4BL7B

Crystal structure of the aimp3-mrs n-terminal domain complex in different space group
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
SMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFSHIQHYPGIRQHLSSVVFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Aimp3-Mrs N-Terminal Domain Complex in Different Space Group
rcsb
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
molecule tags Translation
source organism Homo sapiens
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bl7B02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bl7B01
1FW1A 4GF0A 4WR5A 1KBNA 2F3MA 2OADA 3GTUB 3IE3A 1F3BA 4F0CA 1ZL9A 2VD0A 4MZWA 3LFLA 5EVOA 3UBKA 4BL7B 3CBUA 4EE0A 4PQIA 1JLVA 4ZBBA 3VPQA 3ZMKA 2N5FA 1VF2A 5D9TA 4LMWA 4MP4A 1U87A 1C72A 4PQHA 2F8FA 1K0AA 5ELGA 1GSEA 2WS2A 5ECLB 2C3NA 4ECCA 1YKCA 2CAIA 1HNAA 1VF1A 3Q18A 1B8XA 2PVQA 1K0OA 3M0FA 4EXJA 5BMUA 4KSMA 2YV7A 3WD6A 2WJUA 2GSSA 4HZ2A 2PERA 5IQYA 1M0UA 4NAXA 4ZB6A 4ZB9A 2CA8A 1XWKA 13GSA 5DCGA 2PMTA 2D2ZA 2VCWA 4IS0A 3HJOA 4MPGA 5DDLA 3M8NA 1GSUA 1AQWA 3LYKA 3U6VA 2PBJA 1XWGA 5AIXA 1ZGNA 4PX1A 4ACSA 5ECMB 3KJYA 3G7JA 1PX6A 3TOTA 3PR8A 3UAPA 3CRUA 4GCIA 4ZXGA 5ECPB 4IQ1A 1R5AA 4GSTA 5AIVA 4MF6A 3UVHA 3R3EA 1GUKA 1GULA 4GSNA 2JL4A 1MD3A 4BVXA 3QAVA 2AB6A 3VPTA 4PNFA 1K3LA 5J4UA 5DQSA 5AN1A 3RBTA 4HJ2A 5ECKB 1XW5A 5ECQB 3O76A 2VO4A 3CSJA 2A2RA 4KH7A 5JCWA 3PPUA 2PGTA 1PL2A 1OYJA 3ERFA 3GSTA 3KMNA 1PA3A 1OE8A 3WYWA 1BAYA 4NHZA 5FWGA 1HNBA 5ECRB 5EL8A 1U3IA 4G19A 5DALA 5A4WA 4LMVA 5DAKA 4KF9A 5J5NA 1EV9A 4ECIA 3DD3A 4TOPA 6GSUA 1RK4A 2GSQA 4G10A 4E8HA 2CAQA 4ISDA 4L5OA 3NIVA 17GSA 1AQXA 1G6WA 3KM6A 3GH6A 1IYIA 3G7IA 5ECHB 1G6YA 4MDCA 5HFKA 1GSQA 2VCQA 5AISA 1M9AA 3TOUA 4FQUA 5ECIB 4ZBDA 3LXZA 4IVFA 4N0VA 4G9HA 3P8WA 1GWCA 4PTSA 4HI7A 3F6DA 1LJRA 2WRTA 4MF7A 2X64A 1K3YA 1LBKA 5G5FA 2C80A 1AQVA 5ECNB 2LJRA 1GTBA 2A2SA 1YDKA 2VD1A 2NTOA 1GLQA 3HKRA 4G0LA 3H1NA 3LJRA 4ZB8A 1V2AA 4BVXB 2OACA 3D0ZA 5D73A 4ECJA 22GSA 1Y6EA 1PKWA 4JZQA 1GUHA 4USSA 1GTIA 5JCUA 3GUSA 4MK3A 4IGJA 1DUGA 2FHEA 3GURA 5ECSA 3QAWA 3ISOA 4BVYA 1N2AA 3VK9A 4K0GA 1XW6A 5DAKB 1A0FA 3MAKA 3LYPA 3GSSA 3VURA 1F3AA 3N9JA 2HSMA 3LSZA 4KX4A 4OFMA 4PUAA 3FR9A 3VWXA 3KMOA 2DC5A 5ECOB 4NHWA 2C4JA 1GSSA 4IELA 4YAPA 11GSA 1GSDA 5GZZB 3IK9A 1TDIA 4Q5QA 3F6FA 4GSSA 4F03A 4EDYA 2R4VA 1E6BA 4PXOA 4QQ7A 19GSA 4PURA 1PL1A 3DGQA 3O3TA 4OFTA 4BL7A 3QAGA 2R3XA 3UARA 7GSSA 5F06A 4IBPA 5LCZA 2GLRA 3IC8A 2HRAA 1GSYA 3VLNA 1PD21 5D9WA 3P90A 5GSSA 1AW9A 1FHEA 2WB9A 1PX7A 9GSSA 3TGZA 2R6KA 1USBA 4Q5NA 1GUMA 3BBYA 4HZ4A 4JBBA 1AXDA 1B48A 4YH2A 1UA5A 3Q74A 1GNEA 1VF4A 5D9VA 3EE2A 1BX9A 3M1GA 1F2EA 18GSA 10GSA 1K0BA 4KE3A 5FHIA 5FT3A 4OFNA 4G0IA 1TU8A 16GSA 4ID0A 4EDZA 4IJIA 1OE7A 1G7OA 3C8EA 4L8EA 1BYEA 8GSSA 4BVYB 4Q5RA 4RI6A 3FRCA 4YQMA 2HSMB 2AHEA 3F63A 4JEDA 3VI7A 1BG5A 4O7HA 1HQOA 3Q19A 2HRKA 2HQTA 3ZFLA 2VCVA 4L5LA 3N5OA 4KDUA 4EC0A 2ON5A 1GTUA 1ML6A 1Q4JA 5A4UA 4E8EA 4K0NA 4KAEA 3PGTA 5DJMA 1JLWA 4HOJA 1M9BA 1TU7A 1VF3A 4MF5A 2R5GA 3FR3A 3I6AA 1Z9HA 4O92A 5EY6A 4ZBAA 1IYHA 1YQ1A 2CVDA 4GLTA 2C8UA 5F0GA 1PGTA 1K0CA 4OMVA 5J41A 2HNLA 4Q5FA 2GSTA 1K0DA 5DALB 6GSXA 6GSYA 12GSA 6GSWA 5DJLA 20GSA 1B4PA 5AGYA 1PN9A 3LQ7A 1M99A 1EOHA 3IBHA 4PNGA 5G5EA 5ELAA 3QR6A 4KDXA 1HNCA 2C3TA 4KDYA 3GTUA 2YV9A 4ECBA 1MD4A 1GNWA 4DEJA 2CZ2A 2UZ8A 3CSIA 2VCZA 4G0KA 1K3OA 1JZRA 3CRTA 5F07A 3FR6A 6GSVA 3SWLA 3ZMLA 1U88A 2WDUA 4YQUA 1EOGA 2OA7A 3EINA 2HRKB 3W8SA 4AGSA 2YCDA 1EEMA 2V6KA 3L0HA 3IR4A 3KTLA 3HJMA 3GX0A 5F05A 3ZFBA 6GSSA 5A4VA 3I69A 4YAVA 1K0NA 3M3MA 4KGIA 3VI5A 3ERGA 4CHSA 1YJ6A 1GLPA 1NHYA 2J9HA 2AAWA 1PKZA 2VCTA 5A5KA 3UBLA 2GTUA 4IKHA 2IMIA 3CSHA 4F0BA 5KEJA 2DSAA 2GSRA 2FNOA 3FY7A 2IL3A 4WR4A 5F8BA 1V40A 4I97A 1MTCA 14GSA 2CZ3A 2IMKA 1OKTA 3MDKA 2GDRA 1EV4A 1PMTA 4IW9A 5B7CA 2VCXA 3LXTA 2HSNB 3R2QA 2ON7A 3AY8A 5GSTA 3IK7A 1K0MA 4J2FA 1GSFA 1YY7A 6GSTA 1TW9A 5D9XA 3LG6A 3FYGA 3KXOA 1GTAA 4GTUA 4YQVA 4PGTA 4IQAA 4MPFA 4RI7A 2C3QA 5LD0A
chains in the Genus database with same CATH superfamily
4WR5A 4TXVA 3FZ9A 3GTUB 2B1KA 1F3BA 3FZ4A 5HFIA 2H71A 1GH2A 3H8QA 3UBKA 2B5YA 3CBUA 3DEXA 2WZSA 1JLVA 4ZBBA 3QOUA 1SENA 1TK5B 4IP6A 4HUAA 4POLA 3HDCA 2F8FA 1GRXA 2H75A 2LEGA 5J9CA 2LS5A 4X4JA 3EU3A 2V41A 2L5OA 3W6GA 5J3RA 4F9ZA 1OC9A 2H0IA 3WD6A 1YZXA 4XS4A 3CYNA 1M0UA 3TJBA 4NAXA 4K2XA 4N3ZA 1SU9A 2ES7A 3I43A 1R5PA 1SKWB 3PINA 2R0GA 2DLXA 3IDVA 2OE1A 4RQRA 2H1BA 1GSUA 4DSSB 4CY6A 1I5GA 1HD2A 2GVPA 5J47A 1ZGNA 3G7JA 3TOTA 2RLIA 3UAPA 3CRUA 3TKSE 4MJEA 4IQ1A 1R5AA 4GSTA 5AIVA 2RM6A 1X5CA 5ID2B 2JL4A 4BVXA 2N5BA 2REMA 4TW5A 3QAVA 2AB6A 5J4UA 5AN1A 3RBTA 4LL1B 4WKWA 2V6OA 2WW3A 3FW2A 2M72A 1OYJA 3KMNA 1M2DA 4NHZA 5ECRB 1DBYA 3UOMA 4F2IA 5J40A 5DAKA 5J5NA 2FA8A 1RK4A 1EWXA 2HSYA 2LJKA 2K6VA 4ISDA 2V2GA 4L5OA 3M9KA 1FAAA 3GH6A 5ECHB 3UIWA 1G6YA 3IC4A 2HRFA 2VCQA 4FQUA 3LEFA 2IPAA 4WBRD 2GT6A 3HMJG 1GWCA 4CW9A 4HU7A 1R4WA 2DMMA 3FEUA 1AQVA 5ECNB 2XBQA 4TR1B 1XG8A 2P31A 2NTOA 1FG4A 3HKRA 2OE3A 3TU3B 2R2JA 4IN0A 3LJRA 4MNNA 2MMNA 4N0ZA 5L71A 2AUVA 2VLUA 2H1AA 4MABA 3GN3A 3ZYWA 5JCUA 3GUSA 3U5RE 1DUGA 4TR3A 3GURA 3ISOA 1O8XA 1N2AA 3HZ4A 5CP1A 1A0FA 3MAKA 2MBTA 3GSSA 3A2XA 3VURA 1QXHA 2HSMA 3V1WA 1ACVA 3VWXA 3KMOA 2JSYA 1GSSA 11GSA 1GSDA 5GZZB 1PSQA 4Q5QA 4Z7XA 4ZILA 4GSSA 3TKSC 2R4VA 2YWOA 4PXOA 2WCIA 2WW2A 3O3TA 4OO5A 3TJJA 2QC7A 5F06A 1LU4A 5LCZA 3KH7A 3H4KA 2MZCA 1PD21 2HSHA 4TKYA 1FHEA 2WB9A 4OCFA 4HZ4A 5IMVA 5IPHA 1B48A 1FVKA 1G0TA 1RW1A 2VLTA 3DKSA 3EE2A 3M1GA 2NPBA 4K1FA 4MJAA 18GSA 2TIRA 5HR1A 3KP8A 1WIKA 3KGKA 3GFKA 1T00A 2BMXA 3TRXA 5FHIA 3QMXA 1XVQA 2YN1A 2H6YA 3F0IA 5DBQA 3QDNA 4BVYB 4Q5RA 3E9JB 4XTSA 3F63A 4JEDA 2C0FA 2PUKC 2H19A 3FKFA 4JU5A 1WJKA 3ZFLA 4WBJA 2C0EA 4L5LA 3N5OA 1AUCA 5IO2A 5INYA 1TKDB 4TN8A 2FWGA 4I6XA 5A4UA 4ML6A 5CRWA 1TXUA 4E8EA 4K0NA 1JZWA 2R5GA 3SBCA 3NOFA 1QQ2A 4BA7A 2DJJA 2CVDA 4GLTA 2DBCA 4X1UA 4ZIJA 4ILFA 2LQOA 1TTZA 2HYXA 1OC3A 3GV1A 3GMFA 2OJLA 2H72A 4MJCA 4GQCA 3NZNA 1J08A 2IIYA 5CRHA 5AGYA 1PN9A 5KOXA 2HI7A 3IBHA 5G5EA 4HDEA 5ELAA 2C3TA 1BG1A 2FWHA 3GTUA 2L4QA 2NDOA 4XHMA 2DKIA 2UZ8A 3CSIA 1X0RA 3DXBA 1U3AA 4RQXA 3KD0A 2LUSA 2X8CA 4KSOA 1CQGA 4YQUA 1EOGA 3W8SA 4AGSA 2HRKB 2YZHA 1EEMA 2B7JA 6GSSA 3BCIA 3HJMA 1XBSA 4YAVA 1B4QA 5J4VA 2J9HA 3RPNA 2JADA 1OC8A 1B9YC 2K9FA 1Z7RA 4IKHA 4I2UA 3KZQA 4W66A 2LRCA 3G7YA 5GAND 5A34B 2QSIA 1O81A 2B1LA 3TKSA 5IPGA 1Z6MA 1OKTA 2GDRA 1PMTA 3LXTA 1SYRA 3AY8A 4DSSA 2XBIA 1M2BA 1TW9A 3MWHA 4YQVA 2H0HA 2P0GA 4WF4A 1FW1A 1XFLA 2K18A 2F3MA 1A0RP 2A2PA 3IE3A 2C0GA 2CX4A 1AAZA 5IMZA 5EVOA 5ID2A 3GL5A 4PQIA 1GP1A 1RQMA 3ZMKA 4AJ6A 1VF2A 4LMWA 2IMFA 4HS1A 4PQHA 5ELGA 4G2EA 3L9SA 2C3NA 1YKCA 3Q18A 2CV4A 2PVQA 3M0FA 1HYUA 2WVXB 3ZTLA 2GSSA 3DVWA 2L59A 3IHGA 2VL2C 3L4NA 4ZB6A 3GKKA 4Z2UA 1TK0B 1UC7A 2GZYA 4O5RA 1XWKA 3FZ5A 4XCSA 2PMTA 2O7KA 2D2ZA 2VCWA 3F3QA 3LWAA 2OT3A 3DMLA 4PX1A 3QFBC 3KJYA 1BQ7A 3PR8A 3HCZA 4YKFA 5A1NB 4GCIA 5ECPB 2YJHA 1SL0B 3GX8A 5IMAA 4MF6A 3KP9A 4TR1A 5IMFA 3HVXA 2VUPA 3APSA 1GUKA 1Y1UA 1SL1B 1MD3A 1JHBA 4DSRA 2VAFA 3IOSA 4PNFA 5DQSA 2GQLA 4K7OA 2DJ1A 2IN3A 4OO4A 3O76A 2VO4A 2LTKA 3CSJA 3MIXA 3PPUA 5IO0A 1PL2A 2F8AA 4I5QA 1PA3A 1OE8A 2IJYA 3WT1A 2E0QA 3UMAA 4NWYA 1X9SB 1U3IA 3ZL5A 3RFRC 1A2JA 2FUG2 1TI3A 1M3IA 2F51A 2VM1A 5ENUA 3HVNA 1SKRB 1AQXA 4MH3A 4V1Ag 1IYIA 4A5PA 3EWLA 2HFDA 2JU5A 4ZBDA 4AF2A 4JRRA 4IVFA 4G9HA 5IMDA 1BJXA 4MF7A 1JFUA 4NPBA 5D8IA 2C80A 3A2VA 4WEYA 2O36A 4PI0C 2LJRA 3ED3A 1VGLA 2VOCA 2EC4A 5DCHA 1O8WA 1YEWC 1GLQA 1OAZA 3EC3A 2QKEA 4XRDA 1V2AA 5IIZA 2OACA 3D0ZA 3TRQA 2G2QA 3JCML 3BJ5A 1XZOA 1WP0A 2VKZG 4PQ1A 3US3A 2O5VA 2GQMA 2RM5A 