4BVXB

Crystal structure of the aimp3-mrs n-terminal domain complex with i3c
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
GHMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNDGPSLMGLTTIAAHLVKQANKEYLLGSTAEEKAMVQQWLEYRVTQVDGHSSKNDIHTLLMDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
molecule tags Ligase
source organism Homo sapiens
total genus 54
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bvxB02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bvxB01
4GSTA 5ELGA 2VCZA 1K0CA 4YH2A 1VF4A 3EINA 1TU7A 3VLNA 3LXZA 1GLPA 2HSMB 4OFNA 4WR4A 1OE7A 2R6KA 4ZBDA 1GUMA 1ZGNA 3M1GA 1MTCA 18GSA 4IVFA 2VO4A 1NHYA 6GSXA 3DGQA 5ECNB 2R4VA 5GSSA 9GSSA 3TOUA 4JEDA 4E8EA 6GSWA 3HJMA 5ECOB 4KSMA 4YQVA 3P90A 1MD4A 1TU8A 3IC8A 1EV4A 3UBKA 3FR9A 1UA5A 3WYWA 1PL1A 4LMWA 1GSUA 4HZ4A 3M0FA 1KBNA 4PXOA 4IJIA 5FHIA 1YJ6A 5DJMA 3CSHA 4L5LA 1GSYA 4MPGA 4ZB8A 4Q5QA 3F63A 4G0LA 3H1NA 4YAVA 1M0UA 5ECRB 3VURA 1YQ1A 5BMUA 4F0BA 2R3XA 2AHEA 2HRKB 3G7JA 5D9VA 1K3LA 2X64A 1HNAA 1PMTA 1G6WA 14GSA 1M9BA 3MDKA 1LBKA 4O92A 4PX1A 6GSUA 4K0GA 3Q18A 4PQHA 4PTSA 3UBLA 5F05A 5LCZA 5DCGA 1M9AA 2HNLA 4MDCA 5FT3A 4BVYB 1GSDA 1TW9A 20GSA 3CRUA 4BVXB 1GTUA 4ECCA 2LJRA 4PGTA 2OA7A 1BYEA 2HRAA 1F3BA 5ECLB 1K0BA 1PD21 2PERA 4EC0A 7GSSA 2CZ3A 3M8NA 3VI7A 2D2ZA 4KF9A 4ZB9A 1F3AA 6GSVA 4MZWA 4GF0A 3VPTA 2GSSA 2V6KA 3M3MA 4Q5RA 3I69A 1ML6A 3F6FA 5GSTA 4KE3A 3VK9A 1IYHA 2C3NA 4IGJA 4ID0A 1PGTA 4IW9A 4AGSA 1GLQA 2VCWA 3IE3A 8GSSA 4DEJA 5AGYA 5D9XA 1K0AA 4YQUA 5EL8A 1EEMA 4G0IA 5ECSA 1GNWA 5FWGA 10GSA 4NAXA 1EOGA 3PPUA 5EY6A 4EDZA 4USSA 1GTIA 5AN1A 1B8XA 1XWGA 3FY7A 3VWXA 2IMIA 4JZQA 4I97A 5A5KA 3LYPA 1JLWA 5GZZB 2IMKA 2JL4A 13GSA 4WR5A 5ECKB 1HNCA 1AQXA 3HKRA 1YY7A 1VF3A 2GSRA 4OFTA 3ISOA 3PR8A 1K0MA 4F03A 3FR6A 3QAGA 4G9HA 3WD6A 1GUHA 2FHEA 1Q4JA 1PN9A 2HSMA 1GULA 3CSIA 4ZXGA 1Z9HA 17GSA 1USBA 5A4UA 3ERGA 3G7IA 5A4WA 3MAKA 16GSA 4YAPA 1PX6A 3O3TA 2CVDA 4MP4A 1K3YA 3ZMLA 2ON5A 1BG5A 3ZFBA 1PKZA 4KDYA 4L8EA 1BX9A 4ZBBA 6GSSA 1E6BA 3N9JA 5LD0A 4KGIA 3KJYA 1GSFA 4HOJA 4BL7B 4L5OA 1PX7A 4PURA 2HQTA 4RI7A 1V40A 4RI6A 3PGTA 4ACSA 4HI7A 6GSTA 2C3QA 4J2FA 4NHZA 1OYJA 4PUAA 4GTUA 3AY8A 3DD3A 2C80A 1U87A 3GH6A 3UVHA 1XW6A 3LXTA 3FRCA 4EE0A 4LMVA 5HFKA 3GTUB 2AAWA 2J9HA 5DAKB 1XWKA 3Q74A 4MF7A 5D73A 3O76A 3LG6A 2HRKA 2F8FA 5EVOA 3I6AA 1K3OA 2VD0A 3GX0A 5J4UA 4PQIA 1GTBA 6GSYA 4ECJA 3TGZA 4KDXA 1R5AA 4GCIA 3TOTA 1TDIA 3GSSA 1GTAA 3NIVA 2OADA 1GWCA 1GSEA 3QR6A 4KAEA 4OMVA 3L0HA 1AW9A 3KXOA 4E8HA 4PNGA 4TOPA 4EXJA 1OKTA 2A2RA 4BVYA 1JZRA 2GLRA 12GSA 3QAVA 4OFMA 4ZB6A 4BVXA 4IQ1A 1M99A 1EOHA 3N5OA 1BAYA 2CZ2A 3RBTA 4KX4A 1PA3A 3LYKA 3U6VA 4KH7A 1F2EA 2PVQA 1AQWA 4MF5A 4EDYA 2ON7A 3IK7A 3EE2A 1K0NA 1MD3A 1U3IA 2WDUA 3KMOA 5DALB 2IL3A 3IK9A 4IELA 5ELAA 2FNOA 3UAPA 2F3MA 2C4JA 5ECIB 5A4VA 2PGTA 2DC5A 2WS2A 1VF2A 2VD1A 1GNEA 5DALA 4IQAA 5J41A 2AB6A 3SWLA 4HJ2A 1A0FA 4KDUA 5JCWA 2YV7A 4QQ7A 22GSA 4JBBA 5F0GA 5J5NA 4GSNA 5DQSA 2CAQA 5AISA 1DUGA 3FR3A 1N2AA 2WB9A 4ZBAA 1Y6EA 2R5GA 4ISDA 1AQVA 5ECMB 2C3TA 3ZMKA 3KTLA 4FQUA 4IS0A 1G6YA 1HQOA 4BL7A 1RK4A 4G19A 1PL2A 5D9WA 3LFLA 1PKWA 1VF1A 3GURA 4PNFA 1C72A 4MPFA 3IR4A 4K0NA 1YDKA 4GLTA 3KMNA 5AIVA 2VCXA 1B4PA 5ECHB 5JCUA 3FYGA 5ECPB 3GTUA 2NTOA 4G10A 5DAKA 4G0KA 3LSZA 3P8WA 2OACA 3IBHA 4CHSA 4Q5FA 3UARA 1AXDA 3GUSA 2VCTA 5G5EA 2N5FA 2YCDA 1U88A 3R3EA 5ECQB 3D0ZA 3HJOA 5F07A 1K0OA 1G7OA 4Q5NA 5F06A 3ZFLA 3ERFA 5KEJA 19GSA 4IKHA 5IQYA 3QAWA 2WJUA 3C8EA 4N0VA 11GSA 5B7CA 3CBUA 4IBPA 3GSTA 4MF6A 3LJRA 1B48A 2PMTA 5F8BA 1K0DA 2DSAA 2YV9A 2GDRA 2C8UA 1GSQA 1EV9A 2A2SA 2PBJA 3VI5A 1XW5A 3F6DA 3LQ7A 2UZ8A 1FW1A 1GUKA 5DJLA 2CAIA 2CA8A 4ECIA 1IYIA 3BBYA 4MK3A 1V2AA 5G5FA 4ECBA 2VCQA 4O7HA 1YKCA 2VCVA 5AIXA 4YQMA 2GTUA 3VPQA 2WRTA 4NHWA 4F0CA 1HNBA 2HSNB 3R2QA 1JLVA 4GSSA 1LJRA 2GSQA 1FHEA 1ZL9A 3KM6A 5D9TA 1OE8A 5DDLA 3W8SA 3CRTA 2GSTA 3CSJA 4HZ2A 1GSSA 3Q19A
chains in the Genus database with same CATH superfamily
4V2NA 1F9MA 2VCZA 3ZIVA 4YH2A 2MYGA 4KA0A 2O3EA 3LXZA 1GLPA 4DVCA 4D73A 2WVXA 1SENA 2GZYA 4FO5A 2L5OA 3Q6OA 5KN0A 18GSA 4IVFA 1AIUA 5C00A 4NMUA 4WF4A 4HQSA 5ECNB 2B5YA 1FOHA 3C1RA 2V1MA 4E8EA 6GSWA 3C1SA 3GH9A 1VRSD 3TKRA 2V6OA 4YQVA 3EURA 3GL3A 2GQKA 4MJAA 2LQOA 4LMWA 1GSUA 3EC3A 4IJIA 2XPDA 4X1UA 4PHZC 4ZILA 5FHIA 3WT2A 1GSYA 1EWXA 1M2DA 3GFKA 3LORA 1HYUA 4MABA 4ILFA 3VURA 2E7PA 3UEMA 2LNTA 2R3XA 2AHEA 1G7EA 1K3LA 2FA8A 3EWLA 3MDKA 1LBKA 3IHGA 1A8LA 4O92A 2B5XA 2NBSA 6GSUA 3Q18A 5IMCA 1YVLA 4L0UA 5CO3A 3ZTLA 4PQHA 3VWWA 1TK0B 5LCZA 3DVWA 3IA1A 1M9AA 2L4QA 20GSA 1GTUA 4XIHA 2HRAA 5COHA 1OC3A 2EC4A 1F3BA 1B9XC 4TR4A 3M8NA 3VI7A 1R5PA 4MZWA 1YKAA 3M3MA 3QFAC 3I69A 1WPIA 4KE3A 3VK9A 2P31A 1JZDA 2C3NA 2CT6A 4IW9A 3W6GA 3WT1A 2VCWA 1ERWA 4ZB7A 3SBCA 3ZL5A 1A0RP 1BG1A 3K8NA 4G0IA 1GNWA 3CYNA 2PUKC 1FOVA 4YKFA 1XG8A 3RAZA 1HNCA 1AQXA 1EGOA 1VF3A 3ISOA 4N0ZA 3V1WA 1K0MA 4F03A 1M3IA 4BA7A 4ULXA 3QAGA 4G9HA 4KW6A 1SD9A 4ICYA 3CTGA 1YF0A 4Z2TA 2FWFA 3TRQA 4ZL7A 5CAXA 3G7IA 3HXSA 16GSA 1OKDA 2CVDA 3TJKA 5DCHA 3ED3A 1T4YA 1BG5A 2B1LA 3ZFBA 4KDYA 1A2MA 4KGIA 4DSQA 