HVXA 1T00A 6GSTA 4HSCX 2XHFA 1XBSA 2MMAA 4CW9A 2OJLA 2WW3A 4K6XA 1TRVA 2VM2A 1SK2A 2OBKA 5G1LA 1K0BA 1WJKA 2IFQB 5D96A 5IMVA 5J3RA 4ZB8A 2JACA 3UVTA 8GSSA 2YANA 3GKNA 4X4JA 1U88A 3ME7A 1SL0B 4WBRD 4V2LA 4G01A 3M1GA 3HJMA 1NW2A 4KDYA 1X5EA 1EOGA 3HDCA 5B8BA 2UV8G 1QGVA 4FH8A 2JZTA 4J2FA 4HUAA 2HNLA 1XPVA 2H71A 5J4VA 5BMUB 4FYCA 3KD0A 1K3YA 2XPEA 4N0VA 4MDCA 1M9BA 4AJ7A 4ZBBA 2FWEA 1ST9A 4FYBA 3WT1A 2O87A 3LEFA 1LBKA 3LGCA 4ICYA 2WZSA 2VL2A 2P5RA 1BG5A 2MMOA 2OE3A 5IMAA 4NHWA 2X8HA 2Z9SA 2V32A 2HQTA 1PKZA 4GQFA 2AAWA 11GSA 3TKSC 5B7CA 4NXIA 3VLNA 5H5RA 5IO2A 5IO0A 2CAQA 3M8NA 2WVYA 1M7TA 4V2NA 1GP1A 1ACVA 3F4SA 3QD9A 3L9SA 4OCFA 5H5QA 1PFOA 3CSHA 3GV1A 4MABA 4POKA 4G9HA 2WFCA 5JWQB 1U87A 1A23A 2IMDA 3FRCA 2H66A 4PUAA 3FMWA 3CQFA 1VGLA 4RI6A 3E9JB 3RHBA 4KDUA 1AAZA 5HFGA 4BL7A 3ZZXA 2NVLA 1WRYA 3F3QA 1ZMAA 5JCUA 2E7PA 2HSYA 2K18A 4AKIA 2CZ3A 2LSTA 1SKRB 2R2JA 4MJAA 4ZBAA 1GSSA 2LRNA 1ERWA 3WD6A 3GNJA 1BF5A 4KDXA 2YCDA 1SJZA 2WGRA 5KOXA 4E8EA 4G0IA 3CHXC 5DAKA 1R26A 3KM6A 4PURA 3WGEA 5IMDA 3TOUA 4OMVA 3KMNA 3Q19A 5F0GA 5KN1A 9GSSA 4USSA 4IQAA 5HQPA 1XVWA 2EIOA 3TRPA 3L9UA 2GDRA 4CHSA 1BYEA 1XOAA 4MNNA 4RUVA 4NWYA 2KOKA 2UZ8A 4DSQA 4PXOA 3FEUA 5G5EA 4KCEA 4J56E 2HSMB 2FLSA 2M72A 2L4QA 4KW6A 2PBJA 4IP1A 2I4AA 2YP6A 2JSZA 2YPMA 2TIRA 2L6DA 3F3RA 1PN0A 4KCAA 2C0EA 2WJUA 5B6NA 3OR5A 1XVQA 3F63A 5IOWA 3R2QA 2WVZA 2IFQA 1SENA 4ZB7A 2V1MA 4HQZA 2VKZG 4L0UA 3QR6A 1Z7RA 4G19A 1G7OA 4GSTA 4EIPA 2FWFA 2C8UA 3GH9A 3KTLA 1KEBA 4V2MA 3UVHA 1WPIA 4NPBA 4MJBA 2GZYA 2NBSA 3C73A 2PN8A 5HFKA 4MH2A 1QK8A 4TR4A 2GQLA 5BMUA 4FO5A 4F9ZA 2VCVA 1J9BA 2R0CA 4IELA 1QFNA 3UOMA 1WIKA 3I69A 2WW1A 3RDWA 1VF1A 3FZ5A 2IMIA 3KP9A 4WETA 2B7JA 2D2ZA 3EE2A 4DVCA 2DJKA 4WKWA 3ZLPA 2E2MA 2VCTA 1GWCA 2OKAA 1N8JA 4AKXB 4XRDA 1WOUA 4F03A 4L0WA 5AN1A 2P5QA 3EYTA 4HU9A 2K8VA 2DJ0A 5INYA 2R37A 1B48A 3LXZA 2AB6A 3FHKA 4POMA 5IM9A 3E3EA 1ZYNA 1NM3A 2R0GA 1RK4A 4LL4B 2FWHA 2REMA 4OFTA 1V58A 4AJ8A 4PGTA 3TJGA 2V6OA 4EO3A 1EOHA 1ZCPA 4IHUA 20GSA 3HXSA 2DSAA 4L8EA 3UIWA 1SL1B 4PQIA 3MSZA 1Q98A 4X0XA 3N5OA 3J7Yk 3VK9A 2N5BA 4P3YB 4ZIJA 4ZB9A 2VLUA 3O3TA 2L6CA 4Z2TA 4NV5A 1YKCA 5ECHB 2WS2A 2TRXA 13GSA 4H86A 1G7EA 2R3XA 1XWBA 2DLXA 3HA9A 2HRKB 3A2WA 2HRFA 4FQUA 1SU9A 2ZNMA 2G0FA 3APQA 2B1KA 1XIYA 3KCMA 1B4QA 3LYPA 2AUVA 3VWUA 4ACSA 1W89A 3F6FA 5D73A 5ENUA 3ZMKA 2X64A 2L4CA 1ZZYA 4WR5A 4JZQA 2G2QA 3A2VA 5DVBA 1EV9A 4BVYB 1BQ7A 2HSMA 5A4UA 1XFLA 4HJ2A 3A3TA 4Z2RA 2QA2A 4KNDA 5DQSA 1FB6A 4IN0A 2CZ2A 2H75A 3PGTA 4I6XA 4KB3A 3DVWA 1Z9HA 4QMKA 4YQMA 1T8EB 3J7Yb 2QKEA 4ULXA 5EY6A 2DKHA 4F82A 4GWRA 1OAZA 3GSSA 4N30A 2H72A 3HJPA 1WMJA 4TR1B 2HYXA 3M9JA 4TKYA 1THOA 4EXJA 5J9BA 2GSRA 2C0DA 2LNTA 1ZL9A 1X9MB 6GSYA 4AKHA 3Q74A 2PPTA 3C8EA 2C0GA 1LJRA 5CNWA 1YEPA 3MYDA 2EIQA 2VL2C 1M99A 3LW9A 3ERWA 5EPFA 1O8WA 1GNWA 4E8HA 3A2XA 4BPYA 2IMKA 4KA0A 1ERVA 5ECIB 3W6GA 3G7IA 2MYGA 1VF4A 2YV9A 3CYNA 4N3ZA 5E59A 4EE0A 3P8WA 5D9VA 2L57A 3NIVA 3DIEA 3TRXA 5GSSA 1Z5YE 1FG4A 2OBIA 4XCSA 3CRTA 2WW0A 1M3JA 3TJFA 2H0HA 2FWGA 1F3BA 4O32A 1R4WA 2C4JA 4K9ZA 4I8BA 2ON5A 4LMWA 2HZEB 1PX6A 3GKMA 2LUSA 3I9V2 1ML6A 2LJKA 5F8BA 4KSMA 1QXHA 3L78A 6GSSA 4E68A 4KE3A 3RGBC 2PUKC 2NPBA 4WBJA 3HZ4A 2GT6A 5A4WA 2VCQA 4HU7A 3K8NA 4PQ1A 3CWGA 1Z6MA 1O7UA 5DCGA
chains in the Genus database with same CATH topology
5LCZA 1GRXA 2OE0A 1JHBA 1XW6A 1XOBA 4ZILA 2OACA 2C3NA 3MNGA 5J5NA 1MTCA 5B8AA 2CVKA 3PR8A 2IMFA 5JWRB 3VI5A 4EC0A 4DEJA 2O7KA 2VO4A 5GSTA 1SD9A 2H1GA 1DE2A 4Q5QA 3ZL5A 2PWJA 1K0MA 3TB2A 3G7JA 4J57E 2YZHA 1WWJA 1Z6NA 1UVZA 4YAPA 2JL4A 5ECMB 2C3TA 1EZKA 2EIRA 2FA4A 4XS1A 3QMXA 4N11A 4EDYA 2H6YA 1J0FA 3TRQA 2B5YA 1Y6EA 2CAIA 4F0BA 5FWGA 5ECOB 2H76A 4O5RA 2OADA 1A8YA 2V6KA 4YQUA 4BVYA 3UAPA 4IJIA 1EGOA 1FOHA 5G2ZA 3ZVJA 3EPTA 5CRGA 6GSXA 3QAGA 1BAYA 1SK0A 2H0IA 4MJCA 3A5WA 1GUKA 3EU3A 3FR9A 5ECNB 3ZVJD 2GZPA 2A4HA 3GTUB 2QA1A 18GSA 4GDFA 1M9AA 2HT9A 2PMTA 2GGTA 5D9WA 4JEDA 1URMA 1YKAA 1V2AA 4EVMA 1MD4A 3N9JA 4MZBA 4TR1A 1TJDA 2CVDA 2JZRA 3UBLA 4HEA2 3TCOA 3IPZA 1R7HA 3IR4A 3HHVA 1JZRA 1GNEA 2B7KA 2YJHA 4MF5A 5CREA 1FO5A 2F3MA 2PERA 4ZXGA 3RPPA 2PVQA 4YKFA 2CQ9A 3FR6A 2YV7A 1B4PA 1FW1A 1OC8A 3KP8A 4HS1A 5HR1A 1KNGA 1HNCA 3GKKA 1V9WA 4BWSA 4TVEA 4OFMA 2HXKA 2JU5A 4WEYA 2KLXA 4OO5A 5ECPB 2DIYA 1IYIA 3F0IA 2YWNA 4G2EA 2KP2A 2LEGA 17GSA 2R4VA 1UN2A 5DQYA 5KN0A 1FVKA 2FHEA 2VL9A 3LQ7A 3IOSA 4CDOA 4KGIA 5GAND 2WRTA 4FYUA 2K8SA 2VD0A 4ISDA 5A34B 4JU5A 5AIXA 4G0KA 5ABRA 2WB9A 2M80A 1F2EA 3C1SA 1ZOFA 4ECIA 2LS5A 5A4VA 3QCPA 1GSUA 1XXUA 3LWAA 4GXZA 4ILFA 2HZEA 1OE8A 3CBUA 2LQOA 3TJJA 4ML6A 2NTOA 5G30A 3HZ8A 4MH3A 5B6MA 3IC4A 4MPFA 4PQHA 1KTEA 3P7XA 2I9HA 3RPNA 1F37A 3KZQA 3Q6OA 3S9FA 5CP1A 4EDZA 4TXVA 3ZIVA 4EIQA 1YZXA 2H1AA 1VF2A 4GSSA 2X4AA 3EVIA 1MDJA 4MF7A 2R6KA 2WULA 3FR3A 5IQYA 3PH9A 2XBQA 1YDKA 1HYUA 3CRUA 5J47A 5IIZA 3DVXA 1TRUA 3LFLA 2RLIA 4IP6A 5GZZB 3VURA 1OVNA 1K0DA 1SJIA 1GSEA 2RIIA 1H75A 3APSA 3KH7A 2H1LA 5AISA 4O7HA 4NAXA 1PA3A 3W8JA 4WXTA 2DBCA 1OC3A 1T4ZA 1TDIA 3KTBA 1ZYQB 4JBBA 1N2AA 4XIHA 4FIWA 4K7OA 1PX7A 2O8VB 4RQXA 3CTGA 1PKWA 1MD3A 4EF0A 4K1FA 2F9SA 2DJ3A 4NHZA 5ELAA 2LTKA 4O5QA 4YH2A 2GSQA 2HFDA 2IJYA 1M2AA 1SKWB 4K8MA 3HJOA 3CTFA 1XZOA 4XRAA 3IBHA 3GTUA 2R5GA 16GSA 2DKIA 4WF5A 4D73B 5ECQB 1X5CA 2H73A 1EV4A 22GSA 4POBA 3FKFA 3VWXA 1OYJA 1AW9A 2KHPA 1GTBA 3HKRA 2DJ2A 2H6ZA 3IHGA 1SJ6A 2B5EA 2RM6A 1YF1A 2H74A 2GQMA 5DJMA 3D21A 2IMEA 5G5FA 1G0TA 4TR3A 3VI7A 2WZ9A 3TOTA 1AQWA 1GTUA 2AJQB 1K0AA 2H0GA 4RQRA 2F8AA 2B3SA 5KEJA 5H5SA 1TOFA 3AY8A 2YOIA 2FY6A 2LQQA 5F07A 5A5HB 3TKPA 1UC7A 2HSNB 3DMLA 1MDKA 5D8IA 1PMTA 2EFDA 4MZWA 3FK8A 1TK0B 1TI1A 3BJ5A 4BVXB 2CA8A 1X9SB 5A34A 1RW1A 1GTAA 3SBCA 3EINA 4HI7A 3I6AA 1SVLA 4K2DA 3R3EA 3CMIA 3GRXA 3D22A 3GMFA 1LU4A 4K7IA 4X1UA 2YZUA 2H1BA 4MMMA 3C71A 2WCIA 3I43A 3HMJG 4Q5NA 2GLRA 1DSBA 3MWHA 2ES7A 4DSRA 2B1LA 4ECJA 1T1VA 3FW2A 5E4WA 2OA7A 1EEMA 4V1Ag 1EP7A 3GKXA 1TK5B 2ZCTA 6GSVA 1BEDA 1NSWA 3EU4A 2MMNA 2O5VA 2FGXA 5ID2B 3ZIJA 1M2DA 3FY7A 1MEKA 4TOPA 1A0RP 3RAZA 4ZB6A 3MDKA 4A5PA 1PD21 1YVLA 4XHMA 4L5LA 2DIZA 3KXOA 1BX9A 4F2IA 1OKTA 4ECCA 1JZDA 1VRSD 4XTSA 1GH2A 3P90A 5IPGA 2J9HA 1T4YA 1X5DA 1I9DA 3A5IA 3FZ9A 1EEJA 2RUFA 3L4NA 4AKGA 2JZSA 3SWLA 4K2XA 1O81A 1U3AA 4EL1A 2LNSA 1GLPA 1JZWA 1O73A 1S3CA 1O85A 3WT2A 3NZNA 4MCUA 1GSFA 2BJXA 3DD3A 2GZZA 1PL2A 3QDNA 1V98A 1XW9A 5CYYA 1K0NA 3TDGA 2HI7A 3M9KA 1SK1A 2DMMA 5J40A 4K7NA 1H4OA 3F8UA 3APOA 4LLRA 5AGYA 3VFIA 5DDLA 2LJAA 2F8FA 2HZFA 3C1RA 2GSSA 1ERUA 1SVMA 3O76A 2HE3A 3JCML 2KUCA 4I97A 1SYRA 4TN8A 4GLTA 4D73A 1R5PA 4K0NA 4OFNA 19GSA 2LV3A 4HZ2A 2KP1A 3Q18A 5CRDA 5IMZA 2GT5A 2BTOT 2H70A 1DUGA 1K3OA 3ZRDA 4V1Ap 5J4UA 4Q5FA 4XS4B 2A4VA 3QFAC 3HY2A 1JLWA 3QAWA 4TXOB 3QAVA 1QQ2A 4IJ3A 1M2BA 2H8LA 1Y1UA 3KEBA 3EMXA 2MBSA 1OKDA 2H30A 2XBIA 5C04A 4QL9A 3IAM2 3HD5A 3ZFBA 2IL3A 3RHCA 1A2MA 2NDOA 2HSNA 1E2YA 2K6VA 1B8XA 5A1NB 2YWOA 2H19A 1U3IA 2EFCA 4BVXA 3IXRA 3O6TA 4W66A 3PPUA 5DALB 3BCKA 4PX1A 5JCWA 3VPTA 3KH9A 2J23A 2QSIA 3BCIA 3W8SA 1SYXA 3D5JA 3EMPA 3IE3A 5CO3A 2LJRA 3H93A 4LA1A 2VUPA 4JRRA 2A2SA 3ZMLA 5J4YA 2XC2A 5IOXA 2VL3A 4HOJA 2FA8A 1CQGA 1V40A 2H1DA 2HRKA 2LKUA 4PNFA 4TW5A 2A2RA 3KMOA 5HR0A 1PSQA 4IS0A 4NV2A 1KBNA 5ECSA 4PTSA 3BD2A 2OT3A 1TW9A 3U6VA 1TI3A 1PL1A 3IC8A 3IDVA 4OD7A 1FHEA 1BG1A 1PQNA 1XW5A 3HVVA 2I81A 2P31A 2X8CA 2ALBA 5HR3A 2GQKA 2FUG2 3HCZA 5ID2A 3GL5A 4ECBA 3G9BA 2HLSA 5KN2A 1DBYA 3V1WA 