3WT2A 3L78A 2FHEA 5ECSA 3QAWA 3KCMA 2WVZA 4BVYA 2VIMA 1XW6A 2KP1A 4PUFC 4HSCX 3ME8A 3LYPA 3BOAA 2HLSA 2GQKA 1F3AA 4XS1A 4PUAA 3FR9A 3IV4A 1Z7PA 2YJ7A 3ZREA 2C4JA 4YAPA 1V58A 2JACA 4OD7A 5IOXA 4POKA 4AJ8A 3MNGA 3UARA 7GSSA 2CX3A 1TI1A 2G0FA 5EPFA 2GLRA 3IC8A 1ZYPA 2VL2A 3VLNA 2X99A 1R26A 4EIPA 1AW9A 4EF0A 3TGZA 1GUMA 4TXOB 3TKQA 1EGRA 3BBYA 3H79A 5CAXA 4JBBA 1AXDA 1NM3A 4YH2A 2IWTA 1UA5A 1A2LA 5D9VA 1EP8A 4P3YB 3TKPA 2L5LA 1OVNA 10GSA 4NV5A 1K0BA 2R37A 5FT3A 4G0IA 2HE3A 4HJMA 4KUNA 1J9BA 2EIRA 5B8BA 4IJIA 1OE7A 1XWAA 3QCPA 3C8EA 3IXRA 1BYEA 3GKMA 3E0UA 5JWQB 2ZCTA 3FRCA 4GRFA 3APQA 3VI7A 2YWNA 2H8LA 2O89A 4EO3A 1WWJA 2HRKA 2V1MA 1N8JA 1S3CA 2VCVA 2OBIA 1S3DA 4NMUA 4KDUA 1PRXA 5KN3A 2GGTA 1TRUA 3P2AA 4HOJA 1M9BA 1TU7A 1VF3A 4MF5A 3ZIVA 4DVCA 2HRNA 2RUEA 4Z2RA 3BCKA 1ZYQB 5A34A 1Z9HA 2UV8G 4E68A 1W4VA 1YQ1A 2C8UA 2GZPA 1PGTA 4QL7A 5J41A 3GH9A 2VL3A 3DYRA 4Q5FA 3HJPA 4TRXA 2GSTA 2YANA 6GSWA 2WW0A 5DJLA 1AC1A 5KOWA 1ZCPA 4IHUA 1MDIA 4N11A 4KDXA 4KDYA 2LJAA 2YV9A 1MD4A 2CZ2A 1PQNA 1EEJA 3APOA 4OCEA 4G0KA 3WGDA 1JZRA 3FR6A 6GSVA 1AIUA 2AYTA 1TOFA 3SWLA 3F4RA 3TKRA 1QMVA 2GT5A 2WDUA 3EINA 1YF0A 1Y25A 2B5EA 4O32A 3ZFBA 1ZOFA 5A4VA 3I69A 1EZKA 2LKUA 3A5IA 4KGIA 5J4YA 2B5XA 1PKZA 4ZB7A 2VCTA 5A5KA 1NHOA 2LQQA 2GTUA 5A5HA 3GNJA 3C1SA 3CSHA 2IMEA 2WVXA 4KA0A 2GSRA 2FNOA 3FY7A 2X4AA 2LNSA 4WR4A 5F8BA 1V40A 3EMXA 4N30A 1MTCA 14GSA 4AKHA 2IMKA 3TRPA 4IW9A 5B7CA 4XRAA 2QGVA 3LW9A 4XS6A 1SJZA 2HSNB 3R2QA 3ZVJD 3VWUA 2ON7A 1SL2B 4BWQA 3LGCA 3LG6A 3GA4A 3FYGA 1GTAA 1GL8A 3GL3A 1WOUA 2VL9A 4KNDA 4IQAA 3H93A 4MPFA 3CQFA 5A1NA 5JCGA 5LD0A 2ALBA 1XCCA 4GF0A 1KBNA 4F0CA 4IP1A 1ZL9A 4HEA2 2YPMA 2I4AA 4EE0A 2H6XA 1WMJA 1WE0A 2YWMA 2K8VA 5D9TA 4K8MA 4MP4A 1BF5A 1K0AA 3WGXA 2WS2A 5ECLB 1MEKA 4ECCA 2CAIA 1HNAA 2GS3A 1B8XA 1K0OA 3VFIA 4EXJA 4KSMA 3A3TA 2WJUA 2X8HA 4HZ2A 2FY6A 2B3SA 2PERA 2H66A 5HR2A 1PFOA 3ZVJA 1O85A 2CA8A 4JR4A 5DCGA 1A24A 5LNKe 4IS0A 4MPGA 5DDLA 3M8NA 4ZL8A 2K8SA 1AQWA 2LNTA 3LYKA 1SVMA 1CQHA 5AIXA 1ERWA 2R0PA 5CRDA 4ACSA 5ECMB 4ICYA 1PX6A 1YF1A 2H30A 2C0DA 3LORA 3EMPA 4O5UA 1V57A 3EPTA 1V98A 3S9FA 2H76A 2A4HA 4GSNA 5D93A 1TJDA 5IOWA 2CVKA 1ILOA 3VPTA 1KNGA 1FB6A 1EP7A 2I81A 5CREA 4K6XA 2VLVA 4HJ2A 5ECQB 1SK1A 2EFDA 1WPIA 3I9V2 1W89A 5JCWA 1F9MA 1SYXA 3ERFA 1BAYA 2DMLA 4JE1A 4K2DA 5EL8A 2H1LA 2O85A 5A4WA 5DALA 1TRSA 1EV9A 4ECIA 3KIJA 3DD3A 3FK8A 4G10A 5BMUB 4E8HA 3TDGA 4L0UA 2L4CA 3RGBC 17GSA 1X5EA 2P5QA 4MDCA 2X49A 5HFKA 2PU9C 1GSQA 2FA4A 1M9AA 3K8NA 3L9VA 5B6MA 2H73A 4N0VA 1U6TA 3P8WA 4HI7A 1LJRA 1A8LA 2WRTA 4K5SA 2X64A 1TK8B 1PN0A 2MMZA 3HHVA 1DE2A 3F4TA 5B6NA 1GTBA 4LL4B 2PPTA 2VD1A 4TXOA 1SVLA 2FD3A 4G0LA 3H1NA 4ZB8A 3HY2A 5D73A 4ECJA 4NV2A 5A5HB 3ZITA 1JZOA 2OBKA 1Y6EA 1GUHA 4USSA 3TJFA 2PVOC 3D5JA 1THOA 4K7IA 4MK3A 1E2YA 4IGJA 1QK8A 5IM9A 1Q98A 1THXA 4KCEA 5C04A 5E4WA 3OR5A 3J7Yb 2VM2A 3VK9A 5G2ZA 3UL3A 3N9JA 2LRTA 3LSZA 4V1Ap 5DVBA 4OFMA 2DJ3A 2O3EA 2L57A 1A8YA 2IMDA 1FO5A 1TDIA 2MBSA 2DJ0A 4MMMA 3HYPA 4PURA 1SKSB 4TR4A 2WW1A 2XHFA 4BL7A 3QAGA 2R3XA 2FLSA 3TB2A 1QFNA 1XVWA 2JSZA 4AJ7A 4MJBA 4YKGA 5GSSA 9GSSA 4GWRA 2R6KA 1USBA 4Q5NA 3MYDA 3EU4A 3W8JA 3IAS2 1GNEA 1VF4A 4WETA 4L0WA 1H75A 1BX9A 1XW9A 1ERUA 5C00A 4TVEA 5COHA 2EFCA 5JWOB 1NSWA 2MYGA 5J9BA 1YEXA 2KOKA 3D21A 1TU8A 3A5WA 4EDZA 1G7OA 2L6DA 4JR6A 5H5RA 1XOAA 4RI6A 4YQMA 2E2GA 5H5SA 1HQOA 3FZAA 4KB3A 2HQTA 2LV3A 2RUFA 3HD5A 4ZL7A 3F8UA 1A2MA 5HR3A 2FGXA 1S3AA 3C71A 1GTUA 1ML6A 4J56E 1Q4JA 1YVLA 2O87A 4FYBA 5DQYA 3PGTA 2JZTA 3UVTA 1JLWA 2I3YA 2I1UA 4H86A 4D73B 3ME7A 1X9WB 4BPYA 2KLXA 3IA1A 2AV4A 4O92A 3A2WA 1IYHA 1X5DA 1S3RA 2V32A 3TJKA 4FIWA 4FYCA 1K0CA 2DIYA 2HNLA 3CXGA 2HSNA 5DALB 1SK0A 4GDFA 1B9XC 2H6ZA 4O5QA 1YKAA 3CMIA 1B4PA 1SD9A 3LQ7A 1I1IP 1M99A 2A4VA 2B7KA 1HNCA 5HR0A 4ECBA 1GNWA 3MSZA 4KW6A 4DEJA 2H0GA 3CRTA 4EIQA 5BRTA 4LA1A 1XWBA 2WZ9A 4LLRA 3DRNA 1U88A 3IPZA 3O6TA 2YCDA 2V6KA 2YNXA 3L0HA 3L9UA 4EL1A 3GX0A 2TRXA 4I8BA 1K0NA 1DE1A 1S4BP 3VI5A 4EVMA 2YZUA 4CHSA 1GLPA 2DJ2A 3UBLA 3TJGA 2IMIA 2OE0A 2FWFA 3ZZXA 2M46A 3KEBA 4NXIA 1I9DA 4I97A 3IAM2 2CZ3A 3RDWA 3F9UA 2WULA 2VCXA 4AKGA 2NVLA 3IK7A 1K0MA 4J2FA 1YY7A 3KXOA 4GTUA 4PGTA 5H5QA 2C3QA 2OADA 2C1YA 4K5RA 2XPEA 3GIXA 1ON4A 4X0XA 4MZBA 4K7NA 2VD0A 2P5RA 3D4TA 4MZWA 1M3JA 3LFLA 4BL7B 1XOBA 1F37A 4OWYA 2J23A 2TRCP 2EIQA 3VPQA 4PI2C 2ZNMA 3M9JA 2N5FA 5KN2A 3BD2A 5G30A 1U87A 1C72A 2HZEB 1GSEA 4CDOA 4QMKA 2EIOA 1OKDA 3RAZA 1T3BA 3DWVA 1XWCA 1VF1A 1V9WA 2YOIA 3QD9A 4AI6A 4V2LA 2KUCA 3HXSA 5BMUA 2IFQA 2YV7A 2E2MA 1VRSD 1Z6NA 5G1LA 2JZSA 5IQYA 3RHBA 1WRYA 4GQFA 4ZB9A 4XIHA 4RUVA 13GSA 2FWEA 3HJOA 5ABRA 4FYUA 1XPVA 4J57E 3TUEA 2QA2A 3U6VA 2PBJA 1XWGA 1ERTA 2NBSA 4HQZA 1O7UA 2ZUPA 4ZXGA 2LSTA 3GHAA 1UN2A 4WXTA 2B6MA 3UVHA 3R3EA 1GULA 2OKAA 5CO3A 5B8AA 2GZZA 1TRWA 2PN8A 1M7TA 1K3LA 5ECKB 1XW5A 3UEMA 4X43A 4AKIA 3GRXA 1NW2A 2A2RA 4KH7A 3HVSA 3P7XA 2PGTA 3GSTA 3WYWA 2XPDA 5FWGA 1HNBA 1TXXA 4MLYA 3KH9A 3F4SA 3VWWA 3ERWA 4G19A 4LMVA 4KF9A 1OC9B 4TOPA 6GSUA 2GSQA 3C73A 3RPPA 2CAQA 4GXZA 4XS4B 3NIVA 1QGVA 1G6WA 2R0CA 5CRGA 3KM6A 3G7IA 2KHPA 4N10A 4DSQA 5AISA 3TOUA 1R7HA 5ECIB 3LXZA 5CNWA 2H01A 2M80A 1T8EB 2DJKA 4PTSA 3HA9A 3F6DA 2N5AA 3D22A 1K3YA 4I2TA 1LBKA 3DVXA 5G5FA 1ST9A 1ERVA 1M2AA 1F6MC 5G31A 2YWIA 1O73A 3CHXC 1SVOA 5IMCA 2A2SA 1YDKA 1N25A 1SK2A 3EYTA 3KTBA 3GKXA 2RIIA 4BVXB 4ULXA 4CY8A 4G01A 2PWJA 1A23A 5JWRB 22GSA 4V2NA 2I9HA 1PKWA 4ZL9A 4JZQA 1URMA 2WVYA 1GTIA 2H1GA 2JZRA 1SJIA 1X9MB 2CT6A 4MH2A 2CQ9A 4K0GA 1G7EA 3D6IA 5DAKB 4POBA 3FMWA 4KX4A 3CWGA 2DC5A 2WGRA 5ECOB 4NHWA 4IELA 1T7PB 3IK9A 3VWVA 3F6FA 4F03A 4EDYA 2X8GA 1E6BA 1ZYEA 4PHZC 4QQ7A 19GSA 1PL1A 3DGQA 4OFTA 1TRVA 1BEDA 4IBPA 3DIEA 3CTGA 2HRAA 1ZMAA 3QPMA 1GSYA 4D73A 5D9WA 3P90A 3ZIJA 1PX7A 5HFGA 3Q6OA 3C1RA 4BIKA 2HXKA 3D4MA 4BWSA 1DSBA 3Q74A 1FB0A 4MCUA 1F2EA 2H1DA 2IFQB 4KCAA 4KE3A 1MDKA 1T1VA 2H70A 1O6JA 4OFNA 1T4YA 16GSA 3EURA 3G9BA 3QFAC 3GKNA 4ID0A 1Z5YE 2EFHA 4L8EA 1KTEA 4K9ZA 8GSSA 1T4ZA 2H74A 1SD8A 4IJ3A 2BTOT 2YP6A 2HSMB 2AHEA 1BG5A 4O7HA 3C7MA 3Q19A 1FOHA 4FH8A 4EC0A 4MZCA 2ON5A 1SJ6A 1YEPA 2Z9SA 2BJXA 3FHKA 4KAEA 3TCOA 2O8VB 3CTFA 5DJMA 5HQPA 3GYKA 4AKXB 3FR3A 2FCHA 2E7PA 2F9SA 2QA1A 3I6AA 5EY6A 4ZBAA 4F82A 3RHCA 4QL9A 4EUYA 5F0GA 4OMVA 1FOVA 2DKHA 2HZFA 5KN1A 3WGEA 3UJ1A 3IHQA 1K0DA 6GSXA 6GSYA 3J7Yk 1EGOA 12GSA 2L6CA 4MA9A 4FXYP 3ZRDA 2HT9A 20GSA 1UVZA 2MMOA 1EOHA 4PNGA 4TR0A 3QR6A 4FO5A 1ZZYA 2XC2A 1MDJA 1TP9A 4HQSA 2VCZA 1K3OA 5F07A 2AJQB 4POMA 4V2MA 5E59A 1XXUA 3ZMLA 5G1KA 2OA7A 5CYYA 3EVIA 3E3EA 2KP2A 3IR4A 3KTLA 5F05A 1FVJA 1H4OA 2HZEA 1XIYA 3M3MA 1J0FA 2CVBA 3ERGA 4EKZA 1YJ6A 1NHYA 1ZYNA 2AAWA 3IRAA 5KN0A 4F0BA 5KEJA 4WF5A 2DSAA 5GAPD 2IL3A 2LRNA 2WFCA 3HVVA 1ABAA 4ML1A 3HZ8A 3MDKA 1EV4A 2EFEA 2DIZA 3F3RA 5GSTA 1GSFA 3PH9A 3ZLPA 4HU9A 6GSTA 2MMAA 5D9XA 1JZDA 1Z3EA 1QUWA 1KEBA 4Z2TA 5D96A 4RI7A
chains in the Genus database with same CATH topology