3J7Yb 3QMXA 1A2LA 3HVVA 1XVQA 1QUWA 3TDGA 1Y25A 4RI7A 4RI6A 4F2IA 4HI7A 6GSTA 2C3QA 2MMOA 1TK5B 1FB0A 4PUAA 4GTUA 2C80A 1U87A 3GH6A 2LJAA 1XW6A 1ABAA 3FRCA 4EE0A 2YOIA 2KHPA 4PI0C 5D73A 1OC9A 3TJGA 2JACA 4QMKA 1K3OA 2VD0A 3FHKA 1ZOFA 4MA9A 6GSYA 5CYYA 1AUCA 2I3YA 3IOSA 1DE2A 2CVBA 1GTAA 4V2LA 1GSEA 2GGTA 4KAEA 5G31A 3ZIJA 3L0HA 2BTOT 1AW9A 2X8GA 3VFIA 4PNGA 2YWMA 1JZRA 12GSA 4ZB6A 3LGCA 4GXZA 1M99A 3S9FA 1FAAA 4WKWA 4NPBA 5HR1A 4MMMA 3A3TA 4KH7A 1JZWA 1TRVA 2O36A 1AAZA 3F3RA 1SJ6A 4H86A 3UVTA 1ZMAA 2P5QA 1O7UA 5A5HA 5A34B 2GVPA 2GT6A 5DALB 4IELA 1BEDA 2FNOA 1TI1A 4TVEA 2DJKA 2WS2A 3VWUA 1SJIA 1GNEA 2E2MA 4IQAA 5J41A 1EP8A 2H76A 2AB6A 2DMLA 4HJ2A 5KN2A 1ZYNA 4LL1B 4QQ7A 1VGLA 1TRUA 3F4RA 1TTZA 2JZTA 2AV4A 1I1IP 4GSNA 2CAQA 3TRPA 2WB9A 2QC7A 3APSA 1Y6EA 4ISDA 2YWNA 1XCCA 2H1LA 2X99A 5ECMB 1ERUA 2CX4A 1S3DA 4WETA 3H93A 1RK4A 5D9WA 1KNGA 5GAPD 4FYUA 2WVYA 1F6MC 4V1Ap 1URMA 3IR4A 4JR6A 2L59A 3JCML 5G2ZA 2VCXA 5ECHB 5JCUA 2RUFA 1B4QA 1FB6A 2HT9A 3GTUA 3UL3A 5DAKA 2OACA 2YZUA 2R0PA 1Q98A 1HD2A 2VCTA 4K5RA 4MJBA 3HYPA 3IC4A 5HR2A 3LW9A 3HJOA 3RHCA 5F07A 4KB3A 2CV4A 3QDNA 4QL9A 5F06A 4JE1A 19GSA 2XHFA 3TB2A 2AYTA 2O87A 3C8EA 2BMXA 3PH9A 1WP0A 4POMA 4MF6A 5F8BA 5C04A 3HZ8A 4IN0A 1GSQA 4N10A 2PBJA 4GDFA 4K6XA 2XC2A 5G5FA 4MK3A 4ECBA 1TJDA 2VCQA 4DSRA 2F8AA 3P7XA 2PN8A 3VPQA 2WRTA 1SYRA 5DVBA 1HNBA 2HSNB 3R2QA 1JLVA 4ZIJA 2C0GA 3EU3A 1THXA 2GSQA 2YWOA 1H75A 3BJ5A 4OO4A 1E2YA 3W8SA 2C0EA 3Q19A 2EFEA 4MH2A 2O8VB 1K0CA 3GRXA 3VLNA 2REMA 3IRAA 3FEUA 5IO2A 4ZBDA 2KOKA 5IMZA 4HU7A 1J08A 4TR0A 2VO4A 2X49A 1NHYA 2DJ1A 5GSSA 5IM9A 3TOUA 4JEDA 5ECOB 3GKNA 1TU8A 3FR9A 4HZ4A 1SK2A 4HDEA 1KBNA 4I2UA 1GH2A 1TRSA 5IO0A 3HVSA 1X5CA 2YJHA 4MPGA 4G0LA 4YAVA 5ECRB 4WF5A 1X0RA 4F0BA 4P3YB 2HRKB 3G7JA 2DMMA 2X64A 2PPTA 1X9SB 1M9BA 1S3RA 4DSSB 1MDJA 4BWSA 1YEXA 1WE0A 2O7KA 3EVIA 1THOA 3M9KA 1XOAA 2HNLA 2HZEB 4WBJA 4BVYB 2I81A 2L57A 4BVXB 4ECCA 2LJRA 2OA7A 2VLTA 3CHXC 4MJEA 1NW2A 2GS3A 5H5RA 1OAZA 2D2ZA 4A5PA 4I8BA 6GSVA 2V6KA 2R0CA 4Q5RA 3GL5A 3NOFA 2FLSA 1JHBA 5GSTA 2WW2A 2WCIA 5KN3A 3KCMA 4QL7A 1KTEA 4IGJA 3UIWA 2YNXA 2FGXA 3HCZA 1GLQA 3IE3A 4AJ8A 5D9XA 4XHMA 2GZZA 4YQUA 1W89A 3LEFA 1EEMA 3KEBA 10GSA 4NAXA 5EY6A 3PPUA 2AUVA 1Z3EA 5AN1A 5CRWA 3FY7A 2IFQB 2IMIA 4JZQA 4I2TA 4I97A 5A5KA 4IJ3A 5GZZB 2IMKA 5ECKB 1YY7A 2GSRA 4XRDA 3C7MA 1Q4JA 3KH7A 1X9WB 1PN9A 1XZOA 2HSMA 3CXGA 1GULA 3GHAA 4ZXGA 3ERGA 2E0QA 5IIZA 2FWHA 1XW9A 1K3YA 3ZMLA 3RPNA 2DJ2A 3HDCA 1PKZA 4L8EA 2YN1A 4ZBBA 4LA1A 3CMIA 2HLSA 1GSFA 4HOJA 3F0IA 4FYBA 1YZXA 2LRCA 3D4MA 4ACSA 2ZUPA 3IXRA 4NHZA 2V41A 3CTFA 1OYJA 1LU4A 1ERVA 1XXUA 3HZ4A 3UVHA 3GMFA 1QFNA 4LMVA 3KIJA 5INYA 2H8LA 3ZITA 4MF7A 1XWAA 1XBSA 3O76A 1TOFA 4JRRA 5EVOA 2OJLA 4J56E 1YEWC 1V58A 2RLIA 4ECJA 4CDOA 2LSTA 3TOTA 1TDIA 5J47A 3GSSA 4AKGA 4FH8A 3NIVA 2OADA 4AI6A 2DBCA 4E8HA 2Z9SA 1OKTA 2GT5A 1EEJA 1JFUA 3C73A 2GLRA 5IPGA 5ID2B 4K2DA 3N5OA 2H6XA 2ZCTA 4AKXB 1DBYA 1M2BA 4NWYA 1AQWA 5EPFA 4EDYA 5CRDA 5HFGA 2WDUA 3KMOA 1AC1A 4K7NA 3UAPA 5G1LA 5ECIB 5A4VA 2DC5A 3E0UA 5ABRA 2J23A 3GN3A 5DALA 4PQ1A 3LWAA 5HR0A 4O5RA 3G7YA 2H6ZA 4D73B 3SWLA 1A0FA 2WVXB 4KDUA 22GSA 3KTBA 3I43A 3GNJA 5DQSA 2LRNA 1N2AA 2H74A 5G30A 1AQVA 3DIEA 2C3TA 4GWRA 4HEA2 2WZ9A 1G6YA 4BL7A 3C71A 4ZL9A 4G19A 1S3AA 2H71A 1X5DA 2IMDA 3GURA 4PNFA 3BD2A 5G1KA 1C72A 2H1AA 4K0NA 3TCOA 5J3RA 3DWVA 2H1DA 2H0GA 3LSZA 3APQA 3BCIA 2QKEA 1ZCPA 3F3QA 4Q5FA 5IMDA 3RPPA 3GUSA 2MBSA 4O32A 5G5EA 1A2JA 3D0ZA 5B8BA 5BRTA 2WW0A 1G7OA 2IJYA 3ME8A 3P2AA 1SVMA 2WJUA 4TW5A 4N0VA 11GSA 3CBUA 4KUNA 3LJRA 1K0DA 2DSAA 1PFOA 1T00A 4TXOA 1YEPA 2M80A 3F6DA 2VLVA 2MBTA 4EVMA 1FW1A 3FZAA 5DJLA 1XOBA 1IYIA 1X9MB 1V2AA 4CY8A 3GKXA 1SKWB 1YKCA 2VCVA 1OC8A 1TRWA 4NHWA 5JWRB 2GZPA 3QOUA 4F0CA 3A2WA 2DIZA 2FUG2 2RM5A 3OR5A 3MSZA 3HVNA 3TUEA 3GKKA 1OVNA 3DXBA 4EL1A 1LJRA 2H73A 4KCEA 3KM6A 5J4VA 4HJMA 2A2PA 2GSTA 3CSJA 1M2AA 4GSTA 4G01A 3DVXA 4OCEA 3EINA 2HSHA 1F37A 4OFNA 4WR4A 2HE3A 4CY6A 1ZGNA 3M1GA 1EZKA 1MTCA 2N5BA 5JWOB 2G0FA 6GSXA 3DGQA 2R4VA 4CW9A 3IDVA 5D96A 2LRTA 1O73A 3HJMA 3EU4A 1SD8A 2KP1A 3P90A 3IC8A 3ME7A 1EV4A 2YWIA 1UA5A 3WYWA 1PL1A 1SK1A 2TRXA 3M0FA 1PN0A 4PXOA 1I5GA 5BMUB 5DJMA 2K8VA 3CSHA 2P0GA 4Q5QA 3F63A 3L78A 2DJJA 4K5SA 4EIQA 3ZREA 1G6WA 4BWQA 3IHQA 5A1NB 4IP6A 2I9HA 2DLXA 2WFCA 1U6TA 1DE1A 1TP9A 1O85A 4PTSA 1ZZYA 2MMZA 4DSSA 3KH9A 4PUFC 5DCGA 3TJJA 5FT3A 3GIXA 4MH3A 3US3A 1TW9A 1TXXA 4IHUA 4AF2A 1BYEA 4Z2RA 1SJZA 5JWQB 2I1UA 2HXKA 2HZEA 1K0BA 1PD21 2PERA 4RQXA 2CZ3A 1BF5A 2X8HA 2VAFA 3G9BA 4KF9A 4ZB9A 1F3AA 1SU9A 2HSYA 2H6YA 3ZRDA 1QGVA 3IAM2 1IYHA 4RUVA 4O5UA 3A5IA 4ID0A 1QQ2A 5IMVA 2R2JA 4DEJA 1FG4A 2X8CA 3RGBC 2PWJA 2LQQA 2O89A 4OD7A 5ECSA 3FZ4A 1O81A 5FWGA 5A5HB 2XPEA 2YP6A 4K7IA 2IMEA 2K18A 2VL3A 3LYPA 2A4HA 1JLWA 1R26A 2JL4A 13GSA 1MDIA 2EFCA 4EO3A 1PQNA 1SL2B 3FR6A 5HQPA 3WD6A 2FHEA 1UC7A 3CSIA 1USBA 5A4UA 3GA4A 5A4WA 2ZNMA 2CQ9A 2FD3A 4YAPA 4ML6A 1TI3A 1V98A 3FKFA 2EIQA 6GSSA 2FY6A 5LNKe 2UV8G 3KJYA 2FCHA 2WVZA 2HQTA 1V40A 3PGTA 4MNNA 1B9YC 1WJKA 3D5JA 2H19A 2IMFA 2H66A 3GX8A 3AY8A 3FK8A 2QA2A 2KP2A 5HFKA 3GTUB 