3WYWA

Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
213
structure length
213
Chain Sequence
PIDLYYVPGSAPCRNVLLAAKAVGVDLNLKLTDLKSGQHLTPEFIKLNPQHNVPTLDDNGFVLNESRAIMTYLADQYGKDDSLYPKDPKKRAKVNQRLYFDMGTLYQSFGDAYYPHMFGGAPLDEDKKKKLGDALVFLDGFLEKSAFVAGEDLTLADLAIVASISTIEAVEYDLSPYKNINSWYSKVKAAAPGYKEANEEGAKGFGQMFKAMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the catalytic site of a Nilaparvata lugens delta-class glutathione transferase.
pubmed doi rcsb
molecule keywords Glutathione S-transferase
molecule tags Transferase
total genus 87
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3wywA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wywA01
3GTUA 3CSIA 3GFKA 5GSSA 3LXTA 3UL3A 2HI7A 2A2SA 2PUKC 5IMVA 3D21A 3W8JA 2JZTA 4HQZA 5AIXA 1T7PB 4KB3A 2X99A 3IDVA 2H19A 3H79A 1XW5A 2VO4A 4GXZA 1GSFA 3C1SA 1AW9A 4TXOB 2GQKA 1HNBA 2TRCP 3IAM2 4TXOA 1YY7A 4V2NA 1V40A 1ZYQB 3HZ8A 4IN0A 5B6NA 4PX1A 3ZL5A 3D4TA 1SD8A 1YKCA 4ZL7A 3TCOA 4MPFA 3E0UA 3HJOA 3FZ9A 3KH7A 1SKWB 3MSZA 2E2GA 2FLSA 3QPMA 1PX6A 4ML1A 4TVEA 3MDKA 4I2UA 2DJ2A 5COHA 2IFQB 3HJMA 5E4WA 4F03A 3TDGA 4MF5A 4E8EA 1WPIA 4IKHA 2F3MA 4HJMA 4L5OA 2K9FA 3GNJA 2X8HA 1YF0A 4ZILA 3LYPA 2TRXA 2QSIA 3CSHA 3DEXA 3O76A 1TI3A 4RQXA 2EIRA 4MZBA 4L0WA 2H01A 1FVJA 2YZUA 1EWXA 1XW9A 1BG5A 2YNXA 2NPBA 1M99A 1V2AA 3UARA 1H75A 1CQGA 2HZEB 1VGLA 3UIWA 1OC3A 2VL9A 1W89A 2VCQA 1ILOA 1SL2B 1DSBA 4EC0A 1XWAA 2F8FA 2V6KA 4EDYA 3A5WA 2OE1A 2B1KA 5ECIB 1UA5A 2QKEA 2I3YA 2LKUA 2IMDA 4ECIA 2GZPA 4K0GA 1O7UA 3MAKA 3BOAA 1Q98A 1SK1A 3P90A 4L8EA 2NTOA 1PKZA 2RLIA 1ZCPA 5AGYA 2KUCA 4PQ1A 2F9SA 2H0GA 2C8UA 4HI7A 3LJRA 1OC8A 1ACVA 3HDCA 2B7KA 5HFGA 3QFAC 5JCGA 1JLWA 1JLVA 1M2BA 1Y25A 2X8CA 2JACA 2B3SA 2MMNA 2A4VA 1OYJA 5IMCA 1QQ2A 1TRUA 3LFLA 4F0CA 4XCSA 1R5AA 1ZL9A 2HSHA 4HZ4A 4OD7A 5B8BA 5CAXA 1XPVA 3HD5A 2RM6A 4ILFA 4YQMA 2I9HA 2ON7A 2WULA 1JZOA 3GSSA 3EC3A 3FW2A 4N10A 4G9HA 3V1WA 3M9JA 4XRDA 1JZRA 1T3BA 4POKA 5ENUA 3FY7A 3FZAA 5LNKe 16GSA 2LV3A 3F6FA 5B7CA 2DMMA 4HZ2A 4K9ZA 2H6XA 3FR6A 3LG6A 1E2YA 3L9UA 4BVXA 2H6ZA 2GQLA 5ECKB 5HR0A 4EF0A 4HOJA 4G0IA 2PERA 3KTLA 3IBHA 1HNAA 4OO5A 4JE1A 4ZBBA 1XWBA 2VL3A 2DIYA 2WGRA 5A4WA 2VCXA 3ZRDA 2VAFA 1V9WA 2V32A 5ID2B 2B5XA 5A4UA 2WS2A 3FHKA 3QAVA 4GSSA 3IOSA 4OFMA 4WBRD 4Q5NA 5CNWA 5AIVA 2C4JA 3EU3A 4RI6A 3FZ5A 5IPHA 5D73A 3M0FA 1EV9A 1B9XC 2H76A 1GUMA 2JSZA 3VWUA 4MJEA 2OE0A 3OR5A 4MLYA 4X43A 1B8XA 5JCUA 12GSA 2YWOA 3WT2A 4MA9A 1Z3EA 1T1VA 2N5AA 2EIQA 1BYEA 4TXVA 2CAQA 3EWLA 5ECHB 2KP1A 4IHUA 4OMVA 4WF5A 1OVNA 4PUAA 2NBSA 1R5PA 3IK7A 3N9JA 1NM3A 4F82A 2F8AA 5HR1A 4JRRA 1K0CA 1PL2A 3L78A 4BL7B 4K7IA 4PTSA 3M8NA 1BAYA 2C3TA 5DALB 1JFUA 5ECRB 2C1YA 3W8SA 1XOAA 4WETA 2VD1A 4J2FA 2H8LA 3AY8A 4GRFA 1O6JA 2B5YA 5H5RA 3WD6A 5EVOA 3CYNA 1PD21 2C80A 1K3YA 2IIYA 1EEMA 2C3QA 3HHVA 3EMPA 2RUEA 3L4NA 2P5QA 1G6YA 2KHPA 3ZREA 4OO4A 2VCVA 3GKMA 2MZCA 3RBTA 3P2AA 1GSUA 1XW6A 4Q5FA 1X0RA 4IP1A 2O8VB 2CV4A 1SU9A 1TW9A 4PQHA 4MPGA 1PKWA 3H93A 5G5EA 14GSA 3RPPA 2HXKA 3EU4A 3FRCA 1T4YA 2KP2A 4K6XA 2N5BA 20GSA 2G0FA 3KP8A 4D73A 3LXZA 1IYIA 4ML6A 1Z7RA 5DDLA 4OFTA 2DIZA 7GSSA 4LL4B 22GSA 4ID0A 3UMAA 1HNCA 1AQWA 3F9UA 1EGRA 3C8EA 4MJBA 4ZIJA 2ZUPA 2HQTA 2PMTA 4WF4A 2GSTA 4DSSA 5J41A 1DUGA 4TN8A 1GSQA 1TKDB 2X64A 4I5QA 3RDWA 2ZNMA 3GKKA 3WT1A 3KTBA 3TGZA 3IC4A 2CQ9A 1MDKA 1R7HA 1ZMAA 2NDOA 3TOUA 3LGCA 4WR5A 4IBPA 1GNWA 1F6MC 3TKSC 1VF3A 1KBNA 4YH2A 3W6GA 1E6BA 3KD0A 3BCIA 5KN0A 4KX4A 3DVXA 4EKZA 3ERGA 3EVIA 5G1LA 1GSSA 5J5NA 2B1LA 3O6TA 4NHWA 5C04A 3APOA 1V98A 1EOGA 1QFNA 4MCUA 4MF7A 4BPYA 3ME7A 2RIIA 3GUSA 5F06A 2FWEA 3PR8A 5D8IA 4BA7A 2V2GA 1MD3A 3PGTA 4ISDA 5IPGA 4MH3A 4KSMA 1OC9B 3QR6A 2LEGA 3LWAA 3CMIA 2V41A 2H74A 1EP8A 1YDKA 4KF9A 4X1UA 5AISA 2HYXA 3E3EA 2VCTA 1ST9A 3EMXA 4ECJA 2K8VA 2HSMB 2VM2A 3KZQA 3ZYWA 1T8EB 5B8AA 4KCAA 4K7OA 2VD0A 2YV7A 2XPEA 1C72A 3TOTA 3QOUA 1TK0B 5LCZA 2JL4A 4O92A 3ZZXA 5KN2A 4EUYA 3GTUB 3VI7A 4MABA 1GUHA 1Q4JA 3VPQA 3TJFA 5IMDA 4IS0A 2QC7A 2GZYA 3QD9A 1TU7A 1PSQA 2FWGA 1SD9A 2HSYA 4OCFA 3ZMLA 11GSA 5G30A 3BBYA 5G2ZA 1YJ6A 4GWRA 1UVZA 3TRXA 2O89A 1LU4A 5GZZB 2DLXA 2WB9A 1YQ1A 1UC7A 2M80A 1M7TA 4K1FA 2M72A 4HEA2 2LRNA 4XHMA 4KA0A 1TP9A 2LRCA 4FO5A 4XS4B 5J9CA 4XS4A 2R3XA 1URMA 2E7PA 2ES7A 3TKQA 1FAAA 2AB6A 2YPMA 2NVLA 1ZGNA 3HCZA 3ZIVA 2K8SA 3TKSE 3IHQA 4POBA 4P3YB 5CRDA 1ABAA 3J7Yk 2H0IA 17GSA 3DMLA 2DJ0A 1OE7A 1AAZA 5IMFA 1DE1A 1XBSA 3HYPA 3LORA 5G1KA 2Z9SA 4KSOA 3UOMA 2DMLA 4WBJA 3VWVA 3QDNA 3MNGA 4O32A 3VI5A 1RQMA 2REMA 2LSTA 3KGKA 3KCMA 3GMFA 3UVTA 3KEBA 4XTSA 1Z7PA 5F07A 3C7MA 3IA1A 1WP0A 4PUFC 2HNLA 3K8NA 3G9BA 4GTUA 3CTGA 4WEYA 4V1Ap 4JR6A 4IJ3A 3ISOA 4ACSA 5HR2A 1B48A 5GAPD 1SK2A 2R5GA 2OBIA 3A2WA 2KLXA 5DAKA 5D96A 2HRKA 5CP1A 1J08A 2PGTA 1I5GA 1N8JA 13GSA 4MK3A 5IOXA 2VCWA 1A2JA 3VFIA 4JEDA 4PXOA 2B5EA 5L71A 1LJRA 2L57A 4N0ZA 5ECNB 1SENA 2IMFA 3QAGA 4TRXA 3Q19A 3DWVA 3M1GA 2YOIA 3CSJA 2JSYA 4GQCA 5DCGA 4OCEA 2GTUA 2HRFA 2VLUA 3WYWA 5D93A 3HXSA 3VWXA 2VOCA 4EDZA 4FYCA 1ML6A 1WRYA 3HA9A 2O87A 6GSYA 2XBQA 1EOHA 5HQPA 2H1BA 2K6VA 3D4MA 2M46A 1YEPA 1GUKA 4AJ7A 3UVHA 1A2MA 4WR4A 2P0GA 2I1UA 2L5LA 2VLVA 4FQUA 4YAVA 5CO3A 4GF0A 2R37A 18GSA 3LSZA 4TR1A 3C1RA 1V58A 2GSSA 4BVXB 5H5SA 3A2VA 4YAPA 1GLPA 2H1AA 2JU5A 3FKFA 2L59A 1B9YC 3GYKA 2L6DA 5FHIA 1GTIA 3RHCA 5C00A 5ECSA 1FOVA 3FZ4A 3Q6OA 4NWYA 2DJKA 3D6IA 1GH2A 2H1DA 5GSTA 1BQ7A 1WIKA 5ECMB 3F4SA 3F3QA 1PMTA 1MEKA 1ERTA 1V57A 1SJIA 3ERWA 1S3DA 5ABRA 1BJXA 6GSSA 2XBIA 3R3EA 2HLSA 3HZ4A 1ON4A 1XVQA 1OE8A 1F9MA 3BCKA 5CYYA 5D9WA 4LL1B 1X5EA 2VM1A 1JZWA 2BTOT 5A4VA 3I6AA 1QGVA 2DBCA 3ZIJA 1NHYA 4GSTA 2PN8A 4G0LA 3LEFA 3FR3A 5AN1A 2AJQB 2GSQA 2VCZA 6GSWA 3ZLPA 3F3RA 2LQQA 3KM6A 4NMUA 1J0FA 2F51A 2LQOA 3HVSA 3QCPA 3WGXA 2CAIA 2O7KA 1GSDA 4AF2A 3O3TA 3I69A 4GCIA 2GZZA 1XXUA 3GKNA 2YWMA 2ON5A 4Z7XA 2PWJA 4AGSA 3UBLA 1RW1A 3DVWA 2UZ8A 2DJJA 4DVCA 4OWYA 1U87A 5B6MA 3NOFA 2CA8A 4Q5RA 1TDIA 3TRQA 2L4QA 3DKSA 2XC2A 5INYA 1EEJA 5EL8A 2IMIA 5DJMA 2RUFA 1GP1A 1HYUA 3FEUA 1TI1A 5HFIA 1K0OA 4FIWA 4JZQA 2IL3A 2VL2C 2MBSA 1AC1A 3UEMA 2AUVA 3UBKA 3KXOA 3GURA 4MH2A 3U5RE 1YKAA 1K3LA 1OKDA 5JCWA 1QUWA 1KNGA 3ERFA 2VIMA 2VUPA 4D73B 4HS1A 3TKPA 3PINA 1SL0B 1K0DA 3P7XA 3GHAA 4K8MA 1OAZA 4CDOA 2MMAA 3D5JA 3KMOA 2WJUA 1M9AA 3VURA 2HRAA 2YCDA 2E0QA 3P8WA 4ULXA 3L0HA 3ZFLA 4ZBAA 4DSSB 2CVDA 1FG4A 2YJ7A 1NSWA 2H75A 5ECQB 4XRAA 1U88A 3VLNA 2IMKA 1K0NA 4MJCA 1GTBA 1M2AA 2FUG2 3ZVJD 3SBCA 4ZB6A 2L5OA 4GSNA 1THOA 2WFCA 2HE3A 4MDCA 3GRXA 3HVXA 2H73A 3EURA 4USSA 4XIHA 2FGXA 5CREA 3IK9A 2LNSA 1WE0A 2XPDA 3ME8A 3RHBA 3VPTA 2FY6A 2H71A 4CW9A 2PVQA 2YV9A 2LS5A 2VLTA 1MTCA 1A0RP 1X9WB 1PX7A 1K0AA 1SK0A 3ED3A 1EP7A 2OACA 4HJ2A 2FA8A 1LBKA 4TW5A 3M3MA 4E8HA 4AJ6A 3HVVA 1SKRB 1T00A 2IN3A 1A8YA 3EYTA 4BVYA 3EE2A 3QAWA 1I9DA 1VRSD 4KDXA 2YWIA 3NZNA 5EY6A 2N5FA 1A23A 3C73A 4ZXGA 4IVFA 5DCHA 2OADA 3IAS2 1SYXA 2C0GA 1Y6EA 3GKXA 4PURA 3FK8A 1Z5YE 2MMZA 3CTFA 3APQA 4G0KA 2YJHA 1THXA 3APSA 2L4CA 5KN3A 4J56E 4MJAA 4WKWA 4ZL9A 4AJ8A 3WGEA 3KH9A 5HR3A 3L9SA 1KTEA 2H30A 2JZSA 1TXXA 5E59A 2MMOA 6GSTA 2MYGA 4HU9A 3SWLA 1B4QA 3RAZA 1FB6A 1NW2A 1G7EA 4JU5A 1OKTA 1FO5A 4LA1A 5DQYA 4HQSA 4FYUA 3I9V2 3F0IA 1GNEA 1QMVA 1TOFA 1X9MB 1WOUA 2DJ1A 4PNFA 2FCHA 4O7HA 3F4TA 2R2JA 4LLRA 4EVMA 1M2DA 2LJAA 3Q18A 1XOBA 2HFDA 6GSVA 2FHEA 4ECBA 1GULA 1A24A 4K7NA 2TIRA 3IV4A 2O85A 4GQFA 4L0UA 5IMZA 9GSSA 2VL2A 2HRNA 2IPAA 3TKRA 1O85A 4XS1A 5F0GA 1XCCA 4V2MA 2J9HA 2PVOC 3HJPA 1XIYA 5D9VA 2C0DA 1GWCA 2ALBA 1TK5B 4EE0A 4IGJA 2OBKA 5JWRB 1WJKA 1MD4A 3C71A 3ZTLA 3I43A 1QXHA 3G7IA 2OJLA 1F3AA 3LQ7A 1GTAA 2YWNA 5J9BA 1O73A 1F3BA 3IRAA 4K2DA 3CRUA 3BJ5A 1USBA 2GQMA 1N2AA 1PRXA 3GIXA 3VWWA 2IFQA 2YN1A 5DBQA 1GL8A 2YP6A 3QFBC 4KCEA 1EGOA 5KN1A 10GSA 4YQUA 4KDUA 2OA7A 1K0MA 2I4AA 5G5FA 1O8XA 6GSXA 3BD2A 4GLTA 4G2EA 4V2LA 1BEDA 2CZ2A 1YF1A 4POLA 1CQHA 3L9VA 1YEXA 5ECLB 1HD2A 4IQAA 4V1Ag 3H4KA 1EV4A 3IR4A 2B6MA 3F8UA 2HSNB 4PQIA 1W4VA 1VF1A 2WCIA 5IO2A 2K18A 2HZEA 1K3OA 3TKSA 2CX3A 4ZB9A 5DAKB 2CT6A 4G10A 2HRKB 1F2EA 4JBBA 2C0FA 2AAWA 4I2TA 3KJYA 1J9BA 2BJXA 1G7OA 4TR0A 2H72A 1IYHA 4QL7A 4KNDA 1DBYA 2FWFA 2KOKA 3GX0A 3ZMKA 4EL1A 3M9KA 2BMXA 1X5DA 3PH9A 3WGDA 5IO0A 2GT5A 2HT9A 3IXRA 4EXJA 3N5OA 2PBJA 2EIOA 3IC8A 4HUAA 1PA3A 3US3A 4MZCA 4MMMA 1XWGA 1PGTA 4NXIA 2IWTA 4ECCA 1HQOA 5ECOB 3GL5A 1A0FA 3J7Yb 5IMAA 1ERWA 3QMXA 2HZFA 3RPNA 1Z6NA 2GLRA 1TRSA 1Z9HA 4KAEA 1WMJA 2DC5A 1XZOA 1GLQA 4G19A 1SYRA 5IIZA 3TUEA 4F2IA 4TR1B 2QGVA 3JCML 4PGTA 1TRWA 1GSYA 1TK8B 1QK8A 1JHBA 1F37A 3GV1A 5D9XA 1UN2A 1T4ZA 4TKYA 4LMWA 4JR4A 5DVBA 1SJ6A 3GH6A 1AIUA 1GRXA 4MP4A 1O8WA 1AUCA 3Q74A 3GA4A 3MWHA 2GS3A 2R6KA 2GGTA 5LD0A 2B7JA 19GSA 2DSAA 4N0VA 3R2QA 1GTUA 5JWQB 2FA4A 3D0ZA 2CVKA 2WDUA 3ZVJA 1WWJA 1PL1A 5D9TA 4BWSA 2AV4A 2GVPA 2P5RA 3GX8A 1H4OA 4TR3A 3UAPA 1U3IA 1O81A 2J23A 5ID2A 1S3AA 2WRTA 3DRNA 3IE3A 1A2LA 5IM9A 2E2MA 4DSQA 2GSRA 2RM5A 2WZ9A 1DE2A 1MDIA 2GT6A 1FB0A 2CX4A 2LRTA 2XHFA 2X8GA 2G2QA 3CRTA 4EO3A 1ERVA 4FYBA 5H5QA 5IOWA 3FR9A 1XVWA 5FWGA 1FHEA 4IP6A 4Q5QA 2LTKA 2GDRA 3VK9A 4WXTA 3E9JB 1NHOA 5ELGA 4ZBDA 3CXGA 4MZWA 2ZCTA 1R26A 1FVKA 1X9SB 3D22A 5CRGA 1AQVA 2P31A 3GSTA 2H70A 1R4WA 4I97A 8GSSA 4YQVA 3DXBA 2YANA 2PU9C 4ZL8A 2MBTA 4BL7A 4X0XA 3KMNA 2R4VA 5DALA 4DSRA 2OKAA 1A8LA 1S3CA 6GSUA 1X5CA 5CRHA 4IJIA 4I8BA 1G6WA 4NHZA 5DQSA 3LYKA 5BMUA 4PNGA 4F0BA 1PQNA 4J57E 4I6XA 2V6OA 3TB2A 1SKSB 2I81A 3FYGA 3U6VA 4K0NA 4TR4A 4NV5A 1ZYEA 5DJLA 1XWKA 3HY2A 3DIEA 4QL9A 4NV2A 4RQRA 1AQXA 2YZHA 1XWCA 4CHSA 2OE3A 4BWQA 2LJRA 4RI7A 5CRWA 5J3RA 1VF4A 1XFLA 4IELA 2FNOA 2IMEA 4N30A 5JWOB 4KUNA 3H1NA 1FW1A 1B4PA 5ELAA 4NPBA 1VF2A 5GAND 3CBUA 5J4UA 5A5KA 1KEBA 2FD3A 2H0HA 2LNTA 2AYTA 4KGIA 5FT3A 2V1MA 1K0BA 3G7JA 5KEJA 1SJZA 4KDYA 5ECPB 3DGQA 3TJJA 3KIJA 4IQ1A 4O5RA 2L6CA 2JADA 1TRVA 3S9FA 2A2RA 4KH7A 4LMVA 1TU8A 3A2XA 1EZKA 5EPFA 4RUVA 1TJDA 5F05A 1AXDA 2C0EA 4HDEA 1RK4A 3IPZA 1YZXA 3NIVA 3G7YA 2EC4A 1ERUA 1U3AA 5IQYA 2DJ3A 3TRPA 2H66A 3GN3A 2C3NA 3A3TA 2D2ZA 4HU7A 4BVYB 4NAXA 2CVBA 4MF6A 4QQ7A 1MDJA 4H86A 2LUSA 3H8QA 4DEJA 4L5LA 4POMA 4TOPA 1Z6MA 3ZITA 3DYRA 2CZ3A 3F6DA 1M0UA 4IW9A 5G31A 3GL3A 2IJYA 4FH8A 3F4RA 3TJGA 2PPTA 3UJ1A 4N11A 3DD3A 1JZDA 1OC9A 1ZOFA 3ZFBA 3KP9A 4F9ZA 4ZB8A 3HKRA 1TTZA 2H1GA 3TJKA 5HFKA 3PPUA 3TJBA 2JZRA 1GSEA 4KE3A 2AHEA 3GH9A 1U6TA 2HSMA 1PN9A 1ZZYA 3EINA 1G0TA 2FWHA 5F8BA 3F63A 4KW6A 4OFNA 2LJKA 1SL1B 2H6YA 1BX9A 1M9BA 4XS6A