4ID0A 1O6JA 4MZCA 3MIXA 2VCWA 2CT6A 6GSWA 2IIYA 2RUEA 3M3MA 1Z3EA 5LD0A 5KN3A 3ERGA 2AHEA 4TRXA 5EL8A 5HFIA 3PINA 2FNOA 2HRNA 4OO4A 4MK3A 2AV4A 5G1KA 3P2AA 2VLVA 2OE1A 4AGSA 1TXXA 1GTIA 4F0CA 3CSJA 4ZL9A 1B9XC 2PGTA 1JFUA 3WGXA 4LL1B 3TGZA 14GSA 1GUMA 3IRAA 1SKSB 1YEXA 3C7MA 3HVSA 1TU8A 5ECLB 3GFKA 4KUNA 2K9FA 1J08A 6GSUA 4G10A 4XS6A 2N5FA 3NOFA 3KIJA 3QPMA 5COHA 5FT3A 3GX0A 4LMVA 4GF0A 3D0ZA 3IAS2 3F6DA 1QUWA 3UMAA 1T7PB 1A2JA 1WP0A 4HQSA 4POLA 3BBYA 3G7YA 2EC4A 2PVOC 3U5RE 2VCXA 4XS4A 1FAAA 1F9MA 2QC7A 4EUYA 1S3DA 2VIMA 4BWQA 4ZBDA 3LJRA 4N10A 1O8XA 5AIVA 1A24A 3ZFLA 1XWKA 3E0UA 2EFEA 4TXOA 3D6IA 3RBTA 1NHYA 3KJYA 1XWGA 1BJXA 3EWLA 4HZ4A 2I1UA 2EFHA 2ON7A 3EURA 3TJBA 2R0PA 4IQ1A 5IMCA 2TRCP 1AC1A 3VPQA 3L9VA 1UA5A 3DWVA 1Z7PA 3DRNA 5A1NA 3TJKA 4MF6A 4K0GA 5DALA 1EGRA 5LNKe 3GSTA 4EKZA 1XWCA 1PN9A 2V2GA 2IPAA 1JLVA 1YJ6A 2L59A 1RQMA 3M0FA 1QMVA 3UEMA 3BOAA 1GSDA 1A2LA 2VOCA 3ZREA 3QOUA 4TR0A 1A0FA 4N0ZA 3VWVA 4ZL7A 4KH7A 1WE0A 4KSOA 5J41A 4G0LA 4IGJA 2F51A 2VM1A 3ZITA 4MA9A 1EWXA 4ZL8A 3DKSA 3GA4A 2O85A 2DJ1A 3ED3A 3ZYWA 1TXUA 1JZOA 1A8LA 1EP8A 1SVOA 2CV4A 1YQ1A 4WR4A 4OCEA 4IKHA 1OE7A 3IA1A 3IK9A 2C0FA 1TRSA 1OC9B 1GUHA 3TKRA 1M0UA 2C80A 4QQ7A 2E2GA 3GX8A 2FD3A 1FB0A 4KAEA 1T3BA 2N5AA 3CXGA 4O5UA 3GH6A 4AJ6A 4NMUA 2C3QA 1PRXA 2C1YA 5GAPD 3ISOA 3TKSA 4WF4A 2B6MA 1SL2B 4K5RA 5G31A 1W4VA 1VF3A 1FVJA 3UARA 3WGDA 1GLQA 2X49A 3LSZA 4ML1A 1DE1A 4Q5RA 1ERTA 4JR4A 1TTZA 3FYGA 4BA7A 1E6BA 4JR6A 4IVFA 2DJJA 4MJEA 2L5OA 2RM5A 1K3LA 1S3AA 4IW9A 3UL3A 1MDIA 3FZAA 2MMZA 1AIUA 2XPDA 4Z7XA 1TP9A 1IYHA 5ECKB 1NHOA 5FHIA 1G6WA 5F05A 3US3A 1HQOA 1ON4A 2HSHA 3F4TA 3ME8A 3DGQA 3UBKA 3EC3A 2GS3A 4MP4A 2YWMA 1ILOA 3IV4A 4I2UA 2BMXA 1CQHA 4I2TA 4JE1A 2MZCA 1FOVA 1HD2A 3MAKA 5ELGA 3D4TA 3L0HA 2QGVA 1X9WB 4CY6A 5EVOA 4YKGA 4AF2A 5D9TA 3DXBA 2H01A 1SD8A 4DSSB 3DEXA 2GVPA 4O92A 2LRTA 3GHAA 2A2PA 2AYTA 5D9XA 7GSSA 4GTUA 3H8QA 3FZ4A 3LXTA 1V57A 3H79A 2YJ7A 1Y25A 3WYWA 1ZYEA 1TU7A 2GSTA 4Z2UA 3ERFA 2DMLA 5J9CA 2MBTA 3H1NA 1YY7A 2LRCA 5DBQA 5BRTA 1AQVA 5JCGA 4CY8A 5CAXA 4GQCA 3DYRA 1GSYA 4K5SA 1TK8B 3GUSA 3LYKA 4KX4A 1C72A 2WDUA 2IN3A 2E0QA 4HDEA 1Q4JA 2GTUA 4IBPA 1ZGNA 1K0OA 3IHQA 1K0CA 4MPGA 1YF0A 2JSYA 2B5XA 2VAFA 4AI6A 4MLYA 1OC9A 1XWAA 4GCIA 4OWYA 1ZYPA 2CVBA 3TU3B 3LG6A 2YNXA 5DCHA 1ABAA 1B9YC 1N25A 2CX4A 2FCHA 4RI7A 1PGTA 2X99A 4GSNA 2YWIA 2YN1A 2VCZA 2VD1A 1GL8A 3LORA 3F9UA 2IWTA 10GSA 3F4RA 12GSA 4YQVA 1AXDA 3D4MA 5KOWA 3TUEA 2V41A 2CX3A 3GN3A 4BL7B 5L71A 3VWWA 2L5LA 5JWOB 3H4KA 2ZUPA 1F3AA 1F6MC 2H6XA 1GULA 1X0RA 3HYPA 3CSIA 1U6TA 5F06A 2X8GA 4GRFA 4QL7A 2DC5A 5HR2A 5D93A 1GSQA 1AUCA 2I3YA 1TKDB 2PU9C 5CRWA 3KGKA 5A5HA 5DAKB 2O89A 1XCCA 3TKQA 3GURA 3ZTLA 2JADA 4KF9A 1AQXA 3QFBC 3IK7A 4PNGA 4L5OA 1G6YA 5IPHA 1R5AA 2M46A 3GIXA 4PUFC 3GL3A 4HJMA 5DJLA 5ECRB 5IMFA 4YAVA 5C00A 1TRWA 1I5GA 2P0GA 2VLTA 3GYKA 3UJ1A 1HNAA 4DSSA 1THXA 1USBA 5CRHA 1HNBA 5A5KA 3TKSE 4X43A 2HRAA 4I5QA 3HVXA 1T00A 6GSTA 2XHFA 1XBSA 2MMAA 4CW9A 2OJLA 4K6XA 1TRVA 2VM2A 1SK2A 2OBKA 5G1LA 1K0BA 1WJKA 2IFQB 5D96A 5IMVA 5J3RA 4ZB8A 2JACA 3UVTA 8GSSA 2YANA 3GKNA 4X4JA 1U88A 3ME7A 1SL0B 4WBRD 4V2LA 4G01A 3M1GA 3HJMA 1NW2A 4KDYA 1X5EA 1EOGA 3HDCA 5B8BA 2UV8G 1QGVA 4FH8A 2JZTA 4J2FA 4HUAA 2HNLA 1XPVA 2H71A 5J4VA 5BMUB 4FYCA 3KD0A 1K3YA 2XPEA 4N0VA 4MDCA 1M9BA 4AJ7A 4ZBBA 2FWEA 1ST9A 4FYBA 3WT1A 2O87A 3LEFA 1LBKA 3LGCA 4ICYA 2VL2A 2P5RA 1BG5A 2MMOA 2OE3A 5IMAA 4NHWA 2X8HA 2Z9SA 2V32A 2HQTA 1PKZA 4GQFA 2AAWA 11GSA 3TKSC 5B7CA 4NXIA 3VLNA 5H5RA 5IO2A 5IO0A 2CAQA 3M8NA 1M7TA 4V2NA 1GP1A 1ACVA 3F4SA 3QD9A 3L9SA 4OCFA 5H5QA 4MABA 3CSHA 3GV1A 4POKA 4G9HA 2WFCA 5JWQB 1U87A 1A23A 2IMDA 3FRCA 2H66A 4PUAA 3FMWA 1VGLA 4RI6A 3E9JB 3RHBA 4KDUA 1AAZA 5HFGA 4BL7A 3ZZXA 2NVLA 1WRYA 3F3QA 1ZMAA 5JCUA 2E7PA 2HSYA 2K18A 4AKIA 2CZ3A 2LSTA 1SKRB 2R2JA 4MJAA 4ZBAA 1GSSA 2LRNA 1ERWA 3WD6A 3GNJA 1BF5A 4KDXA 2YCDA 1SJZA 2WGRA 5KOXA 4E8EA 4G0IA 5DAKA 1R26A 3KM6A 4PURA 3WGEA 5IMDA 3TOUA 4OMVA 3KMNA 3Q19A 5F0GA 5KN1A 9GSSA 4USSA 4IQAA 5HQPA 1XVWA 2EIOA 3TRPA 3L9UA 2GDRA 4CHSA 1BYEA 1XOAA 4MNNA 4RUVA 4NWYA 2KOKA 2UZ8A 4DSQA 4PXOA 3FEUA 5G5EA 4KCEA 4J56E 2HSMB 2FLSA 2M72A 2L4QA 4KW6A 2PBJA 4IP1A 2I4AA 2YP6A 2JSZA 2YPMA 2TIRA 2L6DA 3F3RA 1PN0A 4KCAA 2C0EA 2WJUA 5B6NA 3OR5A 1XVQA 3F63A 5IOWA 3R2QA 2IFQA 1SENA 4ZB7A 2V1MA 4HQZA 2VKZG 4L0UA 3QR6A 1Z7RA 4G19A 1G7OA 4GSTA 4EIPA 2FWFA 2C8UA 3GH9A 3KTLA 1KEBA 4V2MA 3UVHA 1WPIA 4NPBA 4MJBA 2GZYA 2NBSA 3C73A 2PN8A 5HFKA 4MH2A 1QK8A 4TR4A 2GQLA 5BMUA 4FO5A 4F9ZA 2VCVA 1J9BA 2R0CA 4IELA 1QFNA 3UOMA 1WIKA 3I69A 3RDWA 1VF1A 3FZ5A 2IMIA 3KP9A 4WETA 2B7JA 2D2ZA 3EE2A 4DVCA 2DJKA 4WKWA 3ZLPA 2E2MA 2VCTA 1GWCA 2OKAA 1N8JA 4AKXB 4XRDA 1WOUA 4F03A 4L0WA 5AN1A 2P5QA 3EYTA 4HU9A 2K8VA 2DJ0A 5INYA 2R37A 1B48A 3LXZA 2AB6A 3FHKA 4POMA 5IM9A 3E3EA 1ZYNA 1NM3A 2R0GA 1RK4A 4LL4B 2FWHA 2REMA 4OFTA 1V58A 4AJ8A 4PGTA 3TJGA 2V6OA 4EO3A 1EOHA 1ZCPA 4IHUA 20GSA 3HXSA 2DSAA 4L8EA 3UIWA 1SL1B 4PQIA 3MSZA 1Q98A 4X0XA 3N5OA 3J7Yk 3VK9A 2N5BA 4P3YB 4ZIJA 4ZB9A 2VLUA 3O3TA 2L6CA 4Z2TA 4NV5A 1YKCA 5ECHB 2WS2A 2TRXA 13GSA 4H86A 1G7EA 2R3XA 1XWBA 2DLXA 3HA9A 2HRKB 3A2WA 2HRFA 4FQUA 1SU9A 2ZNMA 2G0FA 3APQA 2B1KA 1XIYA 3KCMA 1B4QA 3LYPA 2AUVA 3VWUA 4ACSA 1W89A 3F6FA 5D73A 5ENUA 3ZMKA 2X64A 2L4CA 1ZZYA 4WR5A 4JZQA 2G2QA 3A2VA 5DVBA 1EV9A 4BVYB 1BQ7A 2HSMA 5A4UA 1XFLA 4HJ2A 3A3TA 4Z2RA 2QA2A 4KNDA 5DQSA 1FB6A 4IN0A 2CZ2A 2H75A 3PGTA 4I6XA 4KB3A 3DVWA 1Z9HA 4QMKA 4YQMA 1T8EB 3J7Yb 2QKEA 4ULXA 5EY6A 2DKHA 4F82A 4GWRA 1OAZA 3GSSA 4N30A 2H72A 3HJPA 1WMJA 4TR1B 3M9JA 2HYXA 4TKYA 1THOA 4EXJA 5J9BA 2GSRA 2C0DA 2LNTA 1ZL9A 1X9MB 6GSYA 4AKHA 3Q74A 2PPTA 3C8EA 2C0GA 1LJRA 5CNWA 1YEPA 3MYDA 2EIQA 2VL2C 1M99A 3LW9A 3ERWA 5EPFA 1O8WA 1GNWA 4E8HA 3A2XA 4BPYA 2IMKA 4KA0A 1ERVA 5ECIB 3W6GA 3G7IA 2MYGA 1VF4A 2YV9A 3CYNA 4N3ZA 5E59A 4EE0A 3P8WA 5D9VA 2L57A 3NIVA 3DIEA 3TRXA 5GSSA 1Z5YE 1FG4A 2OBIA 4XCSA 3CRTA 3TJFA 2H0HA 2FWGA 1F3BA 4O32A 1R4WA 2C4JA 4K9ZA 4I8BA 2ON5A 4LMWA 2HZEB 1PX6A 3GKMA 2LUSA 3I9V2 1ML6A 2LJKA 5F8BA 4KSMA 1QXHA 3L78A 6GSSA 4E68A 4KE3A 2PUKC 2NPBA 4WBJA 3HZ4A 2GT6A 5A4WA 2VCQA 4HU7A 3K8NA 4PQ1A 3CWGA 1Z6MA 1O7UA 5DCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCZ A;  1GRX A;  2OE0 A;  1JHB A;  1XW6 A;  1XOB A;  4ZIL A;  2OAC A;  2C3N A;  3MNG A;  5J5N A;  1MTC A;  5B8A A;  2CVK A;  3PR8 A;  2IMF A;  5JWR B;  3VI5 A;  4EC0 A;  4DEJ A;  2O7K A;  2VO4 A;  5GST A;  1SD9 A;  2H1G A;  1DE2 A;  4Q5Q A;  3ZL5 A;  2PWJ A;  1K0M A;  3TB2 A;  3G7J A;  4J57 E;  2YZH A;  1WWJ A;  1Z6N A;  1UVZ A;  4YAP A;  2JL4 A;  5ECM B;  2C3T A;  1EZK A;  2EIR A;  2FA4 A;  4XS1 A;  3QMX A;  4N11 A;  4EDY A;  2H6Y A;  1J0F A;  3TRQ A;  2B5Y A;  1Y6E A;  2CAI A;  4F0B A;  5FWG A;  5ECO B;  2H76 A;  4O5R A;  2OAD A;  1A8Y A;  2V6K A;  4YQU A;  4BVY A;  3UAP A;  4IJI A;  1EGO A;  5G2Z A;  3ZVJ A;  5CRG A;  6GSX A;  3QAG A;  1BAY A;  1SK0 A;  2H0I A;  4MJC A;  3A5W A;  1GUK A;  3EU3 A;  3FR9 A;  5ECN B;  3ZVJ D;  2GZP A;  3GTU B;  18GS A;  1M9A A;  2HT9 A;  2PMT A;  2GGT A;  5D9W A;  4JED A;  1URM A;  1YKA A;  1V2A A;  4EVM A;  1MD4 A;  3N9J A;  4MZB A;  4TR1 A;  1TJD A;  2CVD A;  2JZR A;  3UBL A;  4HEA 2;  3TCO A;  3IPZ A;  1R7H A;  3IR4 A;  3HHV A;  1JZR A;  1GNE A;  2B7K A;  2YJH A;  4MF5 A;  5CRE A;  1FO5 A;  2F3M A;  2PER A;  4ZXG A;  3RPP A;  2PVQ A;  2CQ9 A;  3FR6 A;  2YV7 A;  1B4P A;  1FW1 A;  1OC8 