2J9HA 5DAKB 2DKIA 2LV3A 1PRXA 3MYDA 4N30A 4JR4A 3LG6A 3I6AA 2VL2A 5CREA 4I5QA 3TKSE 1GTBA 1A8YA 4X4JA 4KDXA 1R5AA 1J0FA 5J40A 1XWBA 3ZVJD 1XFLA 4LLRA 1WRYA 1GWCA 4F9ZA 3D4TA 1RW1A 5CRGA 4OMVA 3KXOA 1GL8A 3FW2A 1G0TA 3TKPA 3GKMA 4OFMA 1WMJA 2RUEA 2JU5A 1T4ZA 1O6JA 1EOHA 1W4VA 3QCPA 1WIKA 1BAYA 2L5LA 2CZ2A 5DBQA 3RBTA 4TRXA 4KX4A 1PA3A 3U5RE 3LYKA 4POKA 1F2EA 2H01A 2IWTA 2OE3A 4MF5A 2TIRA 2ON7A 1YF1A 3D21A 1K0NA 1U3IA 2FWEA 5D93A 2A4VA 3IK9A 5ELAA 2C4JA 2OT3A 5IMFA 2PGTA 1VF2A 2EFDA 2VD1A 4X43A 2WGRA 2MMNA 2H30A 3A5WA 4K9ZA 1NHOA 4K1FA 1X5EA 4LL4B 4AJ7A 1UN2A 2GQMA 3QD9A 2AJQB 5J5NA 1BQ7A 3APOA 4FIWA 2IPAA 3FR3A 4ZBAA 4G2EA 2O85A 1S4BP 1N25A 4TXVA 2K8SA 2B3SA 2V2GA 2L6CA 2VKZG 5HFIA 3ZMKA 1MDKA 4IS0A 1BJXA 1HQOA 1ZYPA 5B6MA 1PL2A 3LFLA 4ML1A 5J9BA 1PKWA 4J57E 2VM2A 3GYKA 4HUAA 3KMNA 2H0HA 5AIVA 4Z2UA 2DIYA 1GP1A 5ECPB 2P5RA 1M3JA 3D6IA 4V2MA 4G0KA 5IOWA 1NSWA 1XWCA 3P8WA 3HA9A 3A2XA 3RFRC 2QSIA 2B5EA 2YCDA 4HS1A 3ZLPA 2VL9A 4BPYA 1K0OA 5D8IA 4XS4B 2M72A 5J4YA 3KZQA 3ZFLA 2VIMA 3WGEA 2CVKA 5B6NA 3L9SA 1MEKA 1ZYEA 4AKIA 2O5VA 2B7KA 3UJ1A 4IBPA 3L9VA 1B48A 2C0FA 1U3AA 2LNSA 4TR1B 3BCKA 2C8UA 1EV9A 2A2SA 1XW5A 3LQ7A 1SVOA 1I9DA 2QA1A 3HY2A 2CAIA 2VL2C 4ECIA 4Z7XA 3BBYA 2JSYA 4GQCA 1T7PB 3H79A 3J7Yk 4YQMA 2GTUA 3TJBA 3TKQA 3HD5A 1WOUA 2DKHA 2VOCA 3IV4A 5J9CA 5A34A 2OKAA 5DDLA 2HZFA 3QFBC 4POBA 1GSSA 1KEBA 3HVXA 4EUYA 2HI7A 5ELGA 5E4WA 3RHBA 3FZ9A 1VF4A 2RM6A 1SYXA 1TU7A 4K2XA 2H0IA 2HSMB 1ZYQB 1OE7A 2R6KA 1GUMA 3TKSA 4EIPA 1SL0B 3TRXA 4TN8A 1ERTA 2F51A 9GSSA 2L4CA 3HHVA 3BOAA 3NZNA 3O6TA 1QMVA 2KUCA 3EMPA 4KSMA 4V1Ag 5CP1A 3HMJG 1MD4A 2EIRA 4KSOA 3UBKA 2LUSA 1TXUA 5CRHA 1O8XA 3FZ5A 1YJ6A 4F82A 2HRNA 4L5LA 4ZB8A 3M9JA 4AJ6A 1UVZA 3H1NA 1M0UA 2C1YA 1YQ1A 5BMUA 3RDWA 5D9VA 5GAND 1HNAA 1PMTA 14GSA 2R0GA 3KD0A 3QPMA 1R4WA 2LS5A 2K6VA 1V9WA 1T8EB 2MZCA 4PX1A 4K0GA 4N3ZA 5A1NA 2FA4A 3UBLA 5F05A 2JZRA 1XIYA 3ZYWA 4MDCA 3DRNA 1EGRA 1GSDA 3KP8A 2VLUA 4WEYA 3CRUA 4POLA 3HJPA 4PGTA 2X4AA 5ECLB 2H1GA 5KOWA 4EC0A 7GSSA 1T1VA 4K8MA 2CX3A 4OO5A 4OWYA 4GF0A 3VPTA 2GSSA 3TU3B 3IAS2 3E9JB 1ML6A 3F6FA 2XBIA 3H8QA 2MMAA 1PGTA 1N8JA 4AGSA 1ST9A 4XS6A 8GSSA 4ZL8A 3UOMA 5AGYA 1K0AA 4IP1A 5EL8A 3UMAA 3ERWA 1TKDB 1Y1UA 2L6DA 1EOGA 2HSNA 4EDZA 3F4TA 4HU9A 3WGDA 4USSA 1GTIA 1B8XA 1XWGA 1J9BA 3VWXA 1FVKA 4HSCX 3MNGA 4WR5A 2M46A 1FO5A 3HKRA 4OFTA 2NPBA 4TKYA 2H72A 3PR8A 1Z6MA 4XTSA 1GUHA 3F4SA 3D22A 1CQGA 2QGVA 3GV1A 4FYCA 1Z9HA 17GSA 3MAKA 1PSQA 1PX6A 3O3TA 3CQFA 3L4NA 3EPTA 4MP4A 2ON5A 2EIOA 2WW3A 2HRFA 4YKGA 3KP9A 3ZZXA 4N11A 3L9UA 1BX9A 3EMXA 1E6BA 3N9JA 5LD0A 4MZBA 5HR3A 3ZVJA 4BL7B 4L5OA 1PX7A 3IPZA 2IIYA 4PURA 1V57A 5IOXA 5IMAA 1XPVA 1Z7PA 4J2FA 2KLXA 4AKHA 3KGKA 3DD3A 1OC9B 2B1KA 4KNDA 3LXTA 2TRCP 2YANA 2C0DA 4K7OA 2H75A 3MIXA 2AAWA 3A2VA 1XWKA 2NVLA 3Q74A 3TKSC 4NV5A 2F9SA 2HRKA 2F8FA 4MCUA 1WWJA 1Z6NA 1XVWA 2PU9C 2NDOA 3GX0A 5J4UA 4PQIA 1SVLA 3TGZA 2LKUA 4GCIA 4TR3A 5E59A 3QR6A 2HYXA 2OBIA 3WGXA 4TOPA 5H5QA 4EXJA 2A2RA 5KOXA 5ENUA 1SL1B 4BVYA 4XRAA 3QAVA 4BVXA 1T3BA 4HQZA 4IQ1A 3F9UA 4GRFA 4BIKA 4TXOB 2I4AA 4MZCA 1FVJA 5KN1A 1GRXA 4PI2C 2JSZA 1QK8A 3U6VA 2G2QA 2EFHA 1CQHA 2PVQA 4HZ2A 2K9FA 2ALBA 1Z5YE 1A24A 3IK7A 3EYTA 2ES7A 1ACVA 4MLYA 4JU5A 3EE2A 1MD3A 1DSBA 4OCFA 2IL3A 2F3MA 2IFQA 5L71A 2N5AA 4MJCA 2IN3A 2PVOC 3F8UA 3DEXA 5JCWA 1R7HA 2YV7A 3E3EA 2OE0A 4I6XA 4JBBA 1Z7RA 5B8AA 3CWGA 5F0GA 2OE1A 2RIIA 2VM1A 4XCSA 3DMLA 3DKSA 3FMWA 5AISA 1DUGA 2B6MA 2XBQA 3TJFA 2R5GA 1ON4A 1SKRB 3KTLA 4FXYP 4FQUA 2H70A 2WW1A 4L0WA 2E2GA 4O5QA 4RQRA 1VF1A 4WBRD 3VWVA 4MPFA 1YDKA 2VUPA 4GLTA 3MWHA 1M7TA 2JZSA 1B4PA 5DQYA 3FYGA 1A23A 2NTOA 4G10A 1NM3A 2B7JA 2DJ0A 3IBHA 4CHSA 3UARA 1AXDA 5IPHA 1S3CA 1O8WA 4EF0A 2N5FA 1U88A 3R3EA 5ECQB 2YPMA 3DYRA 3H4KA 2WULA 4Q5NA 1RQMA 2LTKA 3ERFA 5KEJA 2BJXA 4IKHA 5IQYA 4NXIA 3QAWA 4E68A 1SK0A 2HFDA 4XS4A 2LEGA 2OBKA 2DJ3A 5B7CA 3GSTA 3W8JA 2PMTA 5ID2A 2H1BA 2YV9A 2GDRA 2GQLA 2WZSA 1JZOA 3VI5A 3I9V2 2YZHA 2YJ7A 1TK8B 2R37A 4TR1A 2UZ8A 1EP7A 1SKSB 4WXTA 1GUKA 1H4OA 5H5SA 2CA8A 4EKZA 4O7HA 4KCAA 5AIXA 5CNWA 4NV2A 4W66A 4X0XA 4GQFA 4GSSA 3PINA 5JCGA 1ILOA 1FHEA 1ZL9A 1QXHA 2V32A 2JADA 1OE8A 2FWGA 3CRTA 5D9TA 4XS1A 2LJKA
chains in the Genus database with same CATH topology
4V2NA 1F9MA 2VCZA 3ZIVA 4YH2A 2MYGA 4KA0A 3LXZA 1GLPA 4DVCA 4D73A 1SENA 2GZYA 4FO5A 2L5OA 3Q6OA 5KN0A 18GSA 4IVFA 1AIUA 5C00A 4NMUA 4WF4A 4HQSA 5ECNB 2B5YA 1FOHA 3C1RA 2V1MA 4E8EA 6GSWA 3C1SA 3GH9A 1VRSD 3TKRA 2V6OA 4YQVA 3EURA 3GL3A 2GQKA 4MJAA 2LQOA 4LMWA 1GSUA 3EC3A 4IJIA 2XPDA 4X1UA 4ZILA 5FHIA 3WT2A 1GSYA 1EWXA 1M2DA 3GFKA 3LORA 1HYUA 4MABA 4ILFA 3VURA 2E7PA 3UEMA 2LNTA 2R3XA 2AHEA 1G7EA 1K3LA 2FA8A 3EWLA 3MDKA 1LBKA 3IHGA 1A8LA 4O92A 2B5XA 2NBSA 6GSUA 3Q18A 5IMCA 1YVLA 4L0UA 5CO3A 3ZTLA 4PQHA 3VWWA 1TK0B 5LCZA 3DVWA 3IA1A 1M9AA 2L4QA 20GSA 1GTUA 4XIHA 2HRAA 5COHA 1OC3A 2EC4A 1F3BA 1B9XC 4TR4A 3M8NA 3VI7A 1R5PA 4MZWA 1YKAA 3M3MA 3QFAC 3I69A 1WPIA 4KE3A 3VK9A 2P31A 1JZDA 2C3NA 2CT6A 4IW9A 3W6GA 3WT1A 2VCWA 1ERWA 4ZB7A 3SBCA 3ZL5A 1A0RP 1BG1A 3K8NA 4G0IA 1GNWA 3CYNA 2PUKC 1FOVA 4YKFA 3RAZA 1HNCA 