3WD6A

Crystal structure of bombyx mori omega-class glutathione transferase in complex with gsh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
242
structure length
242
Chain Sequence
NINFNTKHLRKGDPLPPFNGKLRVYNMRYCPYAQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDEVYPKRPLLPQDPLKKALDKIIVEASAPIQSLFIKILKFSDTVNEEHVAAYHKALDFIQEQLKNRGTVFLDGSEPGYADYMIWPWFERLRAFAHDERVRLEPSKYSLLLEYIDNMLKDSAVSQYLIPLEILAKFHEAYTKKERPNYELLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a Bombyx mori Omega-class glutathione transferase.
pubmed doi rcsb
molecule keywords Omega-class glutathione S-transferase
molecule tags Transferase
source organism Bombyx mori
total genus 94
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3wd6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wd6A01
2XPEA 4DSRA 1AQVA 1O8WA 1M7TA 1K3OA 2I81A 3D22A 3C8EA 1T4YA 4G2EA 1TDIA 1YEPA 4PUAA 3QPMA 1MDKA 3ZFBA 4ECCA 2L6CA 1FB0A 4ZXGA 4IELA 1GP1A 2KOKA 1USBA 2X99A 4XCSA 1PL1A 3HCZA 4DSQA 3C7MA 1G6WA 1TU8A 1A8LA 5KN1A 4O5RA 2B3SA 4LL1B 3PH9A 3C1RA 4GWRA 4ZIJA 3A5WA 3KTLA 5KN3A 2YN1A 3HVXA 1R5AA 1X5DA 1A8YA 3OR5A 3I43A 3BCIA 4F2IA 1KNGA 2LSTA 5ECHB 4DSSB 5IO0A 2H0IA 1PX6A 2N5AA 1ZYEA 3W6GA 2MMNA 2YOIA 5E59A 4H86A 2GQKA 4F9ZA 2O7KA 3FR3A 5DAKA 4OFNA 4ZB8A 5J3RA 1JZDA 3FZ9A 3ZIJA 3MWHA 1JHBA 1XWGA 3GA4A 2AV4A 3F4TA 2VL3A 2OE1A 2DJ0A 1N2AA 1OE7A 2VLTA 3E3EA 2N5BA 5LD0A 1SENA 2DIYA 2X64A 1MD4A 1QQ2A 1SKWB 1YF1A 2L5OA 3H8QA 3E0UA 4WETA 4DSSA 2HSNB 4KUNA 1G7EA 1Z7PA 1Q4JA 1J9BA 3CRTA 3ERWA 2PBJA 1QK8A 9GSSA 2V6KA 1SU9A 4JR6A 2K9FA 3LGCA 5G30A 1GUMA 3KGKA 1XCCA 4K0GA 4V1Ap 2HRKB 1TRSA 2GZZA 6GSSA 2YWMA 4TXOA 3D0ZA 1U88A 1T00A 4F03A 4MZBA 4MF7A 3HDCA 4EDYA 2GT6A 3LXTA 4G9HA 2DJ3A 2FCHA 2AYTA 2XBQA 2CT6A 3HYPA 4HI7A 3EWLA 4GQCA 2ALBA 3F4SA 1W89A 3G9BA 3HKRA 2L4CA 1X9SB 4L8EA 1M0UA 2YANA 5FWGA 1A24A 2NTOA 6GSTA 2IFQB 2VM1A 3A2VA 3EU3A 5D9XA 3GL5A 4BPYA 4MPGA 3Q6OA 2YZUA 3LQ7A 3HZ8A 4EL1A 1TRVA 4QQ7A 1U87A 1SJZA 2FWHA 1EP7A 3GKKA 4BL7B 2V32A 1O6JA 1AUCA 4I2TA 3IC8A 2QSIA 2LV3A 2B5EA 3VWUA 3H79A 5EY6A 1XXUA 5EL8A 1EEJA 2J9HA 4O92A 3UMAA 4K7NA 1RW1A 4O32A 1FVKA 2F9SA 3UVHA 1XFLA 3WYWA 1PA3A 2F3MA 2UZ8A 3KZQA 4JE1A 2KHPA 3ZZXA 5IM9A 3EVIA 4Q5NA 2DJ1A 1UN2A 5CO3A 4N30A 3LSZA 1SD8A 1F2EA 1XW9A 3TUEA 2NDOA 4NMUA 3I6AA 2HFDA 1GL8A 2JACA 4XS1A 4FH8A 3TJKA 4G0KA 3CYNA 4ECJA 3TKPA 4IW9A 4TR1B 3M0FA 5AN1A 1TKDB 1XWBA 2PWJA 2WB9A 3TJGA 3CTFA 3VK9A 4MABA 5FHIA 2TRXA 3TKSE 3H1NA 5ECMB 4HQSA 5HR0A 3ISOA 3IK9A 2DJKA 5C00A 2FY6A 2NBSA 2EIOA 3GIXA 4HU9A 4PGTA 2V2GA 1MDIA 1SJ6A 4BVYB 1YY7A 3EMPA 4MH3A 2MMAA 4TR1A 1N8JA 3GV1A 5ECKB 2YJ7A 1YF0A 2QC7A 2G2QA 2B7KA 5G31A 1A2JA 4FYBA 4NV2A 2O8VB 5J9BA 3H4KA 2LNTA 5DVBA 1WWJA 1O85A 2OA7A 1Z3EA 3NZNA 5LCZA 4GQFA 2P5RA 5A4WA 1FW1A 3FKFA 3APOA 4HUAA 2CAIA 3L4NA 2HRAA 3KXOA 4L0WA 4KH7A 4GTUA 1K0AA 4QL9A 1T7PB 3ZMLA 2O85A 3WGEA 4J56E 3IE3A 2FA8A 2H71A 1TRUA 2M72A 1I9DA 2OACA 5JCUA 3ZIVA 4OFMA 1Z6NA 3BD2A 1FVJA 4RI6A 2YCDA 3CTGA 5ECQB 1T4ZA 3H93A 1MDJA 5EPFA 2AJQB 3TKSC 1ABAA 4OFTA 1YQ1A 1YDKA 3R3EA 2NPBA 1EP8A 3BCKA 2GSRA 1S3DA 4G19A 4XRDA 3TKRA 3ZRDA 3A3TA 4EO3A 4NV5A 4PNGA 4E8EA 2KLXA 2H6YA 2H66A 4MDCA 4KDXA 3FZAA 1RQMA 1UA5A 2WCIA 4IJIA 4TXVA 3GX0A 5IMCA 2GQMA 3WT1A 3PINA 4G10A 2DSAA 1K3YA 2FD3A 1QUWA 3RPPA 3RPNA 1SL0B 1Z7RA 4J2FA 2L59A 2H19A 1GUHA 1KEBA 4ISDA 2H6ZA 2YV7A 4PQIA 4AJ7A 3N9JA 4N11A 2L6DA 3C71A 1VF4A 3TRPA 3ME7A 2DIZA 4K7OA 1GTAA 2HSMB 4ID0A 5DCHA 4ULXA 2V1MA 3WT2A 1TXXA 1GRXA 4KE3A 1SD9A 2DMLA 2WGRA 1UC7A 2HNLA 3ZTLA 3GX8A 2VL2A 1S3AA 5AGYA 4XTSA 4N0VA 4PXOA 1K0DA 4MP4A 2OKAA 3FR9A 1F6MC 2P0GA 4ZBAA 3KEBA 4XS4B 5DJMA 2EC4A 3EURA 2FHEA 1B9XC 4IJ3A 2H8LA 2H30A 4KGIA 5KEJA 2H0HA 3ZYWA 3EU4A 3RAZA 5CNWA 1OE8A 5H5SA 5IMVA 3HJOA 5COHA 4IS0A 4XIHA 2OE3A 5AIVA 4FYUA 2GT5A 4K1FA 3L9UA 4YH2A 3JCML 3E9JB 3HA9A 3KM6A 1EGRA 2M46A 1SL2B 5F06A 2E0QA 2VIMA 2IMFA 1OC9B 5DDLA 3HVVA 1AC1A 1GH2A 5ECIB 2B1KA 3IDVA 4MJAA 3VPQA 4NHWA 1O7UA 2FLSA 1A23A 1EOHA 5ELAA 3QAGA 5D73A 1H75A 3RDWA 3ERGA 2CQ9A 2H0GA 5ECPB 5A5KA 3HJMA 4DVCA 5JCGA 2IPAA 1NHYA 1DUGA 1K0MA 3HHVA 3W8JA 3VPTA 3IAS2 4HZ4A 3IPZA 4TR4A 2C0EA 1HD2A 5CRHA 3KCMA 2RIIA 5ID2B 2C3NA 3CXGA 3L78A 1M9BA 4PX1A 2R5GA 2H74A 5D9TA 3L9SA 1H4OA 3LYPA 5CRDA 2CAQA 1WRYA 2YNXA 3F6FA 2R37A 3DIEA 1SK1A 3VLNA 4GLTA 3D5JA 1XPVA 1R5PA 2LRCA 1G7OA 4ML6A 3QDNA 3TB2A 1HNCA 4IQ1A 1V58A 2HXKA 2FWFA 4RQXA 1J0FA 2MMOA 3Q19A 3KIJA 5ECNB 3QCPA 1GNWA 3F6DA 3GHAA 3HJPA 2F8FA 2LS5A 2MZCA 3DVWA 1ZMAA 4JZQA 5IPGA 3D6IA 3KMOA 1K3LA 2GSQA 5HFGA 2C3TA 5D96A 1MTCA 4GXZA 3TCOA 2WDUA 4KSMA 2I9HA 4V1Ag 5JWRB 2K6VA 2J23A 3CSIA 2OADA 3V1WA 1WMJA 3M9JA 5HR1A 5HR2A 1X5CA 4I8BA 4IN0A 1K0NA 1X0RA 5DQSA 4L5OA 1S3CA 2OBKA 2FNOA 2JL4A 4PURA 5DQYA 1EV9A 4EC0A 12GSA 3GSSA 3SBCA 5E4WA 4KDUA 1SYRA 3LJRA 1QMVA 3TJJA 5J5NA 1JZRA 4KF9A 3LWAA 4USSA 1XW5A 1B8XA 1NSWA 2VCVA 2C80A 5L71A 4GF0A 4ILFA 4K7IA 3IBHA 4F82A 4PUFC 19GSA 1JZWA 4RI7A 1ZCPA 2REMA 2CZ3A 1F37A 4K0NA 4EKZA 1T3BA 2C8UA 1QXHA 3VWWA 1AIUA 1PGTA 4GSSA 2LRNA 5FT3A 2FWEA 5D9WA 2EIQA 3PGTA 2P5QA 4RQRA 5IMDA 2PVQA 3DYRA 4HJ2A 1GSEA 4NXIA 4ECIA 2N5FA 2VCQA 3F3QA 2HRKA 1TU7A 1PKZA 4OCEA 1FOVA 2X8CA 1URMA 1XWCA 2OE0A 5J4UA 3EE2A 1GSUA 1OC3A 3UIWA 3RHCA 1VF1A 2WZ9A 4V2LA 4IGJA 4MF5A 5DALB 5A4VA 4BVXB 4YQMA 1B4QA 1IYHA 20GSA 4L5LA 4BWQA 3NOFA 3VI5A 2VO4A 1ZZYA 2YZHA 3CBUA 2LQOA 3G7JA 1GTBA 1YKCA 3MSZA 3GL3A 3M8NA 3FYGA 1EWXA 3PR8A 4EVMA 2LNSA 2IFQA 3IXRA 2CZ2A 1J08A 4ZB9A 1OC8A 2X8HA 1ZYQB 5ELGA 5CREA 2GSTA 2B5YA 3VI7A 3US3A 2PUKC 1KTEA 3APQA 1KBNA 4BL7A 3M1GA 1XBSA 1TK8B 5KN0A 1GSSA 2HZFA 1R26A 1TRWA 3FR6A 1UVZA 4GSNA 1PMTA 1K0OA 3IHQA 2R3XA 4GSTA 3ZFLA 2LJKA 5IO2A 1SK0A 3GFKA 1TJDA 1FG4A 2JZRA 5H5RA 4TW5A 3GYKA 1U3AA 4NHZA 2H70A 3QR6A 5F05A 2HSHA 2IMDA 1ST9A 2AAWA 3LORA 1X9MB 2JSZA 3L9VA 2C0GA 5F0GA 2IMKA 4X1UA 2WFCA 4ZB6A 1GTUA 2HZEB 4PTSA 3SWLA 2HRNA 1K0CA 3EYTA 5IQYA 3GKMA 5G1KA 3GH9A 2IL3A 1B9YC 1TK0B 3CSJA 1DSBA 2DC5A 4AGSA 4HQZA 3TRQA 4LMVA 3TJFA 3I9V2 5HFIA 4IQAA 6GSUA 3A2WA 1F9MA 1E2YA 4X43A 5GAND 4Q5QA 2JZTA 3TOTA 4LL4B 1W4VA 2O89A 16GSA 3P8WA 1V40A 4BVYA 1TW9A 1GLQA 2YV9A 3TOUA 2CX4A 4ZBBA 5IOXA 4MZWA 3P2AA 3O3TA 3J7Yb 3VWVA 1U6TA 6GSYA 3TGZA 3P7XA 1VRSD 4N0ZA 2C0DA 1OYJA 1TI3A 1O73A 1XVQA 2K18A 4JEDA 3IC4A 1VF2A 5DJLA 2L4QA 3N5OA 1G0TA 5GSSA 3D21A 1THXA 3LEFA 3VURA 2QGVA 3IOSA 2HT9A 3F0IA 3G7IA 5AISA 4PQHA 3IRAA 2PVOC 3FRCA 1FO5A 3ZL5A 4K2DA 4MJBA 1YEXA 1B4PA 1EV4A 2B1LA 10GSA 1M2AA 2QKEA 1O81A 1TP9A 2CX3A 1JLVA 4BA7A 3KJYA 2HYXA 2HSYA 3P90A 4J57E 3UARA 1SKRB 5F07A 5INYA 1WOUA 1GUKA 2XHFA 3APSA 13GSA 4CDOA 2WULA 3KP8A 4WKWA 1PKWA 3U5RE 3K8NA 1BJXA 1OKDA 2RM6A 1PRXA 2VD0A 4IBPA 2E7PA 3GN3A 4Q5RA 4MK3A 1LJRA 5G5FA 2PU9C 3D4MA 3QAWA 3RHBA 2DJ2A 1V2AA 5ECSA 2GLRA 2YWOA 4OO5A 3BJ5A 4IP1A 1O8XA 4ZBDA 1AAZA 2VCWA 2H76A 1XZOA 4ZL9A 2L57A 3KTBA 1E6BA 4XHMA 4DEJA 1ON4A 1WE0A 1ZGNA 4KCEA 2IN3A 2PN8A 1AW9A 2HI7A 2DJJA 2D2ZA 4JR4A 2YJHA 1JFUA 3C73A 1A2MA 2PPTA 1OVNA 3QD9A 4FQUA 2CVBA 3R2QA 2HQTA 2JU5A 1I5GA 1GSDA 5IOWA 3BBYA 3WGXA 2F51A 3GKXA 2HSMA 4K6XA 5C04A 1YJ6A 4MJEA 4HU7A 3ERFA 1XWKA 2LRTA 2GQLA 4KSOA 1EOGA 3FW2A 1XIYA 2BTOT 4JBBA 4KX4A 4L0UA 1VGLA 4XS4A 2B5XA 4WR4A 2H6XA 1BQ7A 1Q98A 4V2NA 3TJBA 5B6MA 3FHKA 3FY7A 2AHEA 4MA9A 3M3MA 1M99A 4K9ZA 3F63A 1FHEA 4KDYA 2LKUA 4ZILA 1VF3A 5BMUA 2ON5A 4ACSA 4HJMA 2IMIA 1WIKA 3DMLA 1BG5A 4FIWA 5CAXA 1OC9A 3F9UA 6GSVA 14GSA 3U6VA 3IR4A 1LBKA 3IV4A 4WEYA 4FO5A 1WJKA 2IIYA 3GNJA 2IMEA 3IA1A 2YWNA 4MH2A 2HE3A 6GSXA 3ZVJD 2PERA 3GURA 2X8GA 4JRRA 2FUG2 4F0CA 2RLIA 5H5QA 3TKQA 3TDGA 1TTZA 5JWOB 1SYXA 4KB3A 1OKTA 3VFIA 3A2XA 2F8AA 2JZSA 4OCFA 3TRXA 4ZL7A 3QFAC 1GSFA 4MCUA 3GKNA 5DBQA 3QMXA 5DAKB 3DWVA 4KW6A 5B7CA 1THOA 3EINA 4PNFA 5DCGA 4TR0A 5ID2A 4PQ1A 1TK5B 2YP6A 1PSQA 4POLA 3QAVA 2JADA 4Z7XA 4EUYA 5G1LA 1XOAA 3O76A 2KP2A 1R4WA 4AJ6A 1HQOA 5CRGA 4IKHA 3DGQA 2C4JA 3ED3A 2VL2C 1YZXA 4OD7A 4EF0A 2FWGA 1FB6A 2YWIA 1XVWA 2H73A 2RUFA 2H1DA 1BAYA 2I4AA 3GTUB 4QL7A 4WF4A 1GULA 3D4TA 3IK7A 5GAPD 4YQVA 4KAEA 3NIVA 3KH9A 4X0XA 2C3QA 4MMMA 1BX9A 3CMIA 4XS6A 8GSSA 4XRAA 2XPDA 3FZ4A 4TXOB 1TOFA 4AF2A 3UL3A 1V98A 2A2SA 4IP6A 3WGDA 1GWCA 2LUSA 1PX7A 3ZITA 3LG6A 3UEMA 1A2LA 1G6YA 3GTUA 4LLRA 2GZYA 5HFKA 2L5LA 5GSTA 2CA8A 4WBJA 5IMFA 1CQGA 3F3RA 4ECBA 2GSSA 2R4VA 5B6NA 3DVXA 2MBTA 3KMNA 4Q5FA 1T8EB 2M80A 2H1GA 2HRFA 2K8VA 3KH7A 5D8IA 4K8MA 1DE1A 2LTKA 1BEDA 3Q18A 2ZNMA 2VD1A 4EDZA 3ZMKA 1GLPA 4OMVA 3M9KA 4N10A 4AJ8A 2LJRA 3UBKA 1JZOA 5CYYA 2LQQA 2TRCP 1DE2A 3GH6A 4WBRD 1M2DA 4IHUA 1B48A 1GSQA 1ERWA 1F3BA 1NHOA 2XBIA 5JCWA 3HD5A 3O6TA 4JU5A 2PGTA 3AY8A 3I69A 7GSSA 17GSA 4IVFA 4GCIA 1Y25A 1C72A 1V57A 3DXBA 4KNDA 3DEXA 3TKSA 4O7HA 2VCTA 4KCAA 3C1SA 4POBA 5DALA 1GSYA 3FEUA 4BVXA 2VCXA 5AIXA 2E2MA 2CVDA 2DBCA 4TR3A 5G5EA 4HS1A 2LEGA 1PQNA 2CVKA 2R2JA 2WRTA 1BYEA 2XC2A 3HZ4A 4POMA 4BWSA 1GTIA 2DMMA 3GRXA 1HNAA 3HY2A 3GSTA 2I1UA 2G0FA 4TKYA 5F8BA 2GS3A 2VOCA 5ABRA 1XW6A 3HXSA 3QOUA 3DKSA 5GZZB 1V9WA 1U3IA 3UBLA 4YAPA 3MDKA 3LFLA 1ERUA 4P3YB 2GZPA 2IJYA 2O87A 3GMFA 5IMZA 2KUCA 1RK4A 2WS2A 2ZUPA 5LNKe 2DLXA 1XOBA 4HEA2 1T1VA 3FK8A 1PL2A 1AQXA 2B7JA 4E8HA 2A4VA 3UJ1A 2TIRA 1A0RP 2PMTA 3LYKA 2V6OA 5ECRB 2IWTA 2VAFA 4WF5A 4ML1A 2H1AA 5A4UA 3J7Yk 2HZEA 2KP1A 4V2MA 1MD3A 1M2BA 4EE0A 5JWQB 3F4RA 5IMAA 4NAXA 2EIRA 2Z9SA 3GUSA 2GGTA 2BMXA 1ERTA 1ACVA 3ZVJA 1SJIA 1F3AA 1SKSB 4D73B 2OJLA 1AQWA 2RM5A 5CRWA 4GRFA 2AB6A 3ME8A 1YKAA 2HLSA 2H01A 5ECOB 5HR3A 4CW9A 4TRXA 2YPMA 4NWYA 1NM3A 5HQPA 1OAZA 2GTUA 6GSWA 4I97A 2H1BA 4MPFA 3G7YA 3IAM2 2ES7A 3HVSA 5G2ZA 4RUVA 5D9VA 11GSA 1QGVA 3DRNA 4D73A 1M9AA 2OBIA 1ERVA 2JSYA 2MYGA 5IPHA 4I5QA 4WR5A 4HZ2A 4FYCA 2C0FA 2WJUA 3UAPA 5EVOA 4HOJA 3LXZA 3F8UA 1X5EA 1IYIA 1Y6EA 1Z5YE 2BJXA 1Z9HA 3WD6A 1SK2A 1ZOFA 4POKA 1EZKA 2E2GA 3RBTA 2R6KA 3MAKA 2VLUA 3ZLPA 1R7HA 2VCZA 3L0HA 4TN8A 3CRUA 1ML6A 4CHSA 2ZCTA 3UOMA 4MJCA 4TVEA 1PD21 2P31A 1Z6MA 3CSHA 4MF6A 2GDRA 2C1YA 1DBYA 4YQUA 3FZ5A 4WXTA 4YAVA 2VM2A 5B8BA 2B6MA 3BOAA 1HYUA 2GVPA 1NW2A 3S9FA 4MLYA 2VL9A 1AXDA 1GNEA 2FA4A 4EXJA 2FGXA 3KD0A 5J41A 2CV4A 2MBSA 2VUPA 1X9WB 4G0IA 1FAAA 2A2RA 5ECLB 5D93A 3UVTA 2ON7A 4I2UA 4LA1A 4KA0A 3EMXA 2H75A 3VWXA 3DD3A 1EEMA 1JLWA 2AUVA 2V41A 5CP1A 4G0LA 1LU4A 1ILOA 1QFNA 4NPBA 5KN2A 4ZL8A 3KP9A 2H72A 1SL1B 4OO4A 4F0BA 4I6XA 3Q74A 3W8SA 4LMWA 2LJAA 5ENUA 3QFBC 4MZCA 1A0FA 1K0BA 3MNGA 1XWAA 2RUEA 22GSA 4HDEA 3ZREA 1CQHA 1PN9A 1MEKA 5J9CA 2K8SA 1EGOA 3PPUA 1TI1A 5IIZA 18GSA 2MMZA 2VLVA 2I3YA 4TOPA 5B8AA 4OWYA 2NVLA 1HNBA 1WP0A 1ZL9A 3EC3A 1WPIA