A;  3KP8 A;  4HS1 A;  5HR1 A;  1KNG A;  1HNC A;  3GKK A;  1V9W A;  4BWS A;  4TVE A;  4OFM A;  2HXK A;  2JU5 A;  4WEY A;  2KLX A;  4OO5 A;  5ECP B;  2DIY A;  1IYI A;  3F0I A;  2YWN A;  4G2E A;  2KP2 A;  2LEG A;  17GS A;  2R4V A;  1UN2 A;  5DQY A;  5KN0 A;  1FVK A;  2FHE A;  2VL9 A;  3LQ7 A;  3IOS A;  4CDO A;  4KGI A;  5GAN D;  2WRT A;  4FYU A;  2K8S A;  2VD0 A;  4ISD A;  4JU5 A;  5AIX A;  4G0K A;  5ABR A;  2WB9 A;  2M80 A;  1F2E A;  3C1S A;  1ZOF A;  4ECI A;  2LS5 A;  5A4V A;  3QCP A;  1GSU A;  1XXU A;  3LWA A;  4GXZ A;  4ILF A;  2HZE A;  1OE8 A;  3CBU A;  2LQO A;  3TJJ A;  4ML6 A;  2NTO A;  5G30 A;  3HZ8 A;  4MH3 A;  5B6M A;  3IC4 A;  4MPF A;  4PQH A;  1KTE A;  3P7X A;  2I9H A;  3RPN A;  1F37 A;  3KZQ A;  3Q6O A;  3S9F A;  5CP1 A;  4EDZ A;  4TXV A;  3ZIV A;  1YZX A;  2H1A A;  1VF2 A;  4GSS A;  3EVI A;  1MDJ A;  4MF7 A;  2R6K A;  2WUL A;  3FR3 A;  5IQY A;  3PH9 A;  2XBQ A;  1YDK A;  1HYU A;  3CRU A;  5IIZ A;  3DVX A;  1TRU A;  3LFL A;  2RLI A;  4IP6 A;  5GZZ B;  3VUR A;  1OVN A;  1K0D A;  1SJI A;  1GSE A;  2RII A;  1H75 A;  3APS A;  3KH7 A;  5AIS A;  4O7H A;  4NAX A;  1PA3 A;  3W8J A;  4WXT A;  2DBC A;  1OC3 A;  1T4Z A;  1TDI A;  3KTB A;  1ZYQ B;  4JBB A;  1N2A A;  4XIH A;  4FIW A;  4K7O A;  1PX7 A;  2O8V B;  4RQX A;  3CTG A;  1PKW A;  1MD3 A;  4EF0 A;  4K1F A;  2F9S A;  2DJ3 A;  4NHZ A;  5ELA A;  2LTK A;  4YH2 A;  2GSQ A;  2HFD A;  2IJY A;  1M2A A;  1SKW B;  4K8M A;  3HJO A;  3CTF A;  1XZO A;  4XRA A;  3IBH A;  3GTU A;  2R5G A;  16GS A;  4WF5 A;  4D73 B;  5ECQ B;  1X5C A;  2H73 A;  1EV4 A;  22GS A;  4POB A;  3FKF A;  3VWX A;  1OYJ A;  1AW9 A;  2KHP A;  1GTB A;  3HKR A;  2DJ2 A;  2H6Z A;  1SJ6 A;  2B5E A;  2RM6 A;  1YF1 A;  2H74 A;  2GQM A;  5DJM A;  3D21 A;  2IME A;  5G5F A;  1G0T A;  4TR3 A;  3VI7 A;  2WZ9 A;  3TOT A;  1AQW A;  1GTU A;  2AJQ B;  1K0A A;  2H0G A;  4RQR A;  2F8A A;  2B3S A;  5KEJ A;  5H5S A;  1TOF A;  3AY8 A;  2YOI A;  2FY6 A;  2LQQ A;  5F07 A;  3TKP A;  1UC7 A;  2HSN B;  3DML A;  1MDK A;  5D8I A;  1PMT A;  4MZW A;  3FK8 A;  1TK0 B;  1TI1 A;  3BJ5 A;  4BVX B;  2CA8 A;  1X9S B;  1RW1 A;  1GTA A;  3SBC A;  3EIN A;  4HI7 A;  3I6A A;  4K2D A;  3R3E A;  3CMI A;  3GRX A;  3D22 A;  3GMF A;  1LU4 A;  4K7I A;  4X1U A;  2YZU A;  2H1B A;  4MMM A;  3C71 A;  2WCI A;  3I43 A;  4Q5N A;  2GLR A;  1DSB A;  3MWH A;  2ES7 A;  4DSR A;  2B1L A;  4ECJ A;  1T1V A;  3FW2 A;  5E4W A;  2OA7 A;  1EEM A;  4V1A g;  1EP7 A;  3GKX A;  1TK5 B;  2ZCT A;  6GSV A;  1BED A;  1NSW A;  3EU4 A;  2MMN A;  2FGX A;  5ID2 B;  3ZIJ A;  1M2D A;  3FY7 A;  1MEK A;  4TOP A;  1A0R P;  3RAZ A;  4ZB6 A;  3MDK A;  1PD2 1;  4XHM A;  4L5L A;  2DIZ A;  3KXO A;  1BX9 A;  4F2I A;  1OKT A;  4ECC A;  1JZD A;  1VRS D;  4XTS A;  1GH2 A;  3P90 A;  5IPG A;  2J9H A;  1T4Y A;  1X5D A;  1I9D A;  3FZ9 A;  1EEJ A;  2RUF A;  3L4N A;  2JZS A;  3SWL A;  1O81 A;  1U3A A;  4EL1 A;  2LNS A;  1GLP A;  1JZW A;  1O73 A;  1S3C A;  1O85 A;  3WT2 A;  3NZN A;  4MCU A;  1GSF A;  2BJX A;  3DD3 A;  2GZZ A;  1PL2 A;  3QDN A;  1V98 A;  1XW9 A;  5CYY A;  1K0N A;  3TDG A;  2HI7 A;  3M9K A;  1SK1 A;  2DMM A;  4K7N A;  1H4O A;  3F8U A;  3APO A;  4LLR A;  5AGY A;  3VFI A;  5DDL A;  2LJA A;  2F8F A;  2HZF A;  3C1R A;  2GSS A;  1ERU A;  3O76 A;  2HE3 A;  3JCM L;  2KUC A;  4I97 A;  1SYR A;  4TN8 A;  4GLT A;  4D73 A;  1R5P A;  4K0N A;  4OFN A;  19GS A;  2LV3 A;  4HZ2 A;  2KP1 A;  3Q18 A;  5CRD A;  5IMZ A;  2GT5 A;  2BTO T;  2H70 A;  1DUG A;  1K3O A;  3ZRD A;  4V1A p;  5J4U A;  4Q5F A;  4XS4 B;  2A4V A;  3QFA C;  3HY2 A;  1JLW A;  3QAW A;  4TXO B;  3QAV A;  1QQ2 A;  4IJ3 A;  1M2B A;  2H8L A;  3KEB A;  3EMX A;  2MBS A;  1OKD A;  2H30 A;  2XBI A;  5C04 A;  4QL9 A;  3IAM 2;  3HD5 A;  3ZFB A;  2IL3 A;  3RHC A;  1A2M A;  2NDO A;  1E2Y A;  2K6V A;  1B8X A;  2YWO A;  2H19 A;  1U3I A;  4BVX A;  3IXR A;  3O6T A;  3PPU A;  5DAL B;  3BCK A;  4PX1 A;  5JCW A;  3VPT A;  3KH9 A;  2J23 A;  2QSI A;  3BCI A;  3W8S A;  1SYX A;  3D5J A;  3EMP A;  3IE3 A;  5CO3 A;  2LJR A;  3H93 A;  4LA1 A;  2VUP A;  4JRR A;  2A2S A;  3ZML A;  2XC2 A;  5IOX A;  2VL3 A;  4HOJ A;  2FA8 A;  1CQG A;  1V40 A;  2H1D A;  2HRK A;  2LKU A;  4PNF A;  4TW5 A;  2A2R A;  3KMO A;  5HR0 A;  1PSQ A;  4IS0 A;  4NV2 A;  1KBN A;  5ECS A;  4PTS A;  3BD2 A;  1TW9 A;  3U6V A;  1TI3 A;  1PL1 A;  3IC8 A;  3IDV A;  4OD7 A;  1FHE A;  1PQN A;  1XW5 A;  3HVV A;  2I81 A;  2P31 A;  2X8C A;  2ALB A;  5HR3 A;  2GQK A;  2FUG 2;  3HCZ A;  5ID2 A;  3GL5 A;  4ECB A;  3G9B A;  2HLS A;  5KN2 A;  1DBY A;  3V1W A;  4ID0 A;  1O6J A;  4MZC A;  2VCW A;  2CT6 A;  6GSW A;  2IIY A;  2RUE A;  3M3M A;  1Z3E A;  5LD0 A;  5KN3 A;  3ERG A;  2AHE A;  4TRX A;  5EL8 A;  5HFI A;  3PIN A;  2FNO A;  2HRN A;  4OO4 A;  4MK3 A;  2AV4 A;  5G1K A;  3P2A A;  2VLV A;  2OE1 A;  4AGS A;  1TXX A;  1GTI A;  4F0C A;  3CSJ A;  4ZL9 A;  1B9X C;  2PGT A;  1JFU A;  3WGX A;  4LL1 B;  3TGZ A;  14GS A;  1GUM A;  3IRA A;  1SKS B;  1YEX A;  3C7M A;  3HVS A;  1TU8 A;  5ECL B;  3GFK A;  4KUN A;  2K9F A;  1J08 A;  6GSU A;  4G10 A;  4XS6 A;  2N5F A;  3NOF A;  3KIJ A;  3QPM A;  5COH A;  5FT3 A;  3GX0 A;  4LMV A;  4GF0 A;  3D0Z A;  3IAS 2;  3F6D A;  1QUW A;  3UMA A;  1T7P B;  1A2J A;  1WP0 A;  4HQS A;  4POL A;  3BBY A;  3G7Y A;  2EC4 A;  2PVO C;  3U5R E;  2VCX A;  4XS4 A;  1FAA A;  1F9M A;  2QC7 A;  4EUY A;  1S3D A;  2VIM A;  4BWQ A;  4ZBD A;  3LJR A;  4N10 A;  1O8X A;  5AIV A;  1A24 A;  3ZFL A;  1XWK A;  3E0U A;  4TXO A;  3D6I A;  3RBT A;  1NHY A;  3KJY A;  1XWG A;  1BJX A;  3EWL A;  4HZ4 A;  2I1U A;  2ON7 A;  3EUR A;  3TJB A;  4IQ1 A;  5IMC A;  2TRC P;  1AC1 A;  3VPQ A;  1UA5 A;  3DWV A;  3L9V A;  1Z7P A;  3DRN A;  3TJK A;  4MF6 A;  4K0G A;  5DAL A;  1EGR A;  5LNK e;  3GST A;  4EKZ A;  1XWC A;  1PN9 A;  2V2G A;  2IPA A;  1JLV A;  1YJ6 A;  2L59 A;  1RQM A;  3M0F A;  1QMV A;  3UEM A;  3BOA A;  1GSD A;  1A2L A;  2VOC A;  3ZRE A;  3QOU A;  4TR0 A;  1A0F A;  4N0Z A;  3VWV A;  4ZL7 A;  4KH7 A;  1WE0 A;  4KSO A;  5J41 A;  4G0L A;  4IGJ A;  2F51 A;  2VM1 A;  3ZIT A;  4MA9 A;  1EWX A;  4ZL8 A;  3DKS A;  3GA4 A;  2O85 A;  2DJ1 A;  3ED3 A;  3ZYW A;  1JZO A;  1A8L A;  1EP8 A;  2CV4 A;  1YQ1 A;  4WR4 A;  4OCE A;  4IKH A;  1OE7 A;  3IA1 A;  3IK9 A;  2C0F A;  1TRS A;  1OC9 B;  1GUH A;  3TKR A;  1M0U A;  2C80 A;  4QQ7 A;  2E2G A;  3GX8 A;  2FD3 A;  1FB0 A;  4KAE A;  1T3B A;  2N5A A;  3CXG A;  3GH6 A;  4AJ6 A;  4NMU A;  2C3Q A;  1PRX A;  2C1Y A;  5GAP D;  3ISO A;  3TKS A;  4WF4 A;  2B6M A;  1SL2 B;  5G31 A;  1W4V A;  1VF3 A;  1FVJ A;  3UAR A;  3WGD A;  1GLQ A;  3LSZ A;  4ML1 A;  1DE1 A;  4Q5R A;  1ERT A;  4JR4 A;  1TTZ A;  3FYG A;  4BA7 A;  1E6B A;  4JR6 A;  4IVF A;  2DJJ A;  4MJE A;  2L5O A;  2RM5 A;  1K3L A;  1S3A A;  4IW9 A;  3UL3 A;  1MDI A;  3FZA A;  2MMZ A;  1AIU A;  2XPD A;  4Z7X A;  1TP9 A;  1IYH A;  5ECK B;  1NHO A;  5FHI A;  1G6W A;  5F05 A;  3US3 A;  1HQO A;  1ON4 A;  2HSH A;  3F4T A;  3ME8 A;  3DGQ A;  3UBK A;  3EC3 A;  2GS3 A;  4MP4 A;  2YWM A;  1ILO A;  3IV4 A;  4I2U A;  2BMX A;  1CQH A;  4I2T A;  4JE1 A;  2MZC A;  1FOV A;  1HD2 A;  3MAK A;  5ELG A;  3D4T A;  3L0H A;  2QGV A;  1X9W B;  5EVO A;  4AF2 A;  5D9T A;  3DXB A;  2H01 A;  1SD8 A;  4DSS B;  3DEX A;  2GVP A;  4O92 A;  2LRT A;  3GHA A;  2AYT A;  5D9X A;  7GSS A;  4GTU A;  3H8Q A;  3FZ4 A;  3LXT A;  1V57 A;  3H79 A;  2YJ7 A;  1Y25 A;  3WYW A;  