1AQXA 1EGOA 1VF3A 3ISOA 4N0ZA 3V1WA 1K0MA 4F03A 4BA7A 4ULXA 3QAGA 4G9HA 4KW6A 1SD9A 4ICYA 3CTGA 1YF0A 4Z2TA 2FWFA 3TRQA 4ZL7A 5CAXA 3G7IA 3HXSA 16GSA 1OKDA 2CVDA 3TJKA 5DCHA 3ED3A 1T4YA 1BG5A 2B1LA 3ZFBA 4KDYA 1A2MA 4KGIA 4DSQA 3J7Yb 3QMXA 1A2LA 3HVVA 1XVQA 1QUWA 3TDGA 1Y25A 4RI7A 4RI6A 4F2IA 4HI7A 6GSTA 2C3QA 2MMOA 1TK5B 1FB0A 4PUAA 4GTUA 2C80A 1U87A 3GH6A 2LJAA 1XW6A 1ABAA 3FRCA 4EE0A 2YOIA 2KHPA 5D73A 1OC9A 3TJGA 2JACA 4QMKA 1K3OA 2VD0A 3FHKA 1ZOFA 4MA9A 6GSYA 5CYYA 1AUCA 2I3YA 3IOSA 1DE2A 2CVBA 1GTAA 4V2LA 1GSEA 2GGTA 4KAEA 5G31A 3ZIJA 3L0HA 2BTOT 1AW9A 2X8GA 3VFIA 4PNGA 2YWMA 1JZRA 12GSA 4ZB6A 3LGCA 4GXZA 1M99A 3S9FA 1FAAA 4WKWA 4NPBA 5HR1A 4MMMA 3A3TA 4KH7A 1JZWA 1TRVA 1AAZA 3F3RA 1SJ6A 4H86A 3UVTA 1ZMAA 2P5QA 1O7UA 5A5HA 5A34B 2GVPA 2GT6A 5DALB 4IELA 1BEDA 2FNOA 1TI1A 4TVEA 2DJKA 2WS2A 3VWUA 1SJIA 1GNEA 2E2MA 4IQAA 5J41A 1EP8A 2H76A 2AB6A 2DMLA 4HJ2A 5KN2A 1ZYNA 4LL1B 4QQ7A 1VGLA 1TRUA 3F4RA 1TTZA 2JZTA 2AV4A 4GSNA 2CAQA 3TRPA 2WB9A 2QC7A 3APSA 1Y6EA 4ISDA 2YWNA 1XCCA 2H1LA 2X99A 5ECMB 1ERUA 2CX4A 1S3DA 4WETA 3H93A 1RK4A 5D9WA 1KNGA 5GAPD 4FYUA 1F6MC 4V1Ap 1URMA 3IR4A 4JR6A 2L59A 3JCML 5G2ZA 2VCXA 5ECHB 5JCUA 2RUFA 1B4QA 1FB6A 2HT9A 3GTUA 3UL3A 5DAKA 2OACA 2YZUA 2R0PA 1Q98A 1HD2A 2VCTA 4K5RA 4MJBA 3HYPA 3IC4A 5HR2A 3LW9A 3HJOA 3RHCA 5F07A 4KB3A 2CV4A 3QDNA 4QL9A 5F06A 4JE1A 19GSA 2XHFA 3TB2A 2AYTA 2O87A 3C8EA 2BMXA 3PH9A 1WP0A 4POMA 4MF6A 5F8BA 5C04A 3HZ8A 4IN0A 1GSQA 4N10A 2PBJA 4GDFA 4K6XA 2XC2A 5G5FA 4MK3A 4ECBA 1TJDA 2VCQA 4DSRA 2F8AA 3P7XA 2PN8A 3VPQA 2WRTA 1SYRA 5DVBA 1HNBA 2HSNB 3R2QA 1JLVA 4ZIJA 2C0GA 3EU3A 1THXA 2GSQA 2YWOA 1H75A 3BJ5A 4OO4A 1E2YA 3W8SA 2C0EA 3Q19A 2EFEA 4MH2A 2O8VB 1K0CA 3GRXA 3VLNA 2REMA 3IRAA 3FEUA 5IO2A 4ZBDA 2KOKA 5IMZA 4HU7A 1J08A 4TR0A 2VO4A 2X49A 1NHYA 2DJ1A 5GSSA 5IM9A 3TOUA 4JEDA 5ECOB 3GKNA 1TU8A 3FR9A 4HZ4A 1SK2A 4HDEA 1KBNA 4I2UA 1GH2A 1TRSA 5IO0A 3HVSA 1X5CA 2YJHA 4MPGA 4G0LA 4YAVA 5ECRB 4WF5A 1X0RA 4F0BA 4P3YB 2HRKB 3G7JA 2DMMA 2X64A 2PPTA 1X9SB 1M9BA 4DSSB 1MDJA 4BWSA 1YEXA 1WE0A 2O7KA 3EVIA 1THOA 3M9KA 1XOAA 2HNLA 2HZEB 4WBJA 4BVYB 2I81A 2L57A 4BVXB 4ECCA 2LJRA 2OA7A 2VLTA 4MJEA 1NW2A 2GS3A 5H5RA 1OAZA 2D2ZA 4A5PA 4I8BA 6GSVA 2V6KA 2R0CA 4Q5RA 3GL5A 3NOFA 2FLSA 1JHBA 5GSTA 2WCIA 5KN3A 3KCMA 4QL7A 1KTEA 4IGJA 3UIWA 2YNXA 2FGXA 3HCZA 1GLQA 3IE3A 4AJ8A 5D9XA 4XHMA 2GZZA 4YQUA 1W89A 3LEFA 1EEMA 3KEBA 10GSA 4NAXA 5EY6A 3PPUA 2AUVA 1Z3EA 5AN1A 5CRWA 3FY7A 2IFQB 2IMIA 4JZQA 4I2TA 4I97A 5A5KA 4IJ3A 5GZZB 2IMKA 5ECKB 1YY7A 2GSRA 4XRDA 3C7MA 1Q4JA 3KH7A 1X9WB 1PN9A 1XZOA 2HSMA 3CXGA 1GULA 3GHAA 4ZXGA 3ERGA 2E0QA 5IIZA 2FWHA 1XW9A 1K3YA 3ZMLA 3RPNA 2DJ2A 3HDCA 1PKZA 4L8EA 2YN1A 4ZBBA 4LA1A 3CMIA 2HLSA 1GSFA 4HOJA 3F0IA 4FYBA 1YZXA 2LRCA 3D4MA 4ACSA 2ZUPA 3IXRA 4NHZA 2V41A 3CTFA 1OYJA 1LU4A 1ERVA 1XXUA 3HZ4A 3UVHA 3GMFA 1QFNA 4LMVA 3KIJA 5INYA 2H8LA 3ZITA 4MF7A 1XWAA 1XBSA 3O76A 1TOFA 4JRRA 5EVOA 2OJLA 4J56E 1V58A 2RLIA 4ECJA 4CDOA 2LSTA 3TOTA 1TDIA 5J47A 3GSSA 4AKGA 4FH8A 3NIVA 2OADA 4AI6A 2DBCA 4E8HA 2Z9SA 1OKTA 2GT5A 1EEJA 1JFUA 3C73A 2GLRA 5IPGA 5ID2B 4K2DA 3N5OA 2H6XA 2ZCTA 4AKXB 1DBYA 1M2BA 4NWYA 1AQWA 5EPFA 4EDYA 5CRDA 5HFGA 2WDUA 3KMOA 1AC1A 4K7NA 3UAPA 5G1LA 5ECIB 5A4VA 2DC5A 3E0UA 5ABRA 2J23A 3GN3A 5DALA 4PQ1A 3LWAA 5HR0A 4O5RA 3G7YA 2H6ZA 4D73B 3SWLA 1A0FA 4KDUA 22GSA 3KTBA 3I43A 3GNJA 5DQSA 2LRNA 1N2AA 2H74A 5G30A 1AQVA 3DIEA 2C3TA 4GWRA 4HEA2 2WZ9A 1G6YA 4BL7A 3C71A 4ZL9A 4G19A 1S3AA 2H71A 1X5DA 2IMDA 3GURA 4PNFA 3BD2A 5G1KA 1C72A 2H1AA 4K0NA 3TCOA 5J3RA 3DWVA 2H1DA 2H0GA 3LSZA 3APQA 3BCIA 2QKEA 1ZCPA 3F3QA 4Q5FA 5IMDA 3RPPA 3GUSA 2MBSA 4O32A 5G5EA 1A2JA 3D0ZA 5B8BA 5BRTA 1G7OA 2IJYA 3ME8A 3P2AA 1SVMA 2WJUA 4TW5A 4N0VA 11GSA 3CBUA 4KUNA 3LJRA 1K0DA 2DSAA 1T00A 4TXOA 1YEPA 2M80A 3F6DA 2VLVA 2MBTA 4EVMA 1FW1A 3FZAA 5DJLA 1XOBA 1IYIA 1X9MB 1V2AA 4CY8A 3GKXA 1SKWB 1YKCA 2VCVA 1OC8A 1TRWA 4NHWA 5JWRB 2GZPA 3QOUA 4F0CA 3A2WA 2DIZA 2FUG2 2RM5A 3OR5A 3MSZA 3TUEA 3GKKA 1OVNA 3DXBA 4EL1A 1LJRA 2H73A 4KCEA 3KM6A 5J4VA 4HJMA 2A2PA 2GSTA 3CSJA 1M2AA 4GSTA 4G01A 3DVXA 4OCEA 3EINA 2HSHA 1F37A 4OFNA 4WR4A 2HE3A 4CY6A 1ZGNA 3M1GA 1EZKA 1MTCA 2N5BA 5JWOB 2G0FA 6GSXA 3DGQA 2R4VA 4CW9A 3IDVA 5D96A 2LRTA 1O73A 3HJMA 3EU4A 1SD8A 2KP1A 3P90A 3IC8A 3ME7A 1EV4A 2YWIA 1UA5A 3WYWA 1PL1A 1SK1A 2TRXA 3M0FA 1PN0A 4PXOA 1I5GA 5BMUB 5DJMA 2K8VA 3CSHA 2P0GA 4Q5QA 3F63A 3L78A 2DJJA 4K5SA 4EIQA 3ZREA 1G6WA 4BWQA 3IHQA 5A1NB 4IP6A 2I9HA 2DLXA 2WFCA 1U6TA 1DE1A 1TP9A 1O85A 4PTSA 1ZZYA 2MMZA 4DSSA 3KH9A 4PUFC 5DCGA 3TJJA 5FT3A 3GIXA 4MH3A 3US3A 1TW9A 1TXXA 4IHUA 4AF2A 1BYEA 4Z2RA 1SJZA 5JWQB 2I1UA 2HXKA 2HZEA 1K0BA 1PD21 2PERA 4RQXA 2CZ3A 1BF5A 2X8HA 2VAFA 3G9BA 4KF9A 4ZB9A 1F3AA 1SU9A 2HSYA 2H6YA 3ZRDA 1QGVA 3IAM2 1IYHA 4RUVA 4O5UA 3A5IA 4ID0A 1QQ2A 5IMVA 2R2JA 4DEJA 1FG4A 2X8CA 2PWJA 2LQQA 2O89A 4OD7A 5ECSA 3FZ4A 1O81A 5FWGA 5A5HB 2XPEA 2YP6A 4K7IA 2IMEA 2K18A 2VL3A 3LYPA 2A4HA 1JLWA 1R26A 2JL4A 13GSA 1MDIA 2EFCA 4EO3A 1PQNA 1SL2B 3FR6A 5HQPA 3WD6A 2FHEA 1UC7A 3CSIA 1USBA 5A4UA 3GA4A 5A4WA 2ZNMA 2CQ9A 2FD3A 4YAPA 4ML6A 1TI3A 1V98A 