4WR5A 4TXVA 3FZ9A 3GTUB 2B1KA 1F3BA 3FZ4A 5HFIA 2H71A 1GH2A 3H8QA 3UBKA 2B5YA 3CBUA 3DEXA 1JLVA 4ZBBA 3QOUA 1SENA 1TK5B 4IP6A 4HUAA 4POLA 3HDCA 2F8FA 1GRXA 2H75A 2LEGA 5J9CA 2LS5A 4X4JA 3EU3A 2V41A 2L5OA 3W6GA 5J3RA 4F9ZA 1OC9A 2H0IA 3WD6A 1YZXA 4XS4A 3CYNA 1M0UA 3TJBA 4NAXA 4K2XA 4N3ZA 1SU9A 2ES7A 3I43A 1R5PA 1SKWB 3PINA 2R0GA 2DLXA 3IDVA 2OE1A 4RQRA 2H1BA 1GSUA 4DSSB 4CY6A 1I5GA 1HD2A 2GVPA 5J47A 1ZGNA 3G7JA 3TOTA 2RLIA 3UAPA 3CRUA 3TKSE 4MJEA 4IQ1A 1R5AA 4GSTA 5AIVA 2RM6A 1X5CA 5ID2B 2JL4A 4BVXA 2N5BA 2REMA 4TW5A 3QAVA 2AB6A 5J4UA 5AN1A 3RBTA 4LL1B 4WKWA 2V6OA 3FW2A 2M72A 1OYJA 3KMNA 1M2DA 4NHZA 5ECRB 1DBYA 3UOMA 4F2IA 5J40A 5DAKA 5J5NA 2FA8A 1RK4A 1EWXA 2HSYA 2LJKA 2K6VA 4ISDA 2V2GA 4L5OA 3M9KA 1FAAA 3GH6A 5ECHB 3UIWA 1G6YA 3IC4A 2HRFA 2VCQA 4FQUA 3LEFA 2IPAA 4WBRD 2GT6A 3HMJG 1GWCA 4CW9A 4HU7A 1R4WA 2DMMA 3FEUA 1AQVA 5ECNB 2XBQA 4TR1B 2P31A 2NTOA 1FG4A 3HKRA 2OE3A 3TU3B 2R2JA 4IN0A 3LJRA 4MNNA 2MMNA 4N0ZA 5L71A 2AUVA 2VLUA 2H1AA 4MABA 3GN3A 3ZYWA 5JCUA 3GUSA 3U5RE 1DUGA 4TR3A 3GURA 3ISOA 1O8XA 1N2AA 3HZ4A 5CP1A 1A0FA 3MAKA 2MBTA 3GSSA 3A2XA 3VURA 1QXHA 2HSMA 3V1WA 1ACVA 3VWXA 3KMOA 2JSYA 1GSSA 11GSA 1GSDA 5GZZB 1PSQA 4Q5QA 4Z7XA 4ZILA 4GSSA 3TKSC 2R4VA 2YWOA 4PXOA 2WCIA 3O3TA 4OO5A 3TJJA 2QC7A 5F06A 1LU4A 5LCZA 3KH7A 3H4KA 2MZCA 1PD21 2HSHA 4TKYA 1FHEA 2WB9A 4OCFA 4HZ4A 5IMVA 5IPHA 1B48A 1FVKA 1G0TA 1RW1A 2VLTA 3DKSA 3EE2A 3M1GA 2NPBA 4K1FA 4MJAA 18GSA 2TIRA 5HR1A 3KP8A 1WIKA 3KGKA 3GFKA 1T00A 2BMXA 3TRXA 5FHIA 3QMXA 1XVQA 2YN1A 2H6YA 3F0IA 5DBQA 3QDNA 4BVYB 4Q5RA 3E9JB 4XTSA 3F63A 4JEDA 2C0FA 2PUKC 2H19A 3FKFA 4JU5A 1WJKA 3ZFLA 4WBJA 2C0EA 4L5LA 3N5OA 1AUCA 5IO2A 5INYA 1TKDB 4TN8A 2FWGA 4I6XA 5A4UA 4ML6A 5CRWA 1TXUA 4E8EA 4K0NA 1JZWA 2R5GA 3SBCA 3NOFA 1QQ2A 4BA7A 2DJJA 2CVDA 4GLTA 2DBCA 4X1UA 4ZIJA 4ILFA 2LQOA 1TTZA 2HYXA 1OC3A 3GV1A 3GMFA 2OJLA 2H72A 4MJCA 4GQCA 3NZNA 1J08A 2IIYA 5CRHA 5AGYA 1PN9A 5KOXA 2HI7A 3IBHA 5G5EA 4HDEA 5ELAA 2C3TA 1BG1A 2FWHA 3GTUA 2L4QA 2NDOA 4XHMA 2DKIA 2UZ8A 3CSIA 1X0RA 3DXBA 1U3AA 4RQXA 3KD0A 2LUSA 2X8CA 4KSOA 1CQGA 4YQUA 1EOGA 3W8SA 4AGSA 2HRKB 2YZHA 1EEMA 2B7JA 6GSSA 3BCIA 3HJMA 1XBSA 4YAVA 1B4QA 5J4VA 2J9HA 3RPNA 2JADA 1OC8A 1B9YC 2K9FA 1Z7RA 4IKHA 4I2UA 3KZQA 4W66A 2LRCA 3G7YA 5GAND 5A34B 2QSIA 1O81A 2B1LA 3TKSA 5IPGA 1Z6MA 1OKTA 2GDRA 1PMTA 3LXTA 1SYRA 3AY8A 4DSSA 2XBIA 1M2BA 1TW9A 3MWHA 4YQVA 2H0HA 2P0GA 4WF4A 1FW1A 1XFLA 2K18A 2F3MA 1A0RP 2A2PA 3IE3A 2C0GA 2CX4A 1AAZA 5IMZA 5EVOA 5ID2A 3GL5A 4PQIA 1GP1A 1RQMA 3ZMKA 4AJ6A 1VF2A 4LMWA 2IMFA 4HS1A 4PQHA 5ELGA 4G2EA 3L9SA 2C3NA 1YKCA 3Q18A 2CV4A 2PVQA 3M0FA 1HYUA 3ZTLA 2GSSA 3DVWA 2L59A 3IHGA 2VL2C 3L4NA 4ZB6A 3GKKA 4Z2UA 1TK0B 1UC7A 2GZYA 4O5RA 1XWKA 3FZ5A 4XCSA 2PMTA 2O7KA 2D2ZA 2VCWA 3F3QA 3LWAA 2OT3A 3DMLA 4PX1A 3QFBC 3KJYA 1BQ7A 3PR8A 3HCZA 4YKFA 5A1NB 4GCIA 5ECPB 2YJHA 1SL0B 3GX8A 5IMAA 4MF6A 3KP9A 4TR1A 5IMFA 3HVXA 2VUPA 3APSA 1GUKA 1Y1UA 1SL1B 1MD3A 1JHBA 4DSRA 2VAFA 3IOSA 4PNFA 5DQSA 2GQLA 4K7OA 2DJ1A 2IN3A 4OO4A 3O76A 2VO4A 2LTKA 3CSJA 3MIXA 3PPUA 5IO0A 1PL2A 2F8AA 4I5QA 1PA3A 1OE8A 2IJYA 3WT1A 2E0QA 3UMAA 4NWYA 1X9SB 1U3IA 3ZL5A 1A2JA 2FUG2 1TI3A 2F51A 2VM1A 5ENUA 1SKRB 1AQXA 4MH3A 4V1Ag 1IYIA 4A5PA 3EWLA 2HFDA 2JU5A 4ZBDA 4AF2A 4JRRA 4IVFA 4G9HA 5IMDA 1BJXA 4MF7A 1JFUA 4NPBA 5D8IA 2C80A 3A2VA 4WEYA 2LJRA 3ED3A 1VGLA 2VOCA 2EC4A 5DCHA 1O8WA 1GLQA 1OAZA 3EC3A 2QKEA 4XRDA 1V2AA 5IIZA 2OACA 3D0ZA 3TRQA 2G2QA 3JCML 3BJ5A 1XZOA 1WP0A 2VKZG 4PQ1A 3US3A 2O5VA 2GQMA 2RM5A 3WT2A 3L78A 2FHEA 5ECSA 3QAWA 3KCMA 4BVYA 2VIMA 1XW6A 2KP1A 4PUFC 3ME8A 3LYPA 3BOAA 2HLSA 2GQKA 1F3AA 4XS1A 4PUAA 3FR9A 3IV4A 1Z7PA 2YJ7A 3ZREA 2C4JA 4YAPA 1V58A 2JACA 4OD7A 5IOXA 4POKA 4AJ8A 3MNGA 3UARA 7GSSA 2CX3A 1TI1A 2G0FA 5EPFA 2GLRA 3IC8A 1ZYPA 2VL2A 3VLNA 2X99A 1R26A 4EIPA 1AW9A 4EF0A 3TGZA 1GUMA 4TXOB 3TKQA 1EGRA 3BBYA 3H79A 5CAXA 4JBBA 1AXDA 1NM3A 4YH2A 2IWTA 1UA5A 1A2LA 5D9VA 1EP8A 4P3YB 3TKPA 2L5LA 1OVNA 10GSA 4NV5A 1K0BA 2R37A 5FT3A 4G0IA 2HE3A 4HJMA 4KUNA 1J9BA 2EIRA 5B8BA 4IJIA 1OE7A 1XWAA 3QCPA 3C8EA 3IXRA 1BYEA 3GKMA 3E0UA 5JWQB 2ZCTA 3FRCA 4GRFA 3APQA 3VI7A 2YWNA 2H8LA 2O89A 4EO3A 1WWJA 2HRKA 2V1MA 1N8JA 1S3CA 2VCVA 2OBIA 1S3DA 4NMUA 4KDUA 1PRXA 5KN3A 2GGTA 1TRUA 3P2AA 4HOJA 1M9BA 1TU7A 1VF3A 4MF5A 3ZIVA 4DVCA 2HRNA 2RUEA 4Z2RA 3BCKA 1ZYQB 5A34A 1Z9HA 2UV8G 4E68A 1W4VA 1YQ1A 2C8UA 2GZPA 1PGTA 4QL7A 5J41A 3GH9A 2VL3A 3DYRA 4Q5FA 3HJPA 4TRXA 2GSTA 2YANA 6GSWA 5DJLA 1AC1A 5KOWA 1ZCPA 4IHUA 1MDIA 4N11A 4KDXA 4KDYA 2LJAA 2YV9A 1MD4A 2CZ2A 1PQNA 1EEJA 3APOA 4OCEA 4G0KA 3WGDA 1JZRA 3FR6A 6GSVA 1AIUA 2AYTA 1TOFA 3SWLA 3F4RA 3TKRA 1QMVA 2GT5A 2WDUA 3EINA 1YF0A 1Y25A 2B5EA 4O32A 3ZFBA 1ZOFA 5A4VA 3I69A 1EZKA 2LKUA 3A5IA 4KGIA 5J4YA 2B5XA 1PKZA 4ZB7A 2VCTA 5A5KA 1NHOA 2LQQA 2GTUA 5A5HA 3GNJA 3C1SA 3CSHA 2IMEA 4KA0A 2GSRA 2FNOA 3FY7A 2X4AA 2LNSA 4WR4A 5F8BA 1V40A 3EMXA 4N30A 1MTCA 14GSA 4AKHA 2IMKA 3TRPA 4IW9A 5B7CA 4XRAA 2QGVA 3LW9A 4XS6A 1SJZA 2HSNB 3R2QA 3ZVJD 3VWUA 2ON7A 1SL2B 4BWQA 3LGCA 3LG6A 3GA4A 3FYGA 1GTAA 1GL8A 3GL3A 1WOUA 2VL9A 4KNDA 4IQAA 3H93A 4MPFA 5A1NA 5JCGA 5LD0A 2ALBA 1XCCA 4GF0A 1KBNA 4F0CA 4IP1A 1ZL9A 4HEA2 2YPMA 2I4AA 4EE0A 2H6XA 1WMJA 1WE0A 2YWMA 2K8VA 5D9TA 4K8MA 4MP4A 1BF5A 1K0AA 3WGXA 2WS2A 5ECLB 1MEKA 4ECCA 2CAIA 1HNAA 2GS3A 1B8XA 1K0OA 3VFIA 4EXJA 4KSMA 3A3TA 2WJUA 2X8HA 4HZ2A 2FY6A 2B3SA 2PERA 2H66A 5HR2A 3ZVJA 1O85A 2CA8A 4JR4A 5DCGA 1A24A 5LNKe 4IS0A 4MPGA 5DDLA 3M8NA 4ZL8A 2K8SA 1AQWA 2LNTA 3LYKA 1SVMA 1CQHA 5AIXA 1ERWA 2R0PA 5CRDA 4ACSA 5ECMB 4ICYA 1PX6A 1YF1A 2H30A 2C0DA 3LORA 3EMPA 4O5UA 1V57A 3EPTA 1V98A 3S9FA 2H76A 2A4HA 4GSNA 5D93A 1TJDA 5IOWA 2CVKA 1ILOA 3VPTA 1KNGA 1FB6A 1EP7A 2I81A 5CREA 4K6XA 2VLVA 4HJ2A 5ECQB 1SK1A 2EFDA 1WPIA 3I9V2 1W89A 5JCWA 1F9MA 1SYXA 3ERFA 1BAYA 2DMLA 4JE1A 4K2DA 5EL8A 2H1LA 2O85A 5A4WA 5DALA 1TRSA 1EV9A 4ECIA 3KIJA 3DD3A 3FK8A 4G10A 5BMUB 4E8HA 3TDGA 4L0UA 2L4CA 17GSA 1X5EA 2P5QA 4MDCA 2X49A 5HFKA 2PU9C 1GSQA 2FA4A 1M9AA 3K8NA 3L9VA 5B6MA 2H73A 4N0VA 1U6TA 3P8WA 4HI7A 1LJRA 1A8LA 2WRTA 4K5SA 2X64A 1TK8B 1PN0A 2MMZA 3HHVA 1DE2A 3F4TA 5B6NA 1GTBA 4LL4B 2PPTA 2VD1A 4TXOA 1SVLA 2FD3A 4G0LA 3H1NA 4ZB8A 3HY2A 5D73A 4ECJA 4NV2A 5A5HB 3ZITA 1JZOA 2OBKA 1Y6EA 1GUHA 4USSA 3TJFA 2PVOC 3D5JA 1THOA 4K7IA 4MK3A 1E2YA 4IGJA 1QK8A 5IM9A 1Q98A 1THXA 4KCEA 5C04A 5E4WA 3OR5A 3J7Yb 2VM2A 3VK9A 5G2ZA 3UL3A 3N9JA 2LRTA 3LSZA 4V1Ap 5DVBA 4OFMA 2DJ3A 2L57A 1A8YA 2IMDA 1FO5A 1TDIA 2MBSA 2DJ0A 4MMMA 3HYPA 4PURA 1SKSB 4TR4A 2XHFA 4BL7A 3QAGA 2R3XA 2FLSA 3TB2A 1QFNA 1XVWA 2JSZA 4AJ7A 4MJBA 4YKGA 5GSSA 9GSSA 4GWRA 2R6KA 1USBA 4Q5NA 3MYDA 3EU4A 3W8JA 3IAS2 1GNEA 1VF4A 4WETA 4L0WA 1H75A 1BX9A 1XW9A 1ERUA 5C00A 4TVEA 5COHA 2EFCA 5JWOB 1NSWA 2MYGA 5J9BA 1YEXA 2KOKA 3D21A 1TU8A 3A5WA 4EDZA 1G7OA 2L6DA 4JR6A 5H5RA 1XOAA 4RI6A 4YQMA 2E2GA 5H5SA 1HQOA 3FZAA 4KB3A 2HQTA 2LV3A 2RUFA 3HD5A 4ZL7A 3F8UA 1A2MA 5HR3A 2FGXA 1S3AA 3C71A 1GTUA 1ML6A 4J56E 1Q4JA 1YVLA 2O87A 4FYBA 5DQYA 3PGTA 2JZTA 3UVTA 1JLWA 2I3YA 2I1UA 4H86A 4D73B 3ME7A 1X9WB 4BPYA 2KLXA 3IA1A 2AV4A 4O92A 3A2WA 1IYHA 1X5DA 2V32A 3TJKA 4FIWA 4FYCA 1K0CA 2DIYA 2HNLA 3CXGA 2HSNA 5DALB 1SK0A 4GDFA 1B9XC 2H6ZA 4O5QA 1YKAA 3CMIA 1B4PA 1SD9A 3LQ7A 1M99A 2A4VA 2B7KA 1HNCA 5HR0A 4ECBA 1GNWA 3MSZA 4KW6A 4DEJA 2H0GA 3CRTA 4EIQA 5BRTA 4LA1A 1XWBA 2WZ9A 4LLRA 3DRNA 1U88A 3IPZA 3O6TA 2YCDA 2V6KA 2YNXA 3L0HA 3L9UA 4EL1A 3GX0A 2TRXA 4I8BA 1K0NA 1DE1A 3VI5A 4EVMA 2YZUA 4CHSA 1GLPA 2DJ2A 3UBLA 3TJGA 2IMIA 2OE0A 2FWFA 3ZZXA 2M46A 3KEBA 4NXIA 1I9DA 4I97A 3IAM2 2CZ3A 3RDWA 3F9UA 2WULA 2VCXA 4AKGA 2NVLA 3IK7A 1K0MA 4J2FA 1YY7A 3KXOA 4GTUA 4PGTA 5H5QA 2C3QA 2OADA 2C1YA 4K5RA 2XPEA 3GIXA 1ON4A 4X0XA 4MZBA 4K7NA 2VD0A 2P5RA 3D4TA 4MZWA 3LFLA 4BL7B 1XOBA 1F37A 4OWYA 2J23A 2TRCP 2EIQA 3VPQA 2ZNMA 3M9JA 2N5FA 5KN2A 3BD2A 5G30A 1U87A 1C72A 2HZEB 1GSEA 4CDOA 4QMKA 2EIOA 1OKDA 3RAZA 1T3BA 3DWVA 1XWCA 1VF1A 1V9WA 2YOIA 3QD9A 4AI6A 4V2LA 2KUCA 3HXSA 5BMUA 2IFQA 2YV7A 2E2MA 1VRSD 1Z6NA 5G1LA 2JZSA 5IQYA 3RHBA 1WRYA 4GQFA 4ZB9A 4XIHA 4RUVA 13GSA 2FWEA 3HJOA 5ABRA 4FYUA 1XPVA 4J57E 3TUEA 2QA2A 3U6VA 2PBJA 1XWGA 1ERTA 2NBSA 4HQZA 1O7UA 2ZUPA 4ZXGA 2LSTA 3GHAA 1UN2A 4WXTA 2B6MA 3UVHA 3R3EA 1GULA 2OKAA 5CO3A 5B8AA 2GZZA 1TRWA 2PN8A 1M7TA 1K3LA 5ECKB 1XW5A 3UEMA 4X43A 4AKIA 3GRXA 1NW2A 2A2RA 4KH7A 3HVSA 3P7XA 2PGTA 3GSTA 3WYWA 2XPDA 5FWGA 1HNBA 1TXXA 4MLYA 3KH9A 3F4SA 3VWWA 