1ZYE A;  1TU7 A;  2GST A;  3ERF A;  2DML A;  5J9C A;  2MBT A;  3H1N A;  1YY7 A;  2LRC A;  5DBQ A;  1AQV A;  5JCG A;  5CAX A;  4GQC A;  3DYR A;  1GSY A;  1TK8 B;  3GUS A;  3LYK A;  4KX4 A;  1C72 A;  2WDU A;  2IN3 A;  2E0Q A;  4HDE A;  1Q4J A;  2GTU A;  4IBP A;  1ZGN A;  1K0O A;  3IHQ A;  1K0C A;  4MPG A;  1YF0 A;  2JSY A;  2B5X A;  2VAF A;  4MLY A;  1OC9 A;  1XWA A;  4GCI A;  4OWY A;  2CVB A;  3LG6 A;  2YNX A;  5DCH A;  1ABA A;  1B9Y C;  2CX4 A;  2FCH A;  4RI7 A;  1PGT A;  2X99 A;  4GSN A;  2YWI A;  2YN1 A;  2VCZ A;  2VD1 A;  1GL8 A;  3LOR A;  3F9U A;  2IWT A;  10GS A;  3F4R A;  12GS A;  4YQV A;  1AXD A;  3D4M A;  3TUE A;  2V41 A;  2CX3 A;  3GN3 A;  4BL7 B;  5L71 A;  3VWW A;  2L5L A;  5JWO B;  3H4K A;  2ZUP A;  1F3A A;  1F6M C;  2H6X A;  1GUL A;  1X0R A;  3HYP A;  3CSI A;  1U6T A;  5F06 A;  2X8G A;  4GRF A;  4QL7 A;  2DC5 A;  5HR2 A;  5D93 A;  1GSQ A;  1AUC A;  2I3Y A;  1TKD B;  2PU9 C;  5CRW A;  3KGK A;  2O89 A;  5DAK B;  1XCC A;  3TKQ A;  3GUR A;  3ZTL A;  2JAD A;  4KF9 A;  1AQX A;  3QFB C;  3IK7 A;  4PNG A;  4L5O A;  1G6Y A;  5IPH A;  1R5A A;  2M46 A;  3GIX A;  4PUF C;  3GL3 A;  4HJM A;  5DJL A;  5ECR B;  5IMF A;  4YAV A;  5C00 A;  1TRW A;  1I5G A;  2P0G A;  2VLT A;  3GYK A;  3UJ1 A;  1HNA A;  4DSS A;  1THX A;  1USB A;  5CRH A;  1HNB A;  5A5K A;  3TKS E;  4X43 A;  2HRA A;  4I5Q A;  3HVX A;  1T00 A;  6GST A;  2XHF A;  1XBS A;  2MMA A;  4CW9 A;  2OJL A;  4K6X A;  1TRV A;  2VM2 A;  1SK2 A;  2OBK A;  5G1L A;  1K0B A;  1WJK A;  2IFQ B;  5D96 A;  5IMV A;  5J3R A;  4ZB8 A;  2JAC A;  3UVT A;  8GSS A;  2YAN A;  3GKN A;  1U88 A;  3ME7 A;  1SL0 B;  4WBR D;  4V2L A;  3M1G A;  3HJM A;  1NW2 A;  4KDY A;  1X5E A;  1EOG A;  3HDC A;  5B8B A;  1QGV A;  4FH8 A;  2JZT A;  4J2F A;  4HUA A;  2HNL A;  1XPV A;  2H71 A;  4FYC A;  3KD0 A;  1K3Y A;  2XPE A;  4N0V A;  4MDC A;  1M9B A;  4AJ7 A;  4ZBB A;  2FWE A;  1ST9 A;  4FYB A;  3WT1 A;  2O87 A;  3LEF A;  1LBK A;  3LGC A;  2VL2 A;  2P5R A;  1BG5 A;  2MMO A;  2OE3 A;  5IMA A;  4NHW A;  2X8H A;  2Z9S A;  2V32 A;  2HQT A;  1PKZ A;  4GQF A;  2AAW A;  11GS A;  3TKS C;  5B7C A;  4NXI A;  3VLN A;  5H5R A;  5IO2 A;  5IO0 A;  2CAQ A;  3M8N A;  1M7T A;  4V2N A;  1GP1 A;  1ACV A;  3F4S A;  3QD9 A;  3L9S A;  4OCF A;  5H5Q A;  4MAB A;  3CSH A;  3GV1 A;  4POK A;  4G9H A;  2WFC A;  5JWQ B;  1U87 A;  1A23 A;  2IMD A;  3FRC A;  2H66 A;  4PUA A;  1VGL A;  4RI6 A;  3E9J B;  3RHB A;  4KDU A;  1AAZ A;  5HFG A;  4BL7 A;  3ZZX A;  2NVL A;  1WRY A;  3F3Q A;  1ZMA A;  5JCU A;  2E7P A;  2HSY A;  2K18 A;  2CZ3 A;  2LST A;  1SKR B;  2R2J A;  4MJA A;  4ZBA A;  1GSS A;  2LRN A;  1ERW A;  3WD6 A;  3GNJ A;  4KDX A;  2YCD A;  1SJZ A;  2WGR A;  4E8E A;  4G0I A;  5DAK A;  1R26 A;  3KM6 A;  4PUR A;  3WGE A;  5IMD A;  3TOU A;  4OMV A;  3KMN A;  3Q19 A;  5F0G A;  5KN1 A;  9GSS A;  4USS A;  4IQA A;  5HQP A;  1XVW A;  2EIO A;  3TRP A;  3L9U A;  2GDR A;  4CHS A;  1BYE A;  1XOA A;  4RUV A;  4NWY A;  2KOK A;  2UZ8 A;  4DSQ A;  4PXO A;  3FEU A;  5G5E A;  4KCE A;  4J56 E;  2HSM B;  2FLS A;  2M72 A;  2L4Q A;  4KW6 A;  2PBJ A;  4IP1 A;  2I4A A;  2YP6 A;  2JSZ A;  2YPM A;  2TIR A;  2L6D A;  3F3R A;  4KCA A;  2C0E A;  2WJU A;  5B6N A;  3OR5 A;  1XVQ A;  3F63 A;  5IOW A;  3R2Q A;  2IFQ A;  1SEN A;  2V1M A;  4HQZ A;  4L0U A;  3QR6 A;  1Z7R A;  4G19 A;  1G7O A;  4GST A;  2FWF A;  2C8U A;  3GH9 A;  3KTL A;  1KEB A;  4V2M A;  3UVH A;  1WPI A;  4NPB A;  4MJB A;  2GZY A;  2NBS A;  3C73 A;  2PN8 A;  5HFK A;  4MH2 A;  1QK8 A;  4TR4 A;  2GQL A;  5BMU A;  4FO5 A;  4F9Z A;  2VCV A;  1J9B A;  4IEL A;  1QFN A;  3UOM A;  1WIK A;  3I69 A;  3RDW A;  1VF1 A;  3FZ5 A;  2IMI A;  3KP9 A;  4WET A;  2B7J A;  2D2Z A;  3EE2 A;  4DVC A;  2DJK A;  4WKW A;  3ZLP A;  2E2M A;  2VCT A;  1GWC A;  2OKA A;  1N8J A;  4XRD A;  1WOU A;  4F03 A;  4L0W A;  5AN1 A;  2P5Q A;  3EYT A;  4HU9 A;  2K8V A;  2DJ0 A;  5INY A;  2R37 A;  1B48 A;  3LXZ A;  2AB6 A;  3FHK A;  4POM A;  5IM9 A;  3E3E A;  1NM3 A;  1RK4 A;  4LL4 B;  2FWH A;  2REM A;  4OFT A;  1V58 A;  4AJ8 A;  4PGT A;  3TJG A;  2V6O A;  4EO3 A;  1EOH A;  1ZCP A;  4IHU A;  20GS A;  3HXS A;  2DSA A;  4L8E A;  3UIW A;  1SL1 B;  4PQI A;  3MSZ A;  1Q98 A;  4X0X A;  3N5O A;  3J7Y k;  3VK9 A;  2N5B A;  4P3Y B;  4ZIJ A;  4ZB9 A;  2VLU A;  3O3T A;  2L6C A;  4NV5 A;  1YKC A;  5ECH B;  2WS2 A;  2TRX A;  13GS A;  4H86 A;  1G7E A;  2R3X A;  1XWB A;  2DLX A;  3HA9 A;  2HRK B;  3A2W A;  2HRF A;  4FQU A;  1SU9 A;  2ZNM A;  2G0F A;  3APQ A;  2B1K A;  1XIY A;  3KCM A;  1B4Q A;  3LYP A;  2AUV A;  3VWU A;  4ACS A;  1W89 A;  3F6F A;  5D73 A;  5ENU A;  3ZMK A;  2X64 A;  2L4C A;  1ZZY A;  4WR5 A;  4JZQ A;  2G2Q A;  3A2V A;  5DVB A;  1EV9 A;  4BVY B;  1BQ7 A;  2HSM A;  5A4U A;  1XFL A;  4HJ2 A;  3A3T A;  4KND A;  5DQS A;  1FB6 A;  4IN0 A;  2CZ2 A;  2H75 A;  3PGT A;  4I6X A;  4KB3 A;  3DVW A;  1Z9H A;  4YQM A;  1T8E B;  3J7Y b;  2QKE A;  4ULX A;  5EY6 A;  4F82 A;  4GWR A;  1OAZ A;  3GSS A;  4N30 A;  2H72 A;  3HJP A;  1WMJ A;  4TR1 B;  2HYX A;  3M9J A;  4TKY A;  1THO A;  4EXJ A;  5J9B A;  2GSR A;  2C0D A;  2LNT A;  1ZL9 A;  1X9M B;  6GSY A;  3Q74 A;  2PPT A;  3C8E A;  2C0G A;  1LJR A;  5CNW A;  1YEP A;  2EIQ A;  2VL2 C;  1M99 A;  3ERW A;  5EPF A;  1O8W A;  1GNW A;  4E8H A;  3A2X A;  4BPY A;  2IMK A;  4KA0 A;  1ERV A;  5ECI B;  3W6G A;  3G7I A;  2MYG A;  1VF4 A;  2YV9 A;  3CYN A;  5E59 A;  4EE0 A;  3P8W A;  5D9V A;  2L57 A;  3NIV A;  3DIE A;  3TRX A;  5GSS A;  1Z5Y E;  1FG4 A;  2OBI A;  4XCS A;  3CRT A;  3TJF A;  2H0H A;  2FWG A;  1F3B A;  4O32 A;  1R4W A;  2C4J A;  4K9Z A;  4I8B A;  2ON5 A;  4LMW A;  2HZE B;  1PX6 A;  3GKM A;  2LUS A;  3I9V 2;  1ML6 A;  2LJK A;  5F8B A;  4KSM A;  1QXH A;  3L78 A;  6GSS A;  4KE3 A;  2PUK C;  2NPB A;  4WBJ A;  3HZ4 A;  2GT6 A;  5A4W A;  2VCQ A;  4HU7 A;  3K8N A;  4PQ1 A;  1Z6M A;  1O7U A;  5DCG A; 
#chains in the Genus database with same CATH topology
 5LCZ A;  1GRX A;  2OE0 A;  1JHB A;  1XW6 A;  1XOB A;  4ZIL A;  2OAC A;  2C3N A;  3MNG A;  5J5N A;  1MTC A;  5B8A A;  2CVK A;  3PR8 A;  2IMF A;  5JWR B;  3VI5 A;  4EC0 A;  4DEJ A;  2O7K A;  2VO4 A;  5GST A;  1SD9 A;  2H1G A;  1DE2 A;  4Q5Q A;  3ZL5 A;  2PWJ A;  1K0M A;  3TB2 A;  3G7J A;  4J57 E;  2YZH A;  1WWJ A;  1Z6N A;  4PI2 C;  1UVZ A;  3HVN A;  4YAP A;  2JL4 A;  5ECM B;  2C3T A;  1EZK A;  2EIR A;  2FA4 A;  4XS1 A;  3QMX A;  4N11 A;  4EDY A;  2H6Y A;  1J0F A;  3TRQ A;  2B5Y A;  1Y6E A;  2CAI A;  4F0B A;  5FWG A;  5ECO B;  2H76 A;  4O5R A;  2OAD A;  1A8Y A;  2O3E A;  2V6K A;  4YQU A;  4BVY A;  3UAP A;  4IJI A;  1EGO A;  1FOH A;  5G2Z A;  3ZVJ A;  3EPT A;  5CRG A;  6GSX A;  3QAG A;  1BAY A;  1SK0 A;  2H0I A;  4MJC A;  3A5W A;  1GUK A;  3EU3 A;  3FR9 A;  5ECN B;  3ZVJ D;  2GZP A;  2A4H A;  3GTU B;  2QA1 A;  18GS A;  4GDF A;  1M9A A;  2HT9 A;  2PMT A;  2GGT A;  5D9W A;  4JED A;  1URM A;  1YKA A;  1V2A A;  4EVM A;  1MD4 A;  3N9J A;  4MZB A;  4TR1 A;  1TJD A;  2CVD A;  2JZR A;  3UBL A;  4HEA 2;  3TCO A;  3IPZ A;  1R7H A;  3IR4 A;  3HHV A;  1JZR A;  1GNE A;  2B7K A;  2YJH A;  4MF5 A;  5CRE A;  1FO5 A;  2F3M A;  2PER A;  4ZXG A;  3RPP A;  2PVQ A;  4YKF A;  2CQ9 A;  3FR6 A;  2YV7 A;  1B4P A;  1FW1 A;  1OC8 A;  3KP8 A;  4HS1 A;  5HR1 A;  1KNG A;  1HNC A;  3GKK A;  1V9W A;  4BWS A;  4TVE A;  4OFM A;  2HXK A;  2JU5 A;  4WEY A;  2KLX A;  4OO5 A;  5ECP B;  2DIY A;  