chains in the Genus database with same CATH superfamily
2XPEA 4DSRA 1AQVA 1O8WA 1M7TA 3TU3B 1K3OA 2I81A 3D22A 3C8EA 1T4YA 4G2EA 1TDIA 1YEPA 4PUAA 3QPMA 1MDKA 3ZFBA 5J47A 4ECCA 2L6CA 1FB0A 4ZXGA 4IELA 1GP1A 2KOKA 1USBA 2X99A 4XCSA 4AKXB 1PL1A 3HCZA 4DSQA 3C7MA 1G6WA 2A2PA 1TU8A 1A8LA 5KN1A 1TXUA 4O5RA 2B3SA 4LL1B 3PH9A 3C1RA 4GWRA 4ZIJA 3A5WA 3KTLA 5KN3A 2YN1A 3HVXA 1R5AA 2WZSA 1X5DA 1A8YA 3OR5A 3I43A 3BCIA 4F2IA 1KNGA 2LSTA 5ECHB 4DSSB 5IO0A 4K5RA 2H0IA 1PX6A 3MYDA 2N5AA 1ZYEA 3W6GA 2MMNA 2YOIA 1FOHA 5E59A 4H86A 2GQKA 4F9ZA 2O7KA 3FR3A 5DAKA 4OFNA 2X49A 4ZB8A 5J3RA 1JZDA 3FZ9A 3ZIJA 3MWHA 1JHBA 1XWGA 3GA4A 2AV4A 3F4TA 2VL3A 2OE1A 2DJ0A 1N2AA 1OE7A 2VLTA 3E3EA 2N5BA 5LD0A 1SENA 2DIYA 2X64A 1MD4A 1QQ2A 1SKWB 1YF1A 2L5OA 3H8QA 3E0UA 4WETA 4DSSA 2HSNB 4KUNA 1G7EA 1Z7PA 1Q4JA 1J9BA 3CRTA 3ERWA 2PBJA 1QK8A 9GSSA 2V6KA 1SU9A 4JR6A 2K9FA 3LGCA 5G30A 1GUMA 3KGKA 3HVNA 1XCCA 4K0GA 4V1Ap 2HRKB 1TRSA 2GZZA 6GSSA 2YWMA 4TXOA 3D0ZA 1U88A 1T00A 4F03A 4MZBA 4MF7A 1S4BP 3HDCA 4EDYA 2GT6A 3LXTA 4G9HA 2DJ3A 2FCHA 2AYTA 2XBQA 2CT6A 3HYPA 4HI7A 2O3EA 3EWLA 4GQCA 2ALBA 3F4SA 5KOWA 1W89A 3G9BA 3HKRA 2L4CA 1X9SB 4L8EA 1M0UA 2YANA 5FWGA 1A24A 2NTOA 6GSTA 2IFQB 2VM1A 3A2VA 3EU3A 5D9XA 3GL5A 4BPYA 4MPGA 3Q6OA 2YZUA 3LQ7A 3HZ8A 4EL1A 1TRVA 4QQ7A 1U87A 1SJZA 2FWHA 1EP7A 3GKKA 4BL7B 2V32A 1O6JA 1AUCA 4I2TA 3IC8A 2QSIA 2LV3A 2B5EA 3VWUA 3H79A 5EY6A 1XXUA 5EL8A 1EEJA 2J9HA 4O92A 3UMAA 4K7NA 1RW1A 4O32A 1FVKA 2F9SA 3UVHA 1XFLA 3WYWA 1PA3A 2F3MA 2UZ8A 3KZQA 4JE1A 2KHPA 3ZZXA 5IM9A 3EVIA 4Q5NA 2DJ1A 1UN2A 5CO3A 4N30A 3LSZA 1SD8A 1F2EA 2UV8G 1XW9A 3TUEA 2EFDA 2NDOA 4NMUA 3I6AA 2HFDA 1GL8A 2JACA 4XS1A 4FH8A 3TJKA 4G0KA 3CYNA 4ECJA 2WVYA 3TKPA 4IW9A 4TR1B 3M0FA 5AN1A 1TKDB 1XWBA 2PWJA 2WB9A 3TJGA 3CTFA 3VK9A 4MABA 5FHIA 2TRXA 3TKSE 3H1NA 5ECMB 4HQSA 5HR0A 3ISOA 3IK9A 2DJKA 5C00A 2FY6A 2NBSA 4CY8A 1PN0A 2EIOA 3GIXA 4HU9A 4PGTA 2V2GA 1MDIA 1SJ6A 4BVYB 1YY7A 3EMPA 4MH3A 2MMAA 4TR1A 1N8JA 3GV1A 5ECKB 2YJ7A 1YF0A 2QC7A 2G2QA 2B7KA 3RGBC 5G31A 1A2JA 4FYBA 4NV2A 2O8VB 5J9BA 3H4KA 2LNTA 5DVBA 1WWJA 1O85A 2OA7A 1Z3EA 3NZNA 5LCZA 4GQFA 2P5RA 5A4WA 3LW9A 1FW1A 3FKFA 3APOA 4HUAA 2CAIA 3L4NA 2HRAA 3KXOA 4L0WA 4PI2C 4KH7A 4GTUA 1K0AA 1M3IA 4QL9A 1T7PB 3ZMLA 2O85A 3WGEA 4J56E 3IE3A 2FA8A 2H71A 1TRUA 1SVMA 2M72A 1I9DA 2OACA 5JCUA 3ZIVA 4OFMA 1Z6NA 3BD2A 1FVJA 4RI6A 2YCDA 1ZYPA 3CTGA 5ECQB 1T4ZA 3H93A 3HMJG 1MDJA 5EPFA 4AI6A 2AJQB 3TKSC 1ABAA 4OFTA 1YQ1A 1YDKA 3R3EA 2NPBA 1EP8A 3BCKA 2GSRA 1S3DA 4G19A 4XRDA 3TKRA 3ZRDA 3A3TA 4EO3A 4NV5A 2O5VA 4PNGA 4E8EA 2KLXA 2H6YA 2H66A 4MDCA 4KDXA 3FZAA 1RQMA 1UA5A 2WCIA 4IJIA 4TXVA 3GX0A 5IMCA 2GQMA 3WT1A 3PINA 4G10A 2DSAA 1K3YA 2FD3A 1QUWA 3RPPA 3RPNA 1SL0B 1Z7RA 4J2FA 2L59A 2H19A 1GUHA 1KEBA 2WW1A 4ISDA 2H6ZA 2YV7A 3RFRC 4PQIA 4AJ7A 3N9JA 4N11A 2L6DA 3C71A 4E68A 1VF4A 3TRPA 3ME7A 1N25A 2DIZA 4K7OA 1GTAA 2R0CA 2HSMB 4ID0A 5DCHA 4ULXA 2V1MA 3WT2A 1TXXA 1GRXA 4KE3A 1SD9A 2DMLA 1I1IP 2WGRA 1UC7A 2HNLA 4K2XA 3GX8A 3ZTLA 2VL2A 1S3AA 5AGYA 4XTSA 4N0VA 4PXOA 1K0DA 4MP4A 2OKAA 3FR9A 1F6MC 2P0GA 4ZBAA 3KEBA 4XS4B 5DJMA 2EC4A 3EURA 2FHEA 1B9XC 4IJ3A 2H8LA 2H30A 4KGIA 5KEJA 2H0HA 3ZYWA 4O5QA 3EU4A 3RAZA 5CNWA 1OE8A 5H5SA 5IMVA 3HJOA 5COHA 4IS0A 4XIHA 1M3JA 2OE3A 5AIVA 4FYUA 2GT5A 4K1FA 3FMWA 3L9UA 4YH2A 3JCML 3E9JB 3HA9A 3KM6A 1EGRA 2M46A 1SL2B 5F06A 2E0QA 2VIMA 2IMFA 1OC9B 5DDLA 3HVVA 1AC1A 1GH2A 5ECIB 2B1KA 3IDVA 4MJAA 3VPQA 4NHWA 1O7UA 2FLSA 1A23A 1EOHA 5ELAA 3QAGA 5D73A 1H75A 3RDWA 3ERGA 2CQ9A 2H0GA 4EIPA 5ECPB 5A5KA 3HJMA 4DVCA 5JCGA 2IPAA 5A5HB 1NHYA 1DUGA 2WW0A 1K0MA 3HHVA 3W8JA 3VPTA 3IAS2 4EIQA 4HZ4A 3IPZA 4TR4A 2C0EA 1HD2A 5CRHA 3KCMA 2RIIA 5ID2B 2C3NA 3CXGA 3L78A 1M9BA 4PX1A 2R5GA 2H74A 5D9TA 3L9SA 1H4OA 3LYPA 5CRDA 2CAQA 1WRYA 2YNXA 3F6FA 2R37A 3DIEA 1SK1A 3VLNA 4GLTA 3D5JA 1XPVA 1R5PA 2LRCA 1G7OA 4ML6A 3QDNA 3TB2A 1HNCA 4IQ1A 1V58A 2HXKA 2FWFA 4RQXA 1J0FA 2MMOA 3Q19A 3KIJA 5ECNB 3QCPA 1GNWA 3F6DA 3GHAA 3HJPA 2F8FA 2LS5A 2MZCA 3DVWA 1ZMAA 4JZQA 5IPGA 3D6IA 3KMOA 1K3LA 2GSQA 5HFGA 2C3TA 5D96A 1MTCA 4GXZA 3TCOA 2WDUA 4KSMA 2I9HA 4V1Ag 5JWRB 2K6VA 2J23A 3CSIA 2OADA 3V1WA 1WMJA 3M9JA 2X4AA 2R0GA 5HR1A 5HR2A 1X5CA 4I8BA 4IN0A 1K0NA 1X0RA 5DQSA 4L5OA 1S3CA 2OBKA 2FNOA 2JL4A 4PURA 5DQYA 1EV9A 4EC0A 12GSA 3GSSA 4QMKA 3SBCA 5E4WA 4KDUA 1SYRA 3LJRA 1QMVA 3TJJA 5J5NA 1JZRA 4KF9A 3LWAA 4USSA 1XW5A 1B8XA 1NSWA 2VCVA 2C80A 5L71A 4GF0A 4ILFA 4K7IA 3IBHA 4F82A 4PUFC 19GSA 1JZWA 4RI7A 1ZCPA 2REMA 4Z2RA 2CZ3A 1F37A 4K0NA 4EKZA 1T3BA 2C8UA 1QXHA 4ZB7A 3VWWA 1AIUA 1PGTA 2HSNA 4GSSA 2LRNA 5FT3A 2FWEA 5D9WA 2EIQA 2QA1A 3PGTA 2P5QA 4RQRA 4BIKA 5IMDA 2PVQA 3DYRA 4HJ2A 1GSEA 4NXIA 4ECIA 2N5FA 2VCQA 3F3QA 2HRKA 4PI0C 1TU7A 1PKZA 4OCEA 1FOVA 2X8CA 2H1LA 1URMA 1XWCA 2OE0A 5J4UA 3EE2A 1GSUA 1OC3A 5A34B 3UIWA 3RHCA 1VF1A 2WZ9A 4V2LA 4IGJA 4MF5A 5DALB 5A4VA 4BVXB 4YQMA 1B4QA 1IYHA 20GSA 4L5LA 4BWQA 1BG1A 3NOFA 3VI5A 2VO4A 1ZZYA 2YZHA 3CBUA 2LQOA 3G7JA 1GTBA 1YKCA 3MSZA 3GL3A 3M8NA 3FYGA 1EWXA 2EFCA 3PR8A 4EVMA 2LNSA 2IFQA 3IXRA 2CZ2A 1J08A 4ZB9A 1OC8A 2X8HA 1ZYQB 5ELGA 5A34A 5CREA 2GSTA 2B5YA 3VI7A 3US3A 2PUKC 4ICYA 1KTEA 3APQA 1KBNA 4BL7A 3M1GA 1XBSA 1TK8B 5KN0A 1GSSA 2HZFA 1R26A 1TRWA 3FR6A 2O36A 1UVZA 4K5SA 4GSNA 1PMTA 1K0OA 3IHQA 2R3XA 4GSTA 4GDFA 3ZFLA 2LJKA 5IO2A 1SK0A 3GFKA 1TJDA 5J4VA 1FG4A 2JZRA 5H5RA 4TW5A 3GYKA 1U3AA 4NHZA 2H70A 3QR6A 5F05A 2HSHA 2IMDA 1ST9A 2AAWA 3LORA 1X9MB 2JSZA 3L9VA 2C0GA 5F0GA 2IMKA 4X1UA 2WFCA 4ZB6A 1GTUA 2HZEB 4PTSA 3SWLA 5BRTA 2HRNA 1K0CA 3EYTA 5IQYA 3GKMA 5G1KA 3GH9A 2IL3A 1B9YC 1TK0B 3CSJA 1DSBA 2DC5A 4AGSA 4HQZA 3TRQA 4LMVA 3TJFA 3I9V2 5HFIA 4IQAA 6GSUA 4G01A 3A2WA 1F9MA 1E2YA 4X43A 5GAND 4Q5QA 2JZTA 3TOTA 4LL4B 1W4VA 2O89A 16GSA 3P8WA 1V40A 2WVZA 4BVYA 1TW9A 1GLQA 2YV9A 3TOUA 2CX4A 4ZBBA 5IOXA 4MZWA 3P2AA 3O3TA 3J7Yb 3VWVA 1U6TA 3IHGA 6GSYA 3TGZA 3P7XA 1VRSD 4N0ZA 2C0DA 1OYJA 1TI3A 4Z2TA 1O73A 1XVQA 2K18A 4JEDA 3IC4A 1VF2A 5DJLA 2L4QA 3N5OA 1G0TA 4HSCX 2DKHA 5GSSA 3D21A 1THXA 3LEFA 3VURA 2QGVA 3IOSA 2HT9A 3F0IA 3G7IA 5AISA 4PQHA 3IRAA 2PVOC 3FRCA 1FO5A 3ZL5A 4K2DA 4MJBA 1YEXA 1B4PA 1EV4A 2B1LA 10GSA 1M2AA 2QKEA 1O81A 1TP9A 2CX3A 1JLVA 4BA7A 3KJYA 2HYXA 2HSYA 3P90A 4J57E 3UARA 1S3RA 1SKRB 5F07A 5INYA 1WOUA 1GUKA 3CWGA 2XHFA 13GSA 3APSA 4CDOA 2WULA 3KP8A 4WKWA 1PKWA 3U5RE 3K8NA 1BJXA 1OKDA 2RM6A 1PRXA 2VD0A 4IBPA 2E7PA 3GN3A 4Q5RA 4MK3A 1LJRA 5G5FA 2PU9C 3D4MA 3QAWA 3RHBA 2DJ2A 1V2AA 5ECSA 2GLRA 2YWOA 4OO5A 3BJ5A 4IP1A 1O8XA 4ZBDA 1AAZA 2VCWA 2H76A 1XZOA 1ZYNA 4ZL9A 2WVXB 2L57A 3KTBA 1E6BA 4XHMA 4YKGA 4DEJA 1ON4A 1WE0A 1ZGNA 4KCEA 2IN3A 2PN8A 1AW9A 2HI7A 2DJJA 2D2ZA 4JR4A 2YJHA 1JFUA 3C73A 1A2MA 2PPTA 1OVNA 3QD9A 4FQUA 1PFOA 2CVBA 3R2QA 2HQTA 2JU5A 1I5GA 4O5UA 4AKIA 1GSDA 5IOWA 3BBYA 3WGXA 2F51A 3GKXA 2HSMA 4K6XA 5C04A 1YJ6A 4MJEA 2DKIA 4HU7A 3ERFA 5BMUB 1XWKA 2LRTA 2GQLA 2QA2A 5KOXA 4KSOA 1EOGA 3FW2A 1XIYA 2BTOT 4JBBA 4KX4A 2EFEA 1VGLA 3EPTA 4L0UA 4XS4A 2B5XA 4WR4A 2H6XA 1BQ7A 1Q98A 4V2NA 3TJBA 5B6MA 3FHKA 3FY7A 1Y1UA 2AHEA 4MA9A 3M3MA 1M99A 4K9ZA 3F63A 1FHEA 4KDYA 2LKUA 4ZILA 1VF3A 5BMUA 2ON5A 4ACSA 4HJMA 2IMIA 1WIKA 3DMLA 3A5IA 1BG5A 4FIWA 5CAXA 1OC9A 3F9UA 6GSVA 14GSA 3U6VA 1BF5A 3IR4A 1LBKA 3IV4A 4WEYA 1SVLA 4FO5A 1WJKA 2IIYA 3GNJA 2IMEA 3IA1A 2YWNA 4MH2A 2HE3A 6GSXA 3ZVJD 2PERA 3GURA 2X8GA 4JRRA 2FUG2 4F0CA 2RLIA 5H5QA 3TKQA 4N3ZA 3TDGA 4A5PA 1TTZA 5JWOB 1SYXA 4KB3A 1OKTA 4YKFA 3VFIA 3A2XA 2F8AA 2JZSA 4OCFA 5A5HA 3TRXA 4ZL7A 3QFAC 1GSFA 4MCUA 3GKNA 5DBQA 3QMXA 5DAKB 3DWVA 4KW6A 5B7CA 1THOA 3EINA 4PNFA 5DCGA 4TR0A 5ID2A 4PQ1A 1TK5B 2YP6A 1PSQA 4POLA 3QAVA 2JADA 4Z7XA 4EUYA 5G1LA 1XOAA 3O76A 2KP2A 1R4WA 4AJ6A 1HQOA 5CRGA 4IKHA 3DGQA 2C4JA 3ED3A 2VL2C 1YZXA 4OD7A 4EF0A 2FWGA 1FB6A 2YWIA 1XVWA 2H73A 2RUFA 2H1DA 2R0PA 1BAYA 2I4AA 3GTUB 4QL7A 4WF4A 1GULA 3D4TA 3IK7A 5GAPD 4YQVA 4KAEA 3NIVA 3KH9A 4X0XA 2C3QA 4MMMA 1BX9A 3CMIA 4XS6A 8GSSA 4XRAA 2XPDA 3FZ4A 4TXOB 1TOFA 4AF2A 3UL3A 1V98A 2EFHA 2A2SA 4IP6A 3WGDA 1GWCA 2LUSA 1PX7A 3ZITA 3LG6A 4PHZC 3UEMA 5A1NB 1A2LA 3CQFA 1G6YA 3GTUA 4LLRA 5J4YA 2GZYA 5HFKA 2L5LA 5GSTA 2CA8A 4WBJA 5IMFA 1CQGA 3F3RA 3MIXA 4ECBA 2GSSA 2R4VA 5B6NA 3DVXA 2VKZG 2MBTA 3KMNA 4Q5FA 1T8EB 1YEWC 4W66A 2M80A 2H1GA 2HRFA 2K8VA 3KH7A 5D8IA 5A1NA 4K8MA 4X4JA 1DE1A 2LTKA 1BEDA 3Q18A 2ZNMA 2VD1A 4EDZA 3ZMKA 1GLPA 4OMVA 3M9KA 4N10A 4AJ8A 2LJRA 3CHXC 3UBKA 1JZOA 5CYYA 2LQQA 2TRCP 1DE2A 3GH6A 4WBRD 1M2DA 4IHUA 1B48A 1GSQA 1ERWA 1F3BA 1NHOA 2XBIA 5JCWA 3HD5A 3O6TA 4JU5A 2PGTA 3AY8A 3I69A 7GSSA 17GSA 4IVFA 4GCIA 1Y25A 1C72A 1V57A 3DXBA 4KNDA 3DEXA 3TKSA 4O7HA 2VCTA 4KCAA 3C1SA 4POBA 5DALA 1GSYA 3FEUA 4BVXA 2VCXA 5AIXA 2E2MA 2CVDA 2DBCA 4TR3A 5G5EA 4HS1A 2LEGA 1PQNA 2CVKA 2R2JA 2WRTA 1BYEA 2XC2A 3HZ4A 4POMA 4BWSA 1GTIA 2DMMA 3GRXA 1HNAA 