chains in the Genus database with same CATH superfamily
3GTUA 3CSIA 3GFKA 5GSSA 3LXTA 3UL3A 2HI7A 2A2SA 2PUKC 5IMVA 3D21A 3W8JA 2JZTA 4HQZA 5AIXA 2OT3A 1T7PB 4KB3A 2X99A 3IDVA 2H19A 3H79A 1XW5A 2VO4A 4GXZA 1GSFA 3C1SA 1AW9A 4TXOB 2GQKA 1HNBA 2TRCP 3A5IA 3IAM2 1YY7A 4TXOA 4V2NA 1V40A 1ZYQB 3HZ8A 4IN0A 5B6NA 4PX1A 3ZL5A 4AKGA 3D4TA 1SD8A 1YKCA 4ZL7A 3TCOA 4MPFA 3E0UA 3HJOA 3FZ9A 3KH7A 1SKWB 3MSZA 2E2GA 2FLSA 3QPMA 1PX6A 4ML1A 4TVEA 3MDKA 4I2UA 2DJ2A 5COHA 2IFQB 3HJMA 5E4WA 4F03A 3TDGA 4MF5A 4E8EA 1WPIA 4IKHA 2F3MA 4HJMA 4L5OA 2K9FA 3GNJA 2X8HA 1YF0A 4ZILA 3LYPA 2TRXA 2QSIA 3CSHA 3DEXA 3O76A 1TI3A 4RQXA 1ZYNA 2EIRA 4MZBA 4L0WA 2H01A 1FVJA 2YZUA 1EWXA 1XW9A 1BG5A 2YNXA 2NPBA 1M99A 1V2AA 3UARA 5J4YA 1H75A 1CQGA 2HZEB 1VGLA 3UIWA 1OC3A 2VL9A 1W89A 2VCQA 1ILOA 1SL2B 1DSBA 4EC0A 1XWAA 2F8FA 2V6KA 4EDYA 3A5WA 2OE1A 2B1KA 5ECIB 1UA5A 2QKEA 2I3YA 2LKUA 2IMDA 4ECIA 2GZPA 3CHXC 4K0GA 1O7UA 3MAKA 3BOAA 1Q98A 1SK1A 3P90A 4L8EA 2NTOA 1PKZA 4W66A 2RLIA 1ZCPA 5AGYA 2KUCA 4PQ1A 5J40A 2F9SA 2H0GA 2C8UA 4HI7A 3LJRA 4YKFA 1OC8A 1ACVA 3HDCA 2B7KA 5HFGA 3QFAC 5JCGA 1JLWA 1JLVA 1M2BA 1Y25A 2X8CA 2JACA 2B3SA 5KOXA 2MMNA 2A4VA 1OYJA 5IMCA 1QQ2A 1TRUA 3LFLA 4F0CA 4XCSA 1R5AA 2O5VA 1ZL9A 2HSHA 4HZ4A 5BRTA 4OD7A 5B8BA 5CAXA 1XPVA 3HD5A 2RM6A 4ILFA 4YQMA 2I9HA 2ON7A 2WULA 1JZOA 3GSSA 3EC3A 3FW2A 4N10A 4G9HA 3V1WA 3M9JA 4XRDA 1JZRA 1T3BA 4POKA 5ENUA 3FY7A 3FZAA 5LNKe 16GSA 5A5HB 2LV3A 3F6FA 5B7CA 2DMMA 4HZ2A 4K9ZA 2H6XA 1BF5A 3FR6A 3LG6A 1E2YA 3L9UA 4BVXA 2H6ZA 2GQLA 5ECKB 5HR0A 4EF0A 4HOJA 4G0IA 4O5QA 2PERA 3KTLA 3IBHA 1HNAA 4OO5A 4JE1A 4ZBBA 1XWBA 2VL3A 2DIYA 2WGRA 5A4WA 2VCXA 3ZRDA 2VAFA 1V9WA 2V32A 5ID2B 2B5XA 5KOWA 5A4UA 2WS2A 3FHKA 3QAVA 4GSSA 3IOSA 4AKXB 4OFMA 4WBRD 4Q5NA 5CNWA 5AIVA 2C4JA 3TU3B 3EU3A 4RI6A 3FZ5A 5IPHA 5D73A 3M0FA 1EV9A 1B9XC 2H76A 1GUMA 2JSZA 3VWUA 4MJEA 2OE0A 3OR5A 4MLYA 4X43A 1B8XA 5JCUA 12GSA 2YWOA 3WT2A 4MA9A 1Z3EA 1T1VA 2N5AA 2EIQA 1BYEA 4TXVA 2CAQA 3EWLA 5ECHB 4ZB7A 2KP1A 4IHUA 4OMVA 4WF5A 1OVNA 4PUAA 2NBSA 1R5PA 3IK7A 3N9JA 1NM3A 4F82A 2F8AA 5HR1A 4JRRA 1K0CA 1PL2A 3L78A 4BL7B 4K7IA 4PTSA 3M8NA 1BAYA 2C3TA 5DALB 1JFUA 2R0GA 5ECRB 2C1YA 3W8SA 1XOAA 4WETA 2VD1A 4J2FA 2H8LA 1ZYPA 3AY8A 4GRFA 1O6JA 2B5YA 5H5RA 3WD6A 5EVOA 3CYNA 1PD21 2C80A 2QA2A 2WZSA 1K3YA 2IIYA 1EEMA 2C3QA 5BMUB 3HHVA 3EMPA 2RUEA 3L4NA 2P5QA 2WVXA 1G6YA 2KHPA 3ZREA 4OO4A 2VCVA 4PI2C 3GKMA 2MZCA 3RBTA 3P2AA 1GSUA 1XW6A 4Q5FA 1X0RA 4IP1A 2O8VB 2CV4A 1SU9A 1TW9A 4BIKA 4PQHA 4MPGA 1PKWA 2WVYA 3H93A 5G5EA 3MYDA 14GSA 3RPPA 2HXKA 3EU4A 3FRCA 1T4YA 2KP2A 4K6XA 2N5BA 20GSA 2G0FA 3KP8A 4D73A 3LXZA 2A2PA 1IYIA 4ML6A 1Z7RA 5DDLA 4OFTA 2DIZA 7GSSA 4LL4B 22GSA 4ID0A 3UMAA 1HNCA 1AQWA 3F9UA 4AKIA 1EGRA 3C8EA 4MJBA 4ZIJA 2ZUPA 2HQTA 2PMTA 4WF4A 2GSTA 4DSSA 5J41A 1DUGA 4TN8A 1GSQA 1TKDB 2X64A 4I5QA 3RDWA 2ZNMA 2VKZG 3GKKA 3WT1A 3KTBA 3TGZA 3IC4A 2CQ9A 1MDKA 1R7HA 1ZMAA 2NDOA 3TOUA 3LGCA 4WR5A 4IBPA 1GNWA 1F6MC 2DKHA 3TKSC 1VF3A 1KBNA 4QMKA 4YH2A 3W6GA 1E6BA 3KD0A 3BCIA 5KN0A 4KX4A 1XG8A 3DVXA 4EKZA 3ERGA 3EVIA 5G1LA 1GSSA 4PHZC 5J5NA 2B1LA 3O6TA 4NHWA 5C04A 3APOA 1V98A 1EOGA 1QFNA 4MCUA 4MF7A 4BPYA 3ME7A 2RIIA 3RFRC 3GUSA 5F06A 2FWEA 3PR8A 5D8IA 4CY6A 4BA7A 2V2GA 1MD3A 3PGTA 4ISDA 5IPGA 4MH3A 4KSMA 1OC9B 3QR6A 2LEGA 3LWAA 3CMIA 2V41A 2H74A 1EP8A 1YDKA 4KF9A 3FMWA 4X1UA 5AISA 2HYXA 3E3EA 2VCTA 1ST9A 3EMXA 4ECJA 2K8VA 2HSMB 2VM2A 3KZQA 3ZYWA 1T8EB 5B8AA 4KCAA 4K7OA 2VD0A 2YV7A 2XPEA 1C72A 3TOTA 3QOUA 1TK0B 5LCZA 2X49A 2JL4A 4O92A 3ZZXA 5KN2A 4EUYA 3GTUB 3VI7A 4MABA 1GUHA 1Q4JA 3VPQA 3CQFA 5IMDA 3TJFA 4IS0A 2QC7A 2GZYA 3QD9A 1TU7A 2EFEA 1PSQA 2FWGA 4FXYP 1SD9A 2HSYA 4OCFA 3ZMLA 11GSA 5G30A 3BBYA 5G2ZA 1YJ6A 4GWRA 1UVZA 3TRXA 2O89A 1LU4A 5GZZB 2O3EA 2DLXA 2WB9A 1YQ1A 1UC7A 2M80A 1M7TA 4K1FA 2M72A 4HEA2 2LRNA 1BG1A 4XHMA 4KA0A 1TP9A 2LRCA 4FO5A 2R0PA 4XS4B 5J9CA 4XS4A 2R3XA 1URMA 2E7PA 2ES7A 3TKQA 1FAAA 2AB6A 2YPMA 2NVLA 1ZGNA 3HCZA 3ZIVA 2K8SA 3TKSE 3IHQA 4POBA 4P3YB 5CRDA 1ABAA 3J7Yk 2H0IA 2WW3A 17GSA 3DMLA 4AI6A 2DJ0A 1OE7A 1AAZA 5IMFA 1DE1A 1XBSA 3HYPA 3LORA 5G1KA 2Z9SA 4KSOA 3UOMA 2DMLA 4WBJA 3VWVA 3QDNA 3MNGA 4O32A 3VI5A 1RQMA 2REMA 2LSTA 3KGKA 3KCMA 3GMFA 3UVTA 3KEBA 4XTSA 1Z7PA 5F07A 3C7MA 3IA1A 4K5SA 1WP0A 1SVOA 4PUFC 2HNLA 3K8NA 3G9BA 4GTUA 3CTGA 4WEYA 4V1Ap 4JR6A 4IJ3A 3ISOA 4ACSA 5HR2A 2HSNA 1B48A 5GAPD 2X4AA 1SK2A 2R5GA 2OBIA 3A2WA 2KLXA 5DAKA 5D96A 2HRKA 5CP1A 1J08A 2PGTA 1I5GA 1N8JA 13GSA 4MK3A 5IOXA 2VCWA 1A2JA 3VFIA 4JEDA 4PXOA 2B5EA 5L71A 4HSCX 1LJRA 2L57A 4N0ZA 5ECNB 1SENA 2IMFA 3QAGA 4TRXA 3Q19A 3CWGA 3DWVA 3M1GA 2YOIA 3CSJA 2JSYA 4GQCA 5DCGA 4OCEA 2GTUA 2HRFA 2VLUA 3WYWA 5D93A 3HXSA 3HMJG 3VWXA 2VOCA 4EDZA 4FYCA 1ML6A 1WRYA 3HA9A 2O87A 6GSYA 2XBQA 1EOHA 5HQPA 2H1BA 2K6VA 3D4MA 2A4HA 2M46A 1YEPA 1GUKA 4AJ7A 3UVHA 1A2MA 4WR4A 2P0GA 2I1UA 2L5LA 2VLVA 4FQUA 4YAVA 5CO3A 4GF0A 2R37A 18GSA 3LSZA 4TR1A 3C1RA 5A34A 1V58A 2GSSA 4BVXB 5H5SA 3A2VA 4YAPA 1GLPA 2H1AA 2JU5A 3FKFA 2L59A 1B9YC 3GYKA 2L6DA 5FHIA 1GTIA 3RHCA 5C00A 5ECSA 1FOVA 3FZ4A 3Q6OA 4NWYA 2DJKA 3D6IA 1GH2A 2H1DA 5GSTA 1BQ7A 1WIKA 5ECMB 3F4SA 3F3QA 1PMTA 1MEKA 1ERTA 1V57A 1SJIA 3ERWA 1S3DA 5ABRA 1BJXA 6GSSA 2XBIA 3R3EA 2H1LA 2HLSA 3HZ4A 1ON4A 1XVQA 1OE8A 1F9MA 3BCKA 5CYYA 5D9WA 4LL1B 1X5EA 2VM1A 1JZWA 2BTOT 5A4VA 3I6AA 1QGVA 2DBCA 3ZIJA 1NHYA 4GSTA 2PN8A 4G0LA 3LEFA 3FR3A 5AN1A 2AJQB 2GSQA 2VCZA 6GSWA 3ZLPA 3F3RA 2LQQA 4MNNA 3KM6A 4NMUA 1J0FA 2F51A 2LQOA 3HVSA 3QCPA 3WGXA 2CAIA 2O7KA 1GSDA 4AF2A 3O3TA 3I69A 4GCIA 2GZZA 1XXUA 3GKNA 2YWMA 2ON5A 4Z7XA 2PWJA 4AGSA 3UBLA 1RW1A 3DVWA 2UZ8A 2DJJA 4DVCA 4OWYA 1U87A 5B6MA 3NOFA 2CA8A 4Q5RA 1TDIA 3TRQA 2L4QA 3DKSA 2XC2A 5INYA 2WVXB 2EFCA 1EEJA 5EL8A 2IMIA 5DJMA 2RUFA 1GP1A 1HYUA 3FEUA 1TI1A 2R0CA 5HFIA 1K0OA 4FIWA 4JZQA 4O5UA 2IL3A 2VL2C 2MBSA 1AC1A 3UEMA 2AUVA 3UBKA 3KXOA 3GURA 4MH2A 3U5RE 1YKAA 1K3LA 1OKDA 5JCWA 1QUWA 4Z2UA 1KNGA 1FOHA 3ERFA 2VIMA 2VUPA 4D73B 1SVLA 4HS1A 3TKPA 3PINA 1SL0B 1K0DA 3P7XA 3GHAA 4K8MA 1OAZA 4CDOA 2MMAA 3D5JA 2UV8G 3KMOA 2WJUA 1M9AA 3VURA 2HRAA 2YCDA 2E0QA 3P8WA 4ULXA 1PFOA 3L0HA 3ZFLA 4ZBAA 4DSSB 2CVDA 1FG4A 2YJ7A 1NSWA 2H75A 5ECQB 4XRAA 1U88A 3VLNA 2IMKA 1K0NA 4MJCA 1GTBA 1M2AA 2FUG2 3ZVJD 3SBCA 4ZB6A 2L5OA 4GSNA 1THOA 2WFCA 2HE3A 4MDCA 3GRXA 3HVXA 2H73A 3EURA 3RGBC 4USSA 4XIHA 2FGXA 5CREA 3IK9A 2LNSA 1WE0A 2XPDA 3ME8A 3RHBA 1YEWC 3VPTA 2FY6A 2H71A 4CW9A 2PVQA 2YV9A 2LS5A 2VLTA 1MTCA 1A0RP 1X9WB 1PX7A 1K0AA 1SK0A 3ED3A 1EP7A 2OACA 4HJ2A 2FA8A 1LBKA 4TW5A 3M3MA 4E8HA 4AJ6A 3HVVA 1SKRB 1T00A 2IN3A 1A8YA 3EYTA 4BVYA 3EE2A 3QAWA 1I9DA 1VRSD 4KDXA 2YWIA 3NZNA 2O36A 5EY6A 2N5FA 1A23A 3C73A 4ZXGA 4IVFA 5DCHA 2OADA 3IAS2 1SYXA 2C0GA 1Y6EA 3GKXA 4PURA 5A1NA 3FK8A 1Z5YE 1M3JA 2MMZA 3CTFA 3APQA 4G0KA 2YJHA 1THXA 3APSA 2L4CA 5KN3A 4J56E 4MJAA 4WKWA 4ZL9A 4AJ8A 3WGEA 3KH9A 5HR3A 3L9SA 1KTEA 2H30A 2JZSA 1TXXA 5E59A 2MMOA 6GSTA 2MYGA 4HU9A 3SWLA 1B4QA 1N25A 4K5RA 1M3IA 3RAZA 1FB6A 1NW2A 1G7EA 4JU5A 1OKTA 1FO5A 4LA1A 5DQYA 4HQSA 4FYUA 3I9V2 3F0IA 1GNEA 1QMVA 1TOFA 1X9MB 1WOUA 2DJ1A 4EIPA 4PNFA 2FCHA 4O7HA 3F4TA 2R2JA 4LLRA 4EVMA 1M2DA 2LJAA 3Q18A 1XOBA 2QA1A 2HFDA 6GSVA 2FHEA 4ECBA 1GULA 4K2XA 1A24A 4K7NA 1I1IP 2TIRA 3IV4A 2O85A 4GQFA 4L0UA 5IMZA 9GSSA 2VL2A 2HRNA 2IPAA 3TKRA 1O85A 4XS1A 5F0GA 1XCCA 4V2MA 2J9HA 2PVOC 3HJPA 1XIYA 5D9VA 2C0DA 1GWCA 2ALBA 1TK5B 4EE0A 4IGJA 2OBKA 5JWRB 1WJKA 1MD4A 3C71A 3ZTLA 3I43A 1QXHA 3G7IA 2OJLA 1F3AA 3LQ7A 1GTAA 2YWNA 5J9BA 1O73A 1F3BA 3IRAA 3IHGA 3CRUA 4K2DA 3BJ5A 1USBA 2GQMA 1N2AA 1PRXA 3GIXA 3VWWA 2IFQA 2YN1A 5DBQA 1GL8A 2EFHA 2EFDA 2YP6A 3QFBC 4KCEA 1EGOA 5KN1A 10GSA 4YQUA 4KDUA 2OA7A 1K0MA 2I4AA 5G5FA 1O8XA 6GSXA 3BD2A 4GLTA 4G2EA 4V2LA 1BEDA 2CZ2A 1YF1A 4POLA 1CQHA 3L9VA 5J4VA 5ECLB 1YEXA 1HD2A 4IQAA 4V1Ag 3H4KA 1EV4A 3IR4A 2B6MA 3F8UA 2HSNB 4PQIA 1W4VA 1VF1A 2WCIA 5IO2A 2K18A 2HZEA 1K3OA 3TKSA 4X4JA 2CX3A 4ZB9A 5DAKB 2CT6A 4G10A 2HRKB 1F2EA 4JBBA 2C0FA 2AAWA 4I2TA 3KJYA 1J9BA 2BJXA 1G7OA 4TR0A 2H72A 1IYHA 4QL7A 4KNDA 1DBYA 2FWFA 2KOKA 3GX0A 3ZMKA 4EL1A 3M9KA 2BMXA 1X5DA 1TXUA 3PH9A 3WGDA 5IO0A 2GT5A 2HT9A 3IXRA 4EXJA 3N5OA 2PBJA 2EIOA 3IC8A 4HUAA 1PA3A 3US3A 1Y1UA 4MZCA 4MMMA 1XWGA 1PGTA 4NXIA 2IWTA 4ECCA 1HQOA 5ECOB 3GL5A 1A0FA 3J7Yb 5IMAA 1ERWA 3QMXA 2HZFA 3RPNA 1Z6NA 2GLRA 1TRSA 4EIQA 1Z9HA 4KAEA 1WMJA 2DC5A 1XZOA 1GLQA 4G19A 1SYRA 5IIZA 3TUEA 4F2IA 4TR1B 2QGVA 3JCML 5A34B 4PGTA 1TRWA 1GSYA 1TK8B 1QK8A 1JHBA 1F37A 3GV1A 5D9XA 1UN2A 1T4ZA 4TKYA 4LMWA 4JR4A 5DVBA 1SJ6A 3GH6A 4CY8A 1AIUA 1GRXA 4MP4A 1O8WA 1AUCA 3Q74A 3GA4A 3MWHA 2GS3A 2R6KA 5A5HA 2GGTA 5LD0A 2B7JA 19GSA 2DSAA 4N0VA 3R2QA 1GTUA 5JWQB 2FA4A 4Z2RA 3D0ZA 2CVKA 2WDUA 1S3RA 3ZVJA 1WWJA 1PL1A 5D9TA 4BWSA 2AV4A 2GVPA 2P5RA 2WW1A 3GX8A 1H4OA 4TR3A 3UAPA 1U3IA 1O81A 2J23A 5ID2A 1S3AA 2WRTA 4YKGA 3DRNA 3IE3A 1A2LA 5IM9A 2E2MA 4DSQA 2GSRA 2RM5A 2WZ9A 1DE2A 