3ERWA 4G19A 4LMVA 4KF9A 1OC9B 4TOPA 6GSUA 2GSQA 3C73A 3RPPA 2CAQA 4GXZA 4XS4B 3NIVA 1QGVA 1G6WA 2R0CA 5CRGA 3KM6A 3G7IA 2KHPA 4N10A 4DSQA 5AISA 3TOUA 1R7HA 5ECIB 3LXZA 5CNWA 2H01A 2M80A 1T8EB 2DJKA 4PTSA 3HA9A 3F6DA 2N5AA 3D22A 1K3YA 4I2TA 1LBKA 3DVXA 5G5FA 1ST9A 1ERVA 1M2AA 1F6MC 5G31A 2YWIA 1O73A 1SVOA 5IMCA 2A2SA 1YDKA 1N25A 1SK2A 3EYTA 3KTBA 3GKXA 2RIIA 4BVXB 4ULXA 4CY8A 4G01A 2PWJA 1A23A 5JWRB 22GSA 4V2NA 2I9HA 1PKWA 4ZL9A 4JZQA 1URMA 1GTIA 2H1GA 2JZRA 1SJIA 1X9MB 2CT6A 4MH2A 2CQ9A 4K0GA 1G7EA 3D6IA 5DAKB 4POBA 3FMWA 4KX4A 3CWGA 2DC5A 2WGRA 5ECOB 4NHWA 4IELA 1T7PB 3IK9A 3VWVA 3F6FA 4F03A 4EDYA 2X8GA 1E6BA 1ZYEA 4QQ7A 19GSA 1PL1A 3DGQA 4OFTA 1TRVA 1BEDA 4IBPA 3DIEA 3CTGA 2HRAA 1ZMAA 3QPMA 1GSYA 4D73A 5D9WA 3P90A 3ZIJA 1PX7A 5HFGA 3Q6OA 3C1RA 2HXKA 3D4MA 4BWSA 1DSBA 3Q74A 1FB0A 4MCUA 1F2EA 2H1DA 2IFQB 4KCAA 4KE3A 1MDKA 1T1VA 2H70A 1O6JA 4OFNA 1T4YA 16GSA 3EURA 3G9BA 3QFAC 3GKNA 4ID0A 1Z5YE 2EFHA 4L8EA 1KTEA 4K9ZA 8GSSA 1T4ZA 2H74A 1SD8A 4IJ3A 2BTOT 2YP6A 2HSMB 2AHEA 1BG5A 4O7HA 3C7MA 3Q19A 1FOHA 4FH8A 4EC0A 4MZCA 2ON5A 1SJ6A 1YEPA 2Z9SA 2BJXA 3FHKA 4KAEA 3TCOA 2O8VB 3CTFA 5DJMA 5HQPA 3GYKA 4AKXB 3FR3A 2FCHA 2E7PA 2F9SA 2QA1A 3I6AA 5EY6A 4ZBAA 4F82A 3RHCA 4QL9A 4EUYA 5F0GA 4OMVA 1FOVA 2DKHA 2HZFA 5KN1A 3WGEA 3UJ1A 3IHQA 1K0DA 6GSXA 6GSYA 3J7Yk 1EGOA 12GSA 2L6CA 4MA9A 3ZRDA 2HT9A 20GSA 1UVZA 2MMOA 1EOHA 4PNGA 4TR0A 3QR6A 4FO5A 1ZZYA 2XC2A 1MDJA 1TP9A 4HQSA 2VCZA 1K3OA 5F07A 2AJQB 4POMA 4V2MA 5E59A 1XXUA 3ZMLA 5G1KA 2OA7A 5CYYA 3EVIA 3E3EA 2KP2A 3IR4A 3KTLA 5F05A 1FVJA 1H4OA 2HZEA 1XIYA 3M3MA 1J0FA 2CVBA 3ERGA 4EKZA 1YJ6A 1NHYA 1ZYNA 2AAWA 3IRAA 5KN0A 4F0BA 5KEJA 4WF5A 2DSAA 5GAPD 2IL3A 2LRNA 2WFCA 3HVVA 1ABAA 4ML1A 3HZ8A 3MDKA 1EV4A 2EFEA 2DIZA 3F3RA 5GSTA 1GSFA 3PH9A 3ZLPA 4HU9A 6GSTA 2MMAA 5D9XA 1JZDA 1Z3EA 1QUWA 1KEBA 4Z2TA 5D96A 4RI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW1 A;  4GF0 A;  4WR5 A;  1KBN A;  2F3M A;  2OAD A;  3GTU B;  3IE3 A;  1F3B A;  4F0C A;  1ZL9 A;  2VD0 A;  4MZW A;  3LFL A;  5EVO A;  3UBK A;  4BL7 B;  3CBU A;  4EE0 A;  4PQI A;  1JLV A;  4ZBB A;  3VPQ A;  3ZMK A;  2N5F A;  1VF2 A;  5D9T A;  4LMW A;  4MP4 A;  1U87 A;  1C72 A;  4PQH A;  2F8F A;  1K0A A;  5ELG A;  1GSE A;  2WS2 A;  5ECL B;  2C3N A;  4ECC A;  1YKC A;  2CAI A;  1HNA A;  1VF1 A;  3Q18 A;  1B8X A;  2PVQ A;  1K0O A;  3M0F A;  4EXJ A;  5BMU A;  4KSM A;  2YV7 A;  3WD6 A;  2WJU A;  2GSS A;  4HZ2 A;  2PER A;  5IQY A;  1M0U A;  4NAX A;  4ZB6 A;  4ZB9 A;  2CA8 A;  1XWK A;  13GS A;  5DCG A;  2PMT A;  2D2Z A;  2VCW A;  4IS0 A;  3HJO A;  4MPG A;  5DDL A;  3M8N A;  1GSU A;  1AQW A;  3LYK A;  3U6V A;  2PBJ A;  1XWG A;  5AIX A;  1ZGN A;  4PX1 A;  4ACS A;  5ECM B;  3KJY A;  3G7J A;  1PX6 A;  3TOT A;  3PR8 A;  3UAP A;  3CRU A;  4GCI A;  4ZXG A;  5ECP B;  4IQ1 A;  1R5A A;  4GST A;  5AIV A;  4MF6 A;  3UVH A;  3R3E A;  1GUK A;  1GUL A;  4GSN A;  2JL4 A;  1MD3 A;  4BVX A;  3QAV A;  2AB6 A;  3VPT A;  4PNF A;  1K3L A;  5J4U A;  5DQS A;  5AN1 A;  3RBT A;  4HJ2 A;  5ECK B;  1XW5 A;  5ECQ B;  3O76 A;  2VO4 A;  3CSJ A;  2A2R A;  4KH7 A;  5JCW A;  3PPU A;  2PGT A;  1PL2 A;  1OYJ A;  3ERF A;  3GST A;  3KMN A;  1PA3 A;  1OE8 A;  3WYW A;  1BAY A;  4NHZ A;  5FWG A;  1HNB A;  5ECR B;  5EL8 A;  1U3I A;  4G19 A;  5DAL A;  5A4W A;  4LMV A;  5DAK A;  4KF9 A;  5J5N A;  1EV9 A;  4ECI A;  3DD3 A;  4TOP A;  6GSU A;  1RK4 A;  2GSQ A;  4G10 A;  4E8H A;  2CAQ A;  4ISD A;  4L5O A;  3NIV A;  17GS A;  1AQX A;  1G6W A;  3KM6 A;  3GH6 A;  1IYI A;  3G7I A;  5ECH B;  1G6Y A;  4MDC A;  5HFK A;  1GSQ A;  2VCQ A;  5AIS A;  1M9A A;  3TOU A;  4FQU A;  5ECI B;  4ZBD A;  3LXZ A;  4IVF A;  4N0V A;  4G9H A;  3P8W A;  1GWC A;  4PTS A;  4HI7 A;  3F6D A;  1LJR A;  2WRT A;  4MF7 A;  2X64 A;  1K3Y A;  1LBK A;  5G5F A;  2C80 A;  1AQV A;  5ECN B;  2LJR A;  1GTB A;  2A2S A;  1YDK A;  2VD1 A;  2NTO A;  1GLQ A;  3HKR A;  4G0L A;  3H1N A;  3LJR A;  4ZB8 A;  1V2A A;  4BVX B;  2OAC A;  3D0Z A;  5D73 A;  4ECJ A;  22GS A;  1Y6E A;  1PKW A;  4JZQ A;  1GUH A;  4USS A;  1GTI A;  5JCU A;  3GUS A;  4MK3 A;  4IGJ A;  1DUG A;  2FHE A;  3GUR A;  5ECS A;  3QAW A;  3ISO A;  4BVY A;  1N2A A;  3VK9 A;  4K0G A;  1XW6 A;  5DAK B;  1A0F A;  3MAK A;  3LYP A;  3GSS A;  3VUR A;  1F3A A;  3N9J A;  2HSM A;  3LSZ A;  4KX4 A;  4OFM A;  4PUA A;  3FR9 A;  3VWX A;  3KMO A;  2DC5 A;  5ECO B;  4NHW A;  2C4J A;  1GSS A;  4IEL A;  4YAP A;  11GS A;  1GSD A;  5GZZ B;  3IK9 A;  1TDI A;  4Q5Q A;  3F6F A;  4GSS A;  4F03 A;  4EDY A;  2R4V A;  1E6B A;  4PXO A;  4QQ7 A;  19GS A;  4PUR A;  1PL1 A;  3DGQ A;  3O3T A;  4OFT A;  4BL7 A;  3QAG A;  2R3X A;  3UAR A;  7GSS A;  5F06 A;  4IBP A;  5LCZ A;  2GLR A;  3IC8 A;  2HRA A;  1GSY A;  3VLN A;  1PD2 1;  5D9W A;  3P90 A;  5GSS A;  1AW9 A;  1FHE A;  2WB9 A;  1PX7 A;  9GSS A;  3TGZ A;  2R6K A;  1USB A;  4Q5N A;  1GUM A;  3BBY A;  4HZ4 A;  4JBB A;  1AXD A;  1B48 A;  4YH2 A;  1UA5 A;  3Q74 A;  1GNE A;  1VF4 A;  5D9V A;  3EE2 A;  1BX9 A;  3M1G A;  1F2E A;  18GS A;  10GS A;  1K0B A;  4KE3 A;  5FHI A;  5FT3 A;  4OFN A;  4G0I A;  1TU8 A;  16GS A;  4ID0 A;  4EDZ A;  4IJI A;  1OE7 A;  1G7O A;  3C8E A;  4L8E A;  1BYE A;  8GSS A;  4BVY B;  4Q5R A;  4RI6 A;  3FRC A;  4YQM A;  2HSM B;  2AHE A;  3F63 A;  4JED A;  3VI7 A;  1BG5 A;  4O7H A;  1HQO A;  3Q19 A;  2HRK A;  2HQT A;  3ZFL A;  2VCV A;  4L5L A;  3N5O A;  4KDU A;  4EC0 A;  2ON5 A;  1GTU A;  1ML6 A;  1Q4J A;  5A4U A;  4E8E A;  4K0N A;  4KAE A;  3PGT A;  5DJM A;  1JLW A;  4HOJ A;  1M9B A;  1TU7 A;  1VF3 A;  4MF5 A;  2R5G A;  3FR3 A;  3I6A A;  1Z9H A;  4O92 A;  5EY6 A;  4ZBA A;  1IYH A;  1YQ1 A;  2CVD A;  4GLT A;  2C8U A;  5F0G A;  1PGT A;  1K0C A;  4OMV A;  5J41 A;  2HNL A;  4Q5F A;  2GST A;  1K0D A;  5DAL B;  6GSX A;  6GSY A;  12GS A;  6GSW A;  5DJL A;  20GS A;  1B4P A;  5AGY A;  1PN9 A;  3LQ7 A;  1M99 A;  1EOH A;  3IBH A;  4PNG A;  5G5E A;  5ELA A;  3QR6 A;  4KDX A;  1HNC A;  2C3T A;  4KDY A;  3GTU A;  2YV9 A;  4ECB A;  1MD4 A;  1GNW A;  4DEJ A;  2CZ2 A;  2UZ8 A;  3CSI A;  2VCZ A;  4G0K A;  1K3O A;  1JZR A;  3CRT A;  5F07 A;  3FR6 A;  6GSV A;  3SWL A;  3ZML A;  1U88 A;  2WDU A;  4YQU A;  1EOG A;  2OA7 A;  3EIN A;  2HRK B;  3W8S A;  4AGS A;  2YCD A;  1EEM A;  2V6K A;  3L0H A;  3IR4 A;  3KTL A;  3HJM A;  3GX0 A;  5F05 A;  3ZFB A;  6GSS A;  5A4V A;  3I69 A;  4YAV A;  1K0N A;  3M3M A;  4KGI A;  3VI5 A;  3ERG A;  4CHS A;  1YJ6 A;  1GLP A;  1NHY A;  2J9H A;  2AAW A;  1PKZ A;  2VCT A;  5A5K A;  3UBL A;  2GTU A;  4IKH A;  2IMI A;  3CSH A;  4F0B A;  5KEJ A;  2DSA A;  2GSR A;  2FNO A;  3FY7 A;  2IL3 A;  4WR4 A;  5F8B A;  1V40 A;  4I97 A;  1MTC A;  14GS A;  2CZ3 A;  2IMK A;  1OKT A;  3MDK A;  2GDR A;  1EV4 A;  1PMT A;  4IW9 A;  5B7C A;  2VCX A;  3LXT A;  2HSN B;  3R2Q A;  2ON7 A;  3AY8 A;  5GST A;  3IK7 A;  1K0M A;  4J2F A;  1GSF A;  1YY7 A;  6GST A;  1TW9 A;  5D9X A;  3LG6 A;  3FYG A;  3KXO A;  1GTA A;  4GTU A;  4YQV A;  4PGT A;  4IQA A;  4MPF A;  4RI7 A;  2C3Q A;  5LD0 A; 
#chains in the Genus database with same CATH topology