3HY2A 3GSTA 2I1UA 2G0FA 4TKYA 5F8BA 2GS3A 2WW3A 2VOCA 5ABRA 1XW6A 3HXSA 3QOUA 3DKSA 5GZZB 1V9WA 1U3IA 3UBLA 4YAPA 3MDKA 3LFLA 1ERUA 4P3YB 2GZPA 2IJYA 2O87A 3GMFA 5IMZA 2KUCA 1RK4A 2WS2A 2ZUPA 5LNKe 2DLXA 1XOBA 4HEA2 1T1VA 3FK8A 1PL2A 1AQXA 2B7JA 4E8HA 2A4VA 3UJ1A 2TIRA 1A0RP 2PMTA 3LYKA 2V6OA 5ECRB 2IWTA 2VAFA 4WF5A 4ML1A 2H1AA 5A4UA 1YVLA 3J7Yk 2HZEA 2KP1A 4V2MA 1MD3A 1M2BA 4EE0A 5JWQB 3F4RA 5IMAA 5J40A 4NAXA 2EIRA 2Z9SA 3GUSA 2GGTA 2BMXA 4MNNA 1ERTA 1ACVA 2WW2A 3ZVJA 1SJIA 1F3AA 1SKSB 4D73B 2OJLA 1AQWA 2RM5A 5CRWA 4GRFA 1SVOA 2AB6A 3ME8A 1YKAA 2HLSA 2H01A 5ECOB 5HR3A 4CW9A 4CY6A 4TRXA 2YPMA 4NWYA 1NM3A 5HQPA 1OAZA 2GTUA 4FXYP 6GSWA 4I97A 2H1BA 4MPFA 3G7YA 3IAM2 2ES7A 3HVSA 5G2ZA 4RUVA 5D9VA 11GSA 1QGVA 3DRNA 4D73A 1M9AA 1XG8A 2OBIA 1ERVA 2OT3A 2JSYA 2MYGA 5IPHA 4I5QA 4WR5A 4HZ2A 4FYCA 2C0FA 2WJUA 3UAPA 5EVOA 4HOJA 3LXZA 3F8UA 1X5EA 1IYIA 1Y6EA 1Z5YE 2BJXA 1Z9HA 3WD6A 1SK2A 1ZOFA 4POKA 1EZKA 2E2GA 3RBTA 2R6KA 3MAKA 2VLUA 3ZLPA 1R7HA 2VCZA 3L0HA 4TN8A 3CRUA 1ML6A 4CHSA 2ZCTA 3UOMA 4MJCA 4TVEA 1PD21 2P31A 4Z2UA 1Z6MA 3CSHA 4MF6A 2GDRA 2C1YA 1DBYA 4YQUA 3FZ5A 4WXTA 4YAVA 2VM2A 5B8BA 2B6MA 3BOAA 1HYUA 2GVPA 1NW2A 3S9FA 4MLYA 2VL9A 1AXDA 1GNEA 2FA4A 4EXJA 2FGXA 3KD0A 5J41A 2CV4A 2MBSA 2VUPA 1X9WB 4G0IA 1FAAA 2A2RA 5ECLB 5D93A 3UVTA 2ON7A 4I2UA 4LA1A 4KA0A 2WVXA 3EMXA 2H75A 3VWXA 3DD3A 1EEMA 1JLWA 2AUVA 4AKGA 2V41A 5CP1A 4G0LA 1LU4A 1ILOA 1QFNA 4NPBA 5KN2A 2A4HA 4ZL8A 3KP9A 2H72A 1SL1B 4OO4A 4F0BA 4I6XA 3Q74A 4AKHA 3W8SA 4LMWA 2LJAA 5ENUA 3QFBC 4MZCA 1A0FA 1K0BA 3MNGA 1XWAA 2RUEA 22GSA 4HDEA 3ZREA 1CQHA 1PN9A 1MEKA 5J9CA 2K8SA 1EGOA 3PPUA 1TI1A 5IIZA 18GSA 2MMZA 2VLVA 2I3YA 4TOPA 5B8AA 4OWYA 2NVLA 1HNBA 1WP0A 1ZL9A 3EC3A 1WPIA
chains in the Genus database with same CATH topology
2XPEA 4DSRA 1AQVA 1O8WA 1M7TA 3TU3B 1K3OA 2I81A 3D22A 3C8EA 1T4YA 4G2EA 1TDIA 1YEPA 4PUAA 3QPMA 1MDKA 3ZFBA 5J47A 4ECCA 2L6CA 1FB0A 4ZXGA 4IELA 1GP1A 2KOKA 1USBA 2X99A 4XCSA 4AKXB 1PL1A 3HCZA 4DSQA 3C7MA 1G6WA 2A2PA 1TU8A 1A8LA 5KN1A 1TXUA 4O5RA 2B3SA 4LL1B 3PH9A 3C1RA 4GWRA 4ZIJA 3A5WA 3KTLA 5KN3A 2YN1A 3HVXA 1R5AA 1X5DA 1A8YA 3OR5A 3I43A 3BCIA 4F2IA 1KNGA 2LSTA 5ECHB 4DSSB 5IO0A 4K5RA 2H0IA 1PX6A 3MYDA 2N5AA 1ZYEA 3W6GA 2MMNA 2YOIA 1FOHA 5E59A 4H86A 2GQKA 4F9ZA 2O7KA 3FR3A 5DAKA 4OFNA 2X49A 4ZB8A 5J3RA 1JZDA 3FZ9A 3ZIJA 3MWHA 1JHBA 1XWGA 3GA4A 2AV4A 3F4TA 2VL3A 2OE1A 2DJ0A 1N2AA 1OE7A 2VLTA 3E3EA 2N5BA 5LD0A 1SENA 2DIYA 2X64A 1MD4A 1QQ2A 1SKWB 1YF1A 2L5OA 3H8QA 3E0UA 4WETA 4DSSA 2HSNB 4KUNA 1G7EA 1Z7PA 1Q4JA 1J9BA 3CRTA 3ERWA 2PBJA 1QK8A 9GSSA 2V6KA 1SU9A 4JR6A 2K9FA 3LGCA 5G30A 1GUMA 3KGKA 1XCCA 4K0GA 4V1Ap 2HRKB 1TRSA 2GZZA 6GSSA 2YWMA 4TXOA 3D0ZA 1U88A 1T00A 4F03A 4MZBA 4MF7A 3HDCA 4EDYA 2GT6A 3LXTA 4G9HA 2DJ3A 2FCHA 2AYTA 2XBQA 2CT6A 3HYPA 4HI7A 3EWLA 4GQCA 2ALBA 3F4SA 5KOWA 1W89A 3G9BA 3HKRA 2L4CA 1X9SB 4L8EA 1M0UA 2YANA 5FWGA 1A24A 2NTOA 6GSTA 2IFQB 2VM1A 3A2VA 3EU3A 5D9XA 3GL5A 4BPYA 4MPGA 3Q6OA 2YZUA 3LQ7A 3HZ8A 4EL1A 1TRVA 4QQ7A 1U87A 1SJZA 2FWHA 1EP7A 3GKKA 4BL7B 2V32A 1O6JA 1AUCA 4I2TA 3IC8A 2QSIA 2LV3A 2B5EA 3VWUA 3H79A 5EY6A 1XXUA 5EL8A 1EEJA 2J9HA 4O92A 3UMAA 4K7NA 1RW1A 4O32A 1FVKA 2F9SA 3UVHA 1XFLA 3WYWA 1PA3A 2F3MA 2UZ8A 3KZQA 4JE1A 2KHPA 3ZZXA 5IM9A 3EVIA 4Q5NA 2DJ1A 1UN2A 5CO3A 4N30A 3LSZA 1SD8A 1F2EA 2UV8G 1XW9A 3TUEA 2EFDA 2NDOA 4NMUA 3I6AA 2HFDA 1GL8A 2JACA 4XS1A 4FH8A 3TJKA 4G0KA 3CYNA 4ECJA 3TKPA 4IW9A 4TR1B 3M0FA 5AN1A 1TKDB 1XWBA 2PWJA 2WB9A 3TJGA 3CTFA 3VK9A 4MABA 5FHIA 2TRXA 3TKSE 3H1NA 5ECMB 4HQSA 5HR0A 3ISOA 3IK9A 2DJKA 5C00A 2FY6A 2NBSA 4CY8A 1PN0A 2EIOA 3GIXA 4HU9A 4PGTA 2V2GA 1MDIA 1SJ6A 4BVYB 1YY7A 3EMPA 4MH3A 2MMAA 4TR1A 1N8JA 3GV1A 5ECKB 2YJ7A 1YF0A 2QC7A 2G2QA 2B7KA 5G31A 1A2JA 4FYBA 4NV2A 2O8VB 5J9BA 3H4KA 2LNTA 5DVBA 1WWJA 1O85A 2OA7A 1Z3EA 3NZNA 5LCZA 4GQFA 2P5RA 5A4WA 3LW9A 1FW1A 3FKFA 3APOA 4HUAA 2CAIA 3L4NA 2HRAA 3KXOA 4L0WA 4KH7A 4GTUA 1K0AA 4QL9A 1T7PB 3ZMLA 2O85A 3WGEA 4J56E 3IE3A 2FA8A 2H71A 1TRUA 1SVMA 2M72A 1I9DA 2OACA 5JCUA 3ZIVA 4OFMA 1Z6NA 3BD2A 1FVJA 4RI6A 2YCDA 1ZYPA 3CTGA 5ECQB 1T4ZA 3H93A 3HMJG 1MDJA 5EPFA 4AI6A 2AJQB 3TKSC 1ABAA 4OFTA 1YQ1A 1YDKA 3R3EA 2NPBA 1EP8A 3BCKA 2GSRA 1S3DA 4G19A 4XRDA 3TKRA 3ZRDA 3A3TA 4EO3A 4NV5A 2O5VA 4PNGA 4E8EA 2KLXA 2H6YA 2H66A 4MDCA 4KDXA 3FZAA 1RQMA 1UA5A 2WCIA 4IJIA 4TXVA 3GX0A 5IMCA 2GQMA 3WT1A 3PINA 4G10A 2DSAA 1K3YA 2FD3A 1QUWA 3RPPA 3RPNA 1SL0B 1Z7RA 4J2FA 2L59A 2H19A 1GUHA 1KEBA 4ISDA 2H6ZA 2YV7A 4PQIA 4AJ7A 3N9JA 4N11A 2L6DA 3C71A 4E68A 1VF4A 3TRPA 3ME7A 1N25A 2DIZA 4K7OA 1GTAA 2R0CA 2HSMB 4ID0A 5DCHA 4ULXA 2V1MA 3WT2A 1TXXA 1GRXA 4KE3A 1SD9A 2DMLA 2WGRA 1UC7A 2HNLA 4K2XA 3GX8A 3ZTLA 2VL2A 1S3AA 5AGYA 4XTSA 4N0VA 4PXOA 1K0DA 4MP4A 2OKAA 3FR9A 1F6MC 2P0GA 4ZBAA 3KEBA 4XS4B 5DJMA 2EC4A 3EURA 2FHEA 1B9XC 4IJ3A 2H8LA 2H30A 4KGIA 5KEJA 2H0HA 3ZYWA 4O5QA 3EU4A 3RAZA 5CNWA 1OE8A 5H5SA 5IMVA 3HJOA 5COHA 4IS0A 4XIHA 2OE3A 5AIVA 4FYUA 2GT5A 4K1FA 3FMWA 3L9UA 4YH2A 3JCML 3E9JB 3HA9A 3KM6A 1EGRA 2M46A 1SL2B 5F06A 2E0QA 2VIMA 2IMFA 1OC9B 5DDLA 3HVVA 1AC1A 1GH2A 5ECIB 2B1KA 3IDVA 4MJAA 3VPQA 4NHWA 1O7UA 2FLSA 1A23A 1EOHA 5ELAA 3QAGA 5D73A 1H75A 3RDWA 3ERGA 2CQ9A 2H0GA 4EIPA 5ECPB 5A5KA 3HJMA 4DVCA 5JCGA 2IPAA 5A5HB 1NHYA 1DUGA 1K0MA 3HHVA 3W8JA 3VPTA 3IAS2 4EIQA 4HZ4A 3IPZA 4TR4A 2C0EA 1HD2A 5CRHA 3KCMA 2RIIA 5ID2B 2C3NA 3CXGA 3L78A 1M9BA 4PX1A 2R5GA 2H74A 5D9TA 3L9SA 1H4OA 3LYPA 5CRDA 2CAQA 1WRYA 2YNXA 3F6FA 2R37A 3DIEA 1SK1A 3VLNA 4GLTA 3D5JA 1XPVA 1R5PA 2LRCA 1G7OA 4ML6A 3QDNA 3TB2A 1HNCA 4IQ1A 1V58A 2HXKA 2FWFA 4RQXA 1J0FA 2MMOA 3Q19A 3KIJA 5ECNB 3QCPA 1GNWA 3F6DA 3GHAA 3HJPA 2F8FA 2LS5A 2MZCA 3DVWA 1ZMAA 4JZQA 5IPGA 3D6IA 3KMOA 1K3LA 2GSQA 5HFGA 2C3TA 5D96A 1MTCA 4GXZA 3TCOA 2WDUA 4KSMA 2I9HA 4V1Ag 5JWRB 2K6VA 2J23A 3CSIA 2OADA 3V1WA 1WMJA 3M9JA 2X4AA 2R0GA 5HR1A 5HR2A 1X5CA 4I8BA 4IN0A 1K0NA 1X0RA 5DQSA 4L5OA 1S3CA 2OBKA 2FNOA 2JL4A 4PURA 5DQYA 1EV9A 4EC0A 12GSA 3GSSA 4QMKA 3SBCA 5E4WA 4KDUA 1SYRA 3LJRA 1QMVA 3TJJA 5J5NA 1JZRA 4KF9A 3LWAA 4USSA 1XW5A 1B8XA 1NSWA 2VCVA 2C80A 5L71A 4GF0A 4ILFA 4K7IA 3IBHA 4F82A 4PUFC 19GSA 1JZWA 4RI7A 1ZCPA 2REMA 4Z2RA 2CZ3A 1F37A 4K0NA 4EKZA 1T3BA 2C8UA 1QXHA 4ZB7A 3VWWA 1AIUA 1PGTA 2HSNA 4GSSA 2LRNA 5FT3A 2FWEA 5D9WA 2EIQA 2QA1A 3PGTA 2P5QA 4RQRA 5IMDA 2PVQA 3DYRA 4HJ2A 1GSEA 4NXIA 4ECIA 2N5FA 2VCQA 3F3QA 2HRKA 1TU7A 1PKZA 4OCEA 1FOVA 2X8CA 2H1LA 1URMA 1XWCA 2OE0A 5J4UA 3EE2A 1GSUA 1OC3A 5A34B 3UIWA 3RHCA 1VF1A 2WZ9A 4V2LA 4IGJA 4MF5A 5DALB 5A4VA 4BVXB 4YQMA 1B4QA 1IYHA 20GSA 4L5LA 4BWQA 1BG1A 3NOFA 3VI5A 2VO4A 1ZZYA 2YZHA 3CBUA 2LQOA 3G7JA 1GTBA 1YKCA 3MSZA 3GL3A 3M8NA 3FYGA 1EWXA 2EFCA 3PR8A 4EVMA 2LNSA 2IFQA 3IXRA 2CZ2A 1J08A 4ZB9A 1OC8A 2X8HA 1ZYQB 5ELGA 5A34A 5CREA 2GSTA 2B5YA 3VI7A 3US3A 2PUKC 4ICYA 1KTEA 3APQA 1KBNA 4BL7A 3M1GA 1XBSA 1TK8B 5KN0A 1GSSA 2HZFA 1R26A 1TRWA 3FR6A 1UVZA 4K5SA 4GSNA 1PMTA 1K0OA 3IHQA 2R3XA 4GSTA 4GDFA 3ZFLA 2LJKA 5IO2A 1SK0A 3GFKA 1TJDA 5J4VA 1FG4A 2JZRA 5H5RA 4TW5A 3GYKA 1U3AA 4NHZA 2H70A 3QR6A 5F05A 2HSHA 2IMDA 1ST9A 2AAWA 3LORA 1X9MB 2JSZA 3L9VA 2C0GA 5F0GA 2IMKA 4X1UA 2WFCA 4ZB6A 1GTUA 2HZEB 4PTSA 3SWLA 5BRTA 2HRNA 1K0CA 3EYTA 5IQYA 3GKMA 5G1KA 3GH9A 2IL3A 1B9YC 1TK0B 3CSJA 1DSBA 2DC5A 4AGSA 4HQZA 3TRQA 4LMVA 3TJFA 3I9V2 5HFIA 4IQAA 6GSUA 4G01A 3A2WA 1F9MA 1E2YA 4X43A 5GAND 4Q5QA 2JZTA 3TOTA 4LL4B 1W4VA 2O89A 16GSA 3P8WA 1V40A 4BVYA 1TW9A 1GLQA 2YV9A 3TOUA 2CX4A 4ZBBA 5IOXA 4MZWA 3P2AA 3O3TA 3J7Yb 3VWVA 1U6TA 3IHGA 6GSYA 3TGZA 3P7XA 1VRSD 4N0ZA 2C0DA 1OYJA 1TI3A 4Z2TA 1O73A 1XVQA 2K18A 4JEDA 3IC4A 1VF2A 5DJLA 2L4QA 3N5OA 1G0TA 2DKHA 5GSSA 3D21A 1THXA 3LEFA 3VURA 2QGVA 3IOSA 2HT9A 3F0IA 3G7IA 5AISA 4PQHA 3IRAA 2PVOC 3FRCA 1FO5A 3ZL5A 4K2DA 4MJBA 1YEXA 1B4PA 1EV4A 2B1LA 10GSA 1M2AA 2QKEA 1O81A 1TP9A 2CX3A 1JLVA 4BA7A 3KJYA 2HYXA 2HSYA 3P90A 4J57E 3UARA 1SKRB 5F07A 5INYA 1WOUA 1GUKA 3CWGA 2XHFA 13GSA 3APSA 4CDOA 2WULA 3KP8A 4WKWA 1PKWA 3U5RE 3K8NA 1BJXA 1OKDA 2RM6A 1PRXA 2VD0A 4IBPA 2E7PA 3GN3A 4Q5RA 4MK3A 1LJRA 5G5FA 2PU9C 3D4MA 3QAWA 3RHBA 2DJ2A 1V2AA 5ECSA 2GLRA 2YWOA 4OO5A 3BJ5A 4IP1A 1O8XA 4ZBDA 1AAZA 2VCWA 2H76A 1XZOA 1ZYNA 4ZL9A 2L57A 3KTBA 1E6BA 4XHMA 4YKGA 4DEJA 1ON4A 1WE0A 1ZGNA 4KCEA 2IN3A 2PN8A 1AW9A 2HI7A 2DJJA 2D2ZA 4JR4A 2YJHA 1JFUA 3C73A 1A2MA 2PPTA 1OVNA 3QD9A 4FQUA 2CVBA 3R2QA 2HQTA 2JU5A 1I5GA 4O5UA 4AKIA 1GSDA 5IOWA 3BBYA 3WGXA 2F51A 3GKXA 2HSMA 4K6XA 5C04A 1YJ6A 4MJEA 2DKIA 4HU7A 3ERFA 5BMUB 1XWKA 2LRTA 2GQLA 2QA2A 5KOXA 4KSOA 1EOGA 3FW2A 1XIYA 2BTOT 4JBBA 4KX4A 2EFEA 1VGLA 3EPTA 4L0UA 4XS4A 2B5XA 4WR4A 2H6XA 1BQ7A 1Q98A 4V2NA 3TJBA 5B6MA 3FHKA 3FY7A 1Y1UA 2AHEA 4MA9A 3M3MA 1M99A 4K9ZA 3F63A 1FHEA 4KDYA 2LKUA 4ZILA 1VF3A 5BMUA 2ON5A 4ACSA 4HJMA 2IMIA 1WIKA 3DMLA 3A5IA 1BG5A 4FIWA 5CAXA 1OC9A 3F9UA 6GSVA 14GSA 3U6VA 1BF5A 3IR4A 1LBKA 3IV4A 4WEYA 1SVLA 4FO5A 1WJKA 2IIYA 3GNJA 2IMEA 3IA1A 2YWNA 4MH2A 2HE3A 6GSXA 3ZVJD 2PERA 3GURA 2X8GA 4JRRA 2FUG2 4F0CA 2RLIA 5H5QA 3TKQA 4N3ZA 3TDGA 4A5PA 1TTZA 5JWOB 1SYXA 4KB3A 1OKTA 4YKFA 3VFIA 3A2XA 2F8AA 2JZSA 4OCFA 5A5HA 3TRXA 4ZL7A 3QFAC 1GSFA 4MCUA 3GKNA 5DBQA 3QMXA 5DAKB 3DWVA 4KW6A 5B7CA 1THOA 3EINA 4PNFA 5DCGA 4TR0A 5ID2A 4PQ1A 1TK5B 2YP6A 1PSQA 4POLA 3QAVA 2JADA 4Z7XA 4EUYA 5G1LA 1XOAA 3O76A 2KP2A 1R4WA 4AJ6A 1HQOA 5CRGA 4IKHA 3DGQA 2C4JA 3ED3A 2VL2C 1YZXA 4OD7A 4EF0A 2FWGA 1FB6A 2YWIA 1XVWA 2H73A 2RUFA 2H1DA 2R0PA 1BAYA 2I4AA 3GTUB 4QL7A 4WF4A 1GULA 3D4TA 3IK7A 5GAPD 4YQVA 4KAEA 3NIVA 3KH9A 4X0XA 2C3QA 4MMMA 1BX9A 3CMIA 4XS6A 8GSSA 4XRAA 2XPDA 3FZ4A 4TXOB 1TOFA 4AF2A 3UL3A 1V98A 2EFHA 2A2SA 4IP6A 3WGDA 1GWCA 2LUSA 1PX7A 3ZITA 3LG6A 3UEMA 5A1NB 1A2LA 1G6YA 3GTUA 4LLRA 