1MDIA 2GT6A 1FB0A 2CX4A 2LRTA 2XHFA 2X8GA 2G2QA 3CRTA 4EO3A 1ERVA 4FYBA 5H5QA 5IOWA 3FR9A 1XVWA 5FWGA 1FHEA 4IP6A 4Q5QA 2LTKA 2GDRA 3VK9A 4WXTA 3E9JB 1NHOA 5ELGA 4ZBDA 3CXGA 4MZWA 2ZCTA 1R26A 1FVKA 1X9SB 3D22A 5CRGA 1AQVA 2P31A 3GSTA 2H70A 1R4WA 4I97A 3HVNA 8GSSA 4YQVA 3DXBA 2YANA 2PU9C 2DKIA 4ZL8A 2MBTA 4BL7A 4X0XA 3KMNA 2R4VA 5DALA 4DSRA 3MIXA 2OKAA 1A8LA 1S3CA 6GSUA 1SVMA 1X5CA 5CRHA 4IJIA 4I8BA 1G6WA 4NHZA 5DQSA 3LYKA 5BMUA 4PNGA 4F0BA 1PQNA 4J57E 4I6XA 2V6OA 3TB2A 3LW9A 4N3ZA 1SKSB 2I81A 3FYGA 3U6VA 4K0NA 4TR4A 2WVZA 4NV5A 1ZYEA 5DJLA 1XWKA 3HY2A 3DIEA 4QL9A 4NV2A 4RQRA 1AQXA 2YZHA 1XWCA 4CHSA 2OE3A 4BWQA 2LJRA 4RI7A 5CRWA 5J3RA 1VF4A 1XFLA 4IELA 4A5PA 2FNOA 2IMEA 4N30A 5JWOB 4KUNA 3H1NA 1FW1A 1B4PA 5ELAA 4NPBA 1VF2A 5GAND 3CBUA 5J4UA 5A5KA 1KEBA 1PN0A 1YVLA 2H0HA 2LNTA 2FD3A 4KGIA 2AYTA 2WW2A 5FT3A 2V1MA 1K0BA 3G7JA 5KEJA 1SJZA 4KDYA 5ECPB 1S4BP 3DGQA 3TJJA 3KIJA 4IQ1A 4O5RA 2L6CA 2JADA 1TRVA 3S9FA 2A2RA 4KH7A 4LMVA 1TU8A 3A2XA 1EZKA 5EPFA 4RUVA 1TJDA 5F05A 4PI0C 1AXDA 2C0EA 4Z2TA 4HDEA 1RK4A 3IPZA 1YZXA 3NIVA 3G7YA 2EC4A 1ERUA 1U3AA 5IQYA 2DJ3A 3TRPA 5J47A 2H66A 3GN3A 2C3NA 3A3TA 2D2ZA 4HU7A 4BVYB 4NAXA 2CVBA 4MF6A 4QQ7A 4E68A 1MDJA 4H86A 2LUSA 3H8QA 4DEJA 4L5LA 4POMA 4TOPA 1Z6MA 3ZITA 4GDFA 3DYRA 5A1NB 4AKHA 2CZ3A 3F6DA 1M0UA 4IW9A 5G31A 4ICYA 3GL3A 2IJYA 4FH8A 3F4RA 3TJGA 2PPTA 3UJ1A 4N11A 3DD3A 1JZDA 1OC9A 1ZOFA 3ZFBA 3KP9A 2WW0A 4F9ZA 4ZB8A 3HKRA 1TTZA 2H1GA 3TJKA 5HFKA 3PPUA 3TJBA 2JZRA 1GSEA 4KE3A 2AHEA 3GH9A 1U6TA 2HSMA 1PN9A 1ZZYA 3EINA 1G0TA 2FWHA 5F8BA 3F63A 4KW6A 4G01A 4OFNA 2LJKA 1SL1B 2H6YA 1BX9A 3EPTA 1M9BA 4XS6A
chains in the Genus database with same CATH topology
3GTUA 3CSIA 3GFKA 5GSSA 3LXTA 3UL3A 2HI7A 2A2SA 2PUKC 5IMVA 3D21A 3W8JA 2JZTA 4HQZA 5AIXA 2OT3A 1T7PB 4KB3A 2X99A 3IDVA 2H19A 3H79A 1XW5A 2VO4A 4GXZA 1GSFA 3C1SA 1AW9A 4TXOB 2GQKA 1HNBA 2TRCP 3A5IA 3IAM2 1YY7A 4TXOA 4V2NA 1V40A 1ZYQB 3HZ8A 4IN0A 5B6NA 4PX1A 3ZL5A 4AKGA 3D4TA 1SD8A 1YKCA 4ZL7A 3TCOA 4MPFA 3E0UA 3HJOA 3FZ9A 3KH7A 1SKWB 3MSZA 2E2GA 2FLSA 3QPMA 1PX6A 4ML1A 4TVEA 3MDKA 4I2UA 2DJ2A 5COHA 2IFQB 3HJMA 5E4WA 4F03A 3TDGA 4MF5A 4E8EA 1WPIA 4IKHA 2F3MA 4HJMA 4L5OA 2K9FA 3GNJA 2X8HA 1YF0A 4ZILA 3LYPA 2TRXA 2QSIA 3CSHA 3DEXA 3O76A 1TI3A 4RQXA 1ZYNA 2EIRA 4MZBA 4L0WA 2H01A 1FVJA 2YZUA 1EWXA 1XW9A 1BG5A 2YNXA 2NPBA 1M99A 1V2AA 3UARA 5J4YA 1H75A 1CQGA 2HZEB 1VGLA 3UIWA 1OC3A 2VL9A 1W89A 2VCQA 1ILOA 1SL2B 1DSBA 4EC0A 1XWAA 2F8FA 2V6KA 4EDYA 3A5WA 2OE1A 2B1KA 5ECIB 1UA5A 2QKEA 2I3YA 2LKUA 2IMDA 4ECIA 2GZPA 4K0GA 1O7UA 3MAKA 3BOAA 1Q98A 1SK1A 3P90A 4L8EA 2NTOA 1PKZA 4W66A 2RLIA 1ZCPA 5AGYA 2KUCA 4PQ1A 5J40A 2F9SA 2H0GA 2C8UA 4HI7A 3LJRA 4YKFA 1OC8A 1ACVA 3HDCA 2B7KA 5HFGA 3QFAC 5JCGA 1JLWA 1JLVA 1M2BA 1Y25A 2X8CA 2JACA 2B3SA 5KOXA 2MMNA 2A4VA 1OYJA 5IMCA 1QQ2A 1TRUA 3LFLA 4F0CA 4XCSA 1R5AA 2O5VA 1ZL9A 2HSHA 4HZ4A 5BRTA 4OD7A 5B8BA 5CAXA 1XPVA 3HD5A 2RM6A 4ILFA 4YQMA 2I9HA 2ON7A 2WULA 1JZOA 3GSSA 3EC3A 3FW2A 4N10A 4G9HA 3V1WA 3M9JA 4XRDA 1JZRA 1T3BA 4POKA 5ENUA 3FY7A 3FZAA 5LNKe 16GSA 5A5HB 2LV3A 3F6FA 5B7CA 2DMMA 4HZ2A 4K9ZA 2H6XA 1BF5A 3FR6A 3LG6A 1E2YA 3L9UA 4BVXA 2H6ZA 2GQLA 5ECKB 5HR0A 4EF0A 4HOJA 4G0IA 4O5QA 2PERA 3KTLA 3IBHA 1HNAA 4OO5A 4JE1A 4ZBBA 1XWBA 2VL3A 2DIYA 2WGRA 5A4WA 2VCXA 3ZRDA 2VAFA 1V9WA 2V32A 5ID2B 2B5XA 5KOWA 5A4UA 2WS2A 3FHKA 3QAVA 4GSSA 3IOSA 4AKXB 4OFMA 4WBRD 4Q5NA 5CNWA 5AIVA 2C4JA 3TU3B 3EU3A 4RI6A 3FZ5A 5IPHA 5D73A 3M0FA 1EV9A 1B9XC 2H76A 1GUMA 2JSZA 3VWUA 4MJEA 2OE0A 3OR5A 4MLYA 4X43A 1B8XA 5JCUA 12GSA 2YWOA 3WT2A 4MA9A 1Z3EA 1T1VA 2N5AA 2EIQA 1BYEA 4TXVA 2CAQA 3EWLA 5ECHB 4ZB7A 2KP1A 4IHUA 4OMVA 4WF5A 1OVNA 4PUAA 2NBSA 1R5PA 3IK7A 3N9JA 1NM3A 4F82A 2F8AA 5HR1A 4JRRA 1K0CA 1PL2A 3L78A 4BL7B 4K7IA 4PTSA 3M8NA 1BAYA 2C3TA 5DALB 1JFUA 2R0GA 5ECRB 2C1YA 3W8SA 1XOAA 4WETA 2VD1A 4J2FA 2H8LA 1ZYPA 3AY8A 4GRFA 1O6JA 2B5YA 5H5RA 3WD6A 5EVOA 3CYNA 1PD21 2C80A 2QA2A 1K3YA 2IIYA 1EEMA 2C3QA 5BMUB 3HHVA 3EMPA 2RUEA 3L4NA 2P5QA 1G6YA 2KHPA 3ZREA 4OO4A 2VCVA 3GKMA 2MZCA 3RBTA 3P2AA 1GSUA 1XW6A 4Q5FA 1X0RA 4IP1A 2O8VB 2CV4A 1SU9A 1TW9A 4PQHA 4MPGA 1PKWA 3H93A 5G5EA 3MYDA 14GSA 3RPPA 2HXKA 3EU4A 3FRCA 1T4YA 2KP2A 4K6XA 2N5BA 20GSA 2G0FA 3KP8A 4D73A 3LXZA 2A2PA 1IYIA 4ML6A 1Z7RA 5DDLA 4OFTA 2DIZA 7GSSA 4LL4B 22GSA 4ID0A 3UMAA 1HNCA 1AQWA 3F9UA 4AKIA 1EGRA 3C8EA 4MJBA 4ZIJA 2ZUPA 2HQTA 2PMTA 4WF4A 2GSTA 4DSSA 5J41A 1DUGA 4TN8A 1GSQA 1TKDB 2X64A 4I5QA 3RDWA 2ZNMA 2VKZG 3GKKA 3WT1A 3KTBA 3TGZA 3IC4A 2CQ9A 1MDKA 1R7HA 1ZMAA 2NDOA 3TOUA 3LGCA 4WR5A 4IBPA 1GNWA 1F6MC 2DKHA 3TKSC 1VF3A 1KBNA 4QMKA 4YH2A 3W6GA 1E6BA 3KD0A 3BCIA 5KN0A 4KX4A 3DVXA 4EKZA 3ERGA 3EVIA 5G1LA 1GSSA 5J5NA 2B1LA 3O6TA 4NHWA 5C04A 3APOA 1V98A 1EOGA 1QFNA 4MCUA 4MF7A 4BPYA 3ME7A 2RIIA 3GUSA 5F06A 2FWEA 3PR8A 5D8IA 4CY6A 4BA7A 2V2GA 1MD3A 3PGTA 4ISDA 5IPGA 4MH3A 4KSMA 1OC9B 3QR6A 2LEGA 3LWAA 3CMIA 2V41A 2H74A 1EP8A 1YDKA 4KF9A 3FMWA 4X1UA 5AISA 2HYXA 3E3EA 2VCTA 1ST9A 3EMXA 4ECJA 2K8VA 2HSMB 2VM2A 3KZQA 3ZYWA 1T8EB 5B8AA 4KCAA 4K7OA 2VD0A 2YV7A 2XPEA 1C72A 3TOTA 3QOUA 1TK0B 5LCZA 2X49A 2JL4A 4O92A 3ZZXA 5KN2A 4EUYA 3GTUB 3VI7A 4MABA 1GUHA 1Q4JA 3VPQA 3TJFA 5IMDA 4IS0A 2QC7A 2GZYA 3QD9A 1TU7A 2EFEA 1PSQA 2FWGA 1SD9A 2HSYA 4OCFA 3ZMLA 11GSA 5G30A 3BBYA 5G2ZA 1YJ6A 4GWRA 1UVZA 3TRXA 2O89A 1LU4A 5GZZB 2DLXA 2WB9A 1YQ1A 1UC7A 2M80A 1M7TA 4K1FA 2M72A 4HEA2 2LRNA 1BG1A 4XHMA 4KA0A 1TP9A 2LRCA 4FO5A 2R0PA 4XS4B 5J9CA 4XS4A 2R3XA 1URMA 2E7PA 2ES7A 3TKQA 1FAAA 2AB6A 2YPMA 2NVLA 1ZGNA 3HCZA 3ZIVA 2K8SA 3TKSE 3IHQA 4POBA 4P3YB 5CRDA 1ABAA 3J7Yk 2H0IA 17GSA 3DMLA 4AI6A 2DJ0A 1OE7A 1AAZA 5IMFA 1DE1A 1XBSA 3HYPA 3LORA 5G1KA 2Z9SA 4KSOA 3UOMA 2DMLA 4WBJA 3VWVA 3QDNA 3MNGA 4O32A 3VI5A 1RQMA 2REMA 2LSTA 3KGKA 3KCMA 3GMFA 3UVTA 3KEBA 4XTSA 1Z7PA 5F07A 3C7MA 3IA1A 4K5SA 1WP0A 1SVOA 4PUFC 2HNLA 3K8NA 3G9BA 4GTUA 3CTGA 4WEYA 4V1Ap 4JR6A 4IJ3A 3ISOA 4ACSA 5HR2A 2HSNA 1B48A 5GAPD 2X4AA 1SK2A 2R5GA 2OBIA 3A2WA 2KLXA 5DAKA 5D96A 2HRKA 5CP1A 1J08A 2PGTA 1I5GA 1N8JA 13GSA 4MK3A 5IOXA 2VCWA 1A2JA 3VFIA 4JEDA 4PXOA 2B5EA 5L71A 1LJRA 2L57A 4N0ZA 5ECNB 1SENA 2IMFA 3QAGA 4TRXA 3Q19A 3CWGA 3DWVA 3M1GA 2YOIA 3CSJA 2JSYA 4GQCA 5DCGA 4OCEA 2GTUA 2HRFA 2VLUA 3WYWA 5D93A 3HXSA 3HMJG 3VWXA 2VOCA 4EDZA 4FYCA 1ML6A 1WRYA 3HA9A 2O87A 6GSYA 2XBQA 1EOHA 5HQPA 2H1BA 2K6VA 3D4MA 2A4HA 2M46A 1YEPA 1GUKA 4AJ7A 3UVHA 1A2MA 4WR4A 2P0GA 2I1UA 2L5LA 2VLVA 4FQUA 4YAVA 5CO3A 4GF0A 2R37A 18GSA 3LSZA 4TR1A 3C1RA 5A34A 1V58A 2GSSA 4BVXB 5H5SA 3A2VA 4YAPA 1GLPA 2H1AA 2JU5A 3FKFA 2L59A 1B9YC 3GYKA 2L6DA 5FHIA 1GTIA 3RHCA 5C00A 5ECSA 1FOVA 3FZ4A 3Q6OA 4NWYA 2DJKA 3D6IA 1GH2A 2H1DA 5GSTA 1BQ7A 1WIKA 5ECMB 3F4SA 3F3QA 1PMTA 1MEKA 1ERTA 1V57A 1SJIA 3ERWA 1S3DA 5ABRA 1BJXA 6GSSA 2XBIA 3R3EA 2H1LA 2HLSA 3HZ4A 1ON4A 1XVQA 1OE8A 1F9MA 3BCKA 5CYYA 5D9WA 4LL1B 1X5EA 2VM1A 1JZWA 2BTOT 5A4VA 3I6AA 1QGVA 2DBCA 3ZIJA 1NHYA 4GSTA 2PN8A 4G0LA 3LEFA 3FR3A 5AN1A 2AJQB 2GSQA 2VCZA 6GSWA 3ZLPA 3F3RA 2LQQA 4MNNA 3KM6A 4NMUA 1J0FA 2F51A 2LQOA 3HVSA 3QCPA 3WGXA 2CAIA 2O7KA 1GSDA 4AF2A 3O3TA 3I69A 4GCIA 2GZZA 1XXUA 3GKNA 2YWMA 2ON5A 4Z7XA 2PWJA 4AGSA 3UBLA 1RW1A 3DVWA 2UZ8A 2DJJA 4DVCA 4OWYA 1U87A 5B6MA 3NOFA 2CA8A 4Q5RA 1TDIA 3TRQA 2L4QA 3DKSA 2XC2A 5INYA 2EFCA 1EEJA 5EL8A 2IMIA 5DJMA 2RUFA 1GP1A 1HYUA 3FEUA 1TI1A 2R0CA 5HFIA 1K0OA 4FIWA 4JZQA 4O5UA 2IL3A 2VL2C 2MBSA 1AC1A 3UEMA 2AUVA 3UBKA 3KXOA 3GURA 4MH2A 3U5RE 1YKAA 1K3LA 1OKDA 5JCWA 1QUWA 4Z2UA 1KNGA 1FOHA 3ERFA 2VIMA 2VUPA 4D73B 1SVLA 4HS1A 3TKPA 3PINA 1SL0B 1K0DA 3P7XA 3GHAA 4K8MA 1OAZA 4CDOA 2MMAA 3D5JA 2UV8G 3KMOA 2WJUA 1M9AA 3VURA 2HRAA 2YCDA 2E0QA 3P8WA 4ULXA 3L0HA 3ZFLA 4ZBAA 4DSSB 2CVDA 1FG4A 2YJ7A 1NSWA 2H75A 5ECQB 4XRAA 1U88A 3VLNA 2IMKA 1K0NA 4MJCA 1GTBA 1M2AA 2FUG2 3ZVJD 3SBCA 4ZB6A 2L5OA 4GSNA 1THOA 2WFCA 2HE3A 4MDCA 3GRXA 3HVXA 2H73A 3EURA 4USSA 4XIHA 2FGXA 5CREA 3IK9A 2LNSA 1WE0A 2XPDA 3ME8A 3RHBA 3VPTA 2FY6A 2H71A 4CW9A 2PVQA 2YV9A 2LS5A 2VLTA 1MTCA 1A0RP 1X9WB 1PX7A 1K0AA 1SK0A 3ED3A 1EP7A 2OACA 4HJ2A 2FA8A 1LBKA 4TW5A 3M3MA 4E8HA 4AJ6A 3HVVA 1SKRB 1T00A 2IN3A 1A8YA 3EYTA 4BVYA 3EE2A 3QAWA 1I9DA 1VRSD 4KDXA 2YWIA 3NZNA 5EY6A 2N5FA 1A23A 3C73A 4ZXGA 4IVFA 5DCHA 2OADA 3IAS2 1SYXA 2C0GA 1Y6EA 3GKXA 4PURA 5A1NA 3FK8A 1Z5YE 2MMZA 3CTFA 3APQA 4G0KA 2YJHA 1THXA 3APSA 2L4CA 5KN3A 4J56E 4MJAA 4WKWA 4ZL9A 4AJ8A 3WGEA 3KH9A 5HR3A 3L9SA 1KTEA 2H30A 2JZSA 1TXXA 5E59A 2MMOA 6GSTA 2MYGA 4HU9A 3SWLA 1B4QA 1N25A 4K5RA 3RAZA 1FB6A 1NW2A 1G7EA 4JU5A 1OKTA 1FO5A 4LA1A 5DQYA 4HQSA 4FYUA 3I9V2 3F0IA 1GNEA 1QMVA 1TOFA 1X9MB 1WOUA 2DJ1A 4EIPA 4PNFA 2FCHA 4O7HA 3F4TA 2R2JA 4LLRA 4EVMA 1M2DA 2LJAA 3Q18A 1XOBA 2QA1A 2HFDA 6GSVA 2FHEA 4ECBA 1GULA 4K2XA 1A24A 4K7NA 2TIRA 3IV4A 2O85A 4GQFA 4L0UA 5IMZA 9GSSA 2VL2A 2HRNA 2IPAA 3TKRA 1O85A 4XS1A 5F0GA 1XCCA 4V2MA 2J9HA 2PVOC 3HJPA 1XIYA 5D9VA 2C0DA 1GWCA 2ALBA 1TK5B 4EE0A 4IGJA 2OBKA 5JWRB 1WJKA 1MD4A 3C71A 3ZTLA 3I43A 1QXHA 3G7IA 2OJLA 1F3AA 3LQ7A 1GTAA 2YWNA 5J9BA 1O73A 1F3BA 3IRAA 3IHGA 3CRUA 4K2DA 3BJ5A 1USBA 2GQMA 1N2AA 1PRXA 3GIXA 3VWWA 2IFQA 2YN1A 5DBQA 1GL8A 2EFHA 2EFDA 2YP6A 3QFBC 4KCEA 1EGOA 5KN1A 10GSA 4YQUA 4KDUA 2OA7A 1K0MA 2I4AA 5G5FA 1O8XA 6GSXA 3BD2A 4GLTA 4G2EA 4V2LA 1BEDA 2CZ2A 1YF1A 4POLA 1CQHA 3L9VA 5J4VA 5ECLB 1YEXA 1HD2A 4IQAA 4V1Ag 3H4KA 1EV4A 3IR4A 2B6MA 3F8UA 2HSNB 4PQIA 1W4VA 1VF1A 2WCIA 5IO2A 2K18A 2HZEA 1K3OA 3TKSA 4X4JA 2CX3A 4ZB9A 5DAKB 2CT6A 4G10A 2HRKB 1F2EA 4JBBA 2C0FA 2AAWA 4I2TA 3KJYA 1J9BA 2BJXA 1G7OA 4TR0A 2H72A 1IYHA 4QL7A 4KNDA 1DBYA 2FWFA 2KOKA 3GX0A 3ZMKA 4EL1A 3M9KA 2BMXA 1X5DA 1TXUA 3PH9A 3WGDA 5IO0A 2GT5A 2HT9A 3IXRA 4EXJA 3N5OA 2PBJA 2EIOA 