 4WR5 A;  4TXV A;  3FZ9 A;  3GTU B;  2B1K A;  1F3B A;  3FZ4 A;  5HFI A;  2H71 A;  1GH2 A;  3H8Q A;  3UBK A;  2B5Y A;  3CBU A;  3DEX A;  2WZS A;  1JLV A;  4ZBB A;  3QOU A;  1SEN A;  1TK5 B;  4IP6 A;  4HUA A;  4POL A;  3HDC A;  2F8F A;  1GRX A;  2H75 A;  2LEG A;  5J9C A;  2LS5 A;  4X4J A;  3EU3 A;  2V41 A;  2L5O A;  3W6G A;  5J3R A;  4F9Z A;  1OC9 A;  2H0I A;  3WD6 A;  1YZX A;  4XS4 A;  3CYN A;  1M0U A;  3TJB A;  4NAX A;  4K2X A;  4N3Z A;  1SU9 A;  2ES7 A;  3I43 A;  1R5P A;  1SKW B;  3PIN A;  2R0G A;  2DLX A;  3IDV A;  2OE1 A;  4RQR A;  2H1B A;  1GSU A;  4DSS B;  4CY6 A;  1I5G A;  1HD2 A;  2GVP A;  5J47 A;  1ZGN A;  3G7J A;  3TOT A;  2RLI A;  3UAP A;  3CRU A;  3TKS E;  4MJE A;  4IQ1 A;  1R5A A;  4GST A;  5AIV A;  2RM6 A;  1X5C A;  5ID2 B;  2JL4 A;  4BVX A;  2N5B A;  2REM A;  4TW5 A;  3QAV A;  2AB6 A;  5J4U A;  5AN1 A;  3RBT A;  4LL1 B;  4WKW A;  2V6O A;  2WW3 A;  3FW2 A;  2M72 A;  1OYJ A;  3KMN A;  1M2D A;  4NHZ A;  5ECR B;  1DBY A;  3UOM A;  4F2I A;  5J40 A;  5DAK A;  5J5N A;  2FA8 A;  1RK4 A;  1EWX A;  2HSY A;  2LJK A;  2K6V A;  4ISD A;  2V2G A;  4L5O A;  3M9K A;  1FAA A;  3GH6 A;  5ECH B;  3UIW A;  1G6Y A;  3IC4 A;  2HRF A;  2VCQ A;  4FQU A;  3LEF A;  2IPA A;  4WBR D;  2GT6 A;  3HMJ G;  1GWC A;  4CW9 A;  4HU7 A;  1R4W A;  2DMM A;  3FEU A;  1AQV A;  5ECN B;  2XBQ A;  4TR1 B;  1XG8 A;  2P31 A;  2NTO A;  1FG4 A;  3HKR A;  2OE3 A;  3TU3 B;  2R2J A;  4IN0 A;  3LJR A;  4MNN A;  2MMN A;  4N0Z A;  5L71 A;  2AUV A;  2VLU A;  2H1A A;  4MAB A;  3GN3 A;  3ZYW A;  5JCU A;  3GUS A;  3U5R E;  1DUG A;  4TR3 A;  3GUR A;  3ISO A;  1O8X A;  1N2A A;  3HZ4 A;  5CP1 A;  1A0F A;  3MAK A;  2MBT A;  3GSS A;  3A2X A;  3VUR A;  1QXH A;  2HSM A;  3V1W A;  1ACV A;  3VWX A;  3KMO A;  2JSY A;  1GSS A;  11GS A;  1GSD A;  5GZZ B;  1PSQ A;  4Q5Q A;  4Z7X A;  4ZIL A;  4GSS A;  3TKS C;  2R4V A;  2YWO A;  4PXO A;  2WCI A;  2WW2 A;  3O3T A;  4OO5 A;  3TJJ A;  2QC7 A;  5F06 A;  1LU4 A;  5LCZ A;  3KH7 A;  3H4K A;  2MZC A;  1PD2 1;  2HSH A;  4TKY A;  1FHE A;  2WB9 A;  4OCF A;  4HZ4 A;  5IMV A;  5IPH A;  1B48 A;  1FVK A;  1G0T A;  1RW1 A;  2VLT A;  3DKS A;  3EE2 A;  3M1G A;  2NPB A;  4K1F A;  4MJA A;  18GS A;  2TIR A;  5HR1 A;  3KP8 A;  1WIK A;  3KGK A;  3GFK A;  1T00 A;  2BMX A;  3TRX A;  5FHI A;  3QMX A;  1XVQ A;  2YN1 A;  2H6Y A;  3F0I A;  5DBQ A;  3QDN A;  4BVY B;  4Q5R A;  3E9J B;  4XTS A;  3F63 A;  4JED A;  2C0F A;  2PUK C;  2H19 A;  3FKF A;  4JU5 A;  1WJK A;  3ZFL A;  4WBJ A;  2C0E A;  4L5L A;  3N5O A;  1AUC A;  5IO2 A;  5INY A;  1TKD B;  4TN8 A;  2FWG A;  4I6X A;  5A4U A;  4ML6 A;  5CRW A;  1TXU A;  4E8E A;  4K0N A;  1JZW A;  2R5G A;  3SBC A;  3NOF A;  1QQ2 A;  4BA7 A;  2DJJ A;  2CVD A;  4GLT A;  2DBC A;  4X1U A;  4ZIJ A;  4ILF A;  2LQO A;  1TTZ A;  2HYX A;  1OC3 A;  3GV1 A;  3GMF A;  2OJL A;  2H72 A;  4MJC A;  4GQC A;  3NZN A;  1J08 A;  2IIY A;  5CRH A;  5AGY A;  1PN9 A;  5KOX A;  2HI7 A;  3IBH A;  5G5E A;  4HDE A;  5ELA A;  2C3T A;  1BG1 A;  2FWH A;  3GTU A;  2L4Q A;  2NDO A;  4XHM A;  2DKI A;  2UZ8 A;  3CSI A;  1X0R A;  3DXB A;  1U3A A;  4RQX A;  3KD0 A;  2LUS A;  2X8C A;  4KSO A;  1CQG A;  4YQU A;  1EOG A;  3W8S A;  4AGS A;  2HRK B;  2YZH A;  1EEM A;  2B7J A;  6GSS A;  3BCI A;  3HJM A;  1XBS A;  4YAV A;  1B4Q A;  5J4V A;  2J9H A;  3RPN A;  2JAD A;  1OC8 A;  1B9Y C;  2K9F A;  1Z7R A;  4IKH A;  4I2U A;  3KZQ A;  4W66 A;  2LRC A;  3G7Y A;  5GAN D;  5A34 B;  2QSI A;  1O81 A;  2B1L A;  3TKS A;  5IPG A;  1Z6M A;  1OKT A;  2GDR A;  1PMT A;  3LXT A;  1SYR A;  3AY8 A;  4DSS A;  2XBI A;  1M2B A;  1TW9 A;  3MWH A;  4YQV A;  2H0H A;  2P0G A;  4WF4 A;  1FW1 A;  1XFL A;  2K18 A;  2F3M A;  1A0R P;  2A2P A;  3IE3 A;  2C0G A;  2CX4 A;  1AAZ A;  5IMZ A;  5EVO A;  5ID2 A;  3GL5 A;  4PQI A;  1GP1 A;  1RQM A;  3ZMK A;  4AJ6 A;  1VF2 A;  4LMW A;  2IMF A;  4HS1 A;  4PQH A;  5ELG A;  4G2E A;  3L9S A;  2C3N A;  1YKC A;  3Q18 A;  2CV4 A;  2PVQ A;  3M0F A;  1HYU A;  2WVX B;  3ZTL A;  2GSS A;  3DVW A;  2L59 A;  3IHG A;  2VL2 C;  3L4N A;  4ZB6 A;  3GKK A;  4Z2U A;  1TK0 B;  1UC7 A;  2GZY A;  4O5R A;  1XWK A;  3FZ5 A;  4XCS A;  2PMT A;  2O7K A;  2D2Z A;  2VCW A;  3F3Q A;  3LWA A;  2OT3 A;  3DML A;  4PX1 A;  3QFB C;  3KJY A;  1BQ7 A;  3PR8 A;  3HCZ A;  4YKF A;  5A1N B;  4GCI A;  5ECP B;  2YJH A;  1SL0 B;  3GX8 A;  5IMA A;  4MF6 A;  3KP9 A;  4TR1 A;  5IMF A;  3HVX A;  2VUP A;  3APS A;  1GUK A;  1Y1U A;  1SL1 B;  1MD3 A;  1JHB A;  4DSR A;  2VAF A;  3IOS A;  4PNF A;  5DQS A;  2GQL A;  4K7O A;  2DJ1 A;  2IN3 A;  4OO4 A;  3O76 A;  2VO4 A;  2LTK A;  3CSJ A;  3MIX A;  3PPU A;  5IO0 A;  1PL2 A;  2F8A A;  4I5Q A;  1PA3 A;  1OE8 A;  2IJY A;  3WT1 A;  2E0Q A;  3UMA A;  4NWY A;  1X9S B;  1U3I A;  3ZL5 A;  3RFR C;  1A2J A;  2FUG 2;  1TI3 A;  1M3I A;  2F51 A;  2VM1 A;  5ENU A;  3HVN A;  1SKR B;  1AQX A;  4MH3 A;  4V1A g;  1IYI A;  4A5P A;  3EWL A;  2HFD A;  2JU5 A;  4ZBD A;  4AF2 A;  4JRR A;  4IVF A;  4G9H A;  5IMD A;  1BJX A;  4MF7 A;  1JFU A;  4NPB A;  5D8I A;  2C80 A;  3A2V A;  4WEY A;  2O36 A;  4PI0 C;  2LJR A;  3ED3 A;  1VGL A;  2VOC A;  2EC4 A;  5DCH A;  1O8W A;  1YEW C;  1GLQ A;  1OAZ A;  3EC3 A;  2QKE A;  4XRD A;  1V2A A;  5IIZ A;  2OAC A;  3D0Z A;  3TRQ A;  2G2Q A;  3JCM L;  3BJ5 A;  1XZO A;  1WP0 A;  2VKZ G;  4PQ1 A;  3US3 A;  2O5V A;  2GQM A;  2RM5 A;  3WT2 A;  3L78 A;  2FHE A;  5ECS A;  3QAW A;  3KCM A;  2WVZ A;  4BVY A;  2VIM A;  1XW6 A;  2KP1 A;  4PUF C;  4HSC X;  3ME8 A;  3LYP A;  3BOA A;  2HLS A;  2GQK A;  1F3A A;  4XS1 A;  4PUA A;  3FR9 A;  3IV4 A;  1Z7P A;  2YJ7 A;  3ZRE A;  2C4J A;  4YAP A;  1V58 A;  2JAC A;  4OD7 A;  5IOX A;  4POK A;  4AJ8 A;  3MNG A;  3UAR A;  7GSS A;  2CX3 A;  1TI1 A;  2G0F A;  5EPF A;  2GLR A;  3IC8 A;  1ZYP A;  2VL2 A;  3VLN A;  2X99 A;  1R26 A;  4EIP A;  1AW9 A;  4EF0 A;  3TGZ A;  1GUM A;  4TXO B;  3TKQ A;  1EGR A;  3BBY A;  3H79 A;  5CAX A;  4JBB A;  1AXD A;  1NM3 A;  4YH2 A;  2IWT A;  1UA5 A;  1A2L A;  5D9V A;  1EP8 A;  4P3Y B;  3TKP A;  2L5L A;  1OVN A;  10GS A;  4NV5 A;  1K0B A;  2R37 A;  5FT3 A;  4G0I A;  2HE3 A;  4HJM A;  4KUN A;  1J9B A;  2EIR A;  5B8B A;  4IJI A;  1OE7 A;  1XWA A;  3QCP A;  3C8E A;  3IXR A;  1BYE A;  3GKM A;  3E0U A;  5JWQ B;  2ZCT A;  3FRC A;  4GRF A;  3APQ A;  3VI7 A;  2YWN A;  2H8L A;  2O89 A;  4EO3 A;  1WWJ A;  2HRK A;  2V1M A;  1N8J A;  1S3C A;  2VCV A;  2OBI A;  1S3D A;  4NMU A;  4KDU A;  1PRX A;  5KN3 A;  2GGT A;  1TRU A;  3P2A A;  4HOJ A;  1M9B A;  1TU7 A;  1VF3 A;  4MF5 A;  3ZIV A;  4DVC A;  2HRN A;  2RUE A;  4Z2R A;  3BCK A;  1ZYQ B;  5A34 A;  1Z9H A;  2UV8 G;  4E68 A;  1W4V A;  1YQ1 A;  2C8U A;  2GZP A;  1PGT A;  4QL7 A;  5J41 A;  3GH9 A;  2VL3 A;  3DYR A;  4Q5F A;  3HJP A;  4TRX A;  2GST A;  2YAN A;  6GSW A;  2WW0 A;  5DJL A;  1AC1 A;  5KOW A;  1ZCP A;  4IHU A;  1MDI A;  4N11 A;  4KDX A;  4KDY A;  2LJA A;  2YV9 A;  1MD4 A;  2CZ2 A;  1PQN A;  1EEJ A;  3APO A;  4OCE A;  4G0K A;  3WGD A;  1JZR A;  3FR6 A;  6GSV A;  1AIU A;  2AYT A;  1TOF A;  3SWL A;  3F4R A;  3TKR A;  1QMV A;  2GT5 A;  2WDU A;  3EIN A;  1YF0 A;  1Y25 A;  2B5E A;  4O32 A;  3ZFB A;  1ZOF A;  5A4V A;  3I69 A;  1EZK A;  2LKU A;  3A5I A;  4KGI A;  5J4Y A;  2B5X A;  1PKZ A;  4ZB7 A;  2VCT A;  5A5K A;  1NHO A;  2LQQ A;  2GTU A;  5A5H A;  3GNJ A;  3C1S A;  3CSH A;  2IME A;  2WVX A;  4KA0 A;  2GSR A;  2FNO A;  3FY7 A;  2X4A A;  2LNS A;  4WR4 A;  5F8B A;  1V40 A;  3EMX A;  4N30 A;  1MTC A;  14GS A;  4AKH A;  2IMK A;  3TRP A;  4IW9 A;  5B7C A;  4XRA A;  2QGV A;  3LW9 A;  4XS6 A;  1SJZ A;  2HSN B;  3R2Q A;  3ZVJ D;  3VWU A;  2ON7 A;  1SL2 B;  4BWQ A;  3LGC A;  3LG6 A;  3GA4 A;  3FYG A;  1GTA A;  1GL8 A;  3GL3 A;  1WOU A;  2VL9 A;  4KND A;  4IQA A;  3H93 A;  4MPF A;  3CQF A;  5A1N A;  5JCG A;  5LD0 A;  2ALB A;  1XCC A;  4GF0 A;  1KBN A;  4F0C A;  4IP1 A;  1ZL9 A;  4HEA 2;  2YPM A;  2I4A A;  4EE0 A;  2H6X A;  1WMJ A;  1WE0 A;  2YWM A;  2K8V A;  5D9T A;  4K8M A;  4MP4 A;  1BF5 A;  1K0A A;  3WGX A;  2WS2 A;  5ECL B;  1MEK A;  4ECC A;  2CAI A;  1HNA A;  2GS3 A;  1B8X A;  1K0O A;  3VFI A;  4EXJ A;  4KSM A;  3A3T A;  2WJU A;  2X8H A;  4HZ2 A;  2FY6 A;  2B3S A;  2PER A;  2H66 