5J4YA 2GZYA 5HFKA 2L5LA 5GSTA 2CA8A 4WBJA 5IMFA 1CQGA 3F3RA 3MIXA 4ECBA 2GSSA 2R4VA 5B6NA 3DVXA 2VKZG 2MBTA 3KMNA 4Q5FA 1T8EB 4W66A 2M80A 2H1GA 2HRFA 2K8VA 3KH7A 5D8IA 5A1NA 4K8MA 4X4JA 1DE1A 2LTKA 1BEDA 3Q18A 2ZNMA 2VD1A 4EDZA 3ZMKA 1GLPA 4OMVA 3M9KA 4N10A 4AJ8A 2LJRA 3UBKA 1JZOA 5CYYA 2LQQA 2TRCP 1DE2A 3GH6A 4WBRD 1M2DA 4IHUA 1B48A 1GSQA 1ERWA 1F3BA 1NHOA 2XBIA 5JCWA 3HD5A 3O6TA 4JU5A 2PGTA 3AY8A 3I69A 7GSSA 17GSA 4IVFA 4GCIA 1Y25A 1C72A 1V57A 3DXBA 4KNDA 3DEXA 3TKSA 4O7HA 2VCTA 4KCAA 3C1SA 4POBA 5DALA 1GSYA 3FEUA 4BVXA 2VCXA 5AIXA 2E2MA 2CVDA 2DBCA 4TR3A 5G5EA 4HS1A 2LEGA 1PQNA 2CVKA 2R2JA 2WRTA 1BYEA 2XC2A 3HZ4A 4POMA 4BWSA 1GTIA 2DMMA 3GRXA 1HNAA 3HY2A 3GSTA 2I1UA 2G0FA 4TKYA 5F8BA 2GS3A 2VOCA 5ABRA 1XW6A 3HXSA 3QOUA 3DKSA 5GZZB 1V9WA 1U3IA 3UBLA 4YAPA 3MDKA 3LFLA 1ERUA 4P3YB 2GZPA 2IJYA 2O87A 3GMFA 5IMZA 2KUCA 1RK4A 2WS2A 2ZUPA 5LNKe 2DLXA 1XOBA 4HEA2 1T1VA 3FK8A 1PL2A 1AQXA 2B7JA 4E8HA 2A4VA 3UJ1A 2TIRA 1A0RP 2PMTA 3LYKA 2V6OA 5ECRB 2IWTA 2VAFA 4WF5A 4ML1A 2H1AA 5A4UA 1YVLA 3J7Yk 2HZEA 2KP1A 4V2MA 1MD3A 1M2BA 4EE0A 5JWQB 3F4RA 5IMAA 5J40A 4NAXA 2EIRA 2Z9SA 3GUSA 2GGTA 2BMXA 4MNNA 1ERTA 1ACVA 3ZVJA 1SJIA 1F3AA 1SKSB 4D73B 2OJLA 1AQWA 2RM5A 5CRWA 4GRFA 1SVOA 2AB6A 3ME8A 1YKAA 2HLSA 2H01A 5ECOB 5HR3A 4CW9A 4CY6A 4TRXA 2YPMA 4NWYA 1NM3A 5HQPA 1OAZA 2GTUA 6GSWA 4I97A 2H1BA 4MPFA 3G7YA 3IAM2 2ES7A 3HVSA 5G2ZA 4RUVA 5D9VA 11GSA 1QGVA 3DRNA 4D73A 1M9AA 2OBIA 1ERVA 2OT3A 2JSYA 2MYGA 5IPHA 4I5QA 4WR5A 4HZ2A 4FYCA 2C0FA 2WJUA 3UAPA 5EVOA 4HOJA 3LXZA 3F8UA 1X5EA 1IYIA 1Y6EA 1Z5YE 2BJXA 1Z9HA 3WD6A 1SK2A 1ZOFA 4POKA 1EZKA 2E2GA 3RBTA 2R6KA 3MAKA 2VLUA 3ZLPA 1R7HA 2VCZA 3L0HA 4TN8A 3CRUA 1ML6A 4CHSA 2ZCTA 3UOMA 4MJCA 4TVEA 1PD21 2P31A 4Z2UA 1Z6MA 3CSHA 4MF6A 2GDRA 2C1YA 1DBYA 4YQUA 3FZ5A 4WXTA 4YAVA 2VM2A 5B8BA 2B6MA 3BOAA 1HYUA 2GVPA 1NW2A 3S9FA 4MLYA 2VL9A 1AXDA 1GNEA 2FA4A 4EXJA 2FGXA 3KD0A 5J41A 2CV4A 2MBSA 2VUPA 1X9WB 4G0IA 1FAAA 2A2RA 5ECLB 5D93A 3UVTA 2ON7A 4I2UA 4LA1A 4KA0A 3EMXA 2H75A 3VWXA 3DD3A 1EEMA 1JLWA 2AUVA 4AKGA 2V41A 5CP1A 4G0LA 1LU4A 1ILOA 1QFNA 4NPBA 5KN2A 2A4HA 4ZL8A 3KP9A 2H72A 1SL1B 4OO4A 4F0BA 4I6XA 3Q74A 4AKHA 3W8SA 4LMWA 2LJAA 5ENUA 3QFBC 4MZCA 1A0FA 1K0BA 3MNGA 1XWAA 2RUEA 22GSA 4HDEA 3ZREA 1CQHA 1PN9A 1MEKA 5J9CA 2K8SA 1EGOA 3PPUA 1TI1A 5IIZA 18GSA 2MMZA 2VLVA 2I3YA 4TOPA 5B8AA 4OWYA 2NVLA 1HNBA 1WP0A 1ZL9A 3EC3A 1WPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPE A;  4DSR A;  1AQV A;  1O8W A;  1M7T A;  1K3O A;  2I81 A;  3D22 A;  3C8E A;  1T4Y A;  4G2E A;  1TDI A;  1YEP A;  4PUA A;  3QPM A;  1MDK A;  3ZFB A;  4ECC A;  2L6C A;  1FB0 A;  4ZXG A;  4IEL A;  1GP1 A;  2KOK A;  1USB A;  2X99 A;  4XCS A;  1PL1 A;  3HCZ A;  4DSQ A;  3C7M A;  1G6W A;  1TU8 A;  1A8L A;  5KN1 A;  4O5R A;  2B3S A;  4LL1 B;  3PH9 A;  3C1R A;  4GWR A;  4ZIJ A;  3A5W A;  3KTL A;  5KN3 A;  2YN1 A;  3HVX A;  1R5A A;  1X5D A;  1A8Y A;  3OR5 A;  3I43 A;  3BCI A;  4F2I A;  1KNG A;  2LST A;  5ECH B;  4DSS B;  5IO0 A;  2H0I A;  1PX6 A;  2N5A A;  1ZYE A;  3W6G A;  2MMN A;  2YOI A;  5E59 A;  4H86 A;  2GQK A;  4F9Z A;  2O7K A;  3FR3 A;  5DAK A;  4OFN A;  4ZB8 A;  5J3R A;  1JZD A;  3FZ9 A;  3ZIJ A;  3MWH A;  1JHB A;  1XWG A;  3GA4 A;  2AV4 A;  3F4T A;  2VL3 A;  2OE1 A;  2DJ0 A;  1N2A A;  1OE7 A;  2VLT A;  3E3E A;  2N5B A;  5LD0 A;  1SEN A;  2DIY A;  2X64 A;  1MD4 A;  1QQ2 A;  1SKW B;  1YF1 A;  2L5O A;  3H8Q A;  3E0U A;  4WET A;  4DSS A;  2HSN B;  4KUN A;  1G7E A;  1Z7P A;  1Q4J A;  1J9B A;  3CRT A;  3ERW A;  2PBJ A;  1QK8 A;  9GSS A;  2V6K A;  1SU9 A;  4JR6 A;  2K9F A;  3LGC A;  5G30 A;  1GUM A;  3KGK A;  1XCC A;  4K0G A;  4V1A p;  2HRK B;  1TRS A;  2GZZ A;  6GSS A;  2YWM A;  4TXO A;  3D0Z A;  1U88 A;  1T00 A;  4F03 A;  4MZB A;  4MF7 A;  3HDC A;  4EDY A;  2GT6 A;  3LXT A;  4G9H A;  2DJ3 A;  2FCH A;  2AYT A;  2XBQ A;  2CT6 A;  3HYP A;  4HI7 A;  3EWL A;  4GQC A;  2ALB A;  3F4S A;  1W89 A;  3G9B A;  3HKR A;  2L4C A;  1X9S B;  4L8E A;  1M0U A;  2YAN A;  5FWG A;  1A24 A;  2NTO A;  6GST A;  2IFQ B;  2VM1 A;  3A2V A;  3EU3 A;  5D9X A;  3GL5 A;  4BPY A;  4MPG A;  3Q6O A;  2YZU A;  3LQ7 A;  3HZ8 A;  4EL1 A;  1TRV A;  4QQ7 A;  1U87 A;  1SJZ A;  2FWH A;  1EP7 A;  3GKK A;  4BL7 B;  2V32 A;  1O6J A;  1AUC A;  4I2T A;  3IC8 A;  2QSI A;  2LV3 A;  2B5E A;  3VWU A;  3H79 A;  5EY6 A;  1XXU A;  5EL8 A;  1EEJ A;  2J9H A;  4O92 A;  3UMA A;  4K7N A;  1RW1 A;  4O32 A;  1FVK A;  2F9S A;  3UVH A;  1XFL A;  3WYW A;  1PA3 A;  2F3M A;  2UZ8 A;  3KZQ A;  4JE1 A;  2KHP A;  3ZZX A;  5IM9 A;  3EVI A;  4Q5N A;  2DJ1 A;  1UN2 A;  5CO3 A;  4N30 A;  3LSZ A;  1SD8 A;  1F2E A;  1XW9 A;  3TUE A;  2NDO A;  4NMU A;  3I6A A;  2HFD A;  1GL8 A;  2JAC A;  4XS1 A;  4FH8 A;  3TJK A;  4G0K A;  3CYN A;  4ECJ A;  3TKP A;  4IW9 A;  4TR1 B;  3M0F A;  5AN1 A;  1TKD B;  1XWB A;  2PWJ A;  2WB9 A;  3TJG A;  3CTF A;  3VK9 A;  4MAB A;  5FHI A;  2TRX A;  3TKS E;  3H1N A;  5ECM B;  4HQS A;  5HR0 A;  3ISO A;  3IK9 A;  2DJK A;  5C00 A;  2FY6 A;  2NBS A;  2EIO A;  3GIX A;  4HU9 A;  4PGT A;  2V2G A;  1MDI A;  1SJ6 A;  4BVY B;  1YY7 A;  3EMP A;  4MH3 A;  2MMA A;  4TR1 A;  1N8J A;  3GV1 A;  5ECK B;  2YJ7 A;  1YF0 A;  2QC7 A;  2G2Q A;  2B7K A;  5G31 A;  1A2J A;  4FYB A;  4NV2 A;  2O8V B;  5J9B A;  3H4K A;  2LNT A;  5DVB A;  1WWJ A;  1O85 A;  2OA7 A;  1Z3E A;  3NZN A;  5LCZ A;  4GQF A;  2P5R A;  5A4W A;  1FW1 A;  3FKF A;  3APO A;  4HUA A;  2CAI A;  3L4N A;  2HRA A;  3KXO A;  4L0W A;  4KH7 A;  4GTU A;  1K0A A;  4QL9 A;  1T7P B;  3ZML A;  2O85 A;  3WGE A;  4J56 E;  3IE3 A;  2FA8 A;  2H71 A;  1TRU A;  2M72 A;  1I9D A;  2OAC A;  5JCU A;  3ZIV A;  4OFM A;  1Z6N A;  3BD2 A;  1FVJ A;  4RI6 A;  2YCD A;  3CTG A;  5ECQ B;  1T4Z A;  3H93 A;  1MDJ A;  5EPF A;  2AJQ B;  3TKS C;  1ABA A;  4OFT A;  1YQ1 A;  1YDK A;  3R3E A;  2NPB A;  1EP8 A;  3BCK A;  2GSR A;  1S3D A;  4G19 A;  4XRD A;  3TKR A;  3ZRD A;  3A3T A;  4EO3 A;  4NV5 A;  4PNG A;  4E8E A;  2KLX A;  2H6Y A;  2H66 A;  4MDC A;  4KDX A;  3FZA A;  1RQM A;  1UA5 A;  2WCI A;  4IJI A;  4TXV A;  3GX0 A;  5IMC A;  2GQM A;  3WT1 A;  3PIN A;  4G10 A;  2DSA A;  1K3Y A;  2FD3 A;  1QUW A;  3RPP A;  3RPN A;  1SL0 B;  1Z7R A;  4J2F A;  2L59 A;  2H19 A;  1GUH A;  1KEB A;  4ISD A;  2H6Z A;  2YV7 A;  4PQI A;  4AJ7 A;  3N9J A;  4N11 A;  2L6D A;  3C71 A;  1VF4 A;  3TRP A;  3ME7 A;  2DIZ A;  4K7O A;  1GTA A;  2HSM B;  4ID0 A;  5DCH A;  4ULX A;  2V1M A;  3WT2 A;  1TXX A;  1GRX A;  4KE3 A;  1SD9 A;  2DML A;  2WGR A;  1UC7 A;  2HNL A;  3ZTL A;  3GX8 A;  2VL2 A;  1S3A A;  5AGY A;  4XTS A;  4N0V A;  4PXO A;  1K0D A;  4MP4 A;  2OKA A;  3FR9 A;  1F6M C;  2P0G A;  4ZBA A;  3KEB A;  4XS4 B;  5DJM A;  2EC4 A;  3EUR A;  2FHE A;  1B9X C;  4IJ3 A;  2H8L A;  2H30 A;  4KGI A;  5KEJ A;  2H0H A;  3ZYW A;  3EU4 A;  3RAZ A;  5CNW A;  1OE8 A;  5H5S A;  5IMV A;  3HJO A;  5COH A;  4IS0 A;  4XIH A;  2OE3 A;  5AIV A;  4FYU A;  2GT5 A;  4K1F A;  3L9U A;  4YH2 A;  3JCM L;  3E9J B;  3HA9 A;  3KM6 A;  1EGR A;  2M46 A;  1SL2 B;  5F06 A;  2E0Q A;  2VIM A;  2IMF A;  1OC9 B;  5DDL A;  3HVV A;  1AC1 A;  1GH2 A;  5ECI B;  2B1K A;  3IDV A;  4MJA A;  3VPQ A;  4NHW A;  1O7U A;  2FLS A;  1A23 A;  1EOH A;  5ELA A;  3QAG A;  5D73 A;  1H75 A;  3RDW A;  3ERG A;  2CQ9 A;  2H0G A;  5ECP B;  5A5K A;  3HJM A;  4DVC A;  5JCG A;  2IPA A;  1NHY A;  1DUG A;  1K0M A;  3HHV A;  3W8J A;  3VPT A;  3IAS 2;  4HZ4 A;  3IPZ A;  4TR4 A;  2C0E A;  1HD2 A;  5CRH A;  3KCM A;  2RII A;  5ID2 B;  2C3N A;  3CXG A;  3L78 A;  1M9B A;  4PX1 A;  2R5G A;  2H74 A;  5D9T A;  3L9S A;  1H4O A;  3LYP A;  5CRD A;  2CAQ A;  1WRY A;  2YNX A;  3F6F A;  2R37 A;  3DIE A;  1SK1 A;  3VLN A;  4GLT A;  3D5J A;  1XPV A;  1R5P A;  2LRC A;  1G7O A;  4ML6 A;  3QDN A;  3TB2 A;  1HNC A;  4IQ1 A;  1V58 A;  2HXK A;  2FWF A;  4RQX A;  1J0F A;  2MMO A;  3Q19 A;  3KIJ A;  5ECN B;  3QCP A;  1GNW A;  3F6D A;  3GHA A;  3HJP A;  2F8F A;  2LS5 A;  2MZC A;  3DVW A;  1ZMA A;  4JZQ A;  5IPG A;  3D6I A;  3KMO A;  1K3L A;  2GSQ A;  5HFG A;  2C3T A;  5D96 A;  1MTC A;  4GXZ A;  3TCO A;  2WDU A;  4KSM A;  2I9H A;  4V1A g;  5JWR B;  2K6V A;  2J23 A;  3CSI A;  2OAD A;  3V1W A;  1WMJ A;  3M9J A;  5HR1 A;  5HR2 A;  1X5C A;  4I8B A;  4IN0 A;  1K0N A;  1X0R A;  5DQS A;  4L5O A;  1S3C A;  2OBK A;  2FNO A;  2JL4 A;  4PUR A;  5DQY A;  1EV9 A;  4EC0 A;  12GS A;  3GSS A;  3SBC A;  5E4W A;  4KDU A;  1SYR A;  3LJR A;  1QMV A;  3TJJ A;  5J5N A;  1JZR A;  4KF9 A;  3LWA A;  4USS A;  1XW5 A;  1B8X A;  1NSW A;  2VCV A;  2C80 A;  5L71 A;  4GF0 A;  4ILF A;  4K7I A;  3IBH A;  4F82 A;  4PUF C;  19GS A;  1JZW A;  4RI7 A;  1ZCP A;  2REM A;  2CZ3 A;  1F37 A;  4K0N A;  4EKZ A;  1T3B A;  2C8U A;  1QXH A;  3VWW A;  1AIU A;  1PGT A;  4GSS A;  2LRN A;  5FT3 A;  2FWE A;  5D9W A;  2EIQ A;  3PGT A;  2P5Q A;  4RQR A;  5IMD A;  2PVQ A;  3DYR A;  4HJ2 A;  1GSE A;  4NXI A;  4ECI A;  2N5F A;  2VCQ A;  3F3Q A;  2HRK A;  1TU7 A;  1PKZ A;  4OCE A;  1FOV A;  2X8C A;  1URM A;  1XWC A;  2OE0 A;  5J4U A;  3EE2 A;  1GSU A;  1OC3 A;  3UIW A;  3RHC A;  1VF1 A;  2WZ9 A;  4V2L A;  4IGJ A;  4MF5 A;  5DAL B;  5A4V A;  4BVX B;  4YQM A;  1B4Q A;  1IYH A;  20GS A;  4L5L A;  4BWQ A;  3NOF A;  3VI5 A;  2VO4 A;  1ZZY A;  2YZH A;  3CBU A;  2LQO A;  3G7J A;  1GTB A;  1YKC A;  3MSZ A;  3GL3 A;  3M8N A;  3FYG A;  1EWX A;  3PR8 A;  4EVM A;  2LNS A;  2IFQ A;  3IXR A;  2CZ2 A;  1J08 A;  4ZB9 A;  1OC8 A;  2X8H A;  1ZYQ B;  5ELG A;  5CRE A;  2GST A;  2B5Y A;  3VI7 A;  3US3 A;  2PUK C;  1KTE A;  3APQ A;  1KBN A;  4BL7 A;  3M1G A;  1XBS A;  1TK8 B;  5KN0 A;  1GSS A;  2HZF A;  1R26 A;  1TRW