3FKFA 2EIQA 6GSSA 2FY6A 5LNKe 2UV8G 3KJYA 2FCHA 2HQTA 1V40A 3PGTA 4MNNA 1B9YC 1WJKA 3D5JA 2H19A 2IMFA 2H66A 3GX8A 3AY8A 3FK8A 2QA2A 2KP2A 5HFKA 3GTUB 2J9HA 5DAKB 2DKIA 2LV3A 1PRXA 3MYDA 4N30A 4JR4A 3LG6A 3I6AA 2VL2A 5CREA 4I5QA 3TKSE 1GTBA 1A8YA 4X4JA 4KDXA 1R5AA 1J0FA 5J40A 1XWBA 3ZVJD 1XFLA 4LLRA 1WRYA 1GWCA 4F9ZA 3D4TA 1RW1A 5CRGA 4OMVA 3KXOA 1GL8A 3FW2A 1G0TA 3TKPA 3GKMA 4OFMA 1WMJA 2RUEA 2JU5A 1T4ZA 1O6JA 1EOHA 1W4VA 3QCPA 1WIKA 1BAYA 2L5LA 2CZ2A 5DBQA 3RBTA 4TRXA 4KX4A 1PA3A 3U5RE 3LYKA 4POKA 1F2EA 2H01A 2IWTA 2OE3A 4MF5A 2TIRA 2ON7A 1YF1A 3D21A 1K0NA 1U3IA 2FWEA 5D93A 2A4VA 3IK9A 5ELAA 2C4JA 2OT3A 5IMFA 2PGTA 1VF2A 2EFDA 2VD1A 4X43A 2WGRA 2MMNA 2H30A 3A5WA 4K9ZA 1NHOA 4K1FA 1X5EA 4LL4B 4AJ7A 1UN2A 2GQMA 3QD9A 2AJQB 5J5NA 1BQ7A 3APOA 4FIWA 2IPAA 3FR3A 4ZBAA 4G2EA 2O85A 1N25A 4TXVA 2K8SA 2B3SA 2V2GA 2L6CA 2VKZG 5HFIA 3ZMKA 1MDKA 4IS0A 1BJXA 1HQOA 1ZYPA 5B6MA 1PL2A 3LFLA 4ML1A 5J9BA 1PKWA 4J57E 2VM2A 3GYKA 4HUAA 3KMNA 2H0HA 5AIVA 4Z2UA 2DIYA 1GP1A 5ECPB 2P5RA 3D6IA 4V2MA 4G0KA 5IOWA 1NSWA 1XWCA 3P8WA 3HA9A 3A2XA 2QSIA 2B5EA 2YCDA 4HS1A 3ZLPA 2VL9A 4BPYA 1K0OA 5D8IA 4XS4B 2M72A 5J4YA 3KZQA 3ZFLA 2VIMA 3WGEA 2CVKA 5B6NA 3L9SA 1MEKA 1ZYEA 4AKIA 2O5VA 2B7KA 3UJ1A 4IBPA 3L9VA 1B48A 2C0FA 1U3AA 2LNSA 4TR1B 3BCKA 2C8UA 1EV9A 2A2SA 1XW5A 3LQ7A 1SVOA 1I9DA 2QA1A 3HY2A 2CAIA 2VL2C 4ECIA 4Z7XA 3BBYA 2JSYA 4GQCA 1T7PB 3H79A 3J7Yk 4YQMA 2GTUA 3TJBA 3TKQA 3HD5A 1WOUA 2DKHA 2VOCA 3IV4A 5J9CA 5A34A 2OKAA 5DDLA 2HZFA 3QFBC 4POBA 1GSSA 1KEBA 3HVXA 4EUYA 2HI7A 5ELGA 5E4WA 3RHBA 3FZ9A 1VF4A 2RM6A 1SYXA 1TU7A 4K2XA 2H0IA 2HSMB 1ZYQB 1OE7A 2R6KA 1GUMA 3TKSA 4EIPA 1SL0B 3TRXA 4TN8A 1ERTA 2F51A 9GSSA 2L4CA 3HHVA 3BOAA 3NZNA 3O6TA 1QMVA 2KUCA 3EMPA 4KSMA 4V1Ag 5CP1A 3HMJG 1MD4A 2EIRA 4KSOA 3UBKA 2LUSA 1TXUA 5CRHA 1O8XA 3FZ5A 1YJ6A 4F82A 2HRNA 4L5LA 4ZB8A 3M9JA 4AJ6A 1UVZA 3H1NA 1M0UA 2C1YA 1YQ1A 5BMUA 3RDWA 5D9VA 5GAND 1HNAA 1PMTA 14GSA 2R0GA 3KD0A 3QPMA 1R4WA 2LS5A 2K6VA 1V9WA 1T8EB 2MZCA 4PX1A 4K0GA 4N3ZA 5A1NA 2FA4A 3UBLA 5F05A 2JZRA 1XIYA 3ZYWA 4MDCA 3DRNA 1EGRA 1GSDA 3KP8A 2VLUA 4WEYA 3CRUA 4POLA 3HJPA 4PGTA 2X4AA 5ECLB 2H1GA 5KOWA 4EC0A 7GSSA 1T1VA 4K8MA 2CX3A 4OO5A 4OWYA 4GF0A 3VPTA 2GSSA 3TU3B 3IAS2 3E9JB 1ML6A 3F6FA 2XBIA 3H8QA 2MMAA 1PGTA 1N8JA 4AGSA 1ST9A 4XS6A 8GSSA 4ZL8A 3UOMA 5AGYA 1K0AA 4IP1A 5EL8A 3UMAA 3ERWA 1TKDB 1Y1UA 2L6DA 1EOGA 2HSNA 4EDZA 3F4TA 4HU9A 3WGDA 4USSA 1GTIA 1B8XA 1XWGA 1J9BA 3VWXA 1FVKA 3MNGA 4WR5A 2M46A 1FO5A 3HKRA 4OFTA 2NPBA 4TKYA 2H72A 3PR8A 1Z6MA 4XTSA 1GUHA 3F4SA 3D22A 1CQGA 2QGVA 3GV1A 4FYCA 1Z9HA 17GSA 3MAKA 1PSQA 1PX6A 3O3TA 3L4NA 3EPTA 4MP4A 2ON5A 2EIOA 2HRFA 4YKGA 3KP9A 3ZZXA 4N11A 3L9UA 1BX9A 3EMXA 3N9JA 1E6BA 5LD0A 4MZBA 5HR3A 3ZVJA 4BL7B 4L5OA 1PX7A 3IPZA 2IIYA 4PURA 1V57A 5IOXA 5IMAA 1XPVA 1Z7PA 4J2FA 2KLXA 4AKHA 3KGKA 3DD3A 1OC9B 2B1KA 4KNDA 3LXTA 2TRCP 2YANA 2C0DA 4K7OA 2H75A 3MIXA 2AAWA 3A2VA 1XWKA 2NVLA 3Q74A 3TKSC 4NV5A 2F9SA 2HRKA 2F8FA 4MCUA 1WWJA 1Z6NA 1XVWA 2PU9C 2NDOA 3GX0A 5J4UA 4PQIA 1SVLA 3TGZA 2LKUA 4GCIA 4TR3A 5E59A 3QR6A 2HYXA 2OBIA 3WGXA 4TOPA 5H5QA 4EXJA 2A2RA 5KOXA 5ENUA 1SL1B 4BVYA 4XRAA 3QAVA 4BVXA 1T3BA 4HQZA 4IQ1A 3F9UA 4GRFA 4TXOB 2I4AA 4MZCA 1FVJA 5KN1A 1GRXA 2JSZA 1QK8A 3U6VA 2G2QA 2EFHA 1CQHA 2PVQA 4HZ2A 2K9FA 2ALBA 1Z5YE 1A24A 3IK7A 3EYTA 2ES7A 1ACVA 4MLYA 4JU5A 3EE2A 1MD3A 1DSBA 4OCFA 2IL3A 2F3MA 2IFQA 5L71A 2N5AA 4MJCA 2IN3A 2PVOC 3F8UA 3DEXA 5JCWA 1R7HA 2YV7A 3E3EA 2OE0A 4I6XA 4JBBA 1Z7RA 5B8AA 3CWGA 5F0GA 2OE1A 2RIIA 2VM1A 4XCSA 3DMLA 3DKSA 3FMWA 5AISA 1DUGA 2B6MA 2XBQA 3TJFA 2R5GA 1ON4A 1SKRB 3KTLA 4FQUA 2H70A 4L0WA 2E2GA 4O5QA 4RQRA 1VF1A 4WBRD 3VWVA 4MPFA 1YDKA 2VUPA 4GLTA 3MWHA 1M7TA 2JZSA 1B4PA 5DQYA 3FYGA 1A23A 2NTOA 4G10A 1NM3A 2B7JA 2DJ0A 3IBHA 4CHSA 3UARA 1AXDA 5IPHA 1S3CA 1O8WA 4EF0A 2N5FA 1U88A 3R3EA 5ECQB 2YPMA 3DYRA 3H4KA 2WULA 4Q5NA 1RQMA 2LTKA 3ERFA 5KEJA 2BJXA 4IKHA 5IQYA 4NXIA 3QAWA 4E68A 1SK0A 2HFDA 4XS4A 2LEGA 2OBKA 2DJ3A 5B7CA 3GSTA 3W8JA 2PMTA 5ID2A 2H1BA 2YV9A 2GDRA 2GQLA 1JZOA 3VI5A 3I9V2 2YZHA 2YJ7A 1TK8B 2R37A 4TR1A 2UZ8A 1EP7A 1SKSB 4WXTA 1GUKA 1H4OA 5H5SA 2CA8A 4EKZA 4O7HA 4KCAA 5AIXA 5CNWA 4NV2A 4W66A 4X0XA 4GQFA 4GSSA 3PINA 5JCGA 1ILOA 1FHEA 1ZL9A 1QXHA 2V32A 2JADA 1OE8A 2FWGA 3CRTA 5D9TA 4XS1A 2LJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GST A;  5ELG A;  2VCZ A;  1K0C A;  4YH2 A;  1VF4 A;  3EIN A;  1TU7 A;  3VLN A;  3LXZ A;  1GLP A;  2HSM B;  4OFN A;  4WR4 A;  1OE7 A;  2R6K A;  4ZBD A;  1GUM A;  1ZGN A;  3M1G A;  1MTC A;  18GS A;  4IVF A;  2VO4 A;  1NHY A;  6GSX A;  3DGQ A;  5ECN B;  2R4V A;  5GSS A;  9GSS A;  3TOU A;  4JED A;  4E8E A;  6GSW A;  3HJM A;  5ECO B;  4KSM A;  4YQV A;  3P90 A;  1MD4 A;  1TU8 A;  3IC8 A;  1EV4 A;  3UBK A;  3FR9 A;  1UA5 A;  3WYW A;  1PL1 A;  4LMW A;  1GSU A;  4HZ4 A;  3M0F A;  1KBN A;  4PXO A;  4IJI A;  5FHI A;  1YJ6 A;  5DJM A;  3CSH A;  4L5L A;  1GSY A;  4MPG A;  4ZB8 A;  4Q5Q A;  3F63 A;  4G0L A;  3H1N A;  4YAV A;  1M0U A;  5ECR B;  3VUR A;  1YQ1 A;  5BMU A;  4F0B A;  2R3X A;  2AHE A;  2HRK B;  3G7J A;  5D9V A;  1K3L A;  