3IC8A 4HUAA 1PA3A 3US3A 1Y1UA 4MZCA 4MMMA 1XWGA 1PGTA 4NXIA 2IWTA 4ECCA 1HQOA 5ECOB 3GL5A 1A0FA 3J7Yb 5IMAA 1ERWA 3QMXA 2HZFA 3RPNA 1Z6NA 2GLRA 1TRSA 4EIQA 1Z9HA 4KAEA 1WMJA 2DC5A 1XZOA 1GLQA 4G19A 1SYRA 5IIZA 3TUEA 4F2IA 4TR1B 2QGVA 3JCML 5A34B 4PGTA 1TRWA 1GSYA 1TK8B 1QK8A 1JHBA 1F37A 3GV1A 5D9XA 1UN2A 1T4ZA 4TKYA 4LMWA 4JR4A 5DVBA 1SJ6A 3GH6A 4CY8A 1AIUA 1GRXA 4MP4A 1O8WA 1AUCA 3Q74A 3GA4A 3MWHA 2GS3A 2R6KA 5A5HA 2GGTA 5LD0A 2B7JA 19GSA 2DSAA 4N0VA 3R2QA 1GTUA 5JWQB 2FA4A 4Z2RA 3D0ZA 2CVKA 2WDUA 3ZVJA 1WWJA 1PL1A 5D9TA 4BWSA 2AV4A 2GVPA 2P5RA 3GX8A 1H4OA 4TR3A 3UAPA 1U3IA 1O81A 2J23A 5ID2A 1S3AA 2WRTA 4YKGA 3DRNA 3IE3A 1A2LA 5IM9A 2E2MA 4DSQA 2GSRA 2RM5A 2WZ9A 1DE2A 1MDIA 2GT6A 1FB0A 2CX4A 2LRTA 2XHFA 2X8GA 2G2QA 3CRTA 4EO3A 1ERVA 4FYBA 5H5QA 5IOWA 3FR9A 1XVWA 5FWGA 1FHEA 4IP6A 4Q5QA 2LTKA 2GDRA 3VK9A 4WXTA 3E9JB 1NHOA 5ELGA 4ZBDA 3CXGA 4MZWA 2ZCTA 1R26A 1FVKA 1X9SB 3D22A 5CRGA 1AQVA 2P31A 3GSTA 2H70A 1R4WA 4I97A 8GSSA 4YQVA 3DXBA 2YANA 2PU9C 2DKIA 4ZL8A 2MBTA 4BL7A 4X0XA 3KMNA 2R4VA 5DALA 4DSRA 3MIXA 2OKAA 1A8LA 1S3CA 6GSUA 1SVMA 1X5CA 5CRHA 4IJIA 4I8BA 1G6WA 4NHZA 5DQSA 3LYKA 5BMUA 4PNGA 4F0BA 1PQNA 4J57E 4I6XA 2V6OA 3TB2A 3LW9A 4N3ZA 1SKSB 2I81A 3FYGA 3U6VA 4K0NA 4TR4A 4NV5A 1ZYEA 5DJLA 1XWKA 3HY2A 3DIEA 4QL9A 4NV2A 4RQRA 1AQXA 2YZHA 1XWCA 4CHSA 2OE3A 4BWQA 2LJRA 4RI7A 5CRWA 5J3RA 1VF4A 1XFLA 4IELA 4A5PA 2FNOA 2IMEA 4N30A 5JWOB 4KUNA 3H1NA 1FW1A 1B4PA 5ELAA 4NPBA 1VF2A 5GAND 3CBUA 5J4UA 5A5KA 1KEBA 1PN0A 1YVLA 2FD3A 2LNTA 2AYTA 4KGIA 2H0HA 5FT3A 2V1MA 1K0BA 3G7JA 5KEJA 1SJZA 4KDYA 5ECPB 3DGQA 3TJJA 3KIJA 4IQ1A 4O5RA 2L6CA 2JADA 1TRVA 3S9FA 2A2RA 4KH7A 4LMVA 1TU8A 3A2XA 1EZKA 5EPFA 4RUVA 1TJDA 5F05A 1AXDA 2C0EA 4Z2TA 4HDEA 1RK4A 3IPZA 1YZXA 3NIVA 3G7YA 2EC4A 1ERUA 1U3AA 5IQYA 2DJ3A 3TRPA 5J47A 2H66A 3GN3A 2C3NA 3A3TA 2D2ZA 4HU7A 4BVYB 4NAXA 2CVBA 4MF6A 4QQ7A 4E68A 1MDJA 4H86A 2LUSA 3H8QA 4DEJA 4L5LA 4POMA 4TOPA 1Z6MA 3ZITA 4GDFA 3DYRA 5A1NB 4AKHA 2CZ3A 3F6DA 1M0UA 4IW9A 5G31A 4ICYA 3GL3A 2IJYA 4FH8A 3F4RA 3TJGA 2PPTA 3UJ1A 4N11A 3DD3A 1JZDA 1OC9A 1ZOFA 3ZFBA 3KP9A 4F9ZA 4ZB8A 3HKRA 1TTZA 2H1GA 3TJKA 5HFKA 3PPUA 3TJBA 2JZRA 1GSEA 4KE3A 2AHEA 3GH9A 1U6TA 2HSMA 1PN9A 1ZZYA 3EINA 1G0TA 2FWHA 5F8BA 3F63A 4KW6A 4G01A 4OFNA 2LJKA 1SL1B 2H6YA 1BX9A 3EPTA 1M9BA 4XS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTU A;  3CSI A;  3GFK A;  5GSS A;  3LXT A;  3UL3 A;  2HI7 A;  2A2S A;  2PUK C;  5IMV A;  3D21 A;  3W8J A;  2JZT A;  4HQZ A;  5AIX A;  1T7P B;  4KB3 A;  2X99 A;  3IDV A;  2H19 A;  3H79 A;  1XW5 A;  2VO4 A;  4GXZ A;  1GSF A;  3C1S A;  1AW9 A;  4TXO B;  2GQK A;  1HNB A;  2TRC P;  3IAM 2;  4TXO A;  1YY7 A;  4V2N A;  1V40 A;  1ZYQ B;  3HZ8 A;  4IN0 A;  5B6N A;  4PX1 A;  3ZL5 A;  3D4T A;  1SD8 A;  1YKC A;  4ZL7 A;  3TCO A;  4MPF A;  3E0U A;  3HJO A;  3FZ9 A;  3KH7 A;  1SKW B;  3MSZ A;  2E2G A;  2FLS A;  3QPM A;  1PX6 A;  4ML1 A;  4TVE A;  3MDK A;  4I2U A;  2DJ2 A;  5COH A;  2IFQ B;  3HJM A;  5E4W A;  4F03 A;  3TDG A;  4MF5 A;  4E8E A;  1WPI A;  4IKH A;  2F3M A;  4HJM A;  4L5O A;  2K9F A;  3GNJ A;  2X8H A;  1YF0 A;  4ZIL A;  3LYP A;  2TRX A;  2QSI A;  3CSH A;  3DEX A;  3O76 A;  1TI3 A;  4RQX A;  2EIR A;  4MZB A;  4L0W A;  2H01 A;  1FVJ A;  2YZU A;  1EWX A;  1XW9 A;  1BG5 A;  2YNX A;  2NPB A;  1M99 A;  1V2A A;  3UAR A;  1H75 A;  1CQG A;  2HZE B;  1VGL A;  3UIW A;  1OC3 A;  2VL9 A;  1W89 A;  2VCQ A;  1ILO A;  1SL2 B;  1DSB A;  4EC0 A;  1XWA A;  2F8F A;  2V6K A;  4EDY A;  3A5W A;  2OE1 A;  2B1K A;  5ECI B;  1UA5 A;  2QKE A;  2I3Y A;  2LKU A;  2IMD A;  4ECI A;  2GZP A;  4K0G A;  1O7U A;  3MAK A;  3BOA A;  1Q98 A;  1SK1 A;  3P90 A;  4L8E A;  2NTO A;  1PKZ A;  2RLI A;  1ZCP A;  5AGY A;  2KUC A;  4PQ1 A;  2F9S A;  2H0G A;  2C8U A;  4HI7 A;  3LJR A;  1OC8 A;  1ACV A;  3HDC A;  2B7K A;  5HFG A;  3QFA C;  5JCG A;  1JLW A;  1JLV A;  1M2B A;  1Y25 A;  2X8C A;  2JAC A;  2B3S A;  2MMN A;  2A4V A;  1OYJ A;  5IMC A;  1QQ2 A;  1TRU A;  3LFL A;  4F0C A;  4XCS A;  1R5A A;  1ZL9 A;  2HSH A;  4HZ4 A;  4OD7 A;  5B8B A;  5CAX A;  1XPV A;  3HD5 A;  2RM6 A;  4ILF A;  4YQM A;  2I9H A;  2ON7 A;  2WUL A;  1JZO A;  3GSS A;  3EC3 A;  3FW2 A;  4N10 A;  4G9H A;  3V1W A;  3M9J A;  4XRD A;  1JZR A;  1T3B A;  4POK A;  5ENU A;  3FY7 A;  3FZA A;  5LNK e;  16GS A;  2LV3 A;  3F6F A;  5B7C A;  2DMM A;  4HZ2 A;  4K9Z A;  2H6X A;  3FR6 A;  3LG6 A;  1E2Y A;  3L9U A;  4BVX A;  2H6Z A;  2GQL A;  5ECK B;  5HR0 A;  4EF0 A;  4HOJ A;  4G0I A;  2PER A;  3KTL A;  3IBH A;  1HNA A;  4OO5 A;  4JE1 A;  4ZBB A;  1XWB A;  2VL3 A;  2DIY A;  2WGR A;  5A4W A;  2VCX A;  3ZRD A;  2VAF A;  1V9W A;  2V32 A;  5ID2 B;  2B5X A;  5A4U A;  2WS2 A;  3FHK A;  3QAV A;  4GSS A;  3IOS A;  4OFM A;  4WBR D;  4Q5N A;  5CNW A;  5AIV A;  2C4J A;  3EU3 A;  4RI6 A;  3FZ5 A;  5IPH A;  5D73 A;  3M0F A;  1EV9 A;  1B9X C;  2H76 A;  1GUM A;  2JSZ A;  3VWU A;  4MJE A;  2OE0 A;  3OR5 A;  4MLY A;  4X43 A;  1B8X A;  5JCU A;  12GS A;  2YWO A;  3WT2 A;  4MA9 A;  1Z3E A;  1T1V A;  2N5A A;  2EIQ A;  1BYE A;  4TXV A;  2CAQ A;  3EWL A;  5ECH B;  2KP1 A;  4IHU A;  4OMV A;  4WF5 A;  1OVN A;  4PUA A;  2NBS A;  1R5P A;  3IK7 A;  3N9J A;  1NM3 A;  4F82 A;  2F8A A;  5HR1 A;  4JRR A;  1K0C A;  1PL2 A;  3L78 A;  4BL7 B;  4K7I A;  4PTS A;  3M8N A;  1BAY A;  2C3T A;  5DAL B;  1JFU A;  5ECR B;  2C1Y A;  3W8S A;  1XOA A;  4WET A;  2VD1 A;  4J2F A;  2H8L A;  3AY8 A;  4GRF A;  1O6J A;  2B5Y A;  5H5R A;  3WD6 A;  5EVO A;  3CYN A;  1PD2 1;  2C80 A;  1K3Y A;  2IIY A;  1EEM A;  2C3Q A;  3HHV A;  3EMP A;  2RUE A;  3L4N A;  2P5Q A;  1G6Y A;  2KHP A;  3ZRE A;  4OO4 A;  2VCV A;  3GKM A;  2MZC A;  3RBT A;  3P2A A;  1GSU A;  1XW6 A;  4Q5F A;  1X0R A;  4IP1 A;  2O8V B;  2CV4 A;  1SU9 A;  1TW9 A;  4PQH A;  4MPG A;  1PKW A;  3H93 A;  5G5E A;  14GS A;  3RPP A;  2HXK A;  3EU4 A;  3FRC A;  1T4Y A;  2KP2 A;  4K6X A;  2N5B A;  20GS A;  2G0F A;  3KP8 A;  4D73 A;  3LXZ A;  1IYI A;  4ML6 A;  1Z7R A;  5DDL A;  4OFT A;  2DIZ A;  7GSS A;  4LL4 B;  22GS A;  4ID0 A;  3UMA A;  1HNC A;  1AQW A;  3F9U A;  1EGR A;  3C8E A;  4MJB A;  4ZIJ A;  2ZUP A;  2HQT A;  2PMT A;  4WF4 A;  2GST A;  4DSS A;  5J41 A;  1DUG A;  4TN8 A;  1GSQ A;  1TKD B;  2X64 A;  4I5Q A;  3RDW A;  2ZNM A;  3GKK A;  3WT1 A;  3KTB A;  3TGZ A;  3IC4 A;  2CQ9 A;  1MDK A;  1R7H A;  1ZMA A;  2NDO A;  3TOU A;  3LGC A;  4WR5 A;  4IBP A;  1GNW A;  1F6M C;  3TKS C;  1VF3 A;  1KBN A;  4YH2 A;  3W6G A;  1E6B A;  3KD0 A;  3BCI A;  5KN0 A;  4KX4 A;  3DVX A;  4EKZ A;  3ERG A;  3EVI A;  5G1L A;  1GSS A;  5J5N A;  2B1L A;  3O6T A;  4NHW A;  5C04 A;  3APO A;  1V98 A;  1EOG A;  1QFN A;  4MCU A;  4MF7 A;  4BPY A;  3ME7 A;  2RII A;  3GUS A;  5F06 A;  2FWE A;  3PR8 A;  5D8I A;  4BA7 A;  2V2G A;  1MD3 A;  3PGT A;  4ISD A;  5IPG A;  4MH3 A;  4KSM A;  1OC9 B;  3QR6 A;  2LEG A;  3LWA A;  3CMI A;  2V41 A;  2H74 A;  1EP8 A;  1YDK A;  4KF9 A;  4X1U A;  5AIS A;  2HYX A;  3E3E A;  2VCT A;  1ST9 A;  3EMX A;  4ECJ A;  2K8V A;  2HSM B;  2VM2 A;  3KZQ A;  3ZYW A;  1T8E B;  5B8A A;  4KCA A;  4K7O A;  2VD0 A;  2YV7 A;  2XPE A;  1C72 A;  3TOT A;  3QOU A;  1TK0 B;  5LCZ A;  2JL4 A;  4O92 A;  3ZZX A;  5KN2 A;  4EUY A;  3GTU B;  3VI7 A;  4MAB A;  1GUH A;  1Q4J A;  3VPQ A;  3TJF A;  5IMD A;  4IS0 A;  2QC7 A;  2GZY A;  3QD9 A;  1TU7 A;  1PSQ A;  2FWG A;  1SD9 A;  2HSY A;  4OCF A;  3ZML A;  11GS A;  5G30 A;  3BBY A;  5G2Z A;  1YJ6 A;  4GWR A;  1UVZ A;  3TRX A;  2O89 A;  1LU4 A;  5GZZ B;  2DLX A;  2WB9 A;  1YQ1 A;  1UC7 A;  2M80 A;  1M7T A;  4K1F A;  2M72 A;  4HEA 2;  2LRN A;  4XHM A;  4KA0 A;  1TP9 A;  2LRC A;  4FO5 A;  4XS4 B;  5J9C A;  4XS4 A;  2R3X A;  1URM A;  2E7P A;  2ES7 A;  3TKQ A;  1FAA A;  2AB6 A;  2YPM A;  2NVL A;  1ZGN A;  3HCZ A;  3ZIV A;  2K8S A;  3TKS E;  3IHQ A;  4POB A;  4P3Y B;  5CRD A;  1ABA A;  3J7Y k;  2H0I A;  17GS A;  3DML A;  2DJ0 A;  1OE7 A;  1AAZ A;  5IMF A;  1DE1 A;  1XBS A;  3HYP A;  3LOR A;  5G1K A;  2Z9S A;  4KSO A;  3UOM A;  2DML A;  4WBJ A;  3VWV A;  3QDN A;  3MNG A;  4O32 A;  3VI5 A;  1RQM A;  2REM A;  2LST A;  3KGK A;  3KCM A;  3GMF A;  3UVT A;  3KEB A;  4XTS A;  1Z7P A;  5F07 A;  3C7M A;  3IA1 A;  1WP0 A;  4PUF C;  2HNL A;  3K8N A;  3G9B A;  4GTU A;  3CTG A;  4WEY A;  4V1A p;  4JR6 A;  4IJ3 A;  3ISO A;  4ACS A;  5HR2 A;  1B48 A;  5GAP D;  1SK2 A;  2R5G A;  2OBI A;  3A2W A;  2KLX A;  5DAK A;  5D96 A;  2HRK A;  5CP1 A;  1J08 A;  2PGT A;  1I5G A;  1N8J A;  13GS A;  4MK3 A;  5IOX A;  2VCW A;  1A2J A;  3VFI A;  4JED A;  4PXO A;  2B5E A;  5L71 A;  1LJR A;  2L57 A;  4N0Z A;  5ECN B;  1SEN A;  2IMF A;  3QAG A;  4TRX A;  3Q19 A;  3DWV A;  3M1G A;  2YOI A;  3CSJ A;  2JSY A;  4GQC A;  5DCG A;  4OCE A;  2GTU A;  2HRF A;  2VLU A;  3WYW A;  5D93 A;  3HXS A;  3VWX A;  2VOC A;  4EDZ A;  4FYC A;  1ML6 A;  1WRY A;  3HA9 A;  2O87 A;  6GSY A;  2XBQ A;  1EOH A;  5HQP A;  2H1B A;  2K6V A;  3D4M A;  2M46 A;  1YEP A;  1GUK A;  4AJ7 A;  3UVH A;  1A2M A;  4WR4 A;  2P0G A;  2I1U A;  2L5L A;  2VLV A;  4FQU A;  4YAV A;  5CO3 A;  4GF0 A;  2R37 A;  18GS A;  3LSZ A;  4TR1 A;  3C1R A;  1V58 A;  2GSS A;  4BVX B;  5H5S A;  3A2V A;  4YAP A;  1GLP A;  2H1A A;  2JU5 A;  3FKF A;  2L59 A;  1B9Y C;  3GYK A;  2L6D A;  5FHI A;  1GTI A;  3RHC A;  5C00 A;  5ECS A;  1FOV A;  3FZ4 A;  3Q6O A;  4NWY A;  2DJK A;  3D6I A;  1GH2 A;  2H1D A;  5GST A;  1BQ7 A;  1WIK A;  5ECM B;  3F4S A;  3F3Q A;  1PMT A;  1MEK A;  1ERT A;  1V57 A;  1SJI A;  3ERW A;  1S3D A;  5ABR A;  1BJX A;  6GSS A;  2XBI A;  3R3E A;  2HLS A;  3HZ4 A;  1ON4 A;  1XVQ A;  1OE8 A;  1F9M A;  3BCK A;  5CYY