A;  3FR6 A;  1UVZ A;  4GSN A;  1PMT A;  1K0O A;  3IHQ A;  2R3X A;  4GST A;  3ZFL A;  2LJK A;  5IO2 A;  1SK0 A;  3GFK A;  1TJD A;  1FG4 A;  2JZR A;  5H5R A;  4TW5 A;  3GYK A;  1U3A A;  4NHZ A;  2H70 A;  3QR6 A;  5F05 A;  2HSH A;  2IMD A;  1ST9 A;  2AAW A;  3LOR A;  1X9M B;  2JSZ A;  3L9V A;  2C0G A;  5F0G A;  2IMK A;  4X1U A;  2WFC A;  4ZB6 A;  1GTU A;  2HZE B;  4PTS A;  3SWL A;  2HRN A;  1K0C A;  3EYT A;  5IQY A;  3GKM A;  5G1K A;  3GH9 A;  2IL3 A;  1B9Y C;  1TK0 B;  3CSJ A;  1DSB A;  2DC5 A;  4AGS A;  4HQZ A;  3TRQ A;  4LMV A;  3TJF A;  3I9V 2;  5HFI A;  4IQA A;  6GSU A;  3A2W A;  1F9M A;  1E2Y A;  4X43 A;  5GAN D;  4Q5Q A;  2JZT A;  3TOT A;  4LL4 B;  1W4V A;  2O89 A;  16GS A;  3P8W A;  1V40 A;  4BVY A;  1TW9 A;  1GLQ A;  2YV9 A;  3TOU A;  2CX4 A;  4ZBB A;  5IOX A;  4MZW A;  3P2A A;  3O3T A;  3J7Y b;  3VWV A;  1U6T A;  6GSY A;  3TGZ A;  3P7X A;  1VRS D;  4N0Z A;  2C0D A;  1OYJ A;  1TI3 A;  1O73 A;  1XVQ A;  2K18 A;  4JED A;  3IC4 A;  1VF2 A;  5DJL A;  2L4Q A;  3N5O A;  1G0T A;  5GSS A;  3D21 A;  1THX A;  3LEF A;  3VUR A;  2QGV A;  3IOS A;  2HT9 A;  3F0I A;  3G7I A;  5AIS A;  4PQH A;  3IRA A;  2PVO C;  3FRC A;  1FO5 A;  3ZL5 A;  4K2D A;  4MJB A;  1YEX A;  1B4P A;  1EV4 A;  2B1L A;  10GS A;  1M2A A;  2QKE A;  1O81 A;  1TP9 A;  2CX3 A;  1JLV A;  4BA7 A;  3KJY A;  2HYX A;  2HSY A;  3P90 A;  4J57 E;  3UAR A;  1SKR B;  5F07 A;  5INY A;  1WOU A;  1GUK A;  2XHF A;  3APS A;  13GS A;  4CDO A;  2WUL A;  3KP8 A;  4WKW A;  1PKW A;  3U5R E;  3K8N A;  1BJX A;  1OKD A;  2RM6 A;  1PRX A;  2VD0 A;  4IBP A;  2E7P A;  3GN3 A;  4Q5R A;  4MK3 A;  1LJR A;  5G5F A;  2PU9 C;  3D4M A;  3QAW A;  3RHB A;  2DJ2 A;  1V2A A;  5ECS A;  2GLR A;  2YWO A;  4OO5 A;  3BJ5 A;  4IP1 A;  1O8X A;  4ZBD A;  1AAZ A;  2VCW A;  2H76 A;  1XZO A;  4ZL9 A;  2L57 A;  3KTB A;  1E6B A;  4XHM A;  4DEJ A;  1ON4 A;  1WE0 A;  1ZGN A;  4KCE A;  2IN3 A;  2PN8 A;  1AW9 A;  2HI7 A;  2DJJ A;  2D2Z A;  4JR4 A;  2YJH A;  1JFU A;  3C73 A;  1A2M A;  2PPT A;  1OVN A;  3QD9 A;  4FQU A;  2CVB A;  3R2Q A;  2HQT A;  2JU5 A;  1I5G A;  1GSD A;  5IOW A;  3BBY A;  3WGX A;  2F51 A;  3GKX A;  2HSM A;  4K6X A;  5C04 A;  1YJ6 A;  4MJE A;  4HU7 A;  3ERF A;  1XWK A;  2LRT A;  2GQL A;  4KSO A;  1EOG A;  3FW2 A;  1XIY A;  2BTO T;  4JBB A;  4KX4 A;  4L0U A;  1VGL A;  4XS4 A;  2B5X A;  4WR4 A;  2H6X A;  1BQ7 A;  1Q98 A;  4V2N A;  3TJB A;  5B6M A;  3FHK A;  3FY7 A;  2AHE A;  4MA9 A;  3M3M A;  1M99 A;  4K9Z A;  3F63 A;  1FHE A;  4KDY A;  2LKU A;  4ZIL A;  1VF3 A;  5BMU A;  2ON5 A;  4ACS A;  4HJM A;  2IMI A;  1WIK A;  3DML A;  1BG5 A;  4FIW A;  5CAX A;  1OC9 A;  3F9U A;  6GSV A;  14GS A;  3U6V A;  3IR4 A;  1LBK A;  3IV4 A;  4WEY A;  4FO5 A;  1WJK A;  2IIY A;  3GNJ A;  2IME A;  3IA1 A;  2YWN A;  4MH2 A;  2HE3 A;  6GSX A;  3ZVJ D;  2PER A;  3GUR A;  2X8G A;  4JRR A;  2FUG 2;  4F0C A;  2RLI A;  5H5Q A;  3TKQ A;  3TDG A;  1TTZ A;  5JWO B;  1SYX A;  4KB3 A;  1OKT A;  3VFI A;  3A2X A;  2F8A A;  2JZS A;  4OCF A;  3TRX A;  4ZL7 A;  3QFA C;  1GSF A;  4MCU A;  3GKN A;  5DBQ A;  3QMX A;  5DAK B;  3DWV A;  4KW6 A;  5B7C A;  1THO A;  3EIN A;  4PNF A;  5DCG A;  4TR0 A;  5ID2 A;  4PQ1 A;  1TK5 B;  2YP6 A;  1PSQ A;  4POL A;  3QAV A;  2JAD A;  4Z7X A;  4EUY A;  5G1L A;  1XOA A;  3O76 A;  2KP2 A;  1R4W A;  4AJ6 A;  1HQO A;  5CRG A;  4IKH A;  3DGQ A;  2C4J A;  3ED3 A;  2VL2 C;  1YZX A;  4OD7 A;  4EF0 A;  2FWG A;  1FB6 A;  2YWI A;  1XVW A;  2H73 A;  2RUF A;  2H1D A;  1BAY A;  2I4A A;  3GTU B;  4QL7 A;  4WF4 A;  1GUL A;  3D4T A;  3IK7 A;  5GAP D;  4YQV A;  4KAE A;  3NIV A;  3KH9 A;  4X0X A;  2C3Q A;  4MMM A;  1BX9 A;  3CMI A;  4XS6 A;  8GSS A;  4XRA A;  2XPD A;  3FZ4 A;  4TXO B;  1TOF A;  4AF2 A;  3UL3 A;  1V98 A;  2A2S A;  4IP6 A;  3WGD A;  1GWC A;  2LUS A;  1PX7 A;  3ZIT A;  3LG6 A;  3UEM A;  1A2L A;  1G6Y A;  3GTU A;  4LLR A;  2GZY A;  5HFK A;  2L5L A;  5GST A;  2CA8 A;  4WBJ A;  5IMF A;  1CQG A;  3F3R A;  4ECB A;  2GSS A;  2R4V A;  5B6N A;  3DVX A;  2MBT A;  3KMN A;  4Q5F A;  1T8E B;  2M80 A;  2H1G A;  2HRF A;  2K8V A;  3KH7 A;  5D8I A;  4K8M A;  1DE1 A;  2LTK A;  1BED A;  3Q18 A;  2ZNM A;  2VD1 A;  4EDZ A;  3ZMK A;  1GLP A;  4OMV A;  3M9K A;  4N10 A;  4AJ8 A;  2LJR A;  3UBK A;  1JZO A;  5CYY A;  2LQQ A;  2TRC P;  1DE2 A;  3GH6 A;  4WBR D;  1M2D A;  4IHU A;  1B48 A;  1GSQ A;  1ERW A;  1F3B A;  1NHO A;  2XBI A;  5JCW A;  3HD5 A;  3O6T A;  4JU5 A;  2PGT A;  3AY8 A;  3I69 A;  7GSS A;  17GS A;  4IVF A;  4GCI A;  1Y25 A;  1C72 A;  1V57 A;  3DXB A;  4KND A;  3DEX A;  3TKS A;  4O7H A;  2VCT A;  4KCA A;  3C1S A;  4POB A;  5DAL A;  1GSY A;  3FEU A;  4BVX A;  2VCX A;  5AIX A;  2E2M A;  2CVD A;  2DBC A;  4TR3 A;  5G5E A;  4HS1 A;  2LEG A;  1PQN A;  2CVK A;  2R2J A;  2WRT A;  1BYE A;  2XC2 A;  3HZ4 A;  4POM A;  4BWS A;  1GTI A;  2DMM A;  3GRX A;  1HNA A;  3HY2 A;  3GST A;  2I1U A;  2G0F A;  4TKY A;  5F8B A;  2GS3 A;  2VOC A;  5ABR A;  1XW6 A;  3HXS A;  3QOU A;  3DKS A;  5GZZ B;  1V9W A;  1U3I A;  3UBL A;  4YAP A;  3MDK A;  3LFL A;  1ERU A;  4P3Y B;  2GZP A;  2IJY A;  2O87 A;  3GMF A;  5IMZ A;  2KUC A;  1RK4 A;  2WS2 A;  2ZUP A;  5LNK e;  2DLX A;  1XOB A;  4HEA 2;  1T1V A;  3FK8 A;  1PL2 A;  1AQX A;  2B7J A;  4E8H A;  2A4V A;  3UJ1 A;  2TIR A;  1A0R P;  2PMT A;  3LYK A;  2V6O A;  5ECR B;  2IWT A;  2VAF A;  4WF5 A;  4ML1 A;  2H1A A;  5A4U A;  3J7Y k;  2HZE A;  2KP1 A;  4V2M A;  1MD3 A;  1M2B A;  4EE0 A;  5JWQ B;  3F4R A;  5IMA A;  4NAX A;  2EIR A;  2Z9S A;  3GUS A;  2GGT A;  2BMX A;  1ERT A;  1ACV A;  3ZVJ A;  1SJI A;  1F3A A;  1SKS B;  4D73 B;  2OJL A;  1AQW A;  2RM5 A;  5CRW A;  4GRF A;  2AB6 A;  3ME8 A;  1YKA A;  2HLS A;  2H01 A;  5ECO B;  5HR3 A;  4CW9 A;  4TRX A;  2YPM A;  4NWY A;  1NM3 A;  5HQP A;  1OAZ A;  2GTU A;  6GSW A;  4I97 A;  2H1B A;  4MPF A;  3G7Y A;  3IAM 2;  2ES7 A;  3HVS A;  5G2Z A;  4RUV A;  5D9V A;  11GS A;  1QGV A;  3DRN A;  4D73 A;  1M9A A;  2OBI A;  1ERV A;  2JSY A;  2MYG A;  5IPH A;  4I5Q A;  4WR5 A;  4HZ2 A;  4FYC A;  2C0F A;  2WJU A;  3UAP A;  5EVO A;  4HOJ A;  3LXZ A;  3F8U A;  1X5E A;  1IYI A;  1Y6E A;  1Z5Y E;  2BJX A;  1Z9H A;  3WD6 A;  1SK2 A;  1ZOF A;  4POK A;  1EZK A;  2E2G A;  3RBT A;  2R6K A;  3MAK A;  2VLU A;  3ZLP A;  1R7H A;  2VCZ A;  3L0H A;  4TN8 A;  3CRU A;  1ML6 A;  4CHS A;  2ZCT A;  3UOM A;  4MJC A;  4TVE A;  1PD2 1;  2P31 A;  1Z6M A;  3CSH A;  4MF6 A;  2GDR A;  2C1Y A;  1DBY A;  4YQU A;  3FZ5 A;  4WXT A;  4YAV A;  2VM2 A;  5B8B A;  2B6M A;  3BOA A;  1HYU A;  2GVP A;  1NW2 A;  3S9F A;  4MLY A;  2VL9 A;  1AXD A;  1GNE A;  2FA4 A;  4EXJ A;  2FGX A;  3KD0 A;  5J41 A;  2CV4 A;  2MBS A;  2VUP A;  1X9W B;  4G0I A;  1FAA A;  2A2R A;  5ECL B;  5D93 A;  3UVT A;  2ON7 A;  4I2U A;  4LA1 A;  4KA0 A;  3EMX A;  2H75 A;  3VWX A;  3DD3 A;  1EEM A;  1JLW A;  2AUV A;  2V41 A;  5CP1 A;  4G0L A;  1LU4 A;  1ILO A;  1QFN A;  4NPB A;  5KN2 A;  4ZL8 A;  3KP9 A;  2H72 A;  1SL1 B;  4OO4 A;  4F0B A;  4I6X A;  3Q74 A;  3W8S A;  4LMW A;  2LJA A;  5ENU A;  3QFB C;  4MZC A;  1A0F A;  1K0B A;  3MNG A;  1XWA A;  2RUE A;  22GS A;  4HDE A;  3ZRE A;  1CQH A;  1PN9 A;  1MEK A;  5J9C A;  2K8S A;  1EGO A;  3PPU A;  1TI1 A;  5IIZ A;  18GS A;  2MMZ A;  2VLV A;  2I3Y A;  4TOP A;  5B8A A;  4OWY A;  2NVL A;  1HNB A;  1WP0 A;  1ZL9 A;  3EC3 A;  1WPI A; 
#chains in the Genus database with same CATH topology
 2XPE A;  4DSR A;  1AQV A;  1O8W A;  1M7T A;  3TU3 B;  1K3O A;  2I81 A;  3D22 A;  3C8E A;  1T4Y A;  4G2E A;  1TDI A;  1YEP A;  4PUA A;  3QPM A;  1MDK A;  3ZFB A;  5J47 A;  4ECC A;  2L6C A;  1FB0 A;  4ZXG A;  4IEL A;  1GP1 A;  2KOK A;  1USB A;  2X99 A;  4XCS A;  4AKX B;  1PL1 A;  3HCZ A;  4DSQ A;  3C7M A;  1G6W A;  2A2P A;  1TU8 A;  1A8L A;  5KN1 A;  1TXU A;  4O5R A;  2B3S A;  4LL1 B;  3PH9 A;  3C1R A;  4GWR A;  4ZIJ A;  3A5W A;  3KTL A;  5KN3 A;  2YN1 A;  3HVX A;  1R5A A;  2WZS A;  1X5D A;  1A8Y A;  3OR5 A;  3I43 A;  3BCI A;  4F2I A;  1KNG A;  2LST A;  5ECH B;  4DSS B;  5IO0 A;  4K5R A;  2H0I A;  1PX6 A;  3MYD A;  2N5A A;  1ZYE A;  3W6G A;  2MMN A;  2YOI A;  1FOH A;  5E59 A;  4H86 A;  2GQK A;  4F9Z A;  2O7K A;  3FR3 A;  5DAK A;  4OFN A;  2X49 A;  4ZB8 A;  5J3R A;  1JZD A;  3FZ9 A;  3ZIJ A;  3MWH A;  1JHB A;  1XWG A;  3GA4 A;  2AV4 A;  3F4T A;  2VL3 A;  2OE1 A;  2DJ0 A;  1N2A A;  1OE7 A;  2VLT A;  3E3E A;  2N5B A;  5LD0 A;  1SEN A;  2DIY A;  2X64 A;  1MD4 A;  1QQ2 A;  1SKW B;  1YF1 A;  2L5O A;  3H8Q A;  3E0U A;  4WET A;  4DSS A;  2HSN B;  4KUN A;  1G7E A;  1Z7P A;  1Q4J A;  1J9B A;  3CRT A;  3ERW A;  2PBJ A;  1QK8 A;  9GSS A;  2V6K A;  1SU9 A;  4JR6 A;  2K9F A;  3LGC A;  5G30 A;  1GUM A;  3KGK A;  3HVN A;  1XCC A;  4K0G A;  4V1A p;  2HRK B;  1TRS A;  2GZZ A;  6GSS A;  2YWM A;  4TXO A;  3D0Z A;  1U88 A;  1T00 A;  4F03 A;  4MZB A;  4MF7 A;  1S4B P;  3HDC A;  4EDY A;  2GT6 A;  3LXT A;  4G9H A;  2DJ3 A;  2FCH A;  2AYT A;  2XBQ A;  2CT6 A;  3HYP A;  4HI7 A;  2O3E A;  3EWL A;  4GQC A;  2ALB A;  3F4S A;  5KOW A;  1W89 A;  3G9B A;  3HKR A;  2L4C A;  1X9S B;  4L8E A;  1M0U A;  2YAN A;  5FWG A;  1A24 A;  2NTO A;  6GST A;  2IFQ B;  2VM1 A;  3A2V A;  3EU3 A;  5D9X A;  3GL5 A;  4BPY A;  4MPG A;  3Q6O A;  2YZU A;  3LQ7 A;  3HZ8 A;  4EL1 A;  1TRV A;  4QQ7 A;  1U87 A;  1SJZ A;  2FWH A;  1EP7 A;  3GKK A;  4BL7 B;  2V32 A;  1O6J A;  1AUC A;  4I2T A;  3IC8 A;  2QSI A;  2LV3 A;  2B5E A;  3VWU A;  3H79 A;  5EY6 A;  1XXU A;  5EL8 A;  1EEJ A;  2J9H A;  4O92 A;  3UMA A;  4K7N A;  1RW1 A;  4O32 A;  1FVK A;  2F9S A;  3UVH A;  1XFL A;  3WYW A;  1PA3 A;  2F3M A;  2UZ8 A;  3KZQ A;  4JE1 A;  2KHP A;  