2X64 A;  1HNA A;  1PMT A;  1G6W A;  14GS A;  1M9B A;  3MDK A;  1LBK A;  4O92 A;  4PX1 A;  6GSU A;  4K0G A;  3Q18 A;  4PQH A;  4PTS A;  3UBL A;  5F05 A;  5LCZ A;  5DCG A;  1M9A A;  2HNL A;  4MDC A;  5FT3 A;  4BVY B;  1GSD A;  1TW9 A;  20GS A;  3CRU A;  4BVX B;  1GTU A;  4ECC A;  2LJR A;  4PGT A;  2OA7 A;  1BYE A;  2HRA A;  1F3B A;  5ECL B;  1K0B A;  1PD2 1;  2PER A;  4EC0 A;  7GSS A;  2CZ3 A;  3M8N A;  3VI7 A;  2D2Z A;  4KF9 A;  4ZB9 A;  1F3A A;  6GSV A;  4MZW A;  4GF0 A;  3VPT A;  2GSS A;  2V6K A;  3M3M A;  4Q5R A;  3I69 A;  1ML6 A;  3F6F A;  5GST A;  4KE3 A;  3VK9 A;  1IYH A;  2C3N A;  4IGJ A;  4ID0 A;  1PGT A;  4IW9 A;  4AGS A;  1GLQ A;  2VCW A;  3IE3 A;  8GSS A;  4DEJ A;  5AGY A;  5D9X A;  1K0A A;  4YQU A;  5EL8 A;  1EEM A;  4G0I A;  5ECS A;  1GNW A;  5FWG A;  10GS A;  4NAX A;  1EOG A;  3PPU A;  5EY6 A;  4EDZ A;  4USS A;  1GTI A;  5AN1 A;  1B8X A;  1XWG A;  3FY7 A;  3VWX A;  2IMI A;  4JZQ A;  4I97 A;  5A5K A;  3LYP A;  1JLW A;  5GZZ B;  2IMK A;  2JL4 A;  13GS A;  4WR5 A;  5ECK B;  1HNC A;  1AQX A;  3HKR A;  1YY7 A;  1VF3 A;  2GSR A;  4OFT A;  3ISO A;  3PR8 A;  1K0M A;  4F03 A;  3FR6 A;  3QAG A;  4G9H A;  3WD6 A;  1GUH A;  2FHE A;  1Q4J A;  1PN9 A;  2HSM A;  1GUL A;  3CSI A;  4ZXG A;  1Z9H A;  17GS A;  1USB A;  5A4U A;  3ERG A;  3G7I A;  5A4W A;  3MAK A;  16GS A;  4YAP A;  1PX6 A;  3O3T A;  2CVD A;  4MP4 A;  1K3Y A;  3ZML A;  2ON5 A;  1BG5 A;  3ZFB A;  1PKZ A;  4KDY A;  4L8E A;  1BX9 A;  4ZBB A;  6GSS A;  1E6B A;  3N9J A;  5LD0 A;  4KGI A;  3KJY A;  1GSF A;  4HOJ A;  4BL7 B;  4L5O A;  1PX7 A;  4PUR A;  2HQT A;  4RI7 A;  1V40 A;  4RI6 A;  3PGT A;  4ACS A;  4HI7 A;  6GST A;  2C3Q A;  4J2F A;  4NHZ A;  1OYJ A;  4PUA A;  4GTU A;  3AY8 A;  3DD3 A;  2C80 A;  1U87 A;  3GH6 A;  3UVH A;  1XW6 A;  3LXT A;  3FRC A;  4EE0 A;  4LMV A;  5HFK A;  3GTU B;  2AAW A;  2J9H A;  5DAK B;  1XWK A;  3Q74 A;  4MF7 A;  5D73 A;  3O76 A;  3LG6 A;  2HRK A;  2F8F A;  5EVO A;  3I6A A;  1K3O A;  2VD0 A;  3GX0 A;  5J4U A;  4PQI A;  1GTB A;  6GSY A;  4ECJ A;  3TGZ A;  4KDX A;  1R5A A;  4GCI A;  3TOT A;  1TDI A;  3GSS A;  1GTA A;  3NIV A;  2OAD A;  1GWC A;  1GSE A;  3QR6 A;  4KAE A;  4OMV A;  3L0H A;  1AW9 A;  3KXO A;  4E8H A;  4PNG A;  4TOP A;  4EXJ A;  1OKT A;  2A2R A;  4BVY A;  1JZR A;  2GLR A;  12GS A;  3QAV A;  4OFM A;  4ZB6 A;  4BVX A;  4IQ1 A;  1M99 A;  1EOH A;  3N5O A;  1BAY A;  2CZ2 A;  3RBT A;  4KX4 A;  1PA3 A;  3LYK A;  3U6V A;  4KH7 A;  1F2E A;  2PVQ A;  1AQW A;  4MF5 A;  4EDY A;  2ON7 A;  3IK7 A;  3EE2 A;  1K0N A;  1MD3 A;  1U3I A;  2WDU A;  3KMO A;  5DAL B;  2IL3 A;  3IK9 A;  4IEL A;  5ELA A;  2FNO A;  3UAP A;  2F3M A;  2C4J A;  5ECI B;  5A4V A;  2PGT A;  2DC5 A;  2WS2 A;  1VF2 A;  2VD1 A;  1GNE A;  5DAL A;  4IQA A;  5J41 A;  2AB6 A;  3SWL A;  4HJ2 A;  1A0F A;  4KDU A;  5JCW A;  2YV7 A;  4QQ7 A;  22GS A;  4JBB A;  5F0G A;  5J5N A;  4GSN A;  5DQS A;  2CAQ A;  5AIS A;  1DUG A;  3FR3 A;  1N2A A;  2WB9 A;  4ZBA A;  1Y6E A;  2R5G A;  4ISD A;  1AQV A;  5ECM B;  2C3T A;  3ZMK A;  3KTL A;  4FQU A;  4IS0 A;  1G6Y A;  1HQO A;  4BL7 A;  1RK4 A;  4G19 A;  1PL2 A;  5D9W A;  3LFL A;  1PKW A;  1VF1 A;  3GUR A;  4PNF A;  1C72 A;  4MPF A;  3IR4 A;  4K0N A;  1YDK A;  4GLT A;  3KMN A;  5AIV A;  2VCX A;  1B4P A;  5ECH B;  5JCU A;  3FYG A;  5ECP B;  3GTU A;  2NTO A;  4G10 A;  5DAK A;  4G0K A;  3LSZ A;  3P8W A;  2OAC A;  3IBH A;  4CHS A;  4Q5F A;  3UAR A;  1AXD A;  3GUS A;  2VCT A;  5G5E A;  2N5F A;  2YCD A;  1U88 A;  3R3E A;  5ECQ B;  3D0Z A;  3HJO A;  5F07 A;  1K0O A;  1G7O A;  4Q5N A;  5F06 A;  3ZFL A;  3ERF A;  5KEJ A;  19GS A;  4IKH A;  5IQY A;  3QAW A;  2WJU A;  3C8E A;  4N0V A;  11GS A;  5B7C A;  3CBU A;  4IBP A;  3GST A;  4MF6 A;  3LJR A;  1B48 A;  2PMT A;  5F8B A;  1K0D A;  2DSA A;  2YV9 A;  2GDR A;  2C8U A;  1GSQ A;  1EV9 A;  2A2S A;  2PBJ A;  3VI5 A;  1XW5 A;  3F6D A;  3LQ7 A;  2UZ8 A;  1FW1 A;  1GUK A;  5DJL A;  2CAI A;  2CA8 A;  4ECI A;  1IYI A;  3BBY A;  4MK3 A;  1V2A A;  5G5F A;  4ECB A;  2VCQ A;  4O7H A;  1YKC A;  2VCV A;  5AIX A;  4YQM A;  2GTU A;  3VPQ A;  2WRT A;  4NHW A;  4F0C A;  1HNB A;  2HSN B;  3R2Q A;  1JLV A;  4GSS A;  1LJR A;  2GSQ A;  1FHE A;  1ZL9 A;  3KM6 A;  5D9T A;  1OE8 A;  5DDL A;  3W8S A;  3CRT A;  2GST A;  3CSJ A;  4HZ2 A;  1GSS A;  3Q19 A; 
#chains in the Genus database with same CATH topology