1IYI A;  3F0I A;  2YWN A;  4G2E A;  2KP2 A;  2LEG A;  17GS A;  2R4V A;  1UN2 A;  5DQY A;  5KN0 A;  1FVK A;  2FHE A;  2VL9 A;  3LQ7 A;  3IOS A;  4CDO A;  4KGI A;  5GAN D;  2WRT A;  4FYU A;  2K8S A;  2VD0 A;  4ISD A;  5A34 B;  4JU5 A;  5AIX A;  4G0K A;  5ABR A;  2WB9 A;  2M80 A;  1F2E A;  3C1S A;  1ZOF A;  4ECI A;  2LS5 A;  5A4V A;  3QCP A;  1GSU A;  1XXU A;  3LWA A;  4GXZ A;  4ILF A;  2HZE A;  1OE8 A;  3CBU A;  2LQO A;  3TJJ A;  4ML6 A;  2NTO A;  5G30 A;  3HZ8 A;  4MH3 A;  5B6M A;  3IC4 A;  4MPF A;  4PQH A;  1KTE A;  3P7X A;  2I9H A;  3RPN A;  1F37 A;  3KZQ A;  3Q6O A;  3S9F A;  5CP1 A;  4EDZ A;  4TXV A;  3ZIV A;  4EIQ A;  1YZX A;  2H1A A;  1VF2 A;  4GSS A;  2X4A A;  3EVI A;  1MDJ A;  4MF7 A;  2R6K A;  2WUL A;  3FR3 A;  5IQY A;  3PH9 A;  2XBQ A;  1YDK A;  1HYU A;  3CRU A;  5J47 A;  5IIZ A;  3DVX A;  1TRU A;  3LFL A;  2RLI A;  4IP6 A;  5GZZ B;  3VUR A;  1OVN A;  1K0D A;  1SJI A;  1GSE A;  2RII A;  1H75 A;  3APS A;  3KH7 A;  2H1L A;  5AIS A;  4O7H A;  4NAX A;  1PA3 A;  3W8J A;  4WXT A;  2DBC A;  1OC3 A;  1T4Z A;  1TDI A;  3KTB A;  4FXY P;  1ZYQ B;  4JBB A;  1N2A A;  4XIH A;  4FIW A;  4K7O A;  1PX7 A;  2O8V B;  4RQX A;  3CTG A;  1PKW A;  1MD3 A;  4EF0 A;  4K1F A;  2F9S A;  2DJ3 A;  4NHZ A;  5ELA A;  2LTK A;  4O5Q A;  4YH2 A;  2GSQ A;  2HFD A;  2IJY A;  1M2A A;  1SKW B;  4K8M A;  3HJO A;  3CTF A;  1XZO A;  4XRA A;  3IBH A;  3GTU A;  2R5G A;  16GS A;  2DKI A;  2WVX B;  4WF5 A;  4D73 B;  5ECQ B;  1X5C A;  2H73 A;  1EV4 A;  22GS A;  4POB A;  3FKF A;  3VWX A;  1OYJ A;  1AW9 A;  2KHP A;  1GTB A;  3HKR A;  2DJ2 A;  2H6Z A;  3IHG A;  1SJ6 A;  2B5E A;  2RM6 A;  1YF1 A;  2H74 A;  2GQM A;  5DJM A;  3D21 A;  2IME A;  5G5F A;  1G0T A;  4TR3 A;  3VI7 A;  2WZ9 A;  3TOT A;  1AQW A;  1GTU A;  2AJQ B;  1K0A A;  2H0G A;  4RQR A;  2F8A A;  2B3S A;  5KEJ A;  5H5S A;  1TOF A;  3AY8 A;  2YOI A;  2FY6 A;  2LQQ A;  5F07 A;  5A5H B;  3TKP A;  1UC7 A;  2HSN B;  3DML A;  4BIK A;  1MDK A;  5D8I A;  1PMT A;  2EFD A;  4MZW A;  3FK8 A;  1TK0 B;  1TI1 A;  3BJ5 A;  4BVX B;  2CA8 A;  1X9S B;  5A34 A;  1RW1 A;  1GTA A;  3SBC A;  3EIN A;  4HI7 A;  3I6A A;  2WW2 A;  1SVL A;  4K2D A;  3R3E A;  3CMI A;  3GRX A;  3D22 A;  3GMF A;  1LU4 A;  4K7I A;  4X1U A;  2YZU A;  2H1B A;  4MMM A;  3C71 A;  2WCI A;  3I43 A;  3HMJ G;  4Q5N A;  2GLR A;  1DSB A;  3MWH A;  2ES7 A;  4DSR A;  2B1L A;  4ECJ A;  1T1V A;  3FW2 A;  5E4W A;  2OA7 A;  1EEM A;  4V1A g;  1EP7 A;  3GKX A;  1TK5 B;  2ZCT A;  6GSV A;  1BED A;  1NSW A;  3EU4 A;  2MMN A;  2O5V A;  2FGX A;  5ID2 B;  3ZIJ A;  1M2D A;  3FY7 A;  1MEK A;  4TOP A;  1A0R P;  3RAZ A;  4ZB6 A;  3MDK A;  4A5P A;  1PD2 1;  1YVL A;  4XHM A;  4PHZ C;  4L5L A;  2DIZ A;  3KXO A;  1BX9 A;  4F2I A;  1OKT A;  4ECC A;  1JZD A;  1VRS D;  4XTS A;  1GH2 A;  3P90 A;  5IPG A;  2J9H A;  1T4Y A;  1X5D A;  1I9D A;  3A5I A;  3FZ9 A;  1EEJ A;  2RUF A;  3L4N A;  4AKG A;  2JZS A;  3SWL A;  4K2X A;  1O81 A;  1U3A A;  4EL1 A;  2LNS A;  1GLP A;  1JZW A;  1O73 A;  1S3C A;  1O85 A;  3WT2 A;  3NZN A;  4MCU A;  1I1I P;  1GSF A;  2BJX A;  3DD3 A;  2GZZ A;  1PL2 A;  3QDN A;  1V98 A;  1XW9 A;  5CYY A;  1K0N A;  3TDG A;  2HI7 A;  3M9K A;  1SK1 A;  2DMM A;  5J40 A;  4K7N A;  1H4O A;  3F8U A;  3APO A;  4LLR A;  5AGY A;  3VFI A;  5DDL A;  2LJA A;  2F8F A;  2HZF A;  3C1R A;  2GSS A;  1ERU A;  1SVM A;  3O76 A;  2HE3 A;  3JCM L;  2KUC A;  4I97 A;  1SYR A;  4TN8 A;  4GLT A;  4D73 A;  1R5P A;  4K0N A;  4OFN A;  19GS A;  2LV3 A;  4HZ2 A;  2KP1 A;  3Q18 A;  5CRD A;  5IMZ A;  2GT5 A;  2BTO T;  2H70 A;  1DUG A;  1K3O A;  3ZRD A;  4V1A p;  5J4U A;  4Q5F A;  4XS4 B;  2A4V A;  3QFA C;  3HY2 A;  1JLW A;  3QAW A;  4TXO B;  3QAV A;  1QQ2 A;  4IJ3 A;  1M2B A;  2H8L A;  1Y1U A;  3KEB A;  1S4B P;  3EMX A;  2MBS A;  1OKD A;  2H30 A;  2XBI A;  5C04 A;  4QL9 A;  3IAM 2;  3HD5 A;  3ZFB A;  2IL3 A;  3RHC A;  1A2M A;  2NDO A;  2HSN A;  1E2Y A;  2K6V A;  1B8X A;  5A1N B;  2YWO A;  2H19 A;  1U3I A;  2EFC A;  4BVX A;  3IXR A;  3O6T A;  4W66 A;  3PPU A;  5DAL B;  3BCK A;  4PX1 A;  5JCW A;  3VPT A;  3KH9 A;  2J23 A;  2QSI A;  3BCI A;  3W8S A;  1SYX A;  3D5J A;  3EMP A;  3IE3 A;  5CO3 A;  2LJR A;  3H93 A;  4LA1 A;  2VUP A;  4JRR A;  2A2S A;  3ZML A;  5J4Y A;  2XC2 A;  5IOX A;  2VL3 A;  4HOJ A;  2FA8 A;  1CQG A;  1V40 A;  2H1D A;  2HRK A;  2LKU A;  4PNF A;  4TW5 A;  2A2R A;  3KMO A;  5HR0 A;  1PSQ A;  4IS0 A;  4NV2 A;  1KBN A;  5ECS A;  4PTS A;  3BD2 A;  2OT3 A;  1TW9 A;  3U6V A;  1TI3 A;  1PL1 A;  3IC8 A;  3IDV A;  4OD7 A;  1FHE A;  1BG1 A;  1PQN A;  1XW5 A;  3HVV A;  2I81 A;  2P31 A;  2X8C A;  2ALB A;  5HR3 A;  2GQK A;  2FUG 2;  3HCZ A;  5ID2 A;  3GL5 A;  4ECB A;  3G9B A;  2HLS A;  5KN2 A;  1DBY A;  3V1W A;  4ID0 A;  1O6J A;  4MZC A;  3MIX A;  2VCW A;  2CT6 A;  6GSW A;  2IIY A;  2RUE A;  3M3M A;  1Z3E A;  5LD0 A;  5KN3 A;  3ERG A;  2AHE A;  4TRX A;  5EL8 A;  5HFI A;  3PIN A;  2FNO A;  2HRN A;  4OO4 A;  4MK3 A;  2AV4 A;  5G1K A;  3P2A A;  2VLV A;  2OE1 A;  4AGS A;  1TXX A;  1GTI A;  4F0C A;  3CSJ A;  4ZL9 A;  1B9X C;  2PGT A;  1JFU A;  3WGX A;  4LL1 B;  3TGZ A;  14GS A;  1GUM A;  3IRA A;  1SKS B;  1YEX A;  3C7M A;  3HVS A;  1TU8 A;  5ECL B;  3GFK A;  4KUN A;  2K9F A;  1J08 A;  6GSU A;  4G10 A;  4XS6 A;  2N5F A;  3NOF A;  3KIJ A;  3QPM A;  5COH A;  5FT3 A;  3GX0 A;  4LMV A;  4GF0 A;  3D0Z A;  3IAS 2;  3F6D A;  1QUW A;  3UMA A;  1T7P B;  1A2J A;  1WP0 A;  4HQS A;  4POL A;  3BBY A;  3G7Y A;  2EC4 A;  2PVO C;  3U5R E;  2VCX A;  4XS4 A;  1FAA A;  1F9M A;  2QC7 A;  4EUY A;  1S3D A;  2VIM A;  4BWQ A;  4ZBD A;  3LJR A;  4N10 A;  1O8X A;  5AIV A;  1A24 A;  3ZFL A;  1XWK A;  3E0U A;  2EFE A;  4TXO A;  3D6I A;  3RBT A;  1NHY A;  3KJY A;  1XWG A;  1BJX A;  3EWL A;  4HZ4 A;  2I1U A;  2EFH A;  2ON7 A;  3EUR A;  3TJB A;  2R0P A;  4IQ1 A;  5IMC A;  2TRC P;  1AC1 A;  3VPQ A;  1UA5 A;  3DWV A;  3L9V A;  1Z7P A;  3DRN A;  5A1N A;  3TJK A;  4MF6 A;  4K0G A;  5DAL A;  1EGR A;  5LNK e;  3GST A;  4EKZ A;  1XWC A;  1PN9 A;  2V2G A;  2IPA A;  1JLV A;  1YJ6 A;  2L59 A;  1RQM A;  3M0F A;  1XG8 A;  1QMV A;  3UEM A;  3BOA A;  1GSD A;  1A2L A;  2VOC A;  3ZRE A;  3QOU A;  4TR0 A;  1A0F A;  4N0Z A;  3VWV A;  4ZL7 A;  4KH7 A;  1WE0 A;  4KSO A;  5J41 A;  4G0L A;  4IGJ A;  2F51 A;  2VM1 A;  3ZIT A;  4MA9 A;  1EWX A;  4ZL8 A;  3DKS A;  3GA4 A;  2O85 A;  2DJ1 A;  3ED3 A;  3ZYW A;  1TXU A;  1JZO A;  1A8L A;  1EP8 A;  1SVO A;  2CV4 A;  1YQ1 A;  4WR4 A;  4OCE A;  4IKH A;  1OE7 A;  3IA1 A;  3IK9 A;  2C0F A;  1TRS A;  1OC9 B;  1GUH A;  3TKR A;  1M0U A;  2C80 A;  4QQ7 A;  2E2G A;  3GX8 A;  2FD3 A;  1FB0 A;  4KAE A;  1T3B A;  2N5A A;  3CXG A;  4O5U A;  3GH6 A;  4AJ6 A;  4NMU A;  2C3Q A;  1PRX A;  2C1Y A;  5GAP D;  3ISO A;  3TKS A;  4WF4 A;  2B6M A;  1SL2 B;  4K5R A;  5G31 A;  1W4V A;  1VF3 A;  1FVJ A;  3UAR A;  3WGD A;  1GLQ A;  2X49 A;  3LSZ A;  4ML1 A;  1DE1 A;  4Q5R A;  1ERT A;  4JR4 A;  1TTZ A;  3FYG A;  4BA7 A;  1E6B A;  4JR6 A;  4IVF A;  2DJJ A;  4MJE A;  2L5O A;  2RM5 A;  1K3L A;  1S3A A;  4IW9 A;  3UL3 A;  1MDI A;  3FZA A;  2MMZ A;  1AIU A;  2XPD A;  4Z7X A;  1TP9 A;  1IYH A;  5ECK B;  1NHO A;  5FHI A;  1G6W A;  5F05 A;  3US3 A;  1HQO A;  1ON4 A;  2HSH A;  3F4T A;  3ME8 A;  3DGQ A;  3UBK A;  3EC3 A;  2GS3 A;  4MP4 A;  2YWM A;  1ILO A;  3IV4 A;  4I2U A;  2BMX A;  1CQH A;  4I2T A;  4JE1 A;  2MZC A;  1FOV A;  1HD2 A;  