A;  5D9W A;  4LL1 B;  1X5E A;  2VM1 A;  1JZW A;  2BTO T;  5A4V A;  3I6A A;  1QGV A;  2DBC A;  3ZIJ A;  1NHY A;  4GST A;  2PN8 A;  4G0L A;  3LEF A;  3FR3 A;  5AN1 A;  2AJQ B;  2GSQ A;  2VCZ A;  6GSW A;  3ZLP A;  3F3R A;  2LQQ A;  3KM6 A;  4NMU A;  1J0F A;  2F51 A;  2LQO A;  3HVS A;  3QCP A;  3WGX A;  2CAI A;  2O7K A;  1GSD A;  4AF2 A;  3O3T A;  3I69 A;  4GCI A;  2GZZ A;  1XXU A;  3GKN A;  2YWM A;  2ON5 A;  4Z7X A;  2PWJ A;  4AGS A;  3UBL A;  1RW1 A;  3DVW A;  2UZ8 A;  2DJJ A;  4DVC A;  4OWY A;  1U87 A;  5B6M A;  3NOF A;  2CA8 A;  4Q5R A;  1TDI A;  3TRQ A;  2L4Q A;  3DKS A;  2XC2 A;  5INY A;  1EEJ A;  5EL8 A;  2IMI A;  5DJM A;  2RUF A;  1GP1 A;  1HYU A;  3FEU A;  1TI1 A;  5HFI A;  1K0O A;  4FIW A;  4JZQ A;  2IL3 A;  2VL2 C;  2MBS A;  1AC1 A;  3UEM A;  2AUV A;  3UBK A;  3KXO A;  3GUR A;  4MH2 A;  3U5R E;  1YKA A;  1K3L A;  1OKD A;  5JCW A;  1QUW A;  1KNG A;  3ERF A;  2VIM A;  2VUP A;  4D73 B;  4HS1 A;  3TKP A;  3PIN A;  1SL0 B;  1K0D A;  3P7X A;  3GHA A;  4K8M A;  1OAZ A;  4CDO A;  2MMA A;  3D5J A;  3KMO A;  2WJU A;  1M9A A;  3VUR A;  2HRA A;  2YCD A;  2E0Q A;  3P8W A;  4ULX A;  3L0H A;  3ZFL A;  4ZBA A;  4DSS B;  2CVD A;  1FG4 A;  2YJ7 A;  1NSW A;  2H75 A;  5ECQ B;  4XRA A;  1U88 A;  3VLN A;  2IMK A;  1K0N A;  4MJC A;  1GTB A;  1M2A A;  2FUG 2;  3ZVJ D;  3SBC A;  4ZB6 A;  2L5O A;  4GSN A;  1THO A;  2WFC A;  2HE3 A;  4MDC A;  3GRX A;  3HVX A;  2H73 A;  3EUR A;  4USS A;  4XIH A;  2FGX A;  5CRE A;  3IK9 A;  2LNS A;  1WE0 A;  2XPD A;  3ME8 A;  3RHB A;  3VPT A;  2FY6 A;  2H71 A;  4CW9 A;  2PVQ A;  2YV9 A;  2LS5 A;  2VLT A;  1MTC A;  1A0R P;  1X9W B;  1PX7 A;  1K0A A;  1SK0 A;  3ED3 A;  1EP7 A;  2OAC A;  4HJ2 A;  2FA8 A;  1LBK A;  4TW5 A;  3M3M A;  4E8H A;  4AJ6 A;  3HVV A;  1SKR B;  1T00 A;  2IN3 A;  1A8Y A;  3EYT A;  4BVY A;  3EE2 A;  3QAW A;  1I9D A;  1VRS D;  4KDX A;  2YWI A;  3NZN A;  5EY6 A;  2N5F A;  1A23 A;  3C73 A;  4ZXG A;  4IVF A;  5DCH A;  2OAD A;  3IAS 2;  1SYX A;  2C0G A;  1Y6E A;  3GKX A;  4PUR A;  3FK8 A;  1Z5Y E;  2MMZ A;  3CTF A;  3APQ A;  4G0K A;  2YJH A;  1THX A;  3APS A;  2L4C A;  5KN3 A;  4J56 E;  4MJA A;  4WKW A;  4ZL9 A;  4AJ8 A;  3WGE A;  3KH9 A;  5HR3 A;  3L9S A;  1KTE A;  2H30 A;  2JZS A;  1TXX A;  5E59 A;  2MMO A;  6GST A;  2MYG A;  4HU9 A;  3SWL A;  1B4Q A;  3RAZ A;  1FB6 A;  1NW2 A;  1G7E A;  4JU5 A;  1OKT A;  1FO5 A;  4LA1 A;  5DQY A;  4HQS A;  4FYU A;  3I9V 2;  3F0I A;  1GNE A;  1QMV A;  1TOF A;  1X9M B;  1WOU A;  2DJ1 A;  4PNF A;  2FCH A;  4O7H A;  3F4T A;  2R2J A;  4LLR A;  4EVM A;  1M2D A;  2LJA A;  3Q18 A;  1XOB A;  2HFD A;  6GSV A;  2FHE A;  4ECB A;  1GUL A;  1A24 A;  4K7N A;  2TIR A;  3IV4 A;  2O85 A;  4GQF A;  4L0U A;  5IMZ A;  9GSS A;  2VL2 A;  2HRN A;  2IPA A;  3TKR A;  1O85 A;  4XS1 A;  5F0G A;  1XCC A;  4V2M A;  2J9H A;  2PVO C;  3HJP A;  1XIY A;  5D9V A;  2C0D A;  1GWC A;  2ALB A;  1TK5 B;  4EE0 A;  4IGJ A;  2OBK A;  5JWR B;  1WJK A;  1MD4 A;  3C71 A;  3ZTL A;  3I43 A;  1QXH A;  3G7I A;  2OJL A;  1F3A A;  3LQ7 A;  1GTA A;  2YWN A;  5J9B A;  1O73 A;  1F3B A;  3IRA A;  4K2D A;  3CRU A;  3BJ5 A;  1USB A;  2GQM A;  1N2A A;  1PRX A;  3GIX A;  3VWW A;  2IFQ A;  2YN1 A;  5DBQ A;  1GL8 A;  2YP6 A;  3QFB C;  4KCE A;  1EGO A;  5KN1 A;  10GS A;  4YQU A;  4KDU A;  2OA7 A;  1K0M A;  2I4A A;  5G5F A;  1O8X A;  6GSX A;  3BD2 A;  4GLT A;  4G2E A;  4V2L A;  1BED A;  2CZ2 A;  1YF1 A;  4POL A;  1CQH A;  3L9V A;  1YEX A;  5ECL B;  1HD2 A;  4IQA A;  4V1A g;  3H4K A;  1EV4 A;  3IR4 A;  2B6M A;  3F8U A;  2HSN B;  4PQI A;  1W4V A;  1VF1 A;  2WCI A;  5IO2 A;  2K18 A;  2HZE A;  1K3O A;  3TKS A;  2CX3 A;  4ZB9 A;  5DAK B;  2CT6 A;  4G10 A;  2HRK B;  1F2E A;  4JBB A;  2C0F A;  2AAW A;  4I2T A;  3KJY A;  1J9B A;  2BJX A;  1G7O A;  4TR0 A;  2H72 A;  1IYH A;  4QL7 A;  4KND A;  1DBY A;  2FWF A;  2KOK A;  3GX0 A;  3ZMK A;  4EL1 A;  3M9K A;  2BMX A;  1X5D A;  3PH9 A;  3WGD A;  5IO0 A;  2GT5 A;  2HT9 A;  3IXR A;  4EXJ A;  3N5O A;  2PBJ A;  2EIO A;  3IC8 A;  4HUA A;  1PA3 A;  3US3 A;  4MZC A;  4MMM A;  1XWG A;  1PGT A;  4NXI A;  2IWT A;  4ECC A;  1HQO A;  5ECO B;  3GL5 A;  1A0F A;  3J7Y b;  5IMA A;  1ERW A;  3QMX A;  2HZF A;  3RPN A;  1Z6N A;  2GLR A;  1TRS A;  1Z9H A;  4KAE A;  1WMJ A;  2DC5 A;  1XZO A;  1GLQ A;  4G19 A;  1SYR A;  5IIZ A;  3TUE A;  4F2I A;  4TR1 B;  2QGV A;  3JCM L;  4PGT A;  1TRW A;  1GSY A;  1TK8 B;  1QK8 A;  1JHB A;  1F37 A;  3GV1 A;  5D9X A;  1UN2 A;  1T4Z A;  4TKY A;  4LMW A;  4JR4 A;  5DVB A;  1SJ6 A;  3GH6 A;  1AIU A;  1GRX A;  4MP4 A;  1O8W A;  1AUC A;  3Q74 A;  3GA4 A;  3MWH A;  2GS3 A;  2R6K A;  2GGT A;  5LD0 A;  2B7J A;  19GS A;  2DSA A;  4N0V A;  3R2Q A;  1GTU A;  5JWQ B;  2FA4 A;  3D0Z A;  2CVK A;  2WDU A;  3ZVJ A;  1WWJ A;  1PL1 A;  5D9T A;  4BWS A;  2AV4 A;  2GVP A;  2P5R A;  3GX8 A;  1H4O A;  4TR3 A;  3UAP A;  1U3I A;  1O81 A;  2J23 A;  5ID2 A;  1S3A A;  2WRT A;  3DRN A;  3IE3 A;  1A2L A;  5IM9 A;  2E2M A;  4DSQ A;  2GSR A;  2RM5 A;  2WZ9 A;  1DE2 A;  1MDI A;  2GT6 A;  1FB0 A;  2CX4 A;  2LRT A;  2XHF A;  2X8G A;  2G2Q A;  3CRT A;  4EO3 A;  1ERV A;  4FYB A;  5H5Q A;  5IOW A;  3FR9 A;  1XVW A;  5FWG A;  1FHE A;  4IP6 A;  4Q5Q A;  2LTK A;  2GDR A;  3VK9 A;  4WXT A;  3E9J B;  1NHO A;  5ELG A;  4ZBD A;  3CXG A;  4MZW A;  2ZCT A;  1R26 A;  1FVK A;  1X9S B;  3D22 A;  5CRG A;  1AQV A;  2P31 A;  3GST A;  2H70 A;  1R4W A;  4I97 A;  8GSS A;  4YQV A;  3DXB A;  2YAN A;  2PU9 C;  4ZL8 A;  2MBT A;  4BL7 A;  4X0X A;  3KMN A;  2R4V A;  5DAL A;  4DSR A;  2OKA A;  1A8L A;  1S3C A;  6GSU A;  1X5C A;  5CRH A;  4IJI A;  4I8B A;  1G6W A;  4NHZ A;  5DQS A;  3LYK A;  5BMU A;  4PNG A;  4F0B A;  1PQN A;  4J57 E;  4I6X A;  2V6O A;  3TB2 A;  1SKS B;  2I81 A;  3FYG A;  3U6V A;  4K0N A;  4TR4 A;  4NV5 A;  1ZYE A;  5DJL A;  1XWK A;  3HY2 A;  3DIE A;  4QL9 A;  4NV2 A;  4RQR A;  1AQX A;  2YZH A;  1XWC A;  4CHS A;  2OE3 A;  4BWQ A;  2LJR A;  4RI7 A;  5CRW A;  5J3R A;  1VF4 A;  1XFL A;  4IEL A;  2FNO A;  2IME A;  4N30 A;  5JWO B;  4KUN A;  3H1N A;  1FW1 A;  1B4P A;  5ELA A;  4NPB A;  1VF2 A;  5GAN D;  3CBU A;  5J4U A;  5A5K A;  1KEB A;  2FD3 A;  2H0H A;  2LNT A;  2AYT A;  4KGI A;  5FT3 A;  2V1M A;  1K0B A;  3G7J A;  5KEJ A;  1SJZ A;  4KDY A;  5ECP B;  3DGQ A;  3TJJ A;  3KIJ A;  4IQ1 A;  4O5R A;  2L6C A;  2JAD A;  1TRV A;  3S9F A;  2A2R A;  4KH7 A;  4LMV A;  1TU8 A;  3A2X A;  1EZK A;  5EPF A;  4RUV A;  1TJD A;  5F05 A;  1AXD A;  2C0E A;  4HDE A;  1RK4 A;  3IPZ A;  1YZX A;  3NIV A;  3G7Y A;  2EC4 A;  1ERU A;  1U3A A;  5IQY A;  2DJ3 A;  3TRP A;  2H66 A;  3GN3 A;  2C3N A;  3A3T A;  2D2Z A;  4HU7 A;  4BVY B;  4NAX A;  2CVB A;  4MF6 A;  4QQ7 A;  1MDJ A;  4H86 A;  2LUS A;  3H8Q A;  4DEJ A;  4L5L A;  4POM A;  4TOP A;  1Z6M A;  3ZIT A;  3DYR A;  2CZ3 A;  3F6D A;  1M0U A;  4IW9 A;  5G31 A;  3GL3 A;  2IJY A;  4FH8 A;  3F4R A;  3TJG A;  2PPT A;  3UJ1 A;  4N11 A;  3DD3 A;  1JZD A;  1OC9 A;  1ZOF A;  3ZFB A;  3KP9 A;  4F9Z A;  4ZB8 A;  3HKR A;  1TTZ A;  2H1G A;  3TJK A;  5HFK A;  3PPU A;  3TJB A;  2JZR A;  1GSE A;  4KE3 A;  2AHE A;  3GH9 A;  1U6T A;  2HSM A;  1PN9 A;  1ZZY A;  3EIN A;  1G0T A;  2FWH A;  5F8B A;  3F63 A;  4KW6 A;  4OFN A;  2LJK A;  1SL1 B;  2H6Y A;  1BX9 A;  1M9B A;  4XS6 A; 
#chains in the Genus database with same CATH topology
 3GTU A;  3CSI A;  3GFK A;  5GSS A;  3LXT A;  3UL3 A;  2HI7 A;  2A2S A;  2PUK C;  5IMV A;  3D21 A;  3W8J A;  2JZT A;  4HQZ A;  5AIX A;  2OT3 A;  1T7P B;  4KB3 A;  2X99 A;  3IDV A;  2H19 A;  3H79 A;  1XW5 A;  2VO4 A;  4GXZ A;  1GSF A;  3C1S A;  1AW9 A;  4TXO B;  2GQK A;  1HNB A;  2TRC P;  3A5I A;  3IAM 2;  1YY7 A;  4TXO A;  4V2N A;  1V40 A;  1ZYQ B;  3HZ8 A;  4IN0 A;  5B6N A;  4PX1 A;  3ZL5 A;  4AKG A;  3D4T A;  1SD8 A;  1YKC A;  4ZL7 A;  3TCO A;  4MPF A;  3E0U A;  3HJO A;  3FZ9 A;  3KH7 A;  1SKW B;  3MSZ A;  2E2G A;  2FLS A;  3QPM A;  1PX6 A;  4ML1 A;  4TVE A;  3MDK A;  4I2U A;  2DJ2 A;  5COH A;  2IFQ B;  3HJM A;  5E4W A;  4F03 A;  3TDG A;  4MF5 A;  4E8E A;  1WPI A;  4IKH A;  2F3M A;  4HJM A;  4L5O A;  2K9F A;  3GNJ A;  2X8H A;  1YF0 A;  4ZIL A;  3LYP A;  2TRX A;  2QSI A;  3CSH A;  3DEX A;  3O76 A;  1TI3 A;  4RQX A;  1ZYN A;  2EIR A;  4MZB A;  4L0W A;  2H01 A;  1FVJ A;  2YZU A;  1EWX A;  1XW9 A;  1BG5 A;  2YNX A;  2NPB A;  1M99 A;  1V2A A;  3UAR A;  5J4Y A;  1H75 A;  1CQG A;  2HZE B;  1VGL A;  3UIW A;  1OC3 A;  2VL9 A;  1W89 A;  2VCQ A;  1ILO A;  1SL2 B;  1DSB A;  4EC0 A;  1XWA A;  2F8F A;  2V6K A;  4EDY A;  3A5W A;  2OE1 A;  2B1K A;  5ECI B;  1UA5 A;  2QKE A;  2I3Y A;  2LKU A;  2IMD A;  4ECI A;  2GZP A;  3CHX C;  4K0G A;  1O7U A;  3MAK A;  3BOA A;  1Q98 A;  1SK1 A;  3P90 A;  4L8E A;  2NTO A;  1PKZ A;  4W66 A;  2RLI A;  1ZCP A;  5AGY A;  2KUC A;  4PQ1 A;  5J40 A;  2F9S A;  2H0G A;  2C8U A;  4HI7 A;  3LJR A;  4YKF A;  1OC8 A;  1ACV A;  3HDC A;  2B7K A;  5HFG A;  3QFA C;  5JCG A;  1JLW A;  1JLV A;  1M2B A;  1Y25 A;  2X8C A;  2JAC A;  2B3S A;  5KOX A;  2MMN A;  2A4V A;  1OYJ A;  5IMC A;  1QQ2 A;  1TRU A;  3LFL A;  4F0C A;  4XCS A;  1R5A A;  2O5V A;  1ZL9 A;  2HSH A;  4HZ4 A;  5BRT A;  4OD7 A;  5B8B A;  5CAX A;  1XPV A;  3HD5 A;  2RM6 A;  4ILF A;  4YQM A;  2I9H A;  2ON7 A;  2WUL A;  1JZO A;  3GSS A;  3EC3 A;  3FW2 A;  4N10 A;  4G9H A;  3V1W A;  3M9J A;  4XRD A;  1JZR A;  1T3B A;  4POK A;  5ENU A;  3FY7 A;  3FZA A;  5LNK e;  16GS A;  5A5H B;  2LV3 A;  3F6F A;  5B7C A;  2DMM A;  4HZ2 A;  4K9Z A;  2H6X A;  1BF5 A;  3FR6 A;  3LG6 A;  1E2Y A;  3L9U A;  4BVX A;  2H6Z A;  2GQL A;  5ECK B;  5HR0 A;  4EF0 A;  4HOJ A;  4G0I A;  