A;  5HR2 A;  1PFO A;  3ZVJ A;  1O85 A;  2CA8 A;  4JR4 A;  5DCG A;  1A24 A;  5LNK e;  4IS0 A;  4MPG A;  5DDL A;  3M8N A;  4ZL8 A;  2K8S A;  1AQW A;  2LNT A;  3LYK A;  1SVM A;  1CQH A;  5AIX A;  1ERW A;  2R0P A;  5CRD A;  4ACS A;  5ECM B;  4ICY A;  1PX6 A;  1YF1 A;  2H30 A;  2C0D A;  3LOR A;  3EMP A;  4O5U A;  1V57 A;  3EPT A;  1V98 A;  3S9F A;  2H76 A;  2A4H A;  4GSN A;  5D93 A;  1TJD A;  5IOW A;  2CVK A;  1ILO A;  3VPT A;  1KNG A;  1FB6 A;  1EP7 A;  2I81 A;  5CRE A;  4K6X A;  2VLV A;  4HJ2 A;  5ECQ B;  1SK1 A;  2EFD A;  1WPI A;  3I9V 2;  1W89 A;  5JCW A;  1F9M A;  1SYX A;  3ERF A;  1BAY A;  2DML A;  4JE1 A;  4K2D A;  5EL8 A;  2H1L A;  2O85 A;  5A4W A;  5DAL A;  1TRS A;  1EV9 A;  4ECI A;  3KIJ A;  3DD3 A;  3FK8 A;  4G10 A;  5BMU B;  4E8H A;  3TDG A;  4L0U A;  2L4C A;  3RGB C;  17GS A;  1X5E A;  2P5Q A;  4MDC A;  2X49 A;  5HFK A;  2PU9 C;  1GSQ A;  2FA4 A;  1M9A A;  3K8N A;  3L9V A;  5B6M A;  2H73 A;  4N0V A;  1U6T A;  3P8W A;  4HI7 A;  1LJR A;  1A8L A;  2WRT A;  4K5S A;  2X64 A;  1TK8 B;  1PN0 A;  2MMZ A;  3HHV A;  1DE2 A;  3F4T A;  5B6N A;  1GTB A;  4LL4 B;  2PPT A;  2VD1 A;  4TXO A;  1SVL A;  2FD3 A;  4G0L A;  3H1N A;  4ZB8 A;  3HY2 A;  5D73 A;  4ECJ A;  4NV2 A;  5A5H B;  3ZIT A;  1JZO A;  2OBK A;  1Y6E A;  1GUH A;  4USS A;  3TJF A;  2PVO C;  3D5J A;  1THO A;  4K7I A;  4MK3 A;  1E2Y A;  4IGJ A;  1QK8 A;  5IM9 A;  1Q98 A;  1THX A;  4KCE A;  5C04 A;  5E4W A;  3OR5 A;  3J7Y b;  2VM2 A;  3VK9 A;  5G2Z A;  3UL3 A;  3N9J A;  2LRT A;  3LSZ A;  4V1A p;  5DVB A;  4OFM A;  2DJ3 A;  2O3E A;  2L57 A;  1A8Y A;  2IMD A;  1FO5 A;  1TDI A;  2MBS A;  2DJ0 A;  4MMM A;  3HYP A;  4PUR A;  1SKS B;  4TR4 A;  2WW1 A;  2XHF A;  4BL7 A;  3QAG A;  2R3X A;  2FLS A;  3TB2 A;  1QFN A;  1XVW A;  2JSZ A;  4AJ7 A;  4MJB A;  4YKG A;  5GSS A;  9GSS A;  4GWR A;  2R6K A;  1USB A;  4Q5N A;  3MYD A;  3EU4 A;  3W8J A;  3IAS 2;  1GNE A;  1VF4 A;  4WET A;  4L0W A;  1H75 A;  1BX9 A;  1XW9 A;  1ERU A;  5C00 A;  4TVE A;  5COH A;  2EFC A;  5JWO B;  1NSW A;  2MYG A;  5J9B A;  1YEX A;  2KOK A;  3D21 A;  1TU8 A;  3A5W A;  4EDZ A;  1G7O A;  2L6D A;  4JR6 A;  5H5R A;  1XOA A;  4RI6 A;  4YQM A;  2E2G A;  5H5S A;  1HQO A;  3FZA A;  4KB3 A;  2HQT A;  2LV3 A;  2RUF A;  3HD5 A;  4ZL7 A;  3F8U A;  1A2M A;  5HR3 A;  2FGX A;  1S3A A;  3C71 A;  1GTU A;  1ML6 A;  4J56 E;  1Q4J A;  1YVL A;  2O87 A;  4FYB A;  5DQY A;  3PGT A;  2JZT A;  3UVT A;  1JLW A;  2I3Y A;  2I1U A;  4H86 A;  4D73 B;  3ME7 A;  1X9W B;  4BPY A;  2KLX A;  3IA1 A;  2AV4 A;  4O92 A;  3A2W A;  1IYH A;  1X5D A;  1S3R A;  2V32 A;  3TJK A;  4FIW A;  4FYC A;  1K0C A;  2DIY A;  2HNL A;  3CXG A;  2HSN A;  5DAL B;  1SK0 A;  4GDF A;  1B9X C;  2H6Z A;  4O5Q A;  1YKA A;  3CMI A;  1B4P A;  1SD9 A;  3LQ7 A;  1I1I P;  1M99 A;  2A4V A;  2B7K A;  1HNC A;  5HR0 A;  4ECB A;  1GNW A;  3MSZ A;  4KW6 A;  4DEJ A;  2H0G A;  3CRT A;  4EIQ A;  5BRT A;  4LA1 A;  1XWB A;  2WZ9 A;  4LLR A;  3DRN A;  1U88 A;  3IPZ A;  3O6T A;  2YCD A;  2V6K A;  2YNX A;  3L0H A;  3L9U A;  4EL1 A;  3GX0 A;  2TRX A;  4I8B A;  1K0N A;  1DE1 A;  1S4B P;  3VI5 A;  4EVM A;  2YZU A;  4CHS A;  1GLP A;  2DJ2 A;  3UBL A;  3TJG A;  2IMI A;  2OE0 A;  2FWF A;  3ZZX A;  2M46 A;  3KEB A;  4NXI A;  1I9D A;  4I97 A;  3IAM 2;  2CZ3 A;  3RDW A;  3F9U A;  2WUL A;  2VCX A;  4AKG A;  2NVL A;  3IK7 A;  1K0M A;  4J2F A;  1YY7 A;  3KXO A;  4GTU A;  4PGT A;  5H5Q A;  2C3Q A;  2OAD A;  2C1Y A;  4K5R A;  2XPE A;  3GIX A;  1ON4 A;  4X0X A;  4MZB A;  4K7N A;  2VD0 A;  2P5R A;  3D4T A;  4MZW A;  1M3J A;  3LFL A;  4BL7 B;  1XOB A;  1F37 A;  4OWY A;  2J23 A;  2TRC P;  2EIQ A;  3VPQ A;  4PI2 C;  2ZNM A;  3M9J A;  2N5F A;  5KN2 A;  3BD2 A;  5G30 A;  1U87 A;  1C72 A;  2HZE B;  1GSE A;  4CDO A;  4QMK A;  2EIO A;  1OKD A;  3RAZ A;  1T3B A;  3DWV A;  1XWC A;  1VF1 A;  1V9W A;  2YOI A;  3QD9 A;  4AI6 A;  4V2L A;  2KUC A;  3HXS A;  5BMU A;  2IFQ A;  2YV7 A;  2E2M A;  1VRS D;  1Z6N A;  5G1L A;  2JZS A;  5IQY A;  3RHB A;  1WRY A;  4GQF A;  4ZB9 A;  4XIH A;  4RUV A;  13GS A;  2FWE A;  3HJO A;  5ABR A;  4FYU A;  1XPV A;  4J57 E;  3TUE A;  2QA2 A;  3U6V A;  2PBJ A;  1XWG A;  1ERT A;  2NBS A;  4HQZ A;  1O7U A;  2ZUP A;  4ZXG A;  2LST A;  3GHA A;  1UN2 A;  4WXT A;  2B6M A;  3UVH A;  3R3E A;  1GUL A;  2OKA A;  5CO3 A;  5B8A A;  2GZZ A;  1TRW A;  2PN8 A;  1M7T A;  1K3L A;  5ECK B;  1XW5 A;  3UEM A;  4X43 A;  4AKI A;  3GRX A;  1NW2 A;  2A2R A;  4KH7 A;  3HVS A;  3P7X A;  2PGT A;  3GST A;  3WYW A;  2XPD A;  5FWG A;  1HNB A;  1TXX A;  4MLY A;  3KH9 A;  3F4S A;  3VWW A;  3ERW A;  4G19 A;  4LMV A;  4KF9 A;  1OC9 B;  4TOP A;  6GSU A;  2GSQ A;  3C73 A;  3RPP A;  2CAQ A;  4GXZ A;  4XS4 B;  3NIV A;  1QGV A;  1G6W A;  2R0C A;  5CRG A;  3KM6 A;  3G7I A;  2KHP A;  4N10 A;  4DSQ A;  5AIS A;  3TOU A;  1R7H A;  5ECI B;  3LXZ A;  5CNW A;  2H01 A;  2M80 A;  1T8E B;  2DJK A;  4PTS A;  3HA9 A;  3F6D A;  2N5A A;  3D22 A;  1K3Y A;  4I2T A;  1LBK A;  3DVX A;  5G5F A;  1ST9 A;  1ERV A;  1M2A A;  1F6M C;  5G31 A;  2YWI A;  1O73 A;  3CHX C;  1SVO A;  5IMC A;  2A2S A;  1YDK A;  1N25 A;  1SK2 A;  3EYT A;  3KTB A;  3GKX A;  2RII A;  4BVX B;  4ULX A;  4CY8 A;  4G01 A;  2PWJ A;  1A23 A;  5JWR B;  22GS A;  4V2N A;  2I9H A;  1PKW A;  4ZL9 A;  4JZQ A;  1URM A;  2WVY A;  1GTI A;  2H1G A;  2JZR A;  1SJI A;  1X9M B;  2CT6 A;  4MH2 A;  2CQ9 A;  4K0G A;  1G7E A;  3D6I A;  5DAK B;  4POB A;  3FMW A;  4KX4 A;  3CWG A;  2DC5 A;  2WGR A;  5ECO B;  4NHW A;  4IEL A;  1T7P B;  3IK9 A;  3VWV A;  3F6F A;  4F03 A;  4EDY A;  2X8G A;  1E6B A;  1ZYE A;  4PHZ C;  4QQ7 A;  19GS A;  1PL1 A;  3DGQ A;  4OFT A;  1TRV A;  1BED A;  4IBP A;  3DIE A;  3CTG A;  2HRA A;  1ZMA A;  3QPM A;  1GSY A;  4D73 A;  5D9W A;  3P90 A;  3ZIJ A;  1PX7 A;  5HFG A;  3Q6O A;  3C1R A;  4BIK A;  2HXK A;  3D4M A;  4BWS A;  1DSB A;  3Q74 A;  1FB0 A;  4MCU A;  1F2E A;  2H1D A;  2IFQ B;  4KCA A;  4KE3 A;  1MDK A;  1T1V A;  2H70 A;  1O6J A;  4OFN A;  1T4Y A;  16GS A;  3EUR A;  3G9B A;  3QFA C;  3GKN A;  4ID0 A;  1Z5Y E;  2EFH A;  4L8E A;  1KTE A;  4K9Z A;  8GSS A;  1T4Z A;  2H74 A;  1SD8 A;  4IJ3 A;  2BTO T;  2YP6 A;  2HSM B;  2AHE A;  1BG5 A;  4O7H A;  3C7M A;  3Q19 A;  1FOH A;  4FH8 A;  4EC0 A;  4MZC A;  2ON5 A;  1SJ6 A;  1YEP A;  2Z9S A;  2BJX A;  3FHK A;  4KAE A;  3TCO A;  2O8V B;  3CTF A;  5DJM A;  5HQP A;  3GYK A;  4AKX B;  3FR3 A;  2FCH A;  2E7P A;  2F9S A;  2QA1 A;  3I6A A;  5EY6 A;  4ZBA A;  4F82 A;  3RHC A;  4QL9 A;  4EUY A;  5F0G A;  4OMV A;  1FOV A;  2DKH A;  2HZF A;  5KN1 A;  3WGE A;  3UJ1 A;  3IHQ A;  1K0D A;  6GSX A;  6GSY A;  3J7Y k;  1EGO A;  12GS A;  2L6C A;  4MA9 A;  4FXY P;  3ZRD A;  2HT9 A;  20GS A;  1UVZ A;  2MMO A;  1EOH A;  4PNG A;  4TR0 A;  3QR6 A;  4FO5 A;  1ZZY A;  2XC2 A;  1MDJ A;  1TP9 A;  4HQS A;  2VCZ A;  1K3O A;  5F07 A;  2AJQ B;  4POM A;  4V2M A;  5E59 A;  1XXU A;  3ZML A;  5G1K A;  2OA7 A;  5CYY A;  3EVI A;  3E3E A;  2KP2 A;  3IR4 A;  3KTL A;  5F05 A;  1FVJ A;  1H4O A;  2HZE A;  1XIY A;  3M3M A;  1J0F A;  2CVB A;  3ERG A;  4EKZ A;  1YJ6 A;  1NHY A;  1ZYN A;  2AAW A;  3IRA A;  5KN0 A;  4F0B A;  5KEJ A;  4WF5 A;  2DSA A;  5GAP D;  2IL3 A;  2LRN A;  2WFC A;  3HVV A;  1ABA A;  4ML1 A;  3HZ8 A;  3MDK A;  1EV4 A;  2EFE A;  2DIZ A;  3F3R A;  5GST A;  1GSF A;  3PH9 A;  3ZLP A;  4HU9 A;  6GST A;  2MMA A;  5D9X A;  1JZD A;  1Z3E A;  1QUW A;  1KEB A;  4Z2T A;  5D96 A;  4RI7 A; 
#chains in the Genus database with same CATH homology