3ZZX A;  5IM9 A;  3EVI A;  4Q5N A;  2DJ1 A;  1UN2 A;  5CO3 A;  4N30 A;  3LSZ A;  1SD8 A;  1F2E A;  2UV8 G;  1XW9 A;  3TUE A;  2EFD A;  2NDO A;  4NMU A;  3I6A A;  2HFD A;  1GL8 A;  2JAC A;  4XS1 A;  4FH8 A;  3TJK A;  4G0K A;  3CYN A;  4ECJ A;  2WVY A;  3TKP A;  4IW9 A;  4TR1 B;  3M0F A;  5AN1 A;  1TKD B;  1XWB A;  2PWJ A;  2WB9 A;  3TJG A;  3CTF A;  3VK9 A;  4MAB A;  5FHI A;  2TRX A;  3TKS E;  3H1N A;  5ECM B;  4HQS A;  5HR0 A;  3ISO A;  3IK9 A;  2DJK A;  5C00 A;  2FY6 A;  2NBS A;  4CY8 A;  1PN0 A;  2EIO A;  3GIX A;  4HU9 A;  4PGT A;  2V2G A;  1MDI A;  1SJ6 A;  4BVY B;  1YY7 A;  3EMP A;  4MH3 A;  2MMA A;  4TR1 A;  1N8J A;  3GV1 A;  5ECK B;  2YJ7 A;  1YF0 A;  2QC7 A;  2G2Q A;  2B7K A;  3RGB C;  5G31 A;  1A2J A;  4FYB A;  4NV2 A;  2O8V B;  5J9B A;  3H4K A;  2LNT A;  5DVB A;  1WWJ A;  1O85 A;  2OA7 A;  1Z3E A;  3NZN A;  5LCZ A;  4GQF A;  2P5R A;  5A4W A;  3LW9 A;  1FW1 A;  3FKF A;  3APO A;  4HUA A;  2CAI A;  3L4N A;  2HRA A;  3KXO A;  4L0W A;  4PI2 C;  4KH7 A;  4GTU A;  1K0A A;  1M3I A;  4QL9 A;  1T7P B;  3ZML A;  2O85 A;  3WGE A;  4J56 E;  3IE3 A;  2FA8 A;  2H71 A;  1TRU A;  1SVM A;  2M72 A;  1I9D A;  2OAC A;  5JCU A;  3ZIV A;  4OFM A;  1Z6N A;  3BD2 A;  1FVJ A;  4RI6 A;  2YCD A;  1ZYP A;  3CTG A;  5ECQ B;  1T4Z A;  3H93 A;  3HMJ G;  1MDJ A;  5EPF A;  4AI6 A;  2AJQ B;  3TKS C;  1ABA A;  4OFT A;  1YQ1 A;  1YDK A;  3R3E A;  2NPB A;  1EP8 A;  3BCK A;  2GSR A;  1S3D A;  4G19 A;  4XRD A;  3TKR A;  3ZRD A;  3A3T A;  4EO3 A;  4NV5 A;  2O5V A;  4PNG A;  4E8E A;  2KLX A;  2H6Y A;  2H66 A;  4MDC A;  4KDX A;  3FZA A;  1RQM A;  1UA5 A;  2WCI A;  4IJI A;  4TXV A;  3GX0 A;  5IMC A;  2GQM A;  3WT1 A;  3PIN A;  4G10 A;  2DSA A;  1K3Y A;  2FD3 A;  1QUW A;  3RPP A;  3RPN A;  1SL0 B;  1Z7R A;  4J2F A;  2L59 A;  2H19 A;  1GUH A;  1KEB A;  2WW1 A;  4ISD A;  2H6Z A;  2YV7 A;  3RFR C;  4PQI A;  4AJ7 A;  3N9J A;  4N11 A;  2L6D A;  3C71 A;  4E68 A;  1VF4 A;  3TRP A;  3ME7 A;  1N25 A;  2DIZ A;  4K7O A;  1GTA A;  2R0C A;  2HSM B;  4ID0 A;  5DCH A;  4ULX A;  2V1M A;  3WT2 A;  1TXX A;  1GRX A;  4KE3 A;  1SD9 A;  2DML A;  1I1I P;  2WGR A;  1UC7 A;  2HNL A;  4K2X A;  3GX8 A;  3ZTL A;  2VL2 A;  1S3A A;  5AGY A;  4XTS A;  4N0V A;  4PXO A;  1K0D A;  4MP4 A;  2OKA A;  3FR9 A;  1F6M C;  2P0G A;  4ZBA A;  3KEB A;  4XS4 B;  5DJM A;  2EC4 A;  3EUR A;  2FHE A;  1B9X C;  4IJ3 A;  2H8L A;  2H30 A;  4KGI A;  5KEJ A;  2H0H A;  3ZYW A;  4O5Q A;  3EU4 A;  3RAZ A;  5CNW A;  1OE8 A;  5H5S A;  5IMV A;  3HJO A;  5COH A;  4IS0 A;  4XIH A;  1M3J A;  2OE3 A;  5AIV A;  4FYU A;  2GT5 A;  4K1F A;  3FMW A;  3L9U A;  4YH2 A;  3JCM L;  3E9J B;  3HA9 A;  3KM6 A;  1EGR A;  2M46 A;  1SL2 B;  5F06 A;  2E0Q A;  2VIM A;  2IMF A;  1OC9 B;  5DDL A;  3HVV A;  1AC1 A;  1GH2 A;  5ECI B;  2B1K A;  3IDV A;  4MJA A;  3VPQ A;  4NHW A;  1O7U A;  2FLS A;  1A23 A;  1EOH A;  5ELA A;  3QAG A;  5D73 A;  1H75 A;  3RDW A;  3ERG A;  2CQ9 A;  2H0G A;  4EIP A;  5ECP B;  5A5K A;  3HJM A;  4DVC A;  5JCG A;  2IPA A;  5A5H B;  1NHY A;  1DUG A;  2WW0 A;  1K0M A;  3HHV A;  3W8J A;  3VPT A;  3IAS 2;  4EIQ A;  4HZ4 A;  3IPZ A;  4TR4 A;  2C0E A;  1HD2 A;  5CRH A;  3KCM A;  2RII A;  5ID2 B;  2C3N A;  3CXG A;  3L78 A;  1M9B A;  4PX1 A;  2R5G A;  2H74 A;  5D9T A;  3L9S A;  1H4O A;  3LYP A;  5CRD A;  2CAQ A;  1WRY A;  2YNX A;  3F6F A;  2R37 A;  3DIE A;  1SK1 A;  3VLN A;  4GLT A;  3D5J A;  1XPV A;  1R5P A;  2LRC A;  1G7O A;  4ML6 A;  3QDN A;  3TB2 A;  1HNC A;  4IQ1 A;  1V58 A;  2HXK A;  2FWF A;  4RQX A;  1J0F A;  2MMO A;  3Q19 A;  3KIJ A;  5ECN B;  3QCP A;  1GNW A;  3F6D A;  3GHA A;  3HJP A;  2F8F A;  2LS5 A;  2MZC A;  3DVW A;  1ZMA A;  4JZQ A;  5IPG A;  3D6I A;  3KMO A;  1K3L A;  2GSQ A;  5HFG A;  2C3T A;  5D96 A;  1MTC A;  4GXZ A;  3TCO A;  2WDU A;  4KSM A;  2I9H A;  4V1A g;  5JWR B;  2K6V A;  2J23 A;  3CSI A;  2OAD A;  3V1W A;  1WMJ A;  3M9J A;  2X4A A;  2R0G A;  5HR1 A;  5HR2 A;  1X5C A;  4I8B A;  4IN0 A;  1K0N A;  1X0R A;  5DQS A;  4L5O A;  1S3C A;  2OBK A;  2FNO A;  2JL4 A;  4PUR A;  5DQY A;  1EV9 A;  4EC0 A;  12GS A;  3GSS A;  4QMK A;  3SBC A;  5E4W A;  4KDU A;  1SYR A;  3LJR A;  1QMV A;  3TJJ A;  5J5N A;  1JZR A;  4KF9 A;  3LWA A;  4USS A;  1XW5 A;  1B8X A;  1NSW A;  2VCV A;  2C80 A;  5L71 A;  4GF0 A;  4ILF A;  4K7I A;  3IBH A;  4F82 A;  4PUF C;  19GS A;  1JZW A;  4RI7 A;  1ZCP A;  2REM A;  4Z2R A;  2CZ3 A;  1F37 A;  4K0N A;  4EKZ A;  1T3B A;  2C8U A;  1QXH A;  4ZB7 A;  3VWW A;  1AIU A;  1PGT A;  2HSN A;  4GSS A;  2LRN A;  5FT3 A;  2FWE A;  5D9W A;  2EIQ A;  2QA1 A;  3PGT A;  2P5Q A;  4RQR A;  4BIK A;  5IMD A;  2PVQ A;  3DYR A;  4HJ2 A;  1GSE A;  4NXI A;  4ECI A;  2N5F A;  2VCQ A;  3F3Q A;  2HRK A;  4PI0 C;  1TU7 A;  1PKZ A;  4OCE A;  1FOV A;  2X8C A;  2H1L A;  1URM A;  1XWC A;  2OE0 A;  5J4U A;  3EE2 A;  1GSU A;  1OC3 A;  5A34 B;  3UIW A;  3RHC A;  1VF1 A;  2WZ9 A;  4V2L A;  4IGJ A;  4MF5 A;  5DAL B;  5A4V A;  4BVX B;  4YQM A;  1B4Q A;  1IYH A;  20GS A;  4L5L A;  4BWQ A;  1BG1 A;  3NOF A;  3VI5 A;  2VO4 A;  1ZZY A;  2YZH A;  3CBU A;  2LQO A;  3G7J A;  1GTB A;  1YKC A;  3MSZ A;  3GL3 A;  3M8N A;  3FYG A;  1EWX A;  2EFC A;  3PR8 A;  4EVM A;  2LNS A;  2IFQ A;  3IXR A;  2CZ2 A;  1J08 A;  4ZB9 A;  1OC8 A;  2X8H A;  1ZYQ B;  5ELG A;  5A34 A;  5CRE A;  2GST A;  2B5Y A;  3VI7 A;  3US3 A;  2PUK C;  4ICY A;  1KTE A;  3APQ A;  1KBN A;  4BL7 A;  3M1G A;  1XBS A;  1TK8 B;  5KN0 A;  1GSS A;  2HZF A;  1R26 A;  1TRW A;  3FR6 A;  2O36 A;  1UVZ A;  4K5S A;  4GSN A;  1PMT A;  1K0O A;  3IHQ A;  2R3X A;  4GST A;  4GDF A;  3ZFL A;  2LJK A;  5IO2 A;  1SK0 A;  3GFK A;  1TJD A;  5J4V A;  1FG4 A;  2JZR A;  5H5R A;  4TW5 A;  3GYK A;  1U3A A;  4NHZ A;  2H70 A;  3QR6 A;  5F05 A;  2HSH A;  2IMD A;  1ST9 A;  2AAW A;  3LOR A;  1X9M B;  2JSZ A;  3L9V A;  2C0G A;  5F0G A;  2IMK A;  4X1U A;  2WFC A;  4ZB6 A;  1GTU A;  2HZE B;  4PTS A;  3SWL A;  5BRT A;  2HRN A;  1K0C A;  3EYT A;  5IQY A;  3GKM A;  5G1K A;  3GH9 A;  2IL3 A;  1B9Y C;  1TK0 B;  3CSJ A;  1DSB A;  2DC5 A;  4AGS A;  4HQZ A;  3TRQ A;  4LMV A;  3TJF A;  3I9V 2;  5HFI A;  4IQA A;  6GSU A;  4G01 A;  3A2W A;  1F9M A;  1E2Y A;  4X43 A;  5GAN D;  4Q5Q A;  2JZT A;  3TOT A;  4LL4 B;  1W4V A;  2O89 A;  16GS A;  3P8W A;  1V40 A;  2WVZ A;  4BVY A;  1TW9 A;  1GLQ A;  2YV9 A;  3TOU A;  2CX4 A;  4ZBB A;  5IOX A;  4MZW A;  3P2A A;  3O3T A;  3J7Y b;  3VWV A;  1U6T A;  3IHG A;  6GSY A;  3TGZ A;  3P7X A;  1VRS D;  4N0Z A;  2C0D A;  1OYJ A;  1TI3 A;  4Z2T A;  1O73 A;  1XVQ A;  2K18 A;  4JED A;  3IC4 A;  1VF2 A;  5DJL A;  2L4Q A;  3N5O A;  1G0T A;  4HSC X;  2DKH A;  5GSS A;  3D21 A;  1THX A;  3LEF A;  3VUR A;  2QGV A;  3IOS A;  2HT9 A;  3F0I A;  3G7I A;  5AIS A;  4PQH A;  3IRA A;  2PVO C;  3FRC A;  1FO5 A;  3ZL5 A;  4K2D A;  4MJB A;  1YEX A;  1B4P A;  1EV4 A;  2B1L A;  10GS A;  1M2A A;  2QKE A;  1O81 A;  1TP9 A;  2CX3 A;  1JLV A;  4BA7 A;  3KJY A;  2HYX A;  2HSY A;  3P90 A;  4J57 E;  3UAR A;  1S3R A;  1SKR B;  5F07 A;  5INY A;  1WOU A;  1GUK A;  3CWG A;  2XHF A;  13GS A;  3APS A;  4CDO A;  2WUL A;  3KP8 A;  4WKW A;  1PKW A;  3U5R E;  3K8N A;  1BJX A;  1OKD A;  2RM6 A;  1PRX A;  2VD0 A;  4IBP A;  2E7P A;  3GN3 A;  4Q5R A;  4MK3 A;  1LJR A;  5G5F A;  2PU9 C;  3D4M A;  3QAW A;  3RHB A;  2DJ2 A;  1V2A A;  5ECS A;  2GLR A;  2YWO A;  4OO5 A;  3BJ5 A;  4IP1 A;  1O8X A;  4ZBD A;  1AAZ A;  2VCW A;  2H76 A;  1XZO A;  1ZYN A;  4ZL9 A;  2WVX B;  2L57 A;  3KTB A;  1E6B A;  4XHM A;  4YKG A;  4DEJ A;  1ON4 A;  1WE0 A;  1ZGN A;  4KCE A;  2IN3 A;  2PN8 A;  1AW9 A;  2HI7 A;  2DJJ A;  2D2Z A;  4JR4 A;  2YJH A;  1JFU A;  3C73 A;  1A2M A;  2PPT A;  1OVN A;  3QD9 A;  4FQU A;  1PFO A;  2CVB A;  3R2Q A;  2HQT A;  2JU5 A;  1I5G A;  4O5U A;  4AKI A;  1GSD A;  5IOW A;  3BBY A;  3WGX A;  2F51 A;  3GKX A;  2HSM A;  4K6X A;  5C04 A;  1YJ6 A;  4MJE A;  2DKI A;  4HU7 A;  3ERF A;  5BMU B;  1XWK A;  2LRT A;  2GQL A;  2QA2 A;  5KOX A;  4KSO A;  1EOG A;  3FW2 A;  1XIY A;  2BTO T;  4JBB A;  4KX4 A;  2EFE A;  1VGL A;  3EPT A;  4L0U A;  4XS4 A;  2B5X A;  4WR4 A;  2H6X A;  1BQ7 A;  1Q98 A;  4V2N A;  3TJB A;  5B6M A;  3FHK A;  3FY7 A;  1Y1U A;  2AHE A;  4MA9 A;  3M3M A;  1M99 A;  4K9Z A;  3F63 A;  1FHE A;  4KDY A;  2LKU A;  4ZIL A;  1VF3 A;  5BMU A;  2ON5 A;  4ACS A;  4HJM A;  2IMI A;  1WIK A;  3DML A;  3A5I A;  1BG5 A;  4FIW A;  5CAX A;  1OC9 A;  3F9U A;  6GSV A;  14GS A;  3U6V A;  1BF5 A;  3IR4 A;  1LBK A;  3IV4 A;  4WEY A;  1SVL A;  4FO5 A;  1WJK A;  2IIY A;  3GNJ A;  2IME A;  3IA1 A;  2YWN A;  4MH2 A;  2HE3 A;  6GSX A;  3ZVJ D;  2PER A;  3GUR A;  2X8G A;  4JRR A;  2FUG 2;  4F0C A;  2RLI A;  5H5Q A;  3TKQ A;  4N3Z A;  3TDG A;  4A5P A;  1TTZ A;  5JWO B;  1SYX A;  4KB3 A;  1OKT A;  4YKF A;  3VFI A;  3A2X A;  2F8A A;  2JZS A;  4OCF A;  5A5H A;  3TRX A;  4ZL7 A;  3QFA C;  1GSF A;  4MCU A;  3GKN A;  5DBQ A;  3QMX A;  5DAK B;  3DWV A;  4KW6 A;  5B7C A;  1THO A;  3EIN A;  4PNF A;  5DCG A;  4TR0 A;  5ID2 A;  4PQ1 A;  1TK5 B;  2YP6 A;  1PSQ A;  4POL A;  3QAV A;  2JAD A;  4Z7X A;  4EUY A;  5G1L A;  1XOA A;  3O76 A;  2KP2 A;  1R4W A;  4AJ6 A;  1HQO A;  5CRG A;  4IKH A;  3DGQ A;  2C4J A;  3ED3 A;  2VL2 C;  1YZX A;  4OD7 A;  4EF0 A;  2FWG A;  1FB6 A;  2YWI A;  1XVW A;  2H73 A;  2RUF A;  2H1D A;  2R0P A;  1BAY A;  2I4A A;  3GTU B;  4QL7 A;  4WF4 A;  1GUL A;  3D4T A;  3IK7 A;  5GAP D;  4YQV A;  4KAE A;  3NIV A;  3KH9 A;  4X0X A;  2C3Q A;  4MMM A;  1BX9 A;  3CMI A;  4XS6 A;  8GSS A;  4XRA A;  2XPD A;  3FZ4 A;  4TXO B;  1TOF A;  4AF2 A;  3UL3 A;  1V98 A;  2EFH A;  2A2S A;  4IP6 A;  3WGD A;  1GWC A;  2LUS A;  1PX7 A;  3ZIT A;  3LG6 A;  4PHZ C;  3UEM A;  5A1N B;  1A2L A;  3CQF A;  1G6Y A;  3GTU A;  4LLR A;  5J4Y A;  2GZY A;  5HFK A;  2L5L A;  5GST A;  2CA8 A;  4WBJ A;  5IMF A;  1CQG A;  3F3R A;  3MIX A;  4ECB A;  2GSS A;  2R4V A;  5B6N A;  3DVX A;  2VKZ G;  2MBT A;  3KMN A;  4Q5F A;  1T8E B;  1YEW C;  4W66 A;  2M80 A;  2H1G A;  2HRF A;  2K8V A;  3KH7 A;  5D8I A;  5A1N A;  4K8M A;  4X4J A;  1DE1 A;  2LTK A;  1BED A;  3Q18 A;  2ZNM A;  2VD1 A;  4EDZ A;  3ZMK A;  1GLP A;  4OMV A;  3M9K A;  4N10 A;  4AJ8 A;  2LJR A;  3CHX C;  3UBK A;  1JZO A;  5CYY A;  2LQQ A;  2TRC P;  1DE2 A;  3GH6 A;  4WBR D;  1M2D A;  4IHU A;  1B48 A;  1GSQ A;  1ERW A;  1F3B A;  1NHO A;  2XBI A;  5JCW A;  3HD5 A;  3O6T A;  4JU5 A;  2PGT A;  3AY8 A;  3I69 A;  7GSS A;  17GS A;  4IVF A;  4GCI A;  1Y25 A;  1C72 A;  1V57 A;  3DXB A;  4KND A;  3DEX A;  3TKS A;  4O7H A;  2VCT A;  4KCA A;  3C1S A;  4POB A;  5DAL A;  1GSY A;  3FEU A;  4BVX A;  2VCX A;  5AIX A;  2E2M A;  2CVD A;  2DBC A;  4TR3 A;  5G5E A;  4HS1 A;  2LEG A;  1PQN A;  2CVK A;  2R2J A;  2WRT A;  1BYE A;  2XC2 A;  3HZ4 A;  4POM A;  4BWS A;  1GTI A;  2DMM A;  3GRX A;  1HNA A;  3HY2 A;  3GST A;  2I1U A;  2G0F A;  4TKY A;  5F8B A;  2GS3 A;  2WW3 A;  2VOC A;  5ABR A;  1XW6 A;  3HXS A;  3QOU A;  3DKS A;  5GZZ B;  1V9W A;  1U3I A;  3UBL A;  4YAP A;  3MDK A;  3LFL A;  1ERU A;  4P3Y B;  2GZP A;  2IJY A;  2O87 A;  3GMF A;  5IMZ A;  2KUC A;  1RK4 A;  2WS2 A;  2ZUP A;  5LNK e;  2DLX A;  1XOB A;  4HEA 2;  1T1V A;  3FK8 A;  1PL2 A;  1AQX A;  2B7J A;  4E8H A;  2A4V A;  3UJ1 A;  2TIR A;  1A0R P;  2PMT A;  3LYK A;  2V6O A;  5ECR B;  2IWT A;  2VAF A;  4WF5 A;  4ML1 A;  2H1A A;  5A4U A;  1YVL A;  3J7Y k;  2HZE A;  2KP1 A;  4V2M A;  1MD3 A;  1M2B A;  4EE0 A;  5JWQ B;  3F4R A;  5IMA A;  5J40 A;  4NAX A;  2EIR A;  2Z9S A;  3GUS A;  2GGT A;  2BMX A;  4MNN A;  1ERT A;  1ACV A;  2WW2 A;  3ZVJ A;  1SJI A;  1F3A A;  1SKS B;  4D73 B;  2OJL A;  1AQW A;  2RM5 A;  5CRW A;  4GRF A;  1SVO A;  2AB6 A;  3ME8 A;  1YKA A;  2HLS A;  2H01 A;  5ECO B;  5HR3 A;  4CW9 A;  4CY6 A;  4TRX A;  2YPM A;  4NWY A;  1NM3 A;  5HQP A;  1OAZ A;  2GTU A;  4FXY P;  6GSW A;  4I97 A;  2H1B A;  4MPF A;  3G7Y A;  3IAM 2;  2ES7 A;  3HVS A;  5G2Z A;  4RUV A;  5D9V A;  11GS A;  1QGV A;  3DRN A;  4D73 A;  1M9A A;  1XG8 A;  2OBI A;  1ERV A;  2OT3 A;  2JSY A;  2MYG A;  5IPH A;  4I5Q A;  4WR5 A;  4HZ2 A;  4FYC A;  2C0F A;  2WJU A;  3UAP A;  5EVO A;  4HOJ A;  3LXZ A;  3F8U A;  1X5E A;  1IYI A;  1Y6E A;  1Z5Y E;  2BJX A;  1Z9H A;  3WD6 A;  1SK2 A;  1ZOF A;  4POK A;  1EZK A;  2E2G A;  3RBT A;  2R6K A;  3MAK A;  2VLU A;  3ZLP A;  1R7H A;  2VCZ A;  3L0H A;  4TN8 A;  3CRU A;  1ML6 A;  4CHS A;  2ZCT A;  3UOM A;  4MJC A;  4TVE A;  1PD2 1;  2P31 A;  4Z2U A;  1Z6M A;  3CSH A;  4MF6 A;  2GDR A;  2C1Y A;  1DBY A;  4YQU A;  3FZ5 A;  4WXT A;  4YAV A;  2VM2 A;  5B8B A;  2B6M A;  3BOA A;  1HYU A;  2GVP A;  1NW2 A;  3S9F A;  4MLY A;  2VL9 A;  1AXD A;  1GNE A;  2FA4 A;  4EXJ A;  2FGX A;  3KD0 A;  5J41 A;  2CV4 A;  2MBS A;  2VUP A;  1X9W B;  4G0I A;  1FAA A;  2A2R A;  5ECL B;  5D93 A;  3UVT A;  2ON7 A;  4I2U A;  4LA1 A;  4KA0 A;  2WVX A;  3EMX A;  2H75 A;  3VWX A;  3DD3 A;  1EEM A;  1JLW A;  2AUV A;  4AKG A;  2V41 A;  5CP1 A;  4G0L A;  1LU4 A;  1ILO A;  1QFN A;  4NPB A;  5KN2 A;  2A4H A;  4ZL8 A;  3KP9 A;  2H72 A;  1SL1 B;  4OO4 A;  4F0B A;  4I6X A;  3Q74 A;  4AKH A;  3W8S A;  4LMW A;  2LJA A;  5ENU A;  3QFB C;  4MZC A;  1A0F A;  1K0B A;  3MNG A;  1XWA A;  2RUE A;  22GS A;  4HDE A;  3ZRE A;  1CQH A;  1PN9 A;  1MEK A;  5J9C A;  2K8S A;  1EGO A;  3PPU A;  1TI1 A;  5IIZ A;  18GS A;  2MMZ A;  2VLV A;  2I3Y A;  4TOP A;  5B8A A;  4OWY A;  2NVL A;  1HNB A;  1WP0 A;  1ZL9 A;  3EC3 A;  1WPI A; 
#chains in the Genus database with same CATH homology
 2XPE A;  4DSR A;  1AQV A;  1O8W A;  1M7T A;  3TU3 B;  1K3O A;  2I81 A;  3D22 A;  3C8E A;  1T4Y A;  4G2E A;  1TDI A;  1YEP A;  4PUA A;  3QPM A;  1MDK A;  3ZFB A;  5J47 A;  4ECC A;  2L6C A;  1FB0 A;  4ZXG A;  4IEL A;  1GP1 A;  2KOK A;  1USB A;  2X99 A;  4XCS A;  4AKX B;  1PL1 A;  3HCZ A;  4DSQ A;  3C7M A;  1G6W A;  2A2P A;  1TU8 A;  1A8L A;  5KN1 A;  1TXU A;  4O5R A;  2B3S A;  4LL1 B;  3PH9 A;  3C1R A;  4GWR A;  4ZIJ A;  3A5W A;  3KTL A;  5KN3 A;  2YN1 A;  3HVX A;  1R5A A;  1X5D A;  1A8Y A;  3OR5 A;  3I43 A;  3BCI A;  4F2I A;  1KNG A;  2LST A;  5ECH B;  4DSS B;  5IO0 A;  4K5R A;  2H0I A;  1PX6 A;  3MYD A;  2N5A A;  1ZYE A;  3W6G A;  2MMN A;  2YOI A;  1FOH A;  5E59 A;  4H86 A;  2GQK A;  4F9Z A;  2O7K A;  3FR3 A;  5DAK A;  4OFN A;  2X49 A;  4ZB8 A;  5J3R A;  1JZD A;  3FZ9 A;  3ZIJ A;  3MWH A;  1JHB A;  1XWG A;  3GA4 A;  2AV4 A;  3F4T A;  2VL3 A;  2OE1 A;  2DJ0 A;  1N2A A;  1OE7 A;  2VLT A;  3E3E A;  2N5B A;  5LD0 A;  1SEN A;  2DIY A;  2X64 A;  1MD4 A;  1QQ2 A;  1SKW B;  1YF1 A;  2L5O A;  3H8Q A;  3E0U A;  4WET A;  4DSS A;  2HSN B;  4KUN A;  1G7E A;  1Z7P A;  1Q4J A;  1J9B A;  3CRT A;  3ERW A;  2PBJ A;  1QK8 A;  9GSS A;  2V6K A;  1SU9 A;  4JR6 A;  2K9F A;  3LGC A;  5G30 A;  1GUM A;  3KGK A;  1XCC A;  4K0G A;  4V1A p;  2HRK B;  1TRS A;  2GZZ A;  6GSS A;  2YWM A;  4TXO A;  3D0Z A;  1U88 A;  1T00 A;  4F03 A;  4MZB A;  4MF7 A;  3HDC A;  4EDY A;  2GT6 A;  3LXT A;  4G9H A;  2DJ3 A;  2FCH A;  2AYT A;  2XBQ A;  2CT6 A;  3HYP A;  4HI7 A;  3EWL A;  4GQC A;  2ALB A;  3F4S A;  5KOW A;  1W89 A;  3G9B A;  3HKR A;  2L4C A;  1X9S B;  4L8E A;  1M0U A;  2YAN A;  5FWG A;  1A24 A;  2NTO A;  6GST A;  2IFQ B;  2VM1 A;  3A2V A;  3EU3 A;  5D9X A;  3GL5 A;  4BPY A;  4MPG A;  3Q6O A;  2YZU A;  3LQ7 A;  3HZ8 A;  4EL1 A;  1TRV A;  4QQ7 A;  1U87 A;  1SJZ A;  2FWH A;  1EP7 A;  3GKK A;  4BL7 B;  2V32 A;  1O6J A;  1AUC A;  4I2T A;  3IC8 A;  2QSI A;  2LV3 A;  2B5E A;  3VWU A;  3H79 A;  5EY6 A;  1XXU A;  5EL8 A;  1EEJ A;  2J9H A;  4O92 A;  3UMA A;  4K7N A;  1RW1 A;  4O32 A;  1FVK A;  2F9S A;  3UVH A;  1XFL A;  3WYW A;  1PA3 A;  2F3M A;  2UZ8 A;  3KZQ A;  4JE1 A;  2KHP A;  3ZZX A;  5IM9 A;  3EVI A;  4Q5N A;  2DJ1 A;  1UN2 A;  5CO3 A;  4N30 A;  3LSZ A;  1SD8 A;  1F2E A;  2UV8 G;  1XW9 A;  3TUE A;  2EFD A;  2NDO A;  4NMU A;  3I6A A;  2HFD A;  1GL8 A;  2JAC A;  4XS1 A;  4FH8 A;  3TJK A;  4G0K A;  3CYN A;  4ECJ A;  3TKP A;  4IW9 A;  4TR1 B;  3M0F A;  5AN1 A;  1TKD B;  1XWB A;  2PWJ A;  2WB9 A;  3TJG A;  3CTF A;  3VK9 A;  4MAB A;  5FHI A;  2TRX A;  3TKS E;  3H1N A;  5ECM B;  4HQS A;  5HR0 A;  3ISO A;  3IK9 A;  2DJK A;  5C00 A;  2FY6 A;  2NBS A;  4CY8 A;  1PN0 A;  2EIO A;  3GIX A;  4HU9 A;  4PGT A;  2V2G A;  1MDI A;  1SJ6 A;  4BVY B;  1YY7 A;  3EMP A;  4MH3 A;  2MMA A;  4TR1 A;  1N8J A;  3GV1 A;  5ECK B;  2YJ7 A;  1YF0 A;  2QC7 A;  2G2Q A;  2B7K A;  5G31 A;  1A2J A;  4FYB A;  4NV2 A;  2O8V B;  5J9B A;  3H4K A;  2LNT A;  5DVB A;  1WWJ A;  1O85 A;  2OA7 A;  1Z3E A;  3NZN A;  5LCZ A;  4GQF A;  2P5R A;  5A4W A;  3LW9 A;  1FW1 A;  3FKF A;  3APO A;  4HUA A;  2CAI A;  3L4N A;  2HRA A;  3KXO A;  4L0W A;  4KH7 A;  4GTU A;  1K0A A;  4QL9 A;  1T7P B;  3ZML A;  2O85 A;  3WGE A;  4J56 E;  3IE3 A;  2FA8 A;  2H71 A;  1TRU A;  1SVM A;  2M72 A;  1I9D A;  2OAC A;  5JCU A;  3ZIV A;  4OFM A;  1Z6N A;  3BD2 A;  1FVJ A;  4RI6 A;  2YCD A;  1ZYP A;  3CTG A;  5ECQ B;  1T4Z A;  3H93 A;  3HMJ G;  1MDJ A;  5EPF A;  4AI6 A;  2AJQ B;  3TKS C;  1ABA A;  4OFT A;  1YQ1 A;  1YDK A;  3R3E A;  2NPB A;  1EP8 A;  3BCK A;  2GSR A;  1S3D A;  4G19 A;  4XRD A;  3TKR A;  3ZRD A;  3A3T A;  4EO3 A;  4NV5 A;  2O5V A;  4PNG A;  4E8E A;  2KLX A;  2H6Y A;  2H66 A;  4MDC A;  4KDX A;  3FZA A;  1RQM A;  1UA5 A;  2WCI A;  4IJI A;  4TXV A;  3GX0 A;  5IMC A;  2GQM A;  3WT1 A;  3PIN A;  4G10 A;  2DSA A;  1K3Y A;  2FD3 A;  1QUW A;  3RPP A;  3RPN A;  1SL0 B;  1Z7R A;  4J2F A;  2L59 A;  2H19 A;  1GUH A;  1KEB A;  4ISD A;  2H6Z A;  2YV7 A;  4PQI A;  4AJ7 A;  3N9J A;  4N11 A;  2L6D A;  3C71 A;  4E68 A;  1VF4 A;  3TRP A;  3ME7 A;  1N25 A;  2DIZ A;  4K7O A;  1GTA A;  2R0C A;  2HSM B;  4ID0 A;  5DCH A;  4ULX A;  2V1M A;  3WT2 A;  1TXX A;  1GRX A;  4KE3 A;  1SD9 A;  2DML A;  2WGR A;  1UC7 A;  2HNL A;  4K2X A;  3GX8 A;  3ZTL A;  2VL2 A;  1S3A A;  5AGY A;  4XTS A;  4N0V A;  4PXO A;  1K0D A;  4MP4 A;  2OKA A;  3FR9 A;  1F6M C;  2P0G A;  4ZBA A;  3KEB A;  4XS4 B;  5DJM A;  2EC4 A;  3EUR A;  2FHE A;  1B9X C;  4IJ3 A;  2H8L A;  2H30 A;  4KGI A;  5KEJ A;  2H0H A;  3ZYW A;  4O5Q A;  3EU4 A;  3RAZ A;  5CNW A;  1OE8 A;  5H5S A;  5IMV A;  3HJO A;  5COH A;  4IS0 A;  4XIH A;  2OE3 A;  5AIV A;  4FYU A;  2GT5 A;  4K1F A;  3FMW A;  3L9U A;  4YH2 A;  3JCM L;  3E9J B;  3HA9 A;  3KM6 A;  1EGR A;  2M46 A;  1SL2 B;  5F06 A;  2E0Q A;  2VIM A;  2IMF A;  1OC9 B;  5DDL A;  3HVV A;  1AC1 A;  1GH2 A;  5ECI B;  2B1K A;  3IDV A;  4MJA A;  3VPQ A;  4NHW A;  1O7U A;  2FLS A;  1A23 A;  1EOH A;  5ELA A;  3QAG A;  5D73 A;  1H75 A;  3RDW A;  3ERG A;  2CQ9 A;  2H0G A;  4EIP A;  5ECP B;  5A5K A;  3HJM A;  4DVC A;  5JCG A;  2IPA A;  5A5H B;  1NHY A;  1DUG A;  1K0M A;  3HHV A;  3W8J A;  3VPT A;  3IAS 2;  4EIQ A;  4HZ4 A;  3IPZ A;  4TR4 A;  2C0E A;  1HD2 A;  5CRH A;  3KCM A;  2RII A;  5ID2 B;  2C3N A;  3CXG A;  3L78 A;  1M9B A;  4PX1 A;  2R5G A;  2H74 A;  5D9T A;  3L9S A;  1H4O A;  3LYP A;  5CRD A;  2CAQ A;  1WRY A;  2YNX A;  3F6F A;  2R37 A;  3DIE A;  1SK1 A;  3VLN A;  4GLT A;  3D5J A;  1XPV A;  1R5P A;  2LRC A;  1G7O A;  4ML6 A;  3QDN A;  3TB2 A;  1HNC A;  4IQ1 A;  1V58 A;  2HXK A;  2FWF A;  4RQX A;  1J0F A;  2MMO A;  3Q19 A;  3KIJ A;  5ECN B;  3QCP A;  1GNW A;  3F6D A;  3GHA A;  3HJP A;  2F8F A;  2LS5 A;  2MZC A;  3DVW A;  