4O5Q A;  2PER A;  3KTL A;  3IBH A;  1HNA A;  4OO5 A;  4JE1 A;  4ZBB A;  1XWB A;  2VL3 A;  2DIY A;  2WGR A;  5A4W A;  2VCX A;  3ZRD A;  2VAF A;  1V9W A;  2V32 A;  5ID2 B;  2B5X A;  5KOW A;  5A4U A;  2WS2 A;  3FHK A;  3QAV A;  4GSS A;  3IOS A;  4AKX B;  4OFM A;  4WBR D;  4Q5N A;  5CNW A;  5AIV A;  2C4J A;  3TU3 B;  3EU3 A;  4RI6 A;  3FZ5 A;  5IPH A;  5D73 A;  3M0F A;  1EV9 A;  1B9X C;  2H76 A;  1GUM A;  2JSZ A;  3VWU A;  4MJE A;  2OE0 A;  3OR5 A;  4MLY A;  4X43 A;  1B8X A;  5JCU A;  12GS A;  2YWO A;  3WT2 A;  4MA9 A;  1Z3E A;  1T1V A;  2N5A A;  2EIQ A;  1BYE A;  4TXV A;  2CAQ A;  3EWL A;  5ECH B;  4ZB7 A;  2KP1 A;  4IHU A;  4OMV A;  4WF5 A;  1OVN A;  4PUA A;  2NBS A;  1R5P A;  3IK7 A;  3N9J A;  1NM3 A;  4F82 A;  2F8A A;  5HR1 A;  4JRR A;  1K0C A;  1PL2 A;  3L78 A;  4BL7 B;  4K7I A;  4PTS A;  3M8N A;  1BAY A;  2C3T A;  5DAL B;  1JFU A;  2R0G A;  5ECR B;  2C1Y A;  3W8S A;  1XOA A;  4WET A;  2VD1 A;  4J2F A;  2H8L A;  1ZYP A;  3AY8 A;  4GRF A;  1O6J A;  2B5Y A;  5H5R A;  3WD6 A;  5EVO A;  3CYN A;  1PD2 1;  2C80 A;  2QA2 A;  2WZS A;  1K3Y A;  2IIY A;  1EEM A;  2C3Q A;  5BMU B;  3HHV A;  3EMP A;  2RUE A;  3L4N A;  2P5Q A;  2WVX A;  1G6Y A;  2KHP A;  3ZRE A;  4OO4 A;  2VCV A;  4PI2 C;  3GKM A;  2MZC A;  3RBT A;  3P2A A;  1GSU A;  1XW6 A;  4Q5F A;  1X0R A;  4IP1 A;  2O8V B;  2CV4 A;  1SU9 A;  1TW9 A;  4BIK A;  4PQH A;  4MPG A;  1PKW A;  2WVY A;  3H93 A;  5G5E A;  3MYD A;  14GS A;  3RPP A;  2HXK A;  3EU4 A;  3FRC A;  1T4Y A;  2KP2 A;  4K6X A;  2N5B A;  20GS A;  2G0F A;  3KP8 A;  4D73 A;  3LXZ A;  2A2P A;  1IYI A;  4ML6 A;  1Z7R A;  5DDL A;  4OFT A;  2DIZ A;  7GSS A;  4LL4 B;  22GS A;  4ID0 A;  3UMA A;  1HNC A;  1AQW A;  3F9U A;  4AKI A;  1EGR A;  3C8E A;  4MJB A;  4ZIJ A;  2ZUP A;  2HQT A;  2PMT A;  4WF4 A;  2GST A;  4DSS A;  5J41 A;  1DUG A;  4TN8 A;  1GSQ A;  1TKD B;  2X64 A;  4I5Q A;  3RDW A;  2ZNM A;  2VKZ G;  3GKK A;  3WT1 A;  3KTB A;  3TGZ A;  3IC4 A;  2CQ9 A;  1MDK A;  1R7H A;  1ZMA A;  2NDO A;  3TOU A;  3LGC A;  4WR5 A;  4IBP A;  1GNW A;  1F6M C;  2DKH A;  3TKS C;  1VF3 A;  1KBN A;  4QMK A;  4YH2 A;  3W6G A;  1E6B A;  3KD0 A;  3BCI A;  5KN0 A;  4KX4 A;  1XG8 A;  3DVX A;  4EKZ A;  3ERG A;  3EVI A;  5G1L A;  1GSS A;  4PHZ C;  5J5N A;  2B1L A;  3O6T A;  4NHW A;  5C04 A;  3APO A;  1V98 A;  1EOG A;  1QFN A;  4MCU A;  4MF7 A;  4BPY A;  3ME7 A;  2RII A;  3RFR C;  3GUS A;  5F06 A;  2FWE A;  3PR8 A;  5D8I A;  4CY6 A;  4BA7 A;  2V2G A;  1MD3 A;  3PGT A;  4ISD A;  5IPG A;  4MH3 A;  4KSM A;  1OC9 B;  3QR6 A;  2LEG A;  3LWA A;  3CMI A;  2V41 A;  2H74 A;  1EP8 A;  1YDK A;  4KF9 A;  3FMW A;  4X1U A;  5AIS A;  2HYX A;  3E3E A;  2VCT A;  1ST9 A;  3EMX A;  4ECJ A;  2K8V A;  2HSM B;  2VM2 A;  3KZQ A;  3ZYW A;  1T8E B;  5B8A A;  4KCA A;  4K7O A;  2VD0 A;  2YV7 A;  2XPE A;  1C72 A;  3TOT A;  3QOU A;  1TK0 B;  5LCZ A;  2X49 A;  2JL4 A;  4O92 A;  3ZZX A;  5KN2 A;  4EUY A;  3GTU B;  3VI7 A;  4MAB A;  1GUH A;  1Q4J A;  3VPQ A;  3CQF A;  5IMD A;  3TJF A;  4IS0 A;  2QC7 A;  2GZY A;  3QD9 A;  1TU7 A;  2EFE A;  1PSQ A;  2FWG A;  4FXY P;  1SD9 A;  2HSY A;  4OCF A;  3ZML A;  11GS A;  5G30 A;  3BBY A;  5G2Z A;  1YJ6 A;  4GWR A;  1UVZ A;  3TRX A;  2O89 A;  1LU4 A;  5GZZ B;  2O3E A;  2DLX A;  2WB9 A;  1YQ1 A;  1UC7 A;  2M80 A;  1M7T A;  4K1F A;  2M72 A;  4HEA 2;  2LRN A;  1BG1 A;  4XHM A;  4KA0 A;  1TP9 A;  2LRC A;  4FO5 A;  2R0P A;  4XS4 B;  5J9C A;  4XS4 A;  2R3X A;  1URM A;  2E7P A;  2ES7 A;  3TKQ A;  1FAA A;  2AB6 A;  2YPM A;  2NVL A;  1ZGN A;  3HCZ A;  3ZIV A;  2K8S A;  3TKS E;  3IHQ A;  4POB A;  4P3Y B;  5CRD A;  1ABA A;  3J7Y k;  2H0I A;  2WW3 A;  17GS A;  3DML A;  4AI6 A;  2DJ0 A;  1OE7 A;  1AAZ A;  5IMF A;  1DE1 A;  1XBS A;  3HYP A;  3LOR A;  5G1K A;  2Z9S A;  4KSO A;  3UOM A;  2DML A;  4WBJ A;  3VWV A;  3QDN A;  3MNG A;  4O32 A;  3VI5 A;  1RQM A;  2REM A;  2LST A;  3KGK A;  3KCM A;  3GMF A;  3UVT A;  3KEB A;  4XTS A;  1Z7P A;  5F07 A;  3C7M A;  3IA1 A;  4K5S A;  1WP0 A;  1SVO A;  4PUF C;  2HNL A;  3K8N A;  3G9B A;  4GTU A;  3CTG A;  4WEY A;  4V1A p;  4JR6 A;  4IJ3 A;  3ISO A;  4ACS A;  5HR2 A;  2HSN A;  1B48 A;  5GAP D;  2X4A A;  1SK2 A;  2R5G A;  2OBI A;  3A2W A;  2KLX A;  5DAK A;  5D96 A;  2HRK A;  5CP1 A;  1J08 A;  2PGT A;  1I5G A;  1N8J A;  13GS A;  4MK3 A;  5IOX A;  2VCW A;  1A2J A;  3VFI A;  4JED A;  4PXO A;  2B5E A;  5L71 A;  4HSC X;  1LJR A;  2L57 A;  4N0Z A;  5ECN B;  1SEN A;  2IMF A;  3QAG A;  4TRX A;  3Q19 A;  3CWG A;  3DWV A;  3M1G A;  2YOI A;  3CSJ A;  2JSY A;  4GQC A;  5DCG A;  4OCE A;  2GTU A;  2HRF A;  2VLU A;  3WYW A;  5D93 A;  3HXS A;  3HMJ G;  3VWX A;  2VOC A;  4EDZ A;  4FYC A;  1ML6 A;  1WRY A;  3HA9 A;  2O87 A;  6GSY A;  2XBQ A;  1EOH A;  5HQP A;  2H1B A;  2K6V A;  3D4M A;  2A4H A;  2M46 A;  1YEP A;  1GUK A;  4AJ7 A;  3UVH A;  1A2M A;  4WR4 A;  2P0G A;  2I1U A;  2L5L A;  2VLV A;  4FQU A;  4YAV A;  5CO3 A;  4GF0 A;  2R37 A;  18GS A;  3LSZ A;  4TR1 A;  3C1R A;  5A34 A;  1V58 A;  2GSS A;  4BVX B;  5H5S A;  3A2V A;  4YAP A;  1GLP A;  2H1A A;  2JU5 A;  3FKF A;  2L59 A;  1B9Y C;  3GYK A;  2L6D A;  5FHI A;  1GTI A;  3RHC A;  5C00 A;  5ECS A;  1FOV A;  3FZ4 A;  3Q6O A;  4NWY A;  2DJK A;  3D6I A;  1GH2 A;  2H1D A;  5GST A;  1BQ7 A;  1WIK A;  5ECM B;  3F4S A;  3F3Q A;  1PMT A;  1MEK A;  1ERT A;  1V57 A;  1SJI A;  3ERW A;  1S3D A;  5ABR A;  1BJX A;  6GSS A;  2XBI A;  3R3E A;  2H1L A;  2HLS A;  3HZ4 A;  1ON4 A;  1XVQ A;  1OE8 A;  1F9M A;  3BCK A;  5CYY A;  5D9W A;  4LL1 B;  1X5E A;  2VM1 A;  1JZW A;  2BTO T;  5A4V A;  3I6A A;  1QGV A;  2DBC A;  3ZIJ A;  1NHY A;  4GST A;  2PN8 A;  4G0L A;  3LEF A;  3FR3 A;  5AN1 A;  2AJQ B;  2GSQ A;  2VCZ A;  6GSW A;  3ZLP A;  3F3R A;  2LQQ A;  4MNN A;  3KM6 A;  4NMU A;  1J0F A;  2F51 A;  2LQO A;  3HVS A;  3QCP A;  3WGX A;  2CAI A;  2O7K A;  1GSD A;  4AF2 A;  3O3T A;  3I69 A;  4GCI A;  2GZZ A;  1XXU A;  3GKN A;  2YWM A;  2ON5 A;  4Z7X A;  2PWJ A;  4AGS A;  3UBL A;  1RW1 A;  3DVW A;  2UZ8 A;  2DJJ A;  4DVC A;  4OWY A;  1U87 A;  5B6M A;  3NOF A;  2CA8 A;  4Q5R A;  1TDI A;  3TRQ A;  2L4Q A;  3DKS A;  2XC2 A;  5INY A;  2WVX B;  2EFC A;  1EEJ A;  5EL8 A;  2IMI A;  5DJM A;  2RUF A;  1GP1 A;  1HYU A;  3FEU A;  1TI1 A;  2R0C A;  5HFI A;  1K0O A;  4FIW A;  4JZQ A;  4O5U A;  2IL3 A;  2VL2 C;  2MBS A;  1AC1 A;  3UEM A;  2AUV A;  3UBK A;  3KXO A;  3GUR A;  4MH2 A;  3U5R E;  1YKA A;  1K3L A;  1OKD A;  5JCW A;  1QUW A;  4Z2U A;  1KNG A;  1FOH A;  3ERF A;  2VIM A;  2VUP A;  4D73 B;  1SVL A;  4HS1 A;  3TKP A;  3PIN A;  1SL0 B;  1K0D A;  3P7X A;  3GHA A;  4K8M A;  1OAZ A;  4CDO A;  2MMA A;  3D5J A;  2UV8 G;  3KMO A;  2WJU A;  1M9A A;  3VUR A;  2HRA A;  2YCD A;  2E0Q A;  3P8W A;  4ULX A;  1PFO A;  3L0H A;  3ZFL A;  4ZBA A;  4DSS B;  2CVD A;  1FG4 A;  2YJ7 A;  1NSW A;  2H75 A;  5ECQ B;  4XRA A;  1U88 A;  3VLN A;  2IMK A;  1K0N A;  4MJC A;  1GTB A;  1M2A A;  2FUG 2;  3ZVJ D;  3SBC A;  4ZB6 A;  2L5O A;  4GSN A;  1THO A;  2WFC A;  2HE3 A;  4MDC A;  3GRX A;  3HVX A;  2H73 A;  3EUR A;  3RGB C;  4USS A;  4XIH A;  2FGX A;  5CRE A;  3IK9 A;  2LNS A;  1WE0 A;  2XPD A;  3ME8 A;  3RHB A;  1YEW C;  3VPT A;  2FY6 A;  2H71 A;  4CW9 A;  2PVQ A;  2YV9 A;  2LS5 A;  2VLT A;  1MTC A;  1A0R P;  1X9W B;  1PX7 A;  1K0A A;  1SK0 A;  3ED3 A;  1EP7 A;  2OAC A;  4HJ2 A;  2FA8 A;  1LBK A;  4TW5 A;  3M3M A;  4E8H A;  4AJ6 A;  3HVV A;  1SKR B;  1T00 A;  2IN3 A;  1A8Y A;  3EYT A;  4BVY A;  3EE2 A;  3QAW A;  1I9D A;  1VRS D;  4KDX A;  2YWI A;  3NZN A;  2O36 A;  5EY6 A;  2N5F A;  1A23 A;  3C73 A;  4ZXG A;  4IVF A;  5DCH A;  2OAD A;  3IAS 2;  1SYX A;  2C0G A;  1Y6E A;  3GKX A;  4PUR A;  5A1N A;  3FK8 A;  1Z5Y E;  1M3J A;  2MMZ A;  3CTF A;  3APQ A;  4G0K A;  2YJH A;  1THX A;  3APS A;  2L4C A;  5KN3 A;  4J56 E;  4MJA A;  4WKW A;  4ZL9 A;  4AJ8 A;  3WGE A;  3KH9 A;  5HR3 A;  3L9S A;  1KTE A;  2H30 A;  2JZS A;  1TXX A;  5E59 A;  2MMO A;  6GST A;  2MYG A;  4HU9 A;  3SWL A;  1B4Q A;  1N25 A;  4K5R A;  1M3I A;  3RAZ A;  1FB6 A;  1NW2 A;  1G7E A;  4JU5 A;  1OKT A;  1FO5 A;  4LA1 A;  5DQY A;  4HQS A;  4FYU A;  3I9V 2;  3F0I A;  1GNE A;  1QMV A;  1TOF A;  1X9M B;  1WOU A;  2DJ1 A;  4EIP A;  4PNF A;  2FCH A;  4O7H A;  3F4T A;  2R2J A;  4LLR A;  4EVM A;  1M2D A;  2LJA A;  3Q18 A;  1XOB A;  2QA1 A;  2HFD A;  6GSV A;  2FHE A;  4ECB A;  1GUL A;  4K2X A;  1A24 A;  4K7N A;  1I1I P;  2TIR A;  3IV4 A;  2O85 A;  4GQF A;  4L0U A;  5IMZ A;  9GSS A;  2VL2 A;  2HRN A;  2IPA A;  3TKR A;  1O85 A;  4XS1 A;  5F0G A;  1XCC A;  4V2M A;  2J9H A;  2PVO C;  3HJP A;  1XIY A;  5D9V A;  2C0D A;  1GWC A;  2ALB A;  1TK5 B;  4EE0 A;  4IGJ A;  2OBK A;  5JWR B;  1WJK A;  1MD4 A;  3C71 A;  3ZTL A;  3I43 A;  1QXH A;  3G7I A;  2OJL A;  1F3A A;  3LQ7 A;  1GTA A;  2YWN A;  5J9B A;  1O73 A;  1F3B A;  3IRA A;  3IHG A;  3CRU A;  4K2D A;  3BJ5 A;  1USB A;  2GQM A;  1N2A A;  1PRX A;  3GIX A;  3VWW A;  2IFQ A;  2YN1 A;  5DBQ A;  1GL8 A;  2EFH A;  2EFD A;  2YP6 A;  3QFB C;  4KCE A;  1EGO A;  5KN1 A;  10GS A;  4YQU A;  4KDU A;  2OA7 A;  1K0M A;  2I4A A;  5G5F A;  1O8X A;  6GSX A;  3BD2 A;  4GLT A;  4G2E A;  4V2L A;  1BED A;  2CZ2 A;  1YF1 A;  4POL A;  1CQH A;  3L9V A;  5J4V A;  5ECL B;  1YEX A;  1HD2 A;  4IQA A;  4V1A g;  3H4K A;  1EV4 A;  3IR4 A;  2B6M A;  3F8U A;  2HSN B;  4PQI A;  1W4V A;  1VF1 A;  2WCI A;  5IO2 A;  2K18 A;  2HZE A;  1K3O A;  3TKS A;  4X4J A;  2CX3 A;  4ZB9 A;  5DAK B;  2CT6 A;  4G10 A;  2HRK B;  1F2E A;  4JBB A;  2C0F A;  2AAW A;  4I2T A;  3KJY A;  1J9B A;  2BJX A;  1G7O A;  4TR0 A;  2H72 A;  1IYH A;  4QL7 A;  