3MAK A;  5ELG A;  3D4T A;  3L0H A;  2QGV A;  1X9W B;  4CY6 A;  5EVO A;  4YKG A;  4AF2 A;  5D9T A;  3DXB A;  2H01 A;  1SD8 A;  4DSS B;  3DEX A;  2GVP A;  4O92 A;  2LRT A;  3GHA A;  2A2P A;  2AYT A;  5D9X A;  7GSS A;  4GTU A;  3H8Q A;  3FZ4 A;  3LXT A;  1V57 A;  3H79 A;  2YJ7 A;  1Y25 A;  3WYW A;  1ZYE A;  1TU7 A;  2GST A;  4Z2U A;  3ERF A;  2DML A;  5J9C A;  2MBT A;  3H1N A;  1YY7 A;  2LRC A;  5DBQ A;  5BRT A;  1AQV A;  5JCG A;  4CY8 A;  5CAX A;  4GQC A;  3DYR A;  1GSY A;  4K5S A;  1TK8 B;  3GUS A;  3LYK A;  4KX4 A;  1C72 A;  2WDU A;  3RFR C;  2IN3 A;  2E0Q A;  4HDE A;  1Q4J A;  2GTU A;  4IBP A;  1ZGN A;  1K0O A;  3IHQ A;  1S3R A;  1K0C A;  4MPG A;  1YF0 A;  2JSY A;  2B5X A;  2VAF A;  4AI6 A;  4MLY A;  1OC9 A;  2O36 A;  1XWA A;  4GCI A;  1M3I A;  4OWY A;  1ZYP A;  2CVB A;  3TU3 B;  3LG6 A;  2YNX A;  5DCH A;  1ABA A;  1B9Y C;  1N25 A;  2CX4 A;  2FCH A;  4RI7 A;  1PGT A;  2X99 A;  4GSN A;  2YWI A;  2WVX A;  2YN1 A;  2VCZ A;  2VD1 A;  1GL8 A;  3LOR A;  3F9U A;  2IWT A;  10GS A;  3F4R A;  12GS A;  4YQV A;  1AXD A;  3D4M A;  5KOW A;  3TUE A;  2V41 A;  4PI0 C;  2CX3 A;  3GN3 A;  4BL7 B;  5L71 A;  3VWW A;  2L5L A;  5JWO B;  3H4K A;  2ZUP A;  1F3A A;  1F6M C;  2H6X A;  1GUL A;  1X0R A;  3HYP A;  3CSI A;  1U6T A;  5F06 A;  2X8G A;  4GRF A;  4QL7 A;  2DC5 A;  5HR2 A;  5D93 A;  1GSQ A;  1AUC A;  2I3Y A;  1TKD B;  2PU9 C;  5CRW A;  3KGK A;  5A5H A;  5DAK B;  2O89 A;  1XCC A;  3TKQ A;  3GUR A;  3ZTL A;  2JAD A;  4KF9 A;  1AQX A;  3QFB C;  3IK7 A;  4PNG A;  4L5O A;  1G6Y A;  5IPH A;  1R5A A;  2M46 A;  3GIX A;  4PUF C;  3GL3 A;  4HJM A;  5DJL A;  1YEW C;  5ECR B;  5IMF A;  4YAV A;  5C00 A;  1TRW A;  1I5G A;  2P0G A;  2VLT A;  3GYK A;  3UJ1 A;  1HNA A;  4DSS A;  1THX A;  1USB A;  5CRH A;  1HNB A;  5A5K A;  3TKS E;  4X43 A;  2HRA A;  4I5Q A;  3HVX A;  1T00 A;  6GST A;  4HSC X;  2XHF A;  1XBS A;  2MMA A;  4CW9 A;  2OJL A;  2WW3 A;  4K6X A;  1TRV A;  2VM2 A;  1SK2 A;  2OBK A;  5G1L A;  1K0B A;  1WJK A;  2IFQ B;  5D96 A;  5IMV A;  5J3R A;  4ZB8 A;  2JAC A;  3UVT A;  8GSS A;  2YAN A;  3GKN A;  4X4J A;  1U88 A;  3ME7 A;  1SL0 B;  4WBR D;  4V2L A;  4G01 A;  3M1G A;  3HJM A;  1NW2 A;  4KDY A;  1X5E A;  1EOG A;  3HDC A;  5B8B A;  2UV8 G;  1QGV A;  4FH8 A;  2JZT A;  4J2F A;  4HUA A;  2HNL A;  1XPV A;  2H71 A;  5J4V A;  5BMU B;  4FYC A;  3KD0 A;  1K3Y A;  2XPE A;  4N0V A;  4MDC A;  1M9B A;  4AJ7 A;  4ZBB A;  2FWE A;  1ST9 A;  4FYB A;  3WT1 A;  2O87 A;  3LEF A;  1LBK A;  3LGC A;  4ICY A;  2WZS A;  2VL2 A;  2P5R A;  1BG5 A;  2MMO A;  2OE3 A;  5IMA A;  4NHW A;  2X8H A;  2Z9S A;  2V32 A;  2HQT A;  1PKZ A;  4GQF A;  2AAW A;  11GS A;  3TKS C;  5B7C A;  4NXI A;  3VLN A;  5H5R A;  5IO2 A;  5IO0 A;  2CAQ A;  3M8N A;  2WVY A;  1M7T A;  4V2N A;  1GP1 A;  1ACV A;  3F4S A;  3QD9 A;  3L9S A;  4OCF A;  5H5Q A;  1PFO A;  3CSH A;  3GV1 A;  4MAB A;  4POK A;  4G9H A;  2WFC A;  5JWQ B;  1U87 A;  1A23 A;  2IMD A;  3FRC A;  2H66 A;  4PUA A;  3FMW A;  3CQF A;  1VGL A;  4RI6 A;  3E9J B;  3RHB A;  4KDU A;  1AAZ A;  5HFG A;  4BL7 A;  3ZZX A;  2NVL A;  1WRY A;  3F3Q A;  1ZMA A;  5JCU A;  2E7P A;  2HSY A;  2K18 A;  4AKI A;  2CZ3 A;  2LST A;  1SKR B;  2R2J A;  4MJA A;  4ZBA A;  1GSS A;  2LRN A;  1ERW A;  3WD6 A;  3GNJ A;  1BF5 A;  4KDX A;  2YCD A;  1SJZ A;  2WGR A;  5KOX A;  4E8E A;  4G0I A;  3CHX C;  5DAK A;  1R26 A;  3KM6 A;  4PUR A;  3WGE A;  5IMD A;  3TOU A;  4OMV A;  3KMN A;  3Q19 A;  5F0G A;  5KN1 A;  9GSS A;  4USS A;  4IQA A;  5HQP A;  1XVW A;  2EIO A;  3TRP A;  3L9U A;  2GDR A;  4CHS A;  1BYE A;  1XOA A;  4MNN A;  4RUV A;  4NWY A;  2KOK A;  2UZ8 A;  4DSQ A;  4PXO A;  3FEU A;  5G5E A;  4KCE A;  4J56 E;  2HSM B;  2FLS A;  2M72 A;  2L4Q A;  4KW6 A;  2PBJ A;  4IP1 A;  2I4A A;  2YP6 A;  2JSZ A;  2YPM A;  2TIR A;  2L6D A;  3F3R A;  1PN0 A;  4KCA A;  2C0E A;  2WJU A;  5B6N A;  3OR5 A;  1XVQ A;  3F63 A;  5IOW A;  3R2Q A;  2WVZ A;  2IFQ A;  1SEN A;  4ZB7 A;  2V1M A;  4HQZ A;  2VKZ G;  4L0U A;  3QR6 A;  1Z7R A;  4G19 A;  1G7O A;  4GST A;  4EIP A;  2FWF A;  2C8U A;  3GH9 A;  3KTL A;  1KEB A;  4V2M A;  3UVH A;  1WPI A;  4NPB A;  4MJB A;  2GZY A;  2NBS A;  3C73 A;  2PN8 A;  5HFK A;  4MH2 A;  1QK8 A;  4TR4 A;  2GQL A;  5BMU A;  4FO5 A;  4F9Z A;  2VCV A;  1J9B A;  2R0C A;  4IEL A;  1QFN A;  3UOM A;  1WIK A;  3I69 A;  2WW1 A;  3RDW A;  1VF1 A;  3FZ5 A;  2IMI A;  3KP9 A;  4WET A;  2B7J A;  2D2Z A;  3EE2 A;  4DVC A;  2DJK A;  4WKW A;  3ZLP A;  2E2M A;  2VCT A;  1GWC A;  2OKA A;  1N8J A;  4AKX B;  4XRD A;  1WOU A;  4F03 A;  4L0W A;  5AN1 A;  2P5Q A;  3EYT A;  4HU9 A;  2K8V A;  2DJ0 A;  5INY A;  2R37 A;  1B48 A;  3LXZ A;  2AB6 A;  3FHK A;  4POM A;  5IM9 A;  3E3E A;  1ZYN A;  1NM3 A;  2R0G A;  1RK4 A;  4LL4 B;  2FWH A;  2REM A;  4OFT A;  1V58 A;  4AJ8 A;  4PGT A;  3TJG A;  2V6O A;  4EO3 A;  1EOH A;  1ZCP A;  4IHU A;  20GS A;  3HXS A;  2DSA A;  4L8E A;  3UIW A;  1SL1 B;  4PQI A;  3MSZ A;  1Q98 A;  4X0X A;  3N5O A;  3J7Y k;  3VK9 A;  2N5B A;  4P3Y B;  4ZIJ A;  4ZB9 A;  2VLU A;  3O3T A;  2L6C A;  4Z2T A;  4NV5 A;  1YKC A;  5ECH B;  2WS2 A;  2TRX A;  13GS A;  4H86 A;  1G7E A;  2R3X A;  1XWB A;  2DLX A;  3HA9 A;  2HRK B;  3A2W A;  2HRF A;  4FQU A;  1SU9 A;  2ZNM A;  2G0F A;  3APQ A;  2B1K A;  1XIY A;  3KCM A;  1B4Q A;  3LYP A;  2AUV A;  3VWU A;  4ACS A;  1W89 A;  3F6F A;  5D73 A;  5ENU A;  3ZMK A;  2X64 A;  2L4C A;  1ZZY A;  4WR5 A;  4JZQ A;  2G2Q A;  3A2V A;  5DVB A;  1EV9 A;  4BVY B;  1BQ7 A;  2HSM A;  5A4U A;  1XFL A;  4HJ2 A;  3A3T A;  4Z2R A;  2QA2 A;  4KND A;  5DQS A;  1FB6 A;  4IN0 A;  2CZ2 A;  2H75 A;  3PGT A;  4I6X A;  4KB3 A;  3DVW A;  1Z9H A;  4QMK A;  4YQM A;  1T8E B;  3J7Y b;  2QKE A;  4ULX A;  5EY6 A;  2DKH A;  4F82 A;  4GWR A;  1OAZ A;  3GSS A;  4N30 A;  2H72 A;  3HJP A;  1WMJ A;  4TR1 B;  2HYX A;  3M9J A;  4TKY A;  1THO A;  4EXJ A;  5J9B A;  2GSR A;  2C0D A;  2LNT A;  1ZL9 A;  1X9M B;  6GSY A;  4AKH A;  3Q74 A;  2PPT A;  3C8E A;  2C0G A;  1LJR A;  5CNW A;  1YEP A;  3MYD A;  2EIQ A;  2VL2 C;  1M99 A;  3LW9 A;  3ERW A;  5EPF A;  1O8W A;  1GNW A;  4E8H A;  3A2X A;  4BPY A;  2IMK A;  4KA0 A;  1ERV A;  5ECI B;  3W6G A;  3G7I A;  2MYG A;  1VF4 A;  2YV9 A;  3CYN A;  4N3Z A;  5E59 A;  4EE0 A;  3P8W A;  5D9V A;  2L57 A;  3NIV A;  3DIE A;  3TRX A;  5GSS A;  1Z5Y E;  1FG4 A;  2OBI A;  4XCS A;  3CRT A;  2WW0 A;  1M3J A;  3TJF A;  2H0H A;  2FWG A;  1F3B A;  4O32 A;  1R4W A;  2C4J A;  4K9Z A;  4I8B A;  2ON5 A;  4LMW A;  2HZE B;  1PX6 A;  3GKM A;  2LUS A;  3I9V 2;  1ML6 A;  2LJK A;  5F8B A;  4KSM A;  1QXH A;  3L78 A;  6GSS A;  4E68 A;  4KE3 A;  3RGB C;  2PUK C;  2NPB A;  4WBJ A;  3HZ4 A;  2GT6 A;  5A4W A;  2VCQ A;  4HU7 A;  3K8N A;  4PQ1 A;  3CWG A;  1Z6M A;  1O7U A;  5DCG A; 
#chains in the Genus database with same CATH homology