 4WR5 A;  4TXV A;  3FZ9 A;  3GTU B;  2B1K A;  1F3B A;  3FZ4 A;  5HFI A;  2H71 A;  1GH2 A;  3H8Q A;  3UBK A;  2B5Y A;  3CBU A;  3DEX A;  1JLV A;  4ZBB A;  3QOU A;  1SEN A;  1TK5 B;  4IP6 A;  4HUA A;  4POL A;  3HDC A;  2F8F A;  1GRX A;  2H75 A;  2LEG A;  5J9C A;  2LS5 A;  4X4J A;  3EU3 A;  2V41 A;  2L5O A;  3W6G A;  5J3R A;  4F9Z A;  1OC9 A;  2H0I A;  3WD6 A;  1YZX A;  4XS4 A;  3CYN A;  1M0U A;  3TJB A;  4NAX A;  4K2X A;  4N3Z A;  1SU9 A;  2ES7 A;  3I43 A;  1R5P A;  1SKW B;  3PIN A;  2R0G A;  2DLX A;  3IDV A;  2OE1 A;  4RQR A;  2H1B A;  1GSU A;  4DSS B;  4CY6 A;  1I5G A;  1HD2 A;  2GVP A;  5J47 A;  1ZGN A;  3G7J A;  3TOT A;  2RLI A;  3UAP A;  3CRU A;  3TKS E;  4MJE A;  4IQ1 A;  1R5A A;  4GST A;  5AIV A;  2RM6 A;  1X5C A;  5ID2 B;  2JL4 A;  4BVX A;  2N5B A;  2REM A;  4TW5 A;  3QAV A;  2AB6 A;  5J4U A;  5AN1 A;  3RBT A;  4LL1 B;  4WKW A;  2V6O A;  3FW2 A;  2M72 A;  1OYJ A;  3KMN A;  1M2D A;  4NHZ A;  5ECR B;  1DBY A;  3UOM A;  4F2I A;  5J40 A;  5DAK A;  5J5N A;  2FA8 A;  1RK4 A;  1EWX A;  2HSY A;  2LJK A;  2K6V A;  4ISD A;  2V2G A;  4L5O A;  3M9K A;  1FAA A;  3GH6 A;  5ECH B;  3UIW A;  1G6Y A;  3IC4 A;  2HRF A;  2VCQ A;  4FQU A;  3LEF A;  2IPA A;  4WBR D;  2GT6 A;  3HMJ G;  1GWC A;  4CW9 A;  4HU7 A;  1R4W A;  2DMM A;  3FEU A;  1AQV A;  5ECN B;  2XBQ A;  4TR1 B;  2P31 A;  2NTO A;  1FG4 A;  3HKR A;  2OE3 A;  3TU3 B;  2R2J A;  4IN0 A;  3LJR A;  4MNN A;  2MMN A;  4N0Z A;  5L71 A;  2AUV A;  2VLU A;  2H1A A;  4MAB A;  3GN3 A;  3ZYW A;  5JCU A;  3GUS A;  3U5R E;  1DUG A;  4TR3 A;  3GUR A;  3ISO A;  1O8X A;  1N2A A;  3HZ4 A;  5CP1 A;  1A0F A;  3MAK A;  2MBT A;  3GSS A;  3A2X A;  3VUR A;  1QXH A;  2HSM A;  3V1W A;  1ACV A;  3VWX A;  3KMO A;  2JSY A;  1GSS A;  11GS A;  1GSD A;  5GZZ B;  1PSQ A;  4Q5Q A;  4Z7X A;  4ZIL A;  4GSS A;  3TKS C;  2R4V A;  2YWO A;  4PXO A;  2WCI A;  3O3T A;  4OO5 A;  3TJJ A;  2QC7 A;  5F06 A;  1LU4 A;  5LCZ A;  3KH7 A;  3H4K A;  2MZC A;  1PD2 1;  2HSH A;  4TKY A;  1FHE A;  2WB9 A;  4OCF A;  4HZ4 A;  5IMV A;  5IPH A;  1B48 A;  1FVK A;  1G0T A;  1RW1 A;  2VLT A;  3DKS A;  3EE2 A;  3M1G A;  2NPB A;  4K1F A;  4MJA A;  18GS A;  2TIR A;  5HR1 A;  3KP8 A;  1WIK A;  3KGK A;  3GFK A;  1T00 A;  2BMX A;  3TRX A;  5FHI A;  3QMX A;  1XVQ A;  2YN1 A;  2H6Y A;  3F0I A;  5DBQ A;  3QDN A;  4BVY B;  4Q5R A;  3E9J B;  4XTS A;  3F63 A;  4JED A;  2C0F A;  2PUK C;  2H19 A;  3FKF A;  4JU5 A;  1WJK A;  3ZFL A;  4WBJ A;  2C0E A;  4L5L A;  3N5O A;  1AUC A;  5IO2 A;  5INY A;  1TKD B;  4TN8 A;  2FWG A;  4I6X A;  5A4U A;  4ML6 A;  5CRW A;  1TXU A;  4E8E A;  4K0N A;  1JZW A;  2R5G A;  3SBC A;  3NOF A;  1QQ2 A;  4BA7 A;  2DJJ A;  2CVD A;  4GLT A;  2DBC A;  4X1U A;  4ZIJ A;  4ILF A;  2LQO A;  1TTZ A;  2HYX A;  1OC3 A;  3GV1 A;  3GMF A;  2OJL A;  2H72 A;  4MJC A;  4GQC A;  3NZN A;  1J08 A;  2IIY A;  5CRH A;  5AGY A;  1PN9 A;  5KOX A;  2HI7 A;  3IBH A;  5G5E A;  4HDE A;  5ELA A;  2C3T A;  1BG1 A;  2FWH A;  3GTU A;  2L4Q A;  2NDO A;  4XHM A;  2DKI A;  2UZ8 A;  3CSI A;  1X0R A;  3DXB A;  1U3A A;  4RQX A;  3KD0 A;  2LUS A;  2X8C A;  4KSO A;  1CQG A;  4YQU A;  1EOG A;  3W8S A;  4AGS A;  2HRK B;  2YZH A;  1EEM A;  2B7J A;  6GSS A;  3BCI A;  3HJM A;  1XBS A;  4YAV A;  1B4Q A;  5J4V A;  2J9H A;  3RPN A;  2JAD A;  1OC8 A;  1B9Y C;  2K9F A;  1Z7R A;  4IKH A;  4I2U A;  3KZQ A;  4W66 A;  2LRC A;  3G7Y A;  5GAN D;  5A34 B;  2QSI A;  1O81 A;  2B1L A;  3TKS A;  5IPG A;  1Z6M A;  1OKT A;  2GDR A;  1PMT A;  3LXT A;  1SYR A;  3AY8 A;  4DSS A;  2XBI A;  1M2B A;  1TW9 A;  3MWH A;  4YQV A;  2H0H A;  2P0G A;  4WF4 A;  1FW1 A;  1XFL A;  2K18 A;  2F3M A;  1A0R P;  2A2P A;  3IE3 A;  2C0G A;  2CX4 A;  1AAZ A;  5IMZ A;  5EVO A;  5ID2 A;  3GL5 A;  4PQI A;  1GP1 A;  1RQM A;  3ZMK A;  4AJ6 A;  1VF2 A;  4LMW A;  2IMF A;  4HS1 A;  4PQH A;  5ELG A;  4G2E A;  3L9S A;  2C3N A;  1YKC A;  3Q18 A;  2CV4 A;  2PVQ A;  3M0F A;  1HYU A;  3ZTL A;  2GSS A;  3DVW A;  2L59 A;  3IHG A;  2VL2 C;  3L4N A;  4ZB6 A;  3GKK A;  4Z2U A;  1TK0 B;  1UC7 A;  2GZY A;  4O5R A;  1XWK A;  3FZ5 A;  4XCS A;  2PMT A;  2O7K A;  2D2Z A;  2VCW A;  3F3Q A;  3LWA A;  2OT3 A;  3DML A;  4PX1 A;  3QFB C;  3KJY A;  1BQ7 A;  3PR8 A;  3HCZ A;  4YKF A;  5A1N B;  4GCI A;  5ECP B;  2YJH A;  1SL0 B;  3GX8 A;  5IMA A;  4MF6 A;  3KP9 A;  4TR1 A;  5IMF A;  3HVX A;  2VUP A;  3APS A;  1GUK A;  1Y1U A;  1SL1 B;  1MD3 A;  1JHB A;  4DSR A;  2VAF A;  3IOS A;  4PNF A;  5DQS A;  2GQL A;  4K7O A;  2DJ1 A;  2IN3 A;  4OO4 A;  3O76 A;  2VO4 A;  2LTK A;  3CSJ A;  3MIX A;  3PPU A;  5IO0 A;  1PL2 A;  2F8A A;  4I5Q A;  1PA3 A;  1OE8 A;  2IJY A;  3WT1 A;  2E0Q A;  3UMA A;  4NWY A;  1X9S B;  1U3I A;  3ZL5 A;  1A2J A;  2FUG 2;  1TI3 A;  2F51 A;  2VM1 A;  5ENU A;  1SKR B;  1AQX A;  4MH3 A;  4V1A g;  1IYI A;  4A5P A;  3EWL A;  2HFD A;  2JU5 A;  4ZBD A;  4AF2 A;  4JRR A;  4IVF A;  4G9H A;  5IMD A;  1BJX A;  4MF7 A;  1JFU A;  4NPB A;  5D8I A;  2C80 A;  3A2V A;  4WEY A;  2LJR A;  3ED3 A;  1VGL A;  2VOC A;  2EC4 A;  5DCH A;  1O8W A;  1GLQ A;  1OAZ A;  3EC3 A;  2QKE A;  4XRD A;  1V2A A;  5IIZ A;  2OAC A;  3D0Z A;  3TRQ A;  2G2Q A;  3JCM L;  3BJ5 A;  1XZO A;  1WP0 A;  2VKZ G;  4PQ1 A;  3US3 A;  2O5V A;  2GQM A;  2RM5 A;  3WT2 A;  3L78 A;  2FHE A;  5ECS A;  3QAW A;  3KCM A;  4BVY A;  2VIM A;  1XW6 A;  2KP1 A;  4PUF C;  3ME8 A;  3LYP A;  3BOA A;  2HLS A;  2GQK A;  1F3A A;  4XS1 A;  4PUA A;  3FR9 A;  3IV4 A;  1Z7P A;  2YJ7 A;  3ZRE A;  2C4J A;  4YAP A;  1V58 A;  2JAC A;  4OD7 A;  5IOX A;  4POK A;  4AJ8 A;  3MNG A;  3UAR A;  7GSS A;  2CX3 A;  1TI1 A;  2G0F A;  5EPF A;  2GLR A;  3IC8 A;  1ZYP A;  2VL2 A;  3VLN A;  2X99 A;  1R26 A;  4EIP A;  1AW9 A;  4EF0 A;  3TGZ A;  1GUM A;  4TXO B;  3TKQ A;  1EGR A;  3BBY A;  3H79 A;  5CAX A;  4JBB A;  1AXD A;  1NM3 A;  4YH2 A;  2IWT A;  1UA5 A;  1A2L A;  5D9V A;  1EP8 A;  4P3Y B;  3TKP A;  2L5L A;  1OVN A;  10GS A;  4NV5 A;  1K0B A;  2R37 A;  5FT3 A;  4G0I A;  2HE3 A;  4HJM A;  4KUN A;  1J9B A;  2EIR A;  5B8B A;  4IJI A;  1OE7 A;  1XWA A;  3QCP A;  3C8E A;  3IXR A;  1BYE A;  3GKM A;  3E0U A;  5JWQ B;  2ZCT A;  3FRC A;  4GRF A;  3APQ A;  3VI7 A;  2YWN A;  2H8L A;  2O89 A;  4EO3 A;  1WWJ A;  2HRK A;  2V1M A;  1N8J A;  1S3C A;  2VCV A;  2OBI A;  1S3D A;  4NMU A;  4KDU A;  1PRX A;  5KN3 A;  2GGT A;  1TRU A;  3P2A A;  4HOJ A;  1M9B A;  1TU7 A;  1VF3 A;  4MF5 A;  3ZIV A;  4DVC A;  2HRN A;  2RUE A;  4Z2R A;  3BCK A;  1ZYQ B;  5A34 A;  1Z9H A;  2UV8 G;  4E68 A;  1W4V A;  1YQ1 A;  2C8U A;  2GZP A;  1PGT A;  4QL7 A;  5J41 A;  3GH9 A;  2VL3 A;  3DYR A;  4Q5F A;  3HJP A;  4TRX A;  2GST A;  2YAN A;  6GSW A;  5DJL A;  1AC1 A;  5KOW A;  1ZCP A;  4IHU A;  1MDI A;  4N11 A;  4KDX A;  4KDY A;  2LJA A;  2YV9 A;  1MD4 A;  2CZ2 A;  1PQN A;  1EEJ A;  3APO A;  4OCE A;  4G0K A;  3WGD A;  1JZR A;  3FR6 A;  6GSV A;  1AIU A;  2AYT A;  1TOF A;  3SWL A;  3F4R A;  3TKR A;  1QMV A;  2GT5 A;  2WDU A;  3EIN A;  1YF0 A;  1Y25 A;  2B5E A;  4O32 A;  3ZFB A;  1ZOF A;  5A4V A;  3I69 A;  1EZK A;  2LKU A;  3A5I A;  4KGI A;  5J4Y A;  2B5X A;  1PKZ A;  4ZB7 A;  2VCT A;  5A5K A;  1NHO A;  2LQQ A;  2GTU A;  5A5H A;  3GNJ A;  3C1S A;  3CSH A;  2IME A;  4KA0 A;  2GSR A;  2FNO A;  3FY7 A;  2X4A A;  2LNS A;  4WR4 A;  5F8B A;  1V40 A;  3EMX A;  4N30 A;  1MTC A;  14GS A;  4AKH A;  2IMK A;  3TRP A;  4IW9 A;  5B7C A;  4XRA A;  2QGV A;  3LW9 A;  4XS6 A;  1SJZ A;  2HSN B;  3R2Q A;  3ZVJ D;  3VWU A;  2ON7 A;  1SL2 B;  4BWQ A;  3LGC A;  3LG6 A;  3GA4 A;  3FYG A;  1GTA A;  1GL8 A;  3GL3 A;  1WOU A;  2VL9 A;  4KND A;  4IQA A;  3H93 A;  4MPF A;  5A1N A;  5JCG A;  5LD0 A;  2ALB A;  1XCC A;  4GF0 A;  1KBN A;  4F0C A;  4IP1 A;  1ZL9 A;  4HEA 2;  2YPM A;  2I4A A;  4EE0 A;  2H6X A;  1WMJ A;  1WE0 A;  2YWM A;  2K8V A;  5D9T A;  4K8M A;  4MP4 A;  1BF5 A;  1K0A A;  3WGX A;  2WS2 A;  5ECL B;  1MEK A;  4ECC A;  2CAI A;  1HNA A;  2GS3 A;  1B8X A;  1K0O A;  3VFI A;  4EXJ A;  4KSM A;  3A3T A;  2WJU A;  2X8H A;  4HZ2 A;  2FY6 A;  2B3S A;  2PER A;  2H66 A;  5HR2 A;  3ZVJ A;  1O85 A;  2CA8 A;  4JR4 A;  5DCG A;  1A24 A;  5LNK e;  4IS0 A;  4MPG A;  5DDL A;  3M8N A;  4ZL8 A;  2K8S A;  1AQW A;  2LNT A;  3LYK A;  1SVM A;  1CQH A;  5AIX A;  1ERW A;  2R0P A;  5CRD A;  4ACS A;  5ECM B;  4ICY A;  1PX6 A;  1YF1 A;  2H30 A;  2C0D A;  3LOR A;  3EMP A;  4O5U A;  1V57 A;  3EPT A;  1V98 A;  3S9F A;  2H76 A;  2A4H A;  4GSN A;  5D93 A;  1TJD A;  5IOW A;  2CVK A;  1ILO A;  3VPT A;  1KNG A;  1FB6 A;  1EP7 A;  2I81 A;  5CRE A;  4K6X A;  2VLV A;  4HJ2 A;  5ECQ B;  1SK1 A;  2EFD A;  1WPI A;  3I9V 2;  1W89 A;  5JCW A;  1F9M A;  1SYX A;  3ERF A;  1BAY A;  2DML A;  4JE1 A;  4K2D A;  5EL8 A;  2H1L A;  2O85 A;  5A4W A;  5DAL A;  1TRS A;  1EV9 A;  4ECI A;  3KIJ A;  3DD3 A;  3FK8 A;  4G10 A;  5BMU B;  4E8H A;  3TDG A;  4L0U A;  2L4C A;  17GS A;  1X5E A;  2P5Q A;  4MDC A;  2X49 A;  5HFK A;  2PU9 C;  1GSQ A;  2FA4 A;  1M9A A;  3K8N A;  3L9V A;  5B6M A;  2H73 A;  4N0V A;  1U6T A;  3P8W A;  4HI7 A;  1LJR A;  1A8L A;  2WRT A;  4K5S A;  2X64 A;  1TK8 B;  1PN0 A;  2MMZ A;  3HHV A;  1DE2 A;  3F4T A;  5B6N A;  1GTB A;  4LL4 B;  2PPT A;  2VD1 A;  4TXO A;  1SVL A;  2FD3 A;  4G0L A;  3H1N A;  4ZB8 A;  3HY2 A;  5D73 A;  4ECJ A;  4NV2 A;  5A5H B;  3ZIT A;  1JZO A;  2OBK A;  1Y6E A;  1GUH A;  4USS A;  3TJF A;  2PVO C;  3D5J A;  1THO A;  4K7I A;  4MK3 A;  1E2Y A;  4IGJ A;  1QK8 A;  5IM9 A;  1Q98 A;  1THX A;  4KCE A;  5C04 A;  5E4W A;  3OR5 A;  3J7Y b;  2VM2 A;  3VK9 A;  5G2Z A;  3UL3 A;  3N9J A;  2LRT A;  3LSZ A;  4V1A p;  5DVB A;  4OFM A;  2DJ3 A;  2L57 A;  1A8Y A;  2IMD A;  1FO5 A;  1TDI A;  2MBS A;  2DJ0 A;  4MMM A;  3HYP A;  4PUR A;  1SKS B;  4TR4 A;  2XHF A;  4BL7 A;  3QAG A;  2R3X A;  2FLS A;  3TB2 A;  1QFN A;  1XVW A;  2JSZ A;  4AJ7 A;  4MJB A;  4YKG A;  5GSS A;  9GSS A;  4GWR A;  2R6K A;  1USB A;  4Q5N A;  3MYD A;  3EU4 A;  3W8J A;  3IAS 2;  1GNE A;  1VF4 A;  4WET A;  4L0W A;  1H75 A;  1BX9 A;  1XW9 A;  1ERU A;  5C00 A;  4TVE A;  5COH A;  2EFC A;  5JWO B;  1NSW A;  2MYG A;  5J9B A;  1YEX A;  2KOK A;  3D21 A;  1TU8 A;  3A5W A;  4EDZ A;  1G7O A;  2L6D A;  4JR6 A;  5H5R A;  1XOA A;  4RI6 A;  4YQM A;  2E2G A;  5H5S A;  1HQO A;  3FZA A;  4KB3 A;  2HQT A;  2LV3 A;  2RUF A;  3HD5 A;  4ZL7 A;  3F8U A;  1A2M A;  5HR3 A;  2FGX A;  1S3A A;  3C71 A;  1GTU A;  1ML6 A;  4J56 E;  1Q4J A;  1YVL A;  2O87 A;  4FYB A;  5DQY A;  3PGT A;  2JZT A;  3UVT A;  1JLW A;  2I3Y A;  2I1U A;  4H86 A;  4D73 B;  3ME7 A;  1X9W B;  4BPY A;  2KLX A;  3IA1 A;  2AV4 A;  4O92 A;  3A2W A;  1IYH A;  1X5D A;  2V32 A;  3TJK A;  4FIW A;  4FYC A;  1K0C A;  2DIY A;  2HNL A;  3CXG A;  2HSN A;  5DAL B;  1SK0 A;  4GDF A;  1B9X C;  2H6Z A;  4O5Q A;  1YKA A;  3CMI A;  1B4P A;  1SD9 A;  3LQ7 A;  1M99 A;  2A4V A;  2B7K A;  1HNC A;  5HR0 A;  4ECB A;  1GNW A;  3MSZ A;  4KW6 A;  4DEJ A;  2H0G A;  3CRT A;  4EIQ A;  5BRT A;  4LA1 A;  1XWB A;  2WZ9 A;  4LLR A;  3DRN A;  1U88 A;  3IPZ A;  3O6T A;  2YCD A;  2V6K A;  2YNX A;  3L0H A;  3L9U A;  4EL1 A;  3GX0 A;  2TRX A;  4I8B A;  1K0N A;  1DE1 A;  3VI5 A;  4EVM A;  2YZU A;  4CHS A;  1GLP A;  2DJ2 A;  3UBL A;  3TJG A;  2IMI A;  2OE0 A;  2FWF A;  3ZZX A;  2M46 A;  3KEB A;  4NXI A;  1I9D A;  4I97 A;  3IAM 2;  2CZ3 A;  3RDW A;  3F9U A;  2WUL A;  2VCX A;  4AKG A;  2NVL A;  3IK7 A;  1K0M A;  4J2F A;  1YY7 A;  3KXO A;  4GTU A;  4PGT A;  5H5Q A;  2C3Q A;  2OAD A;  2C1Y A;  4K5R A;  2XPE A;  3GIX A;  1ON4 A;  4X0X A;  4MZB A;  4K7N A;  2VD0 A;  2P5R A;  3D4T A;  4MZW A;  3LFL A;  4BL7 B;  1XOB A;  1F37 A;  4OWY A;  2J23 A;  2TRC P;  2EIQ A;  3VPQ A;  2ZNM A;  3M9J A;  2N5F A;  5KN2 A;  3BD2 A;  5G30 A;  1U87 A;  1C72 A;  2HZE B;  1GSE A;  4CDO A;  4QMK A;  2EIO A;  1OKD A;  3RAZ A;  1T3B A;  3DWV A;  1XWC A;  1VF1 A;  1V9W A;  2YOI A;  3QD9 A;  4AI6 A;  4V2L A;  2KUC A;  3HXS A;  5BMU A;  2IFQ A;  2YV7 A;  2E2M A;  1VRS D;  1Z6N A;  5G1L A;  2JZS A;  5IQY A;  3RHB A;  1WRY A;  4GQF A;  4ZB9 A;  4XIH A;  4RUV A;  13GS A;  2FWE A;  3HJO A;  5ABR A;  4FYU A;  1XPV A;  4J57 E;  3TUE A;  2QA2 A;  3U6V A;  2PBJ A;  1XWG A;  1ERT A;  2NBS A;  4HQZ A;  1O7U A;  2ZUP A;  4ZXG A;  2LST A;  3GHA A;  1UN2 A;  4WXT A;  2B6M A;  3UVH A;  3R3E A;  1GUL A;  2OKA A;  5CO3 A;  5B8A A;  2GZZ A;  1TRW A;  2PN8 A;  1M7T A;  1K3L A;  5ECK B;  1XW5 A;  3UEM A;  4X43 A;  4AKI A;  3GRX A;  1NW2 A;  2A2R A;  4KH7 A;  3HVS A;  3P7X A;  2PGT A;  3GST A;  3WYW A;  2XPD A;  5FWG A;  1HNB A;  1TXX A;  4MLY A;  3KH9 A;  3F4S A;  3VWW A;  3ERW A;  4G19 A;  4LMV A;  4KF9 A;  1OC9 B;  4TOP A;  6GSU A;  2GSQ A;  3C73 A;  3RPP A;  2CAQ A;  4GXZ A;  4XS4 B;  3NIV A;  1QGV A;  1G6W A;  2R0C A;  5CRG A;  3KM6 A;  3G7I A;  2KHP A;  4N10 A;  4DSQ A;  5AIS A;  3TOU A;  1R7H A;  5ECI B;  3LXZ A;  5CNW A;  2H01 A;  2M80 A;  1T8E B;  2DJK A;  4PTS A;  3HA9 A;  3F6D A;  2N5A A;  3D22 A;  1K3Y A;  4I2T A;  1LBK A;  3DVX A;  5G5F A;  1ST9 A;  1ERV A;  1M2A A;  1F6M C;  5G31 A;  2YWI A;  1O73 A;  1SVO A;  5IMC A;  2A2S A;  1YDK A;  1N25 A;  1SK2 A;  3EYT A;  3KTB A;  3GKX A;  2RII A;  4BVX B;  4ULX A;  4CY8 A;  4G01 A;  2PWJ A;  1A23 A;  5JWR B;  22GS A;  4V2N A;  2I9H A;  1PKW A;  4ZL9 A;  4JZQ A;  1URM A;  1GTI A;  2H1G A;  2JZR A;  1SJI A;  1X9M B;  2CT6 A;  4MH2 A;  2CQ9 A;  4K0G A;  1G7E A;  3D6I A;  5DAK B;  4POB A;  3FMW A;  4KX4 A;  3CWG A;  2DC5 A;  2WGR A;  5ECO B;  4NHW A;  4IEL A;  1T7P B;  3IK9 A;  3VWV A;  3F6F A;  4F03 A;  4EDY A;  2X8G A;  1E6B A;  1ZYE A;  4QQ7 A;  19GS A;  1PL1 A;  3DGQ A;  4OFT A;  1TRV A;  1BED A;  4IBP A;  3DIE A;  3CTG A;  2HRA A;  1ZMA A;  3QPM A;  1GSY A;  4D73 A;  5D9W A;  3P90 A;  3ZIJ A;  1PX7 A;  5HFG A;  3Q6O A;  3C1R A;  2HXK A;  3D4M A;  4BWS A;  1DSB A;  3Q74 A;  1FB0 A;  4MCU A;  1F2E A;  2H1D A;  2IFQ B;  4KCA A;  4KE3 A;  1MDK A;  1T1V A;  2H70 A;  1O6J A;  4OFN A;  1T4Y A;  16GS A;  3EUR A;  3G9B A;  3QFA C;  3GKN A;  4ID0 A;  1Z5Y E;  2EFH A;  4L8E A;  1KTE A;  4K9Z A;  8GSS A;  1T4Z A;  2H74 A;  1SD8 A;  4IJ3 A;  2BTO T;  2YP6 A;  2HSM B;  2AHE A;  1BG5 A;  4O7H A;  3C7M A;  3Q19 A;  1FOH A;  4FH8 A;  4EC0 A;  4MZC A;  2ON5 A;  1SJ6 A;  1YEP A;  2Z9S A;  2BJX A;  3FHK A;  4KAE A;  3TCO A;  2O8V B;  3CTF A;  5DJM A;  5HQP A;  3GYK A;  4AKX B;  3FR3 A;  2FCH A;  2E7P A;  2F9S A;  2QA1 A;  3I6A A;  5EY6 A;  4ZBA A;  4F82 A;  3RHC A;  4QL9 A;  4EUY A;  5F0G A;  4OMV A;  1FOV A;  2DKH A;  2HZF A;  5KN1 A;  3WGE A;  3UJ1 A;  3IHQ A;  1K0D A;  6GSX A;  6GSY A;  3J7Y k;  1EGO A;  12GS A;  2L6C A;  4MA9 A;  3ZRD A;  2HT9 A;  20GS A;  1UVZ A;  2MMO A;  1EOH A;  4PNG A;  4TR0 A;  3QR6 A;  4FO5 A;  1ZZY A;  2XC2 A;  1MDJ A;  1TP9 A;  4HQS A;  2VCZ A;  1K3O A;  5F07 A;  2AJQ B;  4POM A;  4V2M A;  5E59 A;  1XXU A;  3ZML A;  5G1K A;  2OA7 A;  5CYY A;  3EVI A;  3E3E A;  2KP2 A;  3IR4 A;  3KTL A;  5F05 A;  1FVJ A;  1H4O A;  2HZE A;  1XIY A;  3M3M A;  1J0F A;  2CVB A;  3ERG A;  4EKZ A;  1YJ6 A;  1NHY A;  1ZYN A;  2AAW A;  3IRA A;  5KN0 A;  4F0B A;  5KEJ A;  4WF5 A;  2DSA A;  5GAP D;  2IL3 A;  2LRN A;  2WFC A;  3HVV A;  1ABA A;  4ML1 A;  3HZ8 A;  3MDK A;  1EV4 A;  2EFE A;  2DIZ A;  3F3R A;  5GST A;  1GSF A;  3PH9 A;  3ZLP A;  4HU9 A;  6GST A;  2MMA A;  5D9X A;  1JZD A;  1Z3E A;  1QUW A;  1KEB A;  4Z2T A;  5D96 A;  4RI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...