4KND A;  1DBY A;  2FWF A;  2KOK A;  3GX0 A;  3ZMK A;  4EL1 A;  3M9K A;  2BMX A;  1X5D A;  1TXU A;  3PH9 A;  3WGD A;  5IO0 A;  2GT5 A;  2HT9 A;  3IXR A;  4EXJ A;  3N5O A;  2PBJ A;  2EIO A;  3IC8 A;  4HUA A;  1PA3 A;  3US3 A;  1Y1U A;  4MZC A;  4MMM A;  1XWG A;  1PGT A;  4NXI A;  2IWT A;  4ECC A;  1HQO A;  5ECO B;  3GL5 A;  1A0F A;  3J7Y b;  5IMA A;  1ERW A;  3QMX A;  2HZF A;  3RPN A;  1Z6N A;  2GLR A;  1TRS A;  4EIQ A;  1Z9H A;  4KAE A;  1WMJ A;  2DC5 A;  1XZO A;  1GLQ A;  4G19 A;  1SYR A;  5IIZ A;  3TUE A;  4F2I A;  4TR1 B;  2QGV A;  3JCM L;  5A34 B;  4PGT A;  1TRW A;  1GSY A;  1TK8 B;  1QK8 A;  1JHB A;  1F37 A;  3GV1 A;  5D9X A;  1UN2 A;  1T4Z A;  4TKY A;  4LMW A;  4JR4 A;  5DVB A;  1SJ6 A;  3GH6 A;  4CY8 A;  1AIU A;  1GRX A;  4MP4 A;  1O8W A;  1AUC A;  3Q74 A;  3GA4 A;  3MWH A;  2GS3 A;  2R6K A;  5A5H A;  2GGT A;  5LD0 A;  2B7J A;  19GS A;  2DSA A;  4N0V A;  3R2Q A;  1GTU A;  5JWQ B;  2FA4 A;  4Z2R A;  3D0Z A;  2CVK A;  2WDU A;  1S3R A;  3ZVJ A;  1WWJ A;  1PL1 A;  5D9T A;  4BWS A;  2AV4 A;  2GVP A;  2P5R A;  2WW1 A;  3GX8 A;  1H4O A;  4TR3 A;  3UAP A;  1U3I A;  1O81 A;  2J23 A;  5ID2 A;  1S3A A;  2WRT A;  4YKG A;  3DRN A;  3IE3 A;  1A2L A;  5IM9 A;  2E2M A;  4DSQ A;  2GSR A;  2RM5 A;  2WZ9 A;  1DE2 A;  1MDI A;  2GT6 A;  1FB0 A;  2CX4 A;  2LRT A;  2XHF A;  2X8G A;  2G2Q A;  3CRT A;  4EO3 A;  1ERV A;  4FYB A;  5H5Q A;  5IOW A;  3FR9 A;  1XVW A;  5FWG A;  1FHE A;  4IP6 A;  4Q5Q A;  2LTK A;  2GDR A;  3VK9 A;  4WXT A;  3E9J B;  1NHO A;  5ELG A;  4ZBD A;  3CXG A;  4MZW A;  2ZCT A;  1R26 A;  1FVK A;  1X9S B;  3D22 A;  5CRG A;  1AQV A;  2P31 A;  3GST A;  2H70 A;  1R4W A;  4I97 A;  3HVN A;  8GSS A;  4YQV A;  3DXB A;  2YAN A;  2PU9 C;  2DKI A;  4ZL8 A;  2MBT A;  4BL7 A;  4X0X A;  3KMN A;  2R4V A;  5DAL A;  4DSR A;  3MIX A;  2OKA A;  1A8L A;  1S3C A;  6GSU A;  1SVM A;  1X5C A;  5CRH A;  4IJI A;  4I8B A;  1G6W A;  4NHZ A;  5DQS A;  3LYK A;  5BMU A;  4PNG A;  4F0B A;  1PQN A;  4J57 E;  4I6X A;  2V6O A;  3TB2 A;  3LW9 A;  4N3Z A;  1SKS B;  2I81 A;  3FYG A;  3U6V A;  4K0N A;  4TR4 A;  2WVZ A;  4NV5 A;  1ZYE A;  5DJL A;  1XWK A;  3HY2 A;  3DIE A;  4QL9 A;  4NV2 A;  4RQR A;  1AQX A;  2YZH A;  1XWC A;  4CHS A;  2OE3 A;  4BWQ A;  2LJR A;  4RI7 A;  5CRW A;  5J3R A;  1VF4 A;  1XFL A;  4IEL A;  4A5P A;  2FNO A;  2IME A;  4N30 A;  5JWO B;  4KUN A;  3H1N A;  1FW1 A;  1B4P A;  5ELA A;  4NPB A;  1VF2 A;  5GAN D;  3CBU A;  5J4U A;  5A5K A;  1KEB A;  1PN0 A;  1YVL A;  2H0H A;  2LNT A;  2FD3 A;  4KGI A;  2AYT A;  2WW2 A;  5FT3 A;  2V1M A;  1K0B A;  3G7J A;  5KEJ A;  1SJZ A;  4KDY A;  5ECP B;  1S4B P;  3DGQ A;  3TJJ A;  3KIJ A;  4IQ1 A;  4O5R A;  2L6C A;  2JAD A;  1TRV A;  3S9F A;  2A2R A;  4KH7 A;  4LMV A;  1TU8 A;  3A2X A;  1EZK A;  5EPF A;  4RUV A;  1TJD A;  5F05 A;  4PI0 C;  1AXD A;  2C0E A;  4Z2T A;  4HDE A;  1RK4 A;  3IPZ A;  1YZX A;  3NIV A;  3G7Y A;  2EC4 A;  1ERU A;  1U3A A;  5IQY A;  2DJ3 A;  3TRP A;  5J47 A;  2H66 A;  3GN3 A;  2C3N A;  3A3T A;  2D2Z A;  4HU7 A;  4BVY B;  4NAX A;  2CVB A;  4MF6 A;  4QQ7 A;  4E68 A;  1MDJ A;  4H86 A;  2LUS A;  3H8Q A;  4DEJ A;  4L5L A;  4POM A;  4TOP A;  1Z6M A;  3ZIT A;  4GDF A;  3DYR A;  5A1N B;  4AKH A;  2CZ3 A;  3F6D A;  1M0U A;  4IW9 A;  5G31 A;  4ICY A;  3GL3 A;  2IJY A;  4FH8 A;  3F4R A;  3TJG A;  2PPT A;  3UJ1 A;  4N11 A;  3DD3 A;  1JZD A;  1OC9 A;  1ZOF A;  3ZFB A;  3KP9 A;  2WW0 A;  4F9Z A;  4ZB8 A;  3HKR A;  1TTZ A;  2H1G A;  3TJK A;  5HFK A;  3PPU A;  3TJB A;  2JZR A;  1GSE A;  4KE3 A;  2AHE A;  3GH9 A;  1U6T A;  2HSM A;  1PN9 A;  1ZZY A;  3EIN A;  1G0T A;  2FWH A;  5F8B A;  3F63 A;  4KW6 A;  4G01 A;  4OFN A;  2LJK A;  1SL1 B;  2H6Y A;  1BX9 A;  3EPT A;  1M9B A;  4XS6 A; 
#chains in the Genus database with same CATH homology
 3GTU A;  3CSI A;  3GFK A;  5GSS A;  3LXT A;  3UL3 A;  2HI7 A;  2A2S A;  2PUK C;  5IMV A;  3D21 A;  3W8J A;  2JZT A;  4HQZ A;  5AIX A;  2OT3 A;  1T7P B;  4KB3 A;  2X99 A;  3IDV A;  2H19 A;  3H79 A;  1XW5 A;  2VO4 A;  4GXZ A;  1GSF A;  3C1S A;  1AW9 A;  4TXO B;  2GQK A;  1HNB A;  2TRC P;  3A5I A;  3IAM 2;  1YY7 A;  4TXO A;  4V2N A;  1V40 A;  1ZYQ B;  3HZ8 A;  4IN0 A;  5B6N A;  4PX1 A;  3ZL5 A;  4AKG A;  3D4T A;  1SD8 A;  1YKC A;  4ZL7 A;  3TCO A;  4MPF A;  3E0U A;  3HJO A;  3FZ9 A;  3KH7 A;  1SKW B;  3MSZ A;  2E2G A;  2FLS A;  3QPM A;  1PX6 A;  4ML1 A;  4TVE A;  3MDK A;  4I2U A;  2DJ2 A;  5COH A;  2IFQ B;  3HJM A;  5E4W A;  4F03 A;  3TDG A;  4MF5 A;  4E8E A;  1WPI A;  4IKH A;  2F3M A;  4HJM A;  4L5O A;  2K9F A;  3GNJ A;  2X8H A;  1YF0 A;  4ZIL A;  3LYP A;  2TRX A;  2QSI A;  3CSH A;  3DEX A;  3O76 A;  1TI3 A;  4RQX A;  1ZYN A;  2EIR A;  4MZB A;  4L0W A;  2H01 A;  1FVJ A;  2YZU A;  1EWX A;  1XW9 A;  1BG5 A;  2YNX A;  2NPB A;  1M99 A;  1V2A A;  3UAR A;  5J4Y A;  1H75 A;  1CQG A;  2HZE B;  1VGL A;  3UIW A;  1OC3 A;  2VL9 A;  1W89 A;  2VCQ A;  1ILO A;  1SL2 B;  1DSB A;  4EC0 A;  1XWA A;  2F8F A;  2V6K A;  4EDY A;  3A5W A;  2OE1 A;  2B1K A;  5ECI B;  1UA5 A;  2QKE A;  2I3Y A;  2LKU A;  2IMD A;  4ECI A;  2GZP A;  4K0G A;  1O7U A;  3MAK A;  3BOA A;  1Q98 A;  1SK1 A;  3P90 A;  4L8E A;  2NTO A;  1PKZ A;  4W66 A;  2RLI A;  1ZCP A;  5AGY A;  2KUC A;  4PQ1 A;  5J40 A;  2F9S A;  2H0G A;  2C8U A;  4HI7 A;  3LJR A;  4YKF A;  1OC8 A;  1ACV A;  3HDC A;  2B7K A;  5HFG A;  3QFA C;  5JCG A;  1JLW A;  1JLV A;  1M2B A;  1Y25 A;  2X8C A;  2JAC A;  2B3S A;  5KOX A;  2MMN A;  2A4V A;  1OYJ A;  5IMC A;  1QQ2 A;  1TRU A;  3LFL A;  4F0C A;  4XCS A;  1R5A A;  2O5V A;  1ZL9 A;  2HSH A;  4HZ4 A;  5BRT A;  4OD7 A;  5B8B A;  5CAX A;  1XPV A;  3HD5 A;  2RM6 A;  4ILF A;  4YQM A;  2I9H A;  2ON7 A;  2WUL A;  1JZO A;  3GSS A;  3EC3 A;  3FW2 A;  4N10 A;  4G9H A;  3V1W A;  3M9J A;  4XRD A;  1JZR A;  1T3B A;  4POK A;  5ENU A;  3FY7 A;  3FZA A;  5LNK e;  16GS A;  5A5H B;  2LV3 A;  3F6F A;  5B7C A;  2DMM A;  4HZ2 A;  4K9Z A;  2H6X A;  1BF5 A;  3FR6 A;  3LG6 A;  1E2Y A;  3L9U A;  4BVX A;  2H6Z A;  2GQL A;  5ECK B;  5HR0 A;  4EF0 A;  4HOJ A;  4G0I A;  4O5Q A;  2PER A;  3KTL A;  3IBH A;  1HNA A;  4OO5 A;  4JE1 A;  4ZBB A;  1XWB A;  2VL3 A;  2DIY A;  2WGR A;  5A4W A;  2VCX A;  3ZRD A;  2VAF A;  1V9W A;  2V32 A;  5ID2 B;  2B5X A;  5KOW A;  5A4U A;  2WS2 A;  3FHK A;  3QAV A;  4GSS A;  3IOS A;  4AKX B;  4OFM A;  4WBR D;  4Q5N A;  5CNW A;  5AIV A;  2C4J A;  3TU3 B;  3EU3 A;  4RI6 A;  3FZ5 A;  5IPH A;  5D73 A;  3M0F A;  1EV9 A;  1B9X C;  2H76 A;  1GUM A;  2JSZ A;  3VWU A;  4MJE A;  2OE0 A;  3OR5 A;  4MLY A;  4X43 A;  1B8X A;  5JCU A;  12GS A;  2YWO A;  3WT2 A;  4MA9 A;  1Z3E A;  1T1V A;  2N5A A;  2EIQ A;  1BYE A;  4TXV A;  2CAQ A;  3EWL A;  5ECH B;  4ZB7 A;  2KP1 A;  4IHU A;  4OMV A;  4WF5 A;  1OVN A;  4PUA A;  2NBS A;  1R5P A;  3IK7 A;  3N9J A;  1NM3 A;  4F82 A;  2F8A A;  5HR1 A;  4JRR A;  1K0C A;  1PL2 A;  3L78 A;  4BL7 B;  4K7I A;  4PTS A;  3M8N A;  1BAY A;  2C3T A;  5DAL B;  1JFU A;  2R0G A;  5ECR B;  2C1Y A;  3W8S A;  1XOA A;  4WET A;  2VD1 A;  4J2F A;  2H8L A;  1ZYP A;  3AY8 A;  4GRF A;  1O6J A;  2B5Y A;  5H5R A;  3WD6 A;  5EVO A;  3CYN A;  1PD2 1;  2C80 A;  2QA2 A;  1K3Y A;  2IIY A;  1EEM A;  2C3Q A;  5BMU B;  3HHV A;  3EMP A;  2RUE A;  3L4N A;  2P5Q A;  1G6Y A;  2KHP A;  3ZRE A;  4OO4 A;  2VCV A;  3GKM A;  2MZC A;  3RBT A;  3P2A A;  1GSU A;  1XW6 A;  4Q5F A;  1X0R A;  4IP1 A;  2O8V B;  2CV4 A;  1SU9 A;  1TW9 A;  4PQH A;  4MPG A;  1PKW A;  3H93 A;  5G5E A;  3MYD A;  14GS A;  3RPP A;  2HXK A;  3EU4 A;  3FRC A;  1T4Y A;  2KP2 A;  4K6X A;  2N5B A;  20GS A;  2G0F A;  3KP8 A;  4D73 A;  3LXZ A;  2A2P A;  1IYI A;  4ML6 A;  1Z7R A;  5DDL A;  4OFT A;  2DIZ A;  7GSS A;  4LL4 B;  22GS A;  4ID0 A;  3UMA A;  1HNC A;  1AQW A;  3F9U A;  4AKI A;  1EGR A;  3C8E A;  4MJB A;  4ZIJ A;  2ZUP A;  2HQT A;  2PMT A;  4WF4 A;  2GST A;  4DSS A;  5J41 A;  1DUG A;  4TN8 A;  1GSQ A;  1TKD B;  2X64 A;  4I5Q A;  3RDW A;  2ZNM A;  2VKZ G;  3GKK A;  3WT1 A;  3KTB A;  3TGZ A;  3IC4 A;  2CQ9 A;  1MDK A;  1R7H A;  1ZMA A;  2NDO A;  3TOU A;  3LGC A;  4WR5 A;  4IBP A;  1GNW A;  1F6M C;  2DKH A;  3TKS C;  1VF3 A;  1KBN A;  4QMK A;  4YH2 A;  3W6G A;  1E6B A;  3KD0 A;  3BCI A;  5KN0 A;  4KX4 A;  3DVX A;  4EKZ A;  3ERG A;  3EVI A;  5G1L A;  1GSS A;  5J5N A;  2B1L A;  3O6T A;  4NHW A;  5C04 A;  3APO A;  1V98 A;  1EOG A;  1QFN A;  4MCU A;  4MF7 A;  4BPY A;  3ME7 A;  2RII A;  3GUS A;  5F06 A;  2FWE A;  3PR8 A;  5D8I A;  4CY6 A;  4BA7 A;  2V2G A;  1MD3 A;  3PGT A;  4ISD A;  5IPG A;  4MH3 A;  4KSM A;  1OC9 B;  3QR6 A;  2LEG A;  3LWA A;  3CMI A;  2V41 A;  2H74 A;  1EP8 A;  1YDK A;  4KF9 A;  3FMW A;  4X1U A;  5AIS A;  2HYX A;  3E3E A;  2VCT A;  1ST9 A;  3EMX A;  4ECJ A;  2K8V A;  2HSM B;  2VM2 A;  3KZQ A;  3ZYW A;  1T8E B;  5B8A A;  4KCA A;  4K7O A;  2VD0 A;  2YV7 A;  2XPE A;  1C72 A;  3TOT A;  3QOU A;  1TK0 B;  5LCZ A;  2X49 A;  2JL4 A;  4O92 A;  3ZZX A;  5KN2 A;  4EUY A;  3GTU B;  3VI7 A;  4MAB A;  1GUH A;  1Q4J A;  3VPQ A;  3TJF A;  5IMD A;  4IS0 A;  2QC7 A;  2GZY A;  3QD9 A;  1TU7 A;  2EFE A;  1PSQ A;  2FWG A;  1SD9 A;  2HSY A;  4OCF A;  3ZML A;  11GS A;  5G30 A;  3BBY A;  5G2Z A;  1YJ6 A;  4GWR A;  1UVZ A;  3TRX A;  2O89 A;  1LU4 A;  5GZZ B;  2DLX A;  2WB9 A;  1YQ1 A;  1UC7 A;  2M80 A;  1M7T A;  4K1F A;  2M72 A;  4HEA 2;  2LRN A;  1BG1 A;  4XHM A;  4KA0 A;  1TP9 A;  2LRC A;  4FO5 A;  2R0P A;  4XS4 B;  5J9C A;  4XS4 A;  2R3X A;  1URM A;  2E7P A;  2ES7 A;  3TKQ A;  1FAA A;  2AB6 A;  2YPM A;  2NVL A;  1ZGN A;  3HCZ A;  3ZIV A;  2K8S A;  3TKS E;  3IHQ A;  4POB A;  4P3Y B;  5CRD A;  1ABA