 4V2N A;  1F9M A;  2VCZ A;  3ZIV A;  4YH2 A;  2MYG A;  4KA0 A;  2O3E A;  3LXZ A;  1GLP A;  4DVC A;  4D73 A;  2WVX A;  1SEN A;  2GZY A;  4FO5 A;  2L5O A;  3Q6O A;  5KN0 A;  18GS A;  4IVF A;  1AIU A;  5C00 A;  4NMU A;  4WF4 A;  4HQS A;  5ECN B;  2B5Y A;  1FOH A;  3C1R A;  2V1M A;  4E8E A;  6GSW A;  3C1S A;  3GH9 A;  1VRS D;  3TKR A;  2V6O A;  4YQV A;  3EUR A;  3GL3 A;  2GQK A;  4MJA A;  2LQO A;  4LMW A;  1GSU A;  3EC3 A;  4IJI A;  2XPD A;  4X1U A;  4PHZ C;  4ZIL A;  5FHI A;  3WT2 A;  1GSY A;  1EWX A;  1M2D A;  3GFK A;  3LOR A;  1HYU A;  4MAB A;  4ILF A;  3VUR A;  2E7P A;  3UEM A;  2LNT A;  2R3X A;  2AHE A;  1G7E A;  1K3L A;  2FA8 A;  3EWL A;  3MDK A;  1LBK A;  3IHG A;  1A8L A;  4O92 A;  2B5X A;  2NBS A;  6GSU A;  3Q18 A;  5IMC A;  1YVL A;  4L0U A;  5CO3 A;  3ZTL A;  4PQH A;  3VWW A;  1TK0 B;  5LCZ A;  3DVW A;  3IA1 A;  1M9A A;  2L4Q A;  20GS A;  1GTU A;  4XIH A;  2HRA A;  5COH A;  1OC3 A;  2EC4 A;  1F3B A;  1B9X C;  4TR4 A;  3M8N A;  3VI7 A;  1R5P A;  4MZW A;  1YKA A;  3M3M A;  3QFA C;  3I69 A;  1WPI A;  4KE3 A;  3VK9 A;  2P31 A;  1JZD A;  2C3N A;  2CT6 A;  4IW9 A;  3W6G A;  3WT1 A;  2VCW A;  1ERW A;  4ZB7 A;  3SBC A;  3ZL5 A;  1A0R P;  1BG1 A;  3K8N A;  4G0I A;  1GNW A;  3CYN A;  2PUK C;  1FOV A;  4YKF A;  1XG8 A;  3RAZ A;  1HNC A;  1AQX A;  1EGO A;  1VF3 A;  3ISO A;  4N0Z A;  3V1W A;  1K0M A;  4F03 A;  1M3I A;  4BA7 A;  4ULX A;  3QAG A;  4G9H A;  4KW6 A;  1SD9 A;  4ICY A;  3CTG A;  1YF0 A;  4Z2T A;  2FWF A;  3TRQ A;  4ZL7 A;  5CAX A;  3G7I A;  3HXS A;  16GS A;  1OKD A;  2CVD A;  3TJK A;  5DCH A;  3ED3 A;  1T4Y A;  1BG5 A;  2B1L A;  3ZFB A;  4KDY A;  1A2M A;  4KGI A;  4DSQ A;  3J7Y b;  3QMX A;  1A2L A;  3HVV A;  1XVQ A;  1QUW A;  3TDG A;  1Y25 A;  4RI7 A;  4RI6 A;  4F2I A;  4HI7 A;  6GST A;  2C3Q A;  2MMO A;  1TK5 B;  1FB0 A;  4PUA A;  4GTU A;  2C80 A;  1U87 A;  3GH6 A;  2LJA A;  1XW6 A;  1ABA A;  3FRC A;  4EE0 A;  2YOI A;  2KHP A;  4PI0 C;  5D73 A;  1OC9 A;  3TJG A;  2JAC A;  4QMK A;  1K3O A;  2VD0 A;  3FHK A;  1ZOF A;  4MA9 A;  6GSY A;  5CYY A;  1AUC A;  2I3Y A;  3IOS A;  1DE2 A;  2CVB A;  1GTA A;  4V2L A;  1GSE A;  2GGT A;  4KAE A;  5G31 A;  3ZIJ A;  3L0H A;  2BTO T;  1AW9 A;  2X8G A;  3VFI A;  4PNG A;  2YWM A;  1JZR A;  12GS A;  4ZB6 A;  3LGC A;  4GXZ A;  1M99 A;  3S9F A;  1FAA A;  4WKW A;  4NPB A;  5HR1 A;  4MMM A;  3A3T A;  4KH7 A;  1JZW A;  1TRV A;  2O36 A;  1AAZ A;  3F3R A;  1SJ6 A;  4H86 A;  3UVT A;  1ZMA A;  2P5Q A;  1O7U A;  5A5H A;  5A34 B;  2GVP A;  2GT6 A;  5DAL B;  4IEL A;  1BED A;  2FNO A;  1TI1 A;  4TVE A;  2DJK A;  2WS2 A;  3VWU A;  1SJI A;  1GNE A;  2E2M A;  4IQA A;  5J41 A;  1EP8 A;  2H76 A;  2AB6 A;  2DML A;  4HJ2 A;  5KN2 A;  1ZYN A;  4LL1 B;  4QQ7 A;  1VGL A;  1TRU A;  3F4R A;  1TTZ A;  2JZT A;  2AV4 A;  1I1I P;  4GSN A;  2CAQ A;  3TRP A;  2WB9 A;  2QC7 A;  3APS A;  1Y6E A;  4ISD A;  2YWN A;  1XCC A;  2H1L A;  2X99 A;  5ECM B;  1ERU A;  2CX4 A;  1S3D A;  4WET A;  3H93 A;  1RK4 A;  5D9W A;  1KNG A;  5GAP D;  4FYU A;  2WVY A;  1F6M C;  4V1A p;  1URM A;  3IR4 A;  4JR6 A;  2L59 A;  3JCM L;  5G2Z A;  2VCX A;  5ECH B;  5JCU A;  2RUF A;  1B4Q A;  1FB6 A;  2HT9 A;  3GTU A;  3UL3 A;  5DAK A;  2OAC A;  2YZU A;  2R0P A;  1Q98 A;  1HD2 A;  2VCT A;  4K5R A;  4MJB A;  3HYP A;  3IC4 A;  5HR2 A;  3LW9 A;  3HJO A;  3RHC A;  5F07 A;  4KB3 A;  2CV4 A;  3QDN A;  4QL9 A;  5F06 A;  4JE1 A;  19GS A;  2XHF A;  3TB2 A;  2AYT A;  2O87 A;  3C8E A;  2BMX A;  3PH9 A;  1WP0 A;  4POM A;  4MF6 A;  5F8B A;  5C04 A;  3HZ8 A;  4IN0 A;  1GSQ A;  4N10 A;  2PBJ A;  4GDF A;  4K6X A;  2XC2 A;  5G5F A;  4MK3 A;  4ECB A;  1TJD A;  2VCQ A;  4DSR A;  2F8A A;  3P7X A;  2PN8 A;  3VPQ A;  2WRT A;  1SYR A;  5DVB A;  1HNB A;  2HSN B;  3R2Q A;  1JLV A;  4ZIJ A;  2C0G A;  3EU3 A;  1THX A;  2GSQ A;  2YWO A;  1H75 A;  3BJ5 A;  4OO4 A;  1E2Y A;  3W8S A;  2C0E A;  3Q19 A;  2EFE A;  4MH2 A;  2O8V B;  1K0C A;  3GRX A;  3VLN A;  2REM A;  3IRA A;  3FEU A;  5IO2 A;  4ZBD A;  2KOK A;  5IMZ A;  4HU7 A;  1J08 A;  4TR0 A;  2VO4 A;  2X49 A;  1NHY A;  2DJ1 A;  5GSS A;  5IM9 A;  3TOU A;  4JED A;  5ECO B;  3GKN A;  1TU8 A;  3FR9 A;  4HZ4 A;  1SK2 A;  4HDE A;  1KBN A;  4I2U A;  1GH2 A;  1TRS A;  5IO0 A;  3HVS A;  1X5C A;  2YJH A;  4MPG A;  4G0L A;  4YAV A;  5ECR B;  4WF5 A;  1X0R A;  4F0B A;  4P3Y B;  2HRK B;  3G7J A;  2DMM A;  2X64 A;  2PPT A;  1X9S B;  1M9B A;  1S3R A;  4DSS B;  1MDJ A;  4BWS A;  1YEX A;  1WE0 A;  2O7K A;  3EVI A;  1THO A;  3M9K A;  1XOA A;  2HNL A;  2HZE B;  4WBJ A;  4BVY B;  2I81 A;  2L57 A;  4BVX B;  4ECC A;  2LJR A;  2OA7 A;  2VLT A;  3CHX C;  4MJE A;  1NW2 A;  2GS3 A;  5H5R A;  1OAZ A;  2D2Z A;  4A5P A;  4I8B A;  6GSV A;  2V6K A;  2R0C A;  4Q5R A;  3GL5 A;  3NOF A;  2FLS A;  1JHB A;  5GST A;  2WW2 A;  2WCI A;  5KN3 A;  3KCM A;  4QL7 A;  1KTE A;  4IGJ A;  3UIW A;  2YNX A;  2FGX A;  3HCZ A;  1GLQ A;  3IE3 A;  4AJ8 A;  5D9X A;  4XHM A;  2GZZ A;  4YQU A;  1W89 A;  3LEF A;  1EEM A;  3KEB A;  10GS A;  4NAX A;  5EY6 A;  3PPU A;  2AUV A;  1Z3E A;  5AN1 A;  5CRW A;  3FY7 A;  2IFQ B;  2IMI A;  4JZQ A;  4I2T A;  4I97 A;  5A5K A;  4IJ3 A;  5GZZ B;  2IMK A;  5ECK B;  1YY7 A;  2GSR A;  4XRD A;  3C7M A;  1Q4J A;  3KH7 A;  1X9W B;  1PN9 A;  1XZO A;  2HSM A;  3CXG A;  1GUL A;  3GHA A;  4ZXG A;  3ERG A;  2E0Q A;  5IIZ A;  2FWH A;  1XW9 A;  1K3Y A;  3ZML A;  3RPN A;  2DJ2 A;  3HDC A;  1PKZ A;  4L8E A;  2YN1 A;  4ZBB A;  4LA1 A;  3CMI A;  2HLS A;  1GSF A;  4HOJ A;  3F0I A;  4FYB A;  1YZX A;  2LRC A;  3D4M A;  4ACS A;  2ZUP A;  3IXR A;  4NHZ A;  2V41 A;  3CTF A;  1OYJ A;  1LU4 A;  1ERV A;  1XXU A;  3HZ4 A;  3UVH A;  3GMF A;  1QFN A;  4LMV A;  3KIJ A;  5INY A;  2H8L A;  3ZIT A;  4MF7 A;  1XWA A;  1XBS A;  3O76 A;  1TOF A;  4JRR A;  5EVO A;  2OJL A;  4J56 