 5LCZ A;  1GRX A;  2OE0 A;  1JHB A;  1XW6 A;  1XOB A;  4ZIL A;  2OAC A;  2C3N A;  3MNG A;  5J5N A;  1MTC A;  5B8A A;  2CVK A;  3PR8 A;  2IMF A;  5JWR B;  3VI5 A;  4EC0 A;  4DEJ A;  2O7K A;  2VO4 A;  5GST A;  1SD9 A;  2H1G A;  1DE2 A;  4Q5Q A;  3ZL5 A;  2PWJ A;  1K0M A;  3TB2 A;  3G7J A;  4J57 E;  2YZH A;  1WWJ A;  1Z6N A;  1UVZ A;  4YAP A;  2JL4 A;  5ECM B;  2C3T A;  1EZK A;  2EIR A;  2FA4 A;  4XS1 A;  3QMX A;  4N11 A;  4EDY A;  2H6Y A;  1J0F A;  3TRQ A;  2B5Y A;  1Y6E A;  2CAI A;  4F0B A;  5FWG A;  5ECO B;  2H76 A;  4O5R A;  2OAD A;  1A8Y A;  2V6K A;  4YQU A;  4BVY A;  3UAP A;  4IJI A;  1EGO A;  1FOH A;  5G2Z A;  3ZVJ A;  3EPT A;  5CRG A;  6GSX A;  3QAG A;  1BAY A;  1SK0 A;  2H0I A;  4MJC A;  3A5W A;  1GUK A;  3EU3 A;  3FR9 A;  5ECN B;  3ZVJ D;  2GZP A;  2A4H A;  3GTU B;  2QA1 A;  18GS A;  4GDF A;  1M9A A;  2HT9 A;  2PMT A;  2GGT A;  5D9W A;  4JED A;  1URM A;  1YKA A;  1V2A A;  4EVM A;  1MD4 A;  3N9J A;  4MZB A;  4TR1 A;  1TJD A;  2CVD A;  2JZR A;  3UBL A;  4HEA 2;  3TCO A;  3IPZ A;  1R7H A;  3IR4 A;  3HHV A;  1JZR A;  1GNE A;  2B7K A;  2YJH A;  4MF5 A;  5CRE A;  1FO5 A;  2F3M A;  2PER A;  4ZXG A;  3RPP A;  2PVQ A;  4YKF A;  2CQ9 A;  3FR6 A;  2YV7 A;  1B4P A;  1FW1 A;  1OC8 A;  3KP8 A;  4HS1 A;  5HR1 A;  1KNG A;  1HNC A;  3GKK A;  1V9W A;  4BWS A;  4TVE A;  4OFM A;  2HXK A;  2JU5 A;  4WEY A;  2KLX A;  4OO5 A;  5ECP B;  2DIY A;  1IYI A;  3F0I A;  2YWN A;  4G2E A;  2KP2 A;  2LEG A;  17GS A;  2R4V A;  1UN2 A;  5DQY A;  5KN0 A;  1FVK A;  2FHE A;  2VL9 A;  3LQ7 A;  3IOS A;  4CDO A;  4KGI A;  5GAN D;  2WRT A;  4FYU A;  2K8S A;  2VD0 A;  4ISD A;  5A34 B;  4JU5 A;  5AIX A;  4G0K A;  5ABR A;  2WB9 A;  2M80 A;  1F2E A;  3C1S A;  1ZOF A;  4ECI A;  2LS5 A;  5A4V A;  3QCP A;  1GSU A;  1XXU A;  3LWA A;  4GXZ A;  4ILF A;  2HZE A;  1OE8 A;  3CBU A;  2LQO A;  3TJJ A;  4ML6 A;  2NTO A;  5G30 A;  3HZ8 A;  4MH3 A;  5B6M A;  3IC4 A;  4MPF A;  4PQH A;  1KTE A;  3P7X A;  2I9H A;  3RPN A;  1F37 A;  3KZQ A;  3Q6O A;  3S9F A;  5CP1 A;  4EDZ A;  4TXV A;  3ZIV A;  4EIQ A;  1YZX A;  2H1A A;  1VF2 A;  4GSS A;  2X4A A;  3EVI A;  1MDJ A;  4MF7 A;  2R6K A;  2WUL A;  3FR3 A;  5IQY A;  3PH9 A;  2XBQ A;  1YDK A;  1HYU A;  3CRU A;  5J47 A;  5IIZ A;  3DVX A;  1TRU A;  3LFL A;  2RLI A;  4IP6 A;  5GZZ B;  3VUR A;  1OVN A;  1K0D A;  1SJI A;  1GSE A;  2RII A;  1H75 A;  3APS A;  3KH7 A;  2H1L A;  5AIS A;  4O7H A;  4NAX A;  1PA3 A;  3W8J A;  4WXT A;  2DBC A;  1OC3 A;  1T4Z A;  1TDI A;  3KTB A;  1ZYQ B;  4JBB A;  1N2A A;  4XIH A;  4FIW A;  4K7O A;  1PX7 A;  2O8V B;  4RQX A;  3CTG A;  1PKW A;  1MD3 A;  4EF0 A;  4K1F A;  2F9S A;  2DJ3 A;  4NHZ A;  5ELA A;  2LTK A;  4O5Q A;  4YH2 A;  2GSQ A;  2HFD A;  2IJY A;  1M2A A;  1SKW B;  4K8M A;  3HJO A;  3CTF A;  1XZO A;  4XRA A;  3IBH A;  3GTU A;  2R5G A;  16GS A;  2DKI A;  4WF5 A;  4D73 B;  5ECQ B;  1X5C A;  2H73 A;  1EV4 A;  22GS A;  4POB A;  3FKF A;  3VWX A;  1OYJ A;  1AW9 A;  2KHP A;  1GTB A;  3HKR A;  2DJ2 A;  2H6Z A;  3IHG A;  1SJ6 A;  2B5E A;  2RM6 A;  1YF1 A;  2H74 A;  2GQM A;  5DJM A;  3D21 A;  2IME A;  5G5F A;  1G0T A;  4TR3 A;  3VI7 A;  2WZ9 A;  3TOT A;  1AQW A;  1GTU A;  2AJQ B;  1K0A A;  2H0G A;  4RQR A;  2F8A A;  2B3S A;  5KEJ A;  5H5S A;  1TOF A;  3AY8 A;  2YOI A;  2FY6 A;  2LQQ A;  5F07 A;  5A5H B;  3TKP A;  1UC7 A;  2HSN B;  3DML A;  1MDK A;  5D8I A;  1PMT A;  2EFD A;  4MZW A;  3FK8 A;  1TK0 B;  1TI1 A;  3BJ5 A;  4BVX B;  2CA8 A;  1X9S B;  5A34 A;  1RW1 A;  1GTA A;  3SBC A;  3EIN A;  4HI7 A;  3I6A A;  1SVL A;  4K2D A;  3R3E A;  3CMI A;  3GRX A;  3D22 A;  3GMF A;  1LU4 A;  4K7I A;  4X1U A;  2YZU A;  2H1B A;  4MMM A;  3C71 A;  2WCI A;  3I43 A;  3HMJ G;  4Q5N A;  2GLR A;  1DSB A;  3MWH A;  2ES7 A;  4DSR A;  2B1L A;  4ECJ A;  1T1V A;  3FW2 A;  5E4W A;  2OA7 A;  1EEM A;  4V1A g;  1EP7 A;  3GKX A;  1TK5 B;  2ZCT A;  6GSV A;  1BED A;  1NSW A;  3EU4 A;  2MMN A;  2O5V A;  2FGX A;  5ID2 B;  3ZIJ A;  1M2D A;  3FY7 A;  1MEK A;  4TOP A;  1A0R P;  3RAZ A;  4ZB6 A;  3MDK A;  4A5P A;  1PD2 1;  1YVL A;  4XHM A;  4L5L A;  2DIZ A;  3KXO A;  1BX9 A;  4F2I A;  1OKT A;  4ECC A;  1JZD A;  1VRS D;  4XTS A;  1GH2 A;  3P90 A;  5IPG A;  2J9H A;  1T4Y A;  1X5D A;  1I9D A;  3A5I A;  3FZ9 A;  1EEJ A;  2RUF A;  3L4N A;  4AKG A;  2JZS A;  3SWL A;  4K2X A;  1O81 A;  1U3A A;  4EL1 A;  2LNS A;  1GLP A;  1JZW A;  1O73 A;  1S3C A;  1O85 A;  3WT2 A;  3NZN A;  4MCU A;  1GSF A;  2BJX A;  3DD3 A;  2GZZ A;  1PL2 A;  3QDN A;  1V98 A;  1XW9 A;  5CYY A;  1K0N A;  3TDG A;  2HI7 A;  3M9K A;  1SK1 A;  2DMM A;  5J40 A;  4K7N A;  1H4O A;  3F8U A;  3APO A;  4LLR A;  5AGY A;  3VFI A;  5DDL A;  2LJA A;  2F8F A;  2HZF A;  3C1R A;  2GSS A;  1ERU A;  1SVM A;  3O76 A;  2HE3 A;  3JCM L;  2KUC A;  4I97 A;  1SYR A;  4TN8 A;  4GLT A;  4D73 A;  1R5P A;  4K0N A;  4OFN A;  19GS A;  2LV3 A;  4HZ2 A;  2KP1 A;  3Q18 A;  5CRD A;  5IMZ A;  2GT5 A;  2BTO T;  2H70 A;  1DUG A;  1K3O A;  3ZRD A;  4V1A p;  5J4U A;  4Q5F A;  4XS4 B;  2A4V A;  3QFA C;  3HY2 A;  1JLW A;  3QAW A;  4TXO B;  3QAV A;  1QQ2 A;  4IJ3 A;  1M2B A;  2H8L A;  1Y1U A;  3KEB A;  3EMX A;  2MBS A;  1OKD A;  2H30 A;  2XBI A;  5C04 A;  4QL9 A;  3IAM 2;  3HD5 A;  3ZFB A;  2IL3 A;  3RHC A;  1A2M A;  2NDO A;  2HSN A;  1E2Y A;  2K6V A;  1B8X A;  5A1N B;  2YWO A;  2H19 A;  1U3I A;  2EFC A;  4BVX A;  3IXR A;  3O6T A;  4W66 A;  3PPU A;  5DAL B;  3BCK A;  4PX1 A;  5JCW A;  3VPT A;  3KH9 A;  2J23 A;  2QSI A;  3BCI A;  3W8S A;  1SYX A;  3D5J A;  3EMP A;  3IE3 A;  5CO3 A;  2LJR A;  3H93 A;  4LA1 A;  2VUP A;  4JRR A;  2A2S A;  3ZML A;  5J4Y A;  2XC2 A;  5IOX A;  2VL3 A;  4HOJ A;  2FA8 A;  1CQG A;  1V40 A;  2H1D A;  2HRK A;  2LKU A;  4PNF A;  4TW5 A;  2A2R A;  3KMO A;  5HR0 A;  1PSQ A;  4IS0 A;  4NV2 A;  1KBN A;  5ECS A;  4PTS A;  3BD2 A;  2OT3 A;  1TW9 A;  3U6V A;  1TI3 A;  1PL1 A;  3IC8 A;  3IDV A;  4OD7 A;  1FHE A;  1BG1 A;  1PQN A;  1XW5 A;  3HVV A;  2I81 A;  2P31 A;  2X8C A;  2ALB A;  5HR3 A;  2GQK A;  2FUG 2;  3HCZ A;  5ID2 A;  3GL5 A;  4ECB A;  3G9B A;  2HLS A;  5KN2 A;  1DBY A;  3V1W A;  4ID0 A;  1O6J A;  4MZC A;  3MIX A;  2VCW A;  2CT6 A;  6GSW A;  2IIY A;  2RUE A;  3M3M A;  1Z3E A;  5LD0 A;  5KN3 A;  3ERG A;  2AHE A;  4TRX A;  5EL8 A;  5HFI A;  3PIN A;  2FNO A;  2HRN A;  4OO4 A;  4MK3 A;  2AV4 A;  5G1K A;  3P2A A;  2VLV A;  2OE1 A;  4AGS A;  1TXX A;  1GTI A;  4F0C A;  3CSJ A;  4ZL9 A;  1B9X C;  2PGT A;  1JFU A;  3WGX A;  4LL1 B;  3TGZ A;  14GS A;  1GUM A;  3IRA A;  1SKS B;  1YEX A;  3C7M A;  3HVS A;  1TU8 A;  5ECL B;  3GFK A;  4KUN A;  2K9F A;  1J08 A;  6GSU A;  4G10 A;  4XS6 A;  2N5F A;  3NOF A;  3KIJ A;  3QPM A;  5COH A;  5FT3 A;  3GX0 A;  4LMV A;  4GF0 A;  3D0Z A;  3IAS 2;  3F6D A;  1QUW A;  3UMA A;  1T7P B;  1A2J A;  1WP0 A;  4HQS A;  4POL A;  3BBY A;  3G7Y A;  2EC4 A;  2PVO C;  3U5R E;  2VCX A;  4XS4 A;  1FAA A;  1F9M A;  2QC7 A;  4EUY A;  1S3D A;  2VIM A;  4BWQ A;  4ZBD A;  3LJR A;  4N10 A;  1O8X A;  5AIV A;  1A24 A;  3ZFL A;  1XWK A;  3E0U A;  2EFE A;  4TXO A;  3D6I A;  3RBT A;  1NHY A;  3KJY A;  1XWG A;  1BJX A;  3EWL A;  4HZ4 A;  2I1U A;  2EFH A;  2ON7 A;  3EUR A;  3TJB A;  2R0P A;  4IQ1 A;  5IMC A;  2TRC P;  1AC1 A;  3VPQ A;  3L9V A;  1UA5 A;  3DWV A;  1Z7P A;  3DRN A;  5A1N A;  3TJK A;  4MF6 A;  4K0G A;  5DAL A;  1EGR A;  5LNK e;  3GST A;  4EKZ A;  1XWC A;  1PN9 A;  2V2G A;  2IPA A;  1JLV A;  1YJ6 A;  2L59 A;  1RQM A;  3M0F A;  1QMV A;  3UEM A;  3BOA A;  1GSD A;  1A2L A;  2VOC A;  3ZRE A;  3QOU A;  4TR0 A;  1A0F A;  4N0Z A;  3VWV A;  4ZL7 A;  4KH7 A;  1WE0 A;  4KSO A;  5J41 A;  4G0L A;  4IGJ A;  2F51 A;  2VM1 A;  3ZIT A;  4MA9 A;  1EWX A;  4ZL8 A;  3DKS A;  3GA4 A;  2O85 A;  2DJ1 A;  3ED3 A;  3ZYW A;  1TXU A;  1JZO A;  1A8L A;  1EP8 A;  1SVO A;  2CV4 A;  1YQ1 A;  4WR4 A;  4OCE A;  4IKH A;  1OE7 A;  3IA1 A;  3IK9 A;  2C0F A;  1TRS A;  1OC9 B;  1GUH A;  3TKR A;  1M0U A;  2C80 A;  4QQ7 A;  2E2G A;  3GX8 A;  2FD3 A;  1FB0 A;  4KAE