A;  3J7Y k;  2H0I A;  17GS A;  3DML A;  4AI6 A;  2DJ0 A;  1OE7 A;  1AAZ A;  5IMF A;  1DE1 A;  1XBS A;  3HYP A;  3LOR A;  5G1K A;  2Z9S A;  4KSO A;  3UOM A;  2DML A;  4WBJ A;  3VWV A;  3QDN A;  3MNG A;  4O32 A;  3VI5 A;  1RQM A;  2REM A;  2LST A;  3KGK A;  3KCM A;  3GMF A;  3UVT A;  3KEB A;  4XTS A;  1Z7P A;  5F07 A;  3C7M A;  3IA1 A;  4K5S A;  1WP0 A;  1SVO A;  4PUF C;  2HNL A;  3K8N A;  3G9B A;  4GTU A;  3CTG A;  4WEY A;  4V1A p;  4JR6 A;  4IJ3 A;  3ISO A;  4ACS A;  5HR2 A;  2HSN A;  1B48 A;  5GAP D;  2X4A A;  1SK2 A;  2R5G A;  2OBI A;  3A2W A;  2KLX A;  5DAK A;  5D96 A;  2HRK A;  5CP1 A;  1J08 A;  2PGT A;  1I5G A;  1N8J A;  13GS A;  4MK3 A;  5IOX A;  2VCW A;  1A2J A;  3VFI A;  4JED A;  4PXO A;  2B5E A;  5L71 A;  1LJR A;  2L57 A;  4N0Z A;  5ECN B;  1SEN A;  2IMF A;  3QAG A;  4TRX A;  3Q19 A;  3CWG A;  3DWV A;  3M1G A;  2YOI A;  3CSJ A;  2JSY A;  4GQC A;  5DCG A;  4OCE A;  2GTU A;  2HRF A;  2VLU A;  3WYW A;  5D93 A;  3HXS A;  3HMJ G;  3VWX A;  2VOC A;  4EDZ A;  4FYC A;  1ML6 A;  1WRY A;  3HA9 A;  2O87 A;  6GSY A;  2XBQ A;  1EOH A;  5HQP A;  2H1B A;  2K6V A;  3D4M A;  2A4H A;  2M46 A;  1YEP A;  1GUK A;  4AJ7 A;  3UVH A;  1A2M A;  4WR4 A;  2P0G A;  2I1U A;  2L5L A;  2VLV A;  4FQU A;  4YAV A;  5CO3 A;  4GF0 A;  2R37 A;  18GS A;  3LSZ A;  4TR1 A;  3C1R A;  5A34 A;  1V58 A;  2GSS A;  4BVX B;  5H5S A;  3A2V A;  4YAP A;  1GLP A;  2H1A A;  2JU5 A;  3FKF A;  2L59 A;  1B9Y C;  3GYK A;  2L6D A;  5FHI A;  1GTI A;  3RHC A;  5C00 A;  5ECS A;  1FOV A;  3FZ4 A;  3Q6O A;  4NWY A;  2DJK A;  3D6I A;  1GH2 A;  2H1D A;  5GST A;  1BQ7 A;  1WIK A;  5ECM B;  3F4S A;  3F3Q A;  1PMT A;  1MEK A;  1ERT A;  1V57 A;  1SJI A;  3ERW A;  1S3D A;  5ABR A;  1BJX A;  6GSS A;  2XBI A;  3R3E A;  2H1L A;  2HLS A;  3HZ4 A;  1ON4 A;  1XVQ A;  1OE8 A;  1F9M A;  3BCK A;  5CYY A;  5D9W A;  4LL1 B;  1X5E A;  2VM1 A;  1JZW A;  2BTO T;  5A4V A;  3I6A A;  1QGV A;  2DBC A;  3ZIJ A;  1NHY A;  4GST A;  2PN8 A;  4G0L A;  3LEF A;  3FR3 A;  5AN1 A;  2AJQ B;  2GSQ A;  2VCZ A;  6GSW A;  3ZLP A;  3F3R A;  2LQQ A;  4MNN A;  3KM6 A;  4NMU A;  1J0F A;  2F51 A;  2LQO A;  3HVS A;  3QCP A;  3WGX A;  2CAI A;  2O7K A;  1GSD A;  4AF2 A;  3O3T A;  3I69 A;  4GCI A;  2GZZ A;  1XXU A;  3GKN A;  2YWM A;  2ON5 A;  4Z7X A;  2PWJ A;  4AGS A;  3UBL A;  1RW1 A;  3DVW A;  2UZ8 A;  2DJJ A;  4DVC A;  4OWY A;  1U87 A;  5B6M A;  3NOF A;  2CA8 A;  4Q5R A;  1TDI A;  3TRQ A;  2L4Q A;  3DKS A;  2XC2 A;  5INY A;  2EFC A;  1EEJ A;  5EL8 A;  2IMI A;  5DJM A;  2RUF A;  1GP1 A;  1HYU A;  3FEU A;  1TI1 A;  2R0C A;  5HFI A;  1K0O A;  4FIW A;  4JZQ A;  4O5U A;  2IL3 A;  2VL2 C;  2MBS A;  1AC1 A;  3UEM A;  2AUV A;  3UBK A;  3KXO A;  3GUR A;  4MH2 A;  3U5R E;  1YKA A;  1K3L A;  1OKD A;  5JCW A;  1QUW A;  4Z2U A;  1KNG A;  1FOH A;  3ERF A;  2VIM A;  2VUP A;  4D73 B;  1SVL A;  4HS1 A;  3TKP A;  3PIN A;  1SL0 B;  1K0D A;  3P7X A;  3GHA A;  4K8M A;  1OAZ A;  4CDO A;  2MMA A;  3D5J A;  2UV8 G;  3KMO A;  2WJU A;  1M9A A;  3VUR A;  2HRA A;  2YCD A;  2E0Q A;  3P8W A;  4ULX A;  3L0H A;  3ZFL A;  4ZBA A;  4DSS B;  2CVD A;  1FG4 A;  2YJ7 A;  1NSW A;  2H75 A;  5ECQ B;  4XRA A;  1U88 A;  3VLN A;  2IMK A;  1K0N A;  4MJC A;  1GTB A;  1M2A A;  2FUG 2;  3ZVJ D;  3SBC A;  4ZB6 A;  2L5O A;  4GSN A;  1THO A;  2WFC A;  2HE3 A;  4MDC A;  3GRX A;  3HVX A;  2H73 A;  3EUR A;  4USS A;  4XIH A;  2FGX A;  5CRE A;  3IK9 A;  2LNS A;  1WE0 A;  2XPD A;  3ME8 A;  3RHB A;  3VPT A;  2FY6 A;  2H71 A;  4CW9 A;  2PVQ A;  2YV9 A;  2LS5 A;  2VLT A;  1MTC A;  1A0R P;  1X9W B;  1PX7 A;  1K0A A;  1SK0 A;  3ED3 A;  1EP7 A;  2OAC A;  4HJ2 A;  2FA8 A;  1LBK A;  4TW5 A;  3M3M A;  4E8H A;  4AJ6 A;  3HVV A;  1SKR B;  1T00 A;  2IN3 A;  1A8Y A;  3EYT A;  4BVY A;  3EE2 A;  3QAW A;  1I9D A;  1VRS D;  4KDX A;  2YWI A;  3NZN A;  5EY6 A;  2N5F A;  1A23 A;  3C73 A;  4ZXG A;  4IVF A;  5DCH A;  2OAD A;  3IAS 2;  1SYX A;  2C0G A;  1Y6E A;  3GKX A;  4PUR A;  5A1N A;  3FK8 A;  1Z5Y E;  2MMZ A;  3CTF A;  3APQ A;  4G0K A;  2YJH A;  1THX A;  3APS A;  2L4C A;  5KN3 A;  4J56 E;  4MJA A;  4WKW A;  4ZL9 A;  4AJ8 A;  3WGE A;  3KH9 A;  5HR3 A;  3L9S A;  1KTE A;  2H30 A;  2JZS A;  1TXX A;  5E59 A;  2MMO A;  6GST A;  2MYG A;  4HU9 A;  3SWL A;  1B4Q A;  1N25 A;  4K5R A;  3RAZ A;  1FB6 A;  1NW2 A;  1G7E A;  4JU5 A;  1OKT A;  1FO5 A;  4LA1 A;  5DQY A;  4HQS A;  4FYU A;  3I9V 2;  3F0I A;  1GNE A;  1QMV A;  1TOF A;  1X9M B;  1WOU A;  2DJ1 A;  4EIP A;  4PNF A;  2FCH A;  4O7H A;  3F4T A;  2R2J A;  4LLR A;  4EVM A;  1M2D A;  2LJA A;  3Q18 A;  1XOB A;  2QA1 A;  2HFD A;  6GSV A;  2FHE A;  4ECB A;  1GUL A;  4K2X A;  1A24 A;  4K7N A;  2TIR A;  3IV4 A;  2O85 A;  4GQF A;  4L0U A;  5IMZ A;  9GSS A;  2VL2 A;  2HRN A;  2IPA A;  3TKR A;  1O85 A;  4XS1 A;  5F0G A;  1XCC A;  4V2M A;  2J9H A;  2PVO C;  3HJP A;  1XIY A;  5D9V A;  2C0D A;  1GWC A;  2ALB A;  1TK5 B;  4EE0 A;  4IGJ A;  2OBK A;  5JWR B;  1WJK A;  1MD4 A;  3C71 A;  3ZTL A;  3I43 A;  1QXH A;  3G7I A;  2OJL A;  1F3A A;  3LQ7 A;  1GTA A;  2YWN A;  5J9B A;  1O73 A;  1F3B A;  3IRA A;  3IHG A;  3CRU A;  4K2D A;  3BJ5 A;  1USB A;  2GQM A;  1N2A A;  1PRX A;  3GIX A;  3VWW A;  2IFQ A;  2YN1 A;  5DBQ A;  1GL8 A;  2EFH A;  2EFD A;  2YP6 A;  3QFB C;  4KCE A;  1EGO A;  5KN1 A;  10GS A;  4YQU A;  4KDU A;  2OA7 A;  1K0M A;  2I4A A;  5G5F A;  1O8X A;  6GSX A;  3BD2 A;  4GLT A;  4G2E A;  4V2L A;  1BED A;  2CZ2 A;  1YF1 A;  4POL A;  1CQH A;  3L9V A;  5J4V A;  5ECL B;  1YEX A;  1HD2 A;  4IQA A;  4V1A g;  3H4K A;  1EV4 A;  3IR4 A;  2B6M A;  3F8U A;  2HSN B;  4PQI A;  1W4V A;  1VF1 A;  2WCI A;  5IO2 A;  2K18 A;  2HZE A;  1K3O A;  3TKS A;  4X4J A;  2CX3 A;  4ZB9 A;  5DAK B;  2CT6 A;  4G10 A;  2HRK B;  1F2E A;  4JBB A;  2C0F A;  2AAW A;  4I2T A;  3KJY A;  1J9B A;  2BJX A;  1G7O A;  4TR0 A;  2H72 A;  1IYH A;  4QL7 A;  4KND A;  1DBY A;  2FWF A;  2KOK A;  3GX0 A;  3ZMK A;  4EL1 A;  3M9K A;  2BMX A;  1X5D A;  1TXU A;  3PH9 A;  3WGD A;  5IO0 A;  2GT5 A;  2HT9 A;  3IXR A;  4EXJ A;  3N5O A;  2PBJ A;  2EIO A;  3IC8 A;  4HUA A;  1PA3 A;  3US3 A;  1Y1U A;  4MZC A;  4MMM A;  1XWG A;  1PGT A;  4NXI A;  2IWT A;  4ECC A;  1HQO A;  5ECO B;  3GL5 A;  1A0F A;  3J7Y b;  5IMA A;  1ERW A;  3QMX A;  2HZF A;  3RPN A;  1Z6N A;  2GLR A;  1TRS A;  4EIQ A;  1Z9H A;  4KAE A;  1WMJ A;  2DC5 A;  1XZO A;  1GLQ A;  4G19 A;  1SYR A;  5IIZ A;  3TUE A;  4F2I A;  4TR1 B;  2QGV A;  3JCM L;  5A34 B;  4PGT A;  1TRW A;  1GSY A;  1TK8 B;  1QK8 A;  1JHB A;  1F37 A;  3GV1 A;  5D9X A;  1UN2 A;  1T4Z A;  4TKY A;  4LMW A;  4JR4 A;  5DVB A;  1SJ6 A;  3GH6 A;  4CY8 A;  1AIU A;  1GRX A;  4MP4 A;  1O8W A;  1AUC A;  3Q74 A;  3GA4 A;  3MWH A;  2GS3 A;  2R6K A;  5A5H A;  2GGT A;  5LD0 A;  2B7J A;  19GS A;  2DSA A;  4N0V A;  3R2Q A;  1GTU A;  5JWQ B;  2FA4 A;  4Z2R A;  3D0Z A;  2CVK A;  2WDU A;  3ZVJ A;  1WWJ A;  1PL1 A;  5D9T A;  4BWS A;  2AV4 A;  2GVP A;  2P5R A;  3GX8 A;  1H4O A;  4TR3 A;  3UAP A;  1U3I A;  1O81 A;  2J23 A;  5ID2 A;  1S3A A;  2WRT A;  4YKG A;  3DRN A;  3IE3 A;  1A2L A;  5IM9 A;  2E2M A;  4DSQ A;  2GSR A;  2RM5 A;  2WZ9 A;  1DE2 A;  1MDI A;  2GT6 A;  1FB0 A;  2CX4 A;  2LRT A;  2XHF A;  2X8G A;  2G2Q A;  3CRT A;  4EO3 A;  1ERV A;  4FYB A;  5H5Q A;  5IOW A;  3FR9 A;  1XVW A;  5FWG A;  1FHE A;  4IP6 A;  4Q5Q A;  2LTK A;  2GDR A;  3VK9 A;  4WXT A;  3E9J B;  1NHO A;  5ELG A;  4ZBD A;  3CXG A;  4MZW A;  2ZCT A;  1R26 A;  1FVK A;  1X9S B;  3D22 A;  5CRG A;  1AQV A;  2P31 A;  3GST A;  2H70 A;  1R4W A;  4I97 A;  8GSS A;  4YQV A;  3DXB A;  2YAN A;  2PU9 C;  2DKI A;  4ZL8 A;  2MBT A;  4BL7 A;  4X0X A;  3KMN A;  2R4V A;  5DAL A;  4DSR A;  3MIX A;  2OKA A;  1A8L A;  1S3C A;  6GSU A;  1SVM A;  1X5C A;  5CRH A;  4IJI A;  4I8B A;  1G6W A;  4NHZ A;  5DQS A;  3LYK A;  5BMU A;  4PNG A;  4F0B A;  1PQN A;  4J57 E;  4I6X A;  2V6O A;  3TB2 A;  3LW9 A;  4N3Z A;  1SKS B;  2I81 A;  3FYG A;  3U6V A;  4K0N A;  4TR4 A;  4NV5 A;  1ZYE A;  5DJL A;  1XWK A;  3HY2 A;  3DIE A;  4QL9 A;  4NV2 A;  4RQR A;  1AQX A;  2YZH A;  1XWC A;  4CHS A;  2OE3 A;  4BWQ A;  2LJR A;  4RI7 A;  5CRW A;  5J3R A;  1VF4 A;  1XFL A;  4IEL A;  4A5P A;  2FNO A;  2IME A;  4N30 A;  5JWO B;  4KUN A;  3H1N A;  1FW1 A;  1B4P A;  5ELA A;  4NPB A;  1VF2 A;  5GAN D;  3CBU A;  5J4U A;  5A5K A;  1KEB A;  1PN0 A;  1YVL A;  2FD3 A;  2LNT A;  2AYT A;  4KGI A;  2H0H A;  5FT3 A;  2V1M A;  1K0B A;  3G7J A;  5KEJ A;  1SJZ A;  4KDY A;  5ECP B;  3DGQ A;  3TJJ A;  3KIJ A;  4IQ1 A;  4O5R A;  2L6C A;  2JAD A;  1TRV A;  3S9F A;  2A2R A;  4KH7 A;  4LMV A;  1TU8 A;  3A2X A;  1EZK A;  5EPF A;  4RUV A;  1TJD A;  5F05 A;  1AXD A;  2C0E A;  4Z2T A;  4HDE A;  1RK4 A;  3IPZ A;  1YZX A;  3NIV A;  3G7Y A;  2EC4 A;  1ERU A;  1U3A A;  5IQY A;  2DJ3 A;  3TRP A;  5J47 A;  2H66 A;  3GN3 A;  2C3N A;  3A3T A;  2D2Z A;  4HU7 A;  4BVY B;  4NAX A;  2CVB A;  4MF6 A;  4QQ7 A;  4E68 A;  1MDJ A;  4H86 A;  2LUS A;  3H8Q A;  4DEJ A;  4L5L A;  4POM A;  4TOP A;  1Z6M A;  3ZIT A;  4GDF A;  3DYR A;  5A1N B;  4AKH A;  2CZ3 A;  3F6D A;  1M0U A;  4IW9 A;  5G31 A;  4ICY A;  3GL3 A;  2IJY A;  4FH8 A;  3F4R A;  3TJG A;  2PPT A;  3UJ1 A;  4N11 A;  3DD3 A;  1JZD A;  1OC9 A;  1ZOF A;  3ZFB A;  3KP9 A;  4F9Z A;  4ZB8 A;  3HKR A;  1TTZ A;  2H1G A;  3TJK A;  5HFK A;  3PPU A;  3TJB A;  2JZR A;  1GSE A;  4KE3 A;  2AHE A;  3GH9 A;  1U6T A;  2HSM A;  1PN9 A;  1ZZY A;  3EIN A;  1G0T A;  2FWH A;  5F8B A;  3F63 A;  4KW6 A;  4G01 A;  4OFN A;  2LJK A;  1SL1 B;  2H6Y A;  1BX9 A;  3EPT A;  1M9B A;  4XS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...