1ZMA A;  4JZQ A;  5IPG A;  3D6I A;  3KMO A;  1K3L A;  2GSQ A;  5HFG A;  2C3T A;  5D96 A;  1MTC A;  4GXZ A;  3TCO A;  2WDU A;  4KSM A;  2I9H A;  4V1A g;  5JWR B;  2K6V A;  2J23 A;  3CSI A;  2OAD A;  3V1W A;  1WMJ A;  3M9J A;  2X4A A;  2R0G A;  5HR1 A;  5HR2 A;  1X5C A;  4I8B A;  4IN0 A;  1K0N A;  1X0R A;  5DQS A;  4L5O A;  1S3C A;  2OBK A;  2FNO A;  2JL4 A;  4PUR A;  5DQY A;  1EV9 A;  4EC0 A;  12GS A;  3GSS A;  4QMK A;  3SBC A;  5E4W A;  4KDU A;  1SYR A;  3LJR A;  1QMV A;  3TJJ A;  5J5N A;  1JZR A;  4KF9 A;  3LWA A;  4USS A;  1XW5 A;  1B8X A;  1NSW A;  2VCV A;  2C80 A;  5L71 A;  4GF0 A;  4ILF A;  4K7I A;  3IBH A;  4F82 A;  4PUF C;  19GS A;  1JZW A;  4RI7 A;  1ZCP A;  2REM A;  4Z2R A;  2CZ3 A;  1F37 A;  4K0N A;  4EKZ A;  1T3B A;  2C8U A;  1QXH A;  4ZB7 A;  3VWW A;  1AIU A;  1PGT A;  2HSN A;  4GSS A;  2LRN A;  5FT3 A;  2FWE A;  5D9W A;  2EIQ A;  2QA1 A;  3PGT A;  2P5Q A;  4RQR A;  5IMD A;  2PVQ A;  3DYR A;  4HJ2 A;  1GSE A;  4NXI A;  4ECI A;  2N5F A;  2VCQ A;  3F3Q A;  2HRK A;  1TU7 A;  1PKZ A;  4OCE A;  1FOV A;  2X8C A;  2H1L A;  1URM A;  1XWC A;  2OE0 A;  5J4U A;  3EE2 A;  1GSU A;  1OC3 A;  5A34 B;  3UIW A;  3RHC A;  1VF1 A;  2WZ9 A;  4V2L A;  4IGJ A;  4MF5 A;  5DAL B;  5A4V A;  4BVX B;  4YQM A;  1B4Q A;  1IYH A;  20GS A;  4L5L A;  4BWQ A;  1BG1 A;  3NOF A;  3VI5 A;  2VO4 A;  1ZZY A;  2YZH A;  3CBU A;  2LQO A;  3G7J A;  1GTB A;  1YKC A;  3MSZ A;  3GL3 A;  3M8N A;  3FYG A;  1EWX A;  2EFC A;  3PR8 A;  4EVM A;  2LNS A;  2IFQ A;  3IXR A;  2CZ2 A;  1J08 A;  4ZB9 A;  1OC8 A;  2X8H A;  1ZYQ B;  5ELG A;  5A34 A;  5CRE A;  2GST A;  2B5Y A;  3VI7 A;  3US3 A;  2PUK C;  4ICY A;  1KTE A;  3APQ A;  1KBN A;  4BL7 A;  3M1G A;  1XBS A;  1TK8 B;  5KN0 A;  1GSS A;  2HZF A;  1R26 A;  1TRW A;  3FR6 A;  1UVZ A;  4K5S A;  4GSN A;  1PMT A;  1K0O A;  3IHQ A;  2R3X A;  4GST A;  4GDF A;  3ZFL A;  2LJK A;  5IO2 A;  1SK0 A;  3GFK A;  1TJD A;  5J4V A;  1FG4 A;  2JZR A;  5H5R A;  4TW5 A;  3GYK A;  1U3A A;  4NHZ A;  2H70 A;  3QR6 A;  5F05 A;  2HSH A;  2IMD A;  1ST9 A;  2AAW A;  3LOR A;  1X9M B;  2JSZ A;  3L9V A;  2C0G A;  5F0G A;  2IMK A;  4X1U A;  2WFC A;  4ZB6 A;  1GTU A;  2HZE B;  4PTS A;  3SWL A;  5BRT A;  2HRN A;  1K0C A;  3EYT A;  5IQY A;  3GKM A;  5G1K A;  3GH9 A;  2IL3 A;  1B9Y C;  1TK0 B;  3CSJ A;  1DSB A;  2DC5 A;  4AGS A;  4HQZ A;  3TRQ A;  4LMV A;  3TJF A;  3I9V 2;  5HFI A;  4IQA A;  6GSU A;  4G01 A;  3A2W A;  1F9M A;  1E2Y A;  4X43 A;  5GAN D;  4Q5Q A;  2JZT A;  3TOT A;  4LL4 B;  1W4V A;  2O89 A;  16GS A;  3P8W A;  1V40 A;  4BVY A;  1TW9 A;  1GLQ A;  2YV9 A;  3TOU A;  2CX4 A;  4ZBB A;  5IOX A;  4MZW A;  3P2A A;  3O3T A;  3J7Y b;  3VWV A;  1U6T A;  3IHG A;  6GSY A;  3TGZ A;  3P7X A;  1VRS D;  4N0Z A;  2C0D A;  1OYJ A;  1TI3 A;  4Z2T A;  1O73 A;  1XVQ A;  2K18 A;  4JED A;  3IC4 A;  1VF2 A;  5DJL A;  2L4Q A;  3N5O A;  1G0T A;  2DKH A;  5GSS A;  3D21 A;  1THX A;  3LEF A;  3VUR A;  2QGV A;  3IOS A;  2HT9 A;  3F0I A;  3G7I A;  5AIS A;  4PQH A;  3IRA A;  2PVO C;  3FRC A;  1FO5 A;  3ZL5 A;  4K2D A;  4MJB A;  1YEX A;  1B4P A;  1EV4 A;  2B1L A;  10GS A;  1M2A A;  2QKE A;  1O81 A;  1TP9 A;  2CX3 A;  1JLV A;  4BA7 A;  3KJY A;  2HYX A;  2HSY A;  3P90 A;  4J57 E;  3UAR A;  1SKR B;  5F07 A;  5INY A;  1WOU A;  1GUK A;  3CWG A;  2XHF A;  13GS A;  3APS A;  4CDO A;  2WUL A;  3KP8 A;  4WKW A;  1PKW A;  3U5R E;  3K8N A;  1BJX A;  1OKD A;  2RM6 A;  1PRX A;  2VD0 A;  4IBP A;  2E7P A;  3GN3 A;  4Q5R A;  4MK3 A;  1LJR A;  5G5F A;  2PU9 C;  3D4M A;  3QAW A;  3RHB A;  2DJ2 A;  1V2A A;  5ECS A;  2GLR A;  2YWO A;  4OO5 A;  3BJ5 A;  4IP1 A;  1O8X A;  4ZBD A;  1AAZ A;  2VCW A;  2H76 A;  1XZO A;  1ZYN A;  4ZL9 A;  2L57 A;  3KTB A;  1E6B A;  4XHM A;  4YKG A;  4DEJ A;  1ON4 A;  1WE0 A;  1ZGN A;  4KCE A;  2IN3 A;  2PN8 A;  1AW9 A;  2HI7 A;  2DJJ A;  2D2Z A;  4JR4 A;  2YJH A;  1JFU A;  3C73 A;  1A2M A;  2PPT A;  1OVN A;  3QD9 A;  4FQU A;  2CVB A;  3R2Q A;  2HQT A;  2JU5 A;  1I5G A;  4O5U A;  4AKI A;  1GSD A;  5IOW A;  3BBY A;  3WGX A;  2F51 A;  3GKX A;  2HSM A;  4K6X A;  5C04 A;  1YJ6 A;  4MJE A;  2DKI A;  4HU7 A;  3ERF A;  5BMU B;  1XWK A;  2LRT A;  2GQL A;  2QA2 A;  5KOX A;  4KSO A;  1EOG A;  3FW2 A;  1XIY A;  2BTO T;  4JBB A;  4KX4 A;  2EFE A;  1VGL A;  3EPT A;  4L0U A;  4XS4 A;  2B5X A;  4WR4 A;  2H6X A;  1BQ7 A;  1Q98 A;  4V2N A;  3TJB A;  5B6M A;  3FHK A;  3FY7 A;  1Y1U A;  2AHE A;  4MA9 A;  3M3M A;  1M99 A;  4K9Z A;  3F63 A;  1FHE A;  4KDY A;  2LKU A;  4ZIL A;  1VF3 A;  5BMU A;  2ON5 A;  4ACS A;  4HJM A;  2IMI A;  1WIK A;  3DML A;  3A5I A;  1BG5 A;  4FIW A;  5CAX A;  1OC9 A;  3F9U A;  6GSV A;  14GS A;  3U6V A;  1BF5 A;  3IR4 A;  1LBK A;  3IV4 A;  4WEY A;  1SVL A;  4FO5 A;  1WJK A;  2IIY A;  3GNJ A;  2IME A;  3IA1 A;  2YWN A;  4MH2 A;  2HE3 A;  6GSX A;  3ZVJ D;  2PER A;  3GUR A;  2X8G A;  4JRR A;  2FUG 2;  4F0C A;  2RLI A;  5H5Q A;  3TKQ A;  4N3Z A;  3TDG A;  4A5P A;  1TTZ A;  5JWO B;  1SYX A;  4KB3 A;  1OKT A;  4YKF A;  3VFI A;  3A2X A;  2F8A A;  2JZS A;  4OCF A;  5A5H A;  3TRX A;  4ZL7 A;  3QFA C;  1GSF A;  4MCU A;  3GKN A;  5DBQ A;  3QMX A;  5DAK B;  3DWV A;  4KW6 A;  5B7C A;  1THO A;  3EIN A;  4PNF A;  5DCG A;  4TR0 A;  5ID2 A;  4PQ1 A;  1TK5 B;  2YP6 A;  1PSQ A;  4POL A;  3QAV A;  2JAD A;  4Z7X A;  4EUY A;  5G1L A;  1XOA A;  3O76 A;  2KP2 A;  1R4W A;  4AJ6 A;  1HQO A;  5CRG A;  4IKH A;  3DGQ A;  2C4J A;  3ED3 A;  2VL2 C;  1YZX A;  4OD7 A;  4EF0 A;  2FWG A;  1FB6 A;  2YWI A;  1XVW A;  2H73 A;  2RUF A;  2H1D A;  2R0P A;  1BAY A;  2I4A A;  3GTU B;  4QL7 A;  4WF4 A;  1GUL A;  3D4T A;  3IK7 A;  5GAP D;  4YQV A;  4KAE A;  3NIV A;  3KH9 A;  4X0X A;  2C3Q A;  4MMM A;  1BX9 A;  3CMI A;  4XS6 A;  8GSS A;  4XRA A;  2XPD A;  3FZ4 A;  4TXO B;  1TOF A;  4AF2 A;  3UL3 A;  1V98 A;  2EFH A;  2A2S A;  4IP6 A;  3WGD A;  1GWC A;  2LUS A;  1PX7 A;  3ZIT A;  3LG6 A;  3UEM A;  5A1N B;  1A2L A;  1G6Y A;  3GTU A;  4LLR A;  5J4Y A;  2GZY A;  5HFK A;  2L5L A;  5GST A;  2CA8 A;  4WBJ A;  5IMF A;  1CQG A;  3F3R A;  3MIX A;  4ECB A;  2GSS A;  2R4V A;  5B6N A;  3DVX A;  2VKZ G;  2MBT A;  3KMN A;  4Q5F A;  1T8E B;  4W66 A;  2M80 A;  2H1G A;  2HRF A;  2K8V A;  3KH7 A;  5D8I A;  5A1N A;  4K8M A;  4X4J A;  1DE1 A;  2LTK A;  1BED A;  3Q18 A;  2ZNM A;  2VD1 A;  4EDZ A;  3ZMK A;  1GLP A;  4OMV A;  3M9K A;  4N10 A;  4AJ8 A;  2LJR A;  3UBK A;  1JZO A;  5CYY A;  2LQQ A;  2TRC P;  1DE2 A;  3GH6 A;  4WBR D;  1M2D A;  4IHU A;  1B48 A;  1GSQ A;  1ERW A;  1F3B A;  1NHO A;  2XBI A;  5JCW A;  3HD5 A;  3O6T A;  4JU5 A;  2PGT A;  3AY8 A;  3I69 A;  7GSS A;  17GS A;  4IVF A;  4GCI A;  1Y25 A;  1C72 A;  1V57 A;  3DXB A;  4KND A;  3DEX A;  3TKS A;  4O7H A;  2VCT A;  4KCA A;  3C1S A;  4POB A;  5DAL A;  1GSY A;  3FEU A;  4BVX A;  2VCX A;  5AIX A;  2E2M A;  2CVD A;  2DBC A;  4TR3 A;  5G5E A;  4HS1 A;  2LEG A;  1PQN A;  2CVK A;  2R2J A;  2WRT A;  1BYE A;  2XC2 A;  3HZ4 A;  4POM A;  4BWS A;  1GTI A;  2DMM A;  3GRX A;  1HNA A;  3HY2 A;  3GST A;  2I1U A;  2G0F A;  4TKY A;  5F8B A;  2GS3 A;  2VOC A;  5ABR A;  1XW6 A;  3HXS A;  3QOU A;  3DKS A;  5GZZ B;  1V9W A;  1U3I A;  3UBL A;  4YAP A;  3MDK A;  3LFL A;  1ERU A;  4P3Y B;  2GZP A;  2IJY A;  2O87 A;  3GMF A;  5IMZ A;  2KUC A;  1RK4 A;  2WS2 A;  2ZUP A;  5LNK e;  2DLX A;  1XOB A;  4HEA 2;  1T1V A;  3FK8 A;  1PL2 A;  1AQX A;  2B7J A;  4E8H A;  2A4V A;  3UJ1 A;  2TIR A;  1A0R P;  2PMT A;  3LYK A;  2V6O A;  5ECR B;  2IWT A;  2VAF A;  4WF5 A;  4ML1 A;  2H1A A;  5A4U A;  1YVL A;  3J7Y k;  2HZE A;  2KP1 A;  4V2M A;  1MD3 A;  1M2B A;  4EE0 A;  5JWQ B;  3F4R A;  5IMA A;  5J40 A;  4NAX A;  2EIR A;  2Z9S A;  3GUS A;  2GGT A;  2BMX A;  4MNN A;  1ERT A;  1ACV A;  3ZVJ A;  1SJI A;  1F3A A;  1SKS B;  4D73 B;  2OJL A;  1AQW A;  2RM5 A;  5CRW A;  4GRF A;  1SVO A;  2AB6 A;  3ME8 A;  1YKA A;  2HLS A;  2H01 A;  5ECO B;  5HR3 A;  4CW9 A;  4CY6 A;  4TRX A;  2YPM A;  4NWY A;  1NM3 A;  5HQP A;  1OAZ A;  2GTU A;  6GSW A;  4I97 A;  2H1B A;  4MPF A;  3G7Y A;  3IAM 2;  2ES7 A;  3HVS A;  5G2Z A;  4RUV A;  5D9V A;  11GS A;  1QGV A;  3DRN A;  4D73 A;  1M9A A;  2OBI A;  1ERV A;  2OT3 A;  2JSY A;  2MYG A;  5IPH A;  4I5Q A;  4WR5 A;  4HZ2 A;  4FYC A;  2C0F A;  2WJU A;  3UAP A;  5EVO A;  4HOJ A;  3LXZ A;  3F8U A;  1X5E A;  1IYI A;  1Y6E A;  1Z5Y E;  2BJX A;  1Z9H A;  3WD6 A;  1SK2 A;  1ZOF A;  4POK A;  1EZK A;  2E2G A;  3RBT A;  2R6K A;  3MAK A;  2VLU A;  3ZLP A;  1R7H A;  2VCZ A;  3L0H A;  4TN8 A;  3CRU A;  1ML6 A;  4CHS A;  2ZCT A;  3UOM A;  4MJC A;  4TVE A;  1PD2 1;  2P31 A;  4Z2U A;  1Z6M A;  3CSH A;  4MF6 A;  2GDR A;  2C1Y A;  1DBY A;  4YQU A;  3FZ5 A;  4WXT A;  4YAV A;  2VM2 A;  5B8B A;  2B6M A;  3BOA A;  1HYU A;  2GVP A;  1NW2 A;  3S9F A;  4MLY A;  2VL9 A;  1AXD A;  1GNE A;  2FA4 A;  4EXJ A;  2FGX A;  3KD0 A;  5J41 A;  2CV4 A;  2MBS A;  2VUP A;  1X9W B;  4G0I A;  1FAA A;  2A2R A;  5ECL B;  5D93 A;  3UVT A;  2ON7 A;  4I2U A;  4LA1 A;  4KA0 A;  3EMX A;  2H75 A;  3VWX A;  3DD3 A;  1EEM A;  1JLW A;  2AUV A;  4AKG A;  2V41 A;  5CP1 A;  4G0L A;  1LU4 A;  1ILO A;  1QFN A;  4NPB A;  5KN2 A;  2A4H A;  4ZL8 A;  3KP9 A;  2H72 A;  1SL1 B;  4OO4 A;  4F0B A;  4I6X A;  3Q74 A;  4AKH A;  3W8S A;  4LMW A;  2LJA A;  5ENU A;  3QFB C;  4MZC A;  1A0F A;  1K0B A;  3MNG A;  1XWA A;  2RUE A;  22GS A;  4HDE A;  3ZRE A;  1CQH A;  1PN9 A;  1MEK A;  5J9C A;  2K8S A;  1EGO A;  3PPU A;  1TI1 A;  5IIZ A;  18GS A;  2MMZ A;  2VLV A;  2I3Y A;  4TOP A;  5B8A A;  4OWY A;  2NVL A;  1HNB A;  1WP0 A;  1ZL9 A;  3EC3 A;  1WPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...