A;  1T3B A;  2N5A A;  3CXG A;  4O5U A;  3GH6 A;  4AJ6 A;  4NMU A;  2C3Q A;  1PRX A;  2C1Y A;  5GAP D;  3ISO A;  3TKS A;  4WF4 A;  2B6M A;  1SL2 B;  4K5R A;  5G31 A;  1W4V A;  1VF3 A;  1FVJ A;  3UAR A;  3WGD A;  1GLQ A;  2X49 A;  3LSZ A;  4ML1 A;  1DE1 A;  4Q5R A;  1ERT A;  4JR4 A;  1TTZ A;  3FYG A;  4BA7 A;  1E6B A;  4JR6 A;  4IVF A;  2DJJ A;  4MJE A;  2L5O A;  2RM5 A;  1K3L A;  1S3A A;  4IW9 A;  3UL3 A;  1MDI A;  3FZA A;  2MMZ A;  1AIU A;  2XPD A;  4Z7X A;  1TP9 A;  1IYH A;  5ECK B;  1NHO A;  5FHI A;  1G6W A;  5F05 A;  3US3 A;  1HQO A;  1ON4 A;  2HSH A;  3F4T A;  3ME8 A;  3DGQ A;  3UBK A;  3EC3 A;  2GS3 A;  4MP4 A;  2YWM A;  1ILO A;  3IV4 A;  4I2U A;  2BMX A;  1CQH A;  4I2T A;  4JE1 A;  2MZC A;  1FOV A;  1HD2 A;  3MAK A;  5ELG A;  3D4T A;  3L0H A;  2QGV A;  1X9W B;  4CY6 A;  5EVO A;  4YKG A;  4AF2 A;  5D9T A;  3DXB A;  2H01 A;  1SD8 A;  4DSS B;  3DEX A;  2GVP A;  4O92 A;  2LRT A;  3GHA A;  2A2P A;  2AYT A;  5D9X A;  7GSS A;  4GTU A;  3H8Q A;  3FZ4 A;  3LXT A;  1V57 A;  3H79 A;  2YJ7 A;  1Y25 A;  3WYW A;  1ZYE A;  1TU7 A;  2GST A;  4Z2U A;  3ERF A;  2DML A;  5J9C A;  2MBT A;  3H1N A;  1YY7 A;  2LRC A;  5DBQ A;  5BRT A;  1AQV A;  5JCG A;  4CY8 A;  5CAX A;  4GQC A;  3DYR A;  1GSY A;  4K5S A;  1TK8 B;  3GUS A;  3LYK A;  4KX4 A;  1C72 A;  2WDU A;  2IN3 A;  2E0Q A;  4HDE A;  1Q4J A;  2GTU A;  4IBP A;  1ZGN A;  1K0O A;  3IHQ A;  1K0C A;  4MPG A;  1YF0 A;  2JSY A;  2B5X A;  2VAF A;  4AI6 A;  4MLY A;  1OC9 A;  1XWA A;  4GCI A;  4OWY A;  1ZYP A;  2CVB A;  3TU3 B;  3LG6 A;  2YNX A;  5DCH A;  1ABA A;  1B9Y C;  1N25 A;  2CX4 A;  2FCH A;  4RI7 A;  1PGT A;  2X99 A;  4GSN A;  2YWI A;  2YN1 A;  2VCZ A;  2VD1 A;  1GL8 A;  3LOR A;  3F9U A;  2IWT A;  10GS A;  3F4R A;  12GS A;  4YQV A;  1AXD A;  3D4M A;  5KOW A;  3TUE A;  2V41 A;  2CX3 A;  3GN3 A;  4BL7 B;  5L71 A;  3VWW A;  2L5L A;  5JWO B;  3H4K A;  2ZUP A;  1F3A A;  1F6M C;  2H6X A;  1GUL A;  1X0R A;  3HYP A;  3CSI A;  1U6T A;  5F06 A;  2X8G A;  4GRF A;  4QL7 A;  2DC5 A;  5HR2 A;  5D93 A;  1GSQ A;  1AUC A;  2I3Y A;  1TKD B;  2PU9 C;  5CRW A;  3KGK A;  5A5H A;  5DAK B;  2O89 A;  1XCC A;  3TKQ A;  3GUR A;  3ZTL A;  2JAD A;  4KF9 A;  1AQX A;  3QFB C;  3IK7 A;  4PNG A;  4L5O A;  1G6Y A;  5IPH A;  1R5A A;  2M46 A;  3GIX A;  4PUF C;  3GL3 A;  4HJM A;  5DJL A;  5ECR B;  5IMF A;  4YAV A;  5C00 A;  1TRW A;  1I5G A;  2P0G A;  2VLT A;  3GYK A;  3UJ1 A;  1HNA A;  4DSS A;  1THX A;  1USB A;  5CRH A;  1HNB A;  5A5K A;  3TKS E;  4X43 A;  2HRA A;  4I5Q A;  3HVX A;  1T00 A;  6GST A;  2XHF A;  1XBS A;  2MMA A;  4CW9 A;  2OJL A;  4K6X A;  1TRV A;  2VM2 A;  1SK2 A;  2OBK A;  5G1L A;  1K0B A;  1WJK A;  2IFQ B;  5D96 A;  5IMV A;  5J3R A;  4ZB8 A;  2JAC A;  3UVT A;  8GSS A;  2YAN A;  3GKN A;  4X4J A;  1U88 A;  3ME7 A;  1SL0 B;  4WBR D;  4V2L A;  4G01 A;  3M1G A;  3HJM A;  1NW2 A;  4KDY A;  1X5E A;  1EOG A;  3HDC A;  5B8B A;  2UV8 G;  1QGV A;  4FH8 A;  2JZT A;  4J2F A;  4HUA A;  2HNL A;  1XPV A;  2H71 A;  5J4V A;  5BMU B;  4FYC A;  3KD0 A;  1K3Y A;  2XPE A;  4N0V A;  4MDC A;  1M9B A;  4AJ7 A;  4ZBB A;  2FWE A;  1ST9 A;  4FYB A;  3WT1 A;  2O87 A;  3LEF A;  1LBK A;  3LGC A;  4ICY A;  2VL2 A;  2P5R A;  1BG5 A;  2MMO A;  2OE3 A;  5IMA A;  4NHW A;  2X8H A;  2Z9S A;  2V32 A;  2HQT A;  1PKZ A;  4GQF A;  2AAW A;  11GS A;  3TKS C;  5B7C A;  4NXI A;  3VLN A;  5H5R A;  5IO2 A;  5IO0 A;  2CAQ A;  3M8N A;  1M7T A;  4V2N A;  1GP1 A;  1ACV A;  3F4S A;  3QD9 A;  3L9S A;  4OCF A;  5H5Q A;  4MAB A;  3CSH A;  3GV1 A;  4POK A;  4G9H A;  2WFC A;  5JWQ B;  1U87 A;  1A23 A;  2IMD A;  3FRC A;  2H66 A;  4PUA A;  3FMW A;  1VGL A;  4RI6 A;  3E9J B;  3RHB A;  4KDU A;  1AAZ A;  5HFG A;  4BL7 A;  3ZZX A;  2NVL A;  1WRY A;  3F3Q A;  1ZMA A;  5JCU A;  2E7P A;  2HSY A;  2K18 A;  4AKI A;  2CZ3 A;  2LST A;  1SKR B;  2R2J A;  4MJA A;  4ZBA A;  1GSS A;  2LRN A;  1ERW A;  3WD6 A;  3GNJ A;  1BF5 A;  4KDX A;  2YCD A;  1SJZ A;  2WGR A;  5KOX A;  4E8E A;  4G0I A;  5DAK A;  1R26 A;  3KM6 A;  4PUR A;  3WGE A;  5IMD A;  3TOU A;  4OMV A;  3KMN A;  3Q19 A;  5F0G A;  5KN1 A;  9GSS A;  4USS A;  4IQA A;  5HQP A;  1XVW A;  2EIO A;  3TRP A;  3L9U A;  2GDR A;  4CHS A;  1BYE A;  1XOA A;  4MNN A;  4RUV A;  4NWY A;  2KOK A;  2UZ8 A;  4DSQ A;  4PXO A;  3FEU A;  5G5E A;  4KCE A;  4J56 E;  2HSM B;  2FLS A;  2M72 A;  2L4Q A;  4KW6 A;  2PBJ A;  4IP1 A;  2I4A A;  2YP6 A;  2JSZ A;  2YPM A;  2TIR A;  2L6D A;  3F3R A;  1PN0 A;  4KCA A;  2C0E A;  2WJU A;  5B6N A;  3OR5 A;  1XVQ A;  3F63 A;  5IOW A;  3R2Q A;  2IFQ A;  1SEN A;  4ZB7 A;  2V1M A;  4HQZ A;  2VKZ G;  4L0U A;  3QR6 A;  1Z7R A;  4G19 A;  1G7O A;  4GST A;  4EIP A;  2FWF A;  2C8U A;  3GH9 A;  3KTL A;  1KEB A;  4V2M A;  3UVH A;  1WPI A;  4NPB A;  4MJB A;  2GZY A;  2NBS A;  3C73 A;  2PN8 A;  5HFK A;  4MH2 A;  1QK8 A;  4TR4 A;  2GQL A;  5BMU A;  4FO5 A;  4F9Z A;  2VCV A;  1J9B A;  2R0C A;  4IEL A;  1QFN A;  3UOM A;  1WIK A;  3I69 A;  3RDW A;  1VF1 A;  3FZ5 A;  2IMI A;  3KP9 A;  4WET A;  2B7J A;  2D2Z A;  3EE2 A;  4DVC A;  2DJK A;  4WKW A;  3ZLP A;  2E2M A;  2VCT A;  1GWC A;  2OKA A;  1N8J A;  4AKX B;  4XRD A;  1WOU A;  4F03 A;  4L0W A;  5AN1 A;  2P5Q A;  3EYT A;  4HU9 A;  2K8V A;  2DJ0 A;  5INY A;  2R37 A;  1B48 A;  3LXZ A;  2AB6 A;  3FHK A;  4POM A;  5IM9 A;  3E3E A;  1ZYN A;  1NM3 A;  2R0G A;  1RK4 A;  4LL4 B;  2FWH A;  2REM A;  4OFT A;  1V58 A;  4AJ8 A;  4PGT A;  3TJG A;  2V6O A;  4EO3 A;  1EOH A;  1ZCP A;  4IHU A;  20GS A;  3HXS A;  2DSA A;  4L8E A;  3UIW A;  1SL1 B;  4PQI A;  3MSZ A;  1Q98 A;  4X0X A;  3N5O A;  3J7Y k;  3VK9 A;  2N5B A;  4P3Y B;  4ZIJ A;  4ZB9 A;  2VLU A;  3O3T A;  2L6C A;  4Z2T A;  4NV5 A;  1YKC A;  5ECH B;  2WS2 A;  2TRX A;  13GS A;  4H86 A;  1G7E A;  2R3X A;  1XWB A;  2DLX A;  3HA9 A;  2HRK B;  3A2W A;  2HRF A;  4FQU A;  1SU9 A;  2ZNM A;  2G0F A;  3APQ A;  2B1K A;  1XIY A;  3KCM A;  1B4Q A;  3LYP A;  2AUV A;  3VWU A;  4ACS A;  1W89 A;  3F6F A;  5D73 A;  5ENU A;  3ZMK A;  2X64 A;  2L4C A;  1ZZY A;  4WR5 A;  4JZQ A;  2G2Q A;  3A2V A;  5DVB A;  1EV9 A;  4BVY B;  1BQ7 A;  2HSM A;  5A4U A;  1XFL A;  4HJ2 A;  3A3T A;  4Z2R A;  2QA2 A;  4KND A;  5DQS A;  1FB6 A;  4IN0 A;  2CZ2 A;  2H75 A;  3PGT A;  4I6X A;  4KB3 A;  3DVW A;  1Z9H A;  4QMK A;  4YQM A;  1T8E B;  3J7Y b;  2QKE A;  4ULX A;  5EY6 A;  2DKH A;  4F82 A;  4GWR A;  1OAZ A;  3GSS A;  4N30 A;  2H72 A;  3HJP A;  1WMJ A;  4TR1 B;  3M9J A;  2HYX A;  4TKY A;  1THO A;  4EXJ A;  5J9B A;  2GSR A;  2C0D A;  2LNT A;  1ZL9 A;  1X9M B;  6GSY A;  4AKH A;  3Q74 A;  2PPT A;  3C8E A;  2C0G A;  1LJR A;  5CNW A;  1YEP A;  3MYD A;  2EIQ A;  2VL2 C;  1M99 A;  3LW9 A;  3ERW A;  5EPF A;  1O8W A;  1GNW A;  4E8H A;  3A2X A;  4BPY A;  2IMK A;  4KA0 A;  1ERV A;  5ECI B;  3W6G A;  3G7I A;  2MYG A;  1VF4 A;  2YV9 A;  3CYN A;  4N3Z A;  5E59 A;  4EE0 A;  3P8W A;  5D9V A;  2L57 A;  3NIV A;  3DIE A;  3TRX A;  5GSS A;  1Z5Y E;  1FG4 A;  2OBI A;  4XCS A;  3CRT A;  3TJF A;  2H0H A;  2FWG A;  1F3B A;  4O32 A;  1R4W A;  2C4J A;  4K9Z A;  4I8B A;  2ON5 A;  4LMW A;  2HZE B;  1PX6 A;  3GKM A;  2LUS A;  3I9V 2;  1ML6 A;  2LJK A;  5F8B A;  4KSM A;  1QXH A;  3L78 A;  6GSS A;  4E68 A;  4KE3 A;  2PUK C;  2NPB A;  4WBJ A;  3HZ4 A;  2GT6 A;  5A4W A;  2VCQ A;  4HU7 A;  3K8N A;  4PQ1 A;  3CWG A;  1Z6M A;  1O7U A;  5DCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...