E;  1YEW C;  1V58 A;  2RLI A;  4ECJ A;  4CDO A;  2LST A;  3TOT A;  1TDI A;  5J47 A;  3GSS A;  4AKG A;  4FH8 A;  3NIV A;  2OAD A;  4AI6 A;  2DBC A;  4E8H A;  2Z9S A;  1OKT A;  2GT5 A;  1EEJ A;  1JFU A;  3C73 A;  2GLR A;  5IPG A;  5ID2 B;  4K2D A;  3N5O A;  2H6X A;  2ZCT A;  4AKX B;  1DBY A;  1M2B A;  4NWY A;  1AQW A;  5EPF A;  4EDY A;  5CRD A;  5HFG A;  2WDU A;  3KMO A;  1AC1 A;  4K7N A;  3UAP A;  5G1L A;  5ECI B;  5A4V A;  2DC5 A;  3E0U A;  5ABR A;  2J23 A;  3GN3 A;  5DAL A;  4PQ1 A;  3LWA A;  5HR0 A;  4O5R A;  3G7Y A;  2H6Z A;  4D73 B;  3SWL A;  1A0F A;  2WVX B;  4KDU A;  22GS A;  3KTB A;  3I43 A;  3GNJ A;  5DQS A;  2LRN A;  1N2A A;  2H74 A;  5G30 A;  1AQV A;  3DIE A;  2C3T A;  4GWR A;  4HEA 2;  2WZ9 A;  1G6Y A;  4BL7 A;  3C71 A;  4ZL9 A;  4G19 A;  1S3A A;  2H71 A;  1X5D A;  2IMD A;  3GUR A;  4PNF A;  3BD2 A;  5G1K A;  1C72 A;  2H1A A;  4K0N A;  3TCO A;  5J3R A;  3DWV A;  2H1D A;  2H0G A;  3LSZ A;  3APQ A;  3BCI A;  2QKE A;  1ZCP A;  3F3Q A;  4Q5F A;  5IMD A;  3RPP A;  3GUS A;  2MBS A;  4O32 A;  5G5E A;  1A2J A;  3D0Z A;  5B8B A;  5BRT A;  2WW0 A;  1G7O A;  2IJY A;  3ME8 A;  3P2A A;  1SVM A;  2WJU A;  4TW5 A;  4N0V A;  11GS A;  3CBU A;  4KUN A;  3LJR A;  1K0D A;  2DSA A;  1PFO A;  1T00 A;  4TXO A;  1YEP A;  2M80 A;  3F6D A;  2VLV A;  2MBT A;  4EVM A;  1FW1 A;  3FZA A;  5DJL A;  1XOB A;  1IYI A;  1X9M B;  1V2A A;  4CY8 A;  3GKX A;  1SKW B;  1YKC A;  2VCV A;  1OC8 A;  1TRW A;  4NHW A;  5JWR B;  2GZP A;  3QOU A;  4F0C A;  3A2W A;  2DIZ A;  2FUG 2;  2RM5 A;  3OR5 A;  3MSZ A;  3HVN A;  3TUE A;  3GKK A;  1OVN A;  3DXB A;  4EL1 A;  1LJR A;  2H73 A;  4KCE A;  3KM6 A;  5J4V A;  4HJM A;  2A2P A;  2GST A;  3CSJ A;  1M2A A;  4GST A;  4G01 A;  3DVX A;  4OCE A;  3EIN A;  2HSH A;  1F37 A;  4OFN A;  4WR4 A;  2HE3 A;  4CY6 A;  1ZGN A;  3M1G A;  1EZK A;  1MTC A;  2N5B A;  5JWO B;  2G0F A;  6GSX A;  3DGQ A;  2R4V A;  4CW9 A;  3IDV A;  5D96 A;  2LRT A;  1O73 A;  3HJM A;  3EU4 A;  1SD8 A;  2KP1 A;  3P90 A;  3IC8 A;  3ME7 A;  1EV4 A;  2YWI A;  1UA5 A;  3WYW A;  1PL1 A;  1SK1 A;  2TRX A;  3M0F A;  1PN0 A;  4PXO A;  1I5G A;  5BMU B;  5DJM A;  2K8V A;  3CSH A;  2P0G A;  4Q5Q A;  3F63 A;  3L78 A;  2DJJ A;  4K5S A;  4EIQ A;  3ZRE A;  1G6W A;  4BWQ A;  3IHQ A;  5A1N B;  4IP6 A;  2I9H A;  2DLX A;  2WFC A;  1U6T A;  1DE1 A;  1TP9 A;  1O85 A;  4PTS A;  1ZZY A;  2MMZ A;  4DSS A;  3KH9 A;  4PUF C;  5DCG A;  3TJJ A;  5FT3 A;  3GIX A;  4MH3 A;  3US3 A;  1TW9 A;  1TXX A;  4IHU A;  4AF2 A;  1BYE A;  4Z2R A;  1SJZ A;  5JWQ B;  2I1U A;  2HXK A;  2HZE A;  1K0B A;  1PD2 1;  2PER A;  4RQX A;  2CZ3 A;  1BF5 A;  2X8H A;  2VAF A;  3G9B A;  4KF9 A;  4ZB9 A;  1F3A A;  1SU9 A;  2HSY A;  2H6Y A;  3ZRD A;  1QGV A;  3IAM 2;  1IYH A;  4RUV A;  4O5U A;  3A5I A;  4ID0 A;  1QQ2 A;  5IMV A;  2R2J A;  4DEJ A;  1FG4 A;  2X8C A;  3RGB C;  2PWJ A;  2LQQ A;  2O89 A;  4OD7 A;  5ECS A;  3FZ4 A;  1O81 A;  5FWG A;  5A5H B;  2XPE A;  2YP6 A;  4K7I A;  2IME A;  2K18 A;  2VL3 A;  3LYP A;  2A4H A;  1JLW A;  1R26 A;  2JL4 A;  13GS A;  1MDI A;  2EFC A;  4EO3 A;  1PQN A;  1SL2 B;  3FR6 A;  5HQP A;  3WD6 A;  2FHE A;  1UC7 A;  3CSI A;  1USB A;  5A4U A;  3GA4 A;  5A4W A;  2ZNM A;  2CQ9 A;  2FD3 A;  4YAP A;  4ML6 A;  1TI3 A;  1V98 A;  3FKF A;  2EIQ A;  6GSS A;  2FY6 A;  5LNK e;  2UV8 G;  3KJY A;  2FCH A;  2WVZ A;  2HQT A;  1V40 A;  3PGT A;  4MNN A;  1B9Y C;  1WJK A;  3D5J A;  2H19 A;  2IMF A;  2H66 A;  3GX8 A;  3AY8 A;  3FK8 A;  2QA2 A;  2KP2 A;  5HFK A;  3GTU B;  2J9H A;  5DAK B;  2DKI A;  2LV3 A;  1PRX A;  3MYD A;  4N30 A;  4JR4 A;  3LG6 A;  3I6A A;  2VL2 A;  5CRE A;  4I5Q A;  3TKS E;  1GTB A;  1A8Y A;  4X4J A;  4KDX A;  1R5A A;  1J0F A;  5J40 A;  1XWB A;  3ZVJ D;  1XFL A;  4LLR A;  1WRY A;  1GWC A;  4F9Z A;  3D4T A;  1RW1 A;  5CRG A;  4OMV A;  3KXO A;  1GL8 A;  3FW2 A;  1G0T A;  3TKP A;  3GKM A;  4OFM A;  1WMJ A;  2RUE A;  2JU5 A;  1T4Z A;  1O6J A;  1EOH A;  1W4V A;  3QCP A;  1WIK A;  1BAY A;  2L5L A;  2CZ2 A;  5DBQ A;  3RBT A;  4TRX A;  4KX4 A;  1PA3 A;  3U5R E;  3LYK A;  4POK A;  1F2E A;  2H01 A;  2IWT A;  2OE3 A;  4MF5 A;  2TIR A;  2ON7 A;  1YF1 A;  3D21 A;  1K0N A;  1U3I A;  2FWE A;  5D93 A;  2A4V A;  3IK9 A;  5ELA A;  2C4J A;  2OT3 A;  5IMF A;  2PGT A;  1VF2 A;  2EFD A;  2VD1 A;  4X43 A;  2WGR A;  2MMN A;  2H30 A;  3A5W A;  4K9Z A;  1NHO A;  4K1F A;  1X5E A;  4LL4 B;  4AJ7 A;  1UN2 A;  2GQM A;  3QD9 A;  2AJQ B;  5J5N A;  1BQ7 A;  3APO A;  4FIW A;  2IPA A;  3FR3 A;  4ZBA A;  4G2E A;  2O85 A;  1S4B P;  1N25 A;  4TXV A;  2K8S A;  2B3S A;  2V2G A;  2L6C A;  2VKZ G;  5HFI A;  3ZMK A;  1MDK A;  4IS0 A;  1BJX A;  1HQO A;  1ZYP A;  5B6M A;  1PL2 A;  3LFL A;  4ML1 A;  5J9B A;  1PKW A;  4J57 E;  2VM2 A;  3GYK A;  4HUA A;  3KMN A;  2H0H A;  5AIV A;  4Z2U A;  2DIY A;  1GP1 A;  5ECP B;  2P5R A;  1M3J A;  3D6I A;  4V2M A;  4G0K A;  5IOW A;  1NSW A;  1XWC A;  3P8W A;  3HA9 A;  3A2X A;  3RFR C;  2QSI A;  2B5E A;  2YCD A;  4HS1 A;  3ZLP A;  2VL9 A;  4BPY A;  1K0O A;  5D8I A;  4XS4 B;  2M72 A;  5J4Y A;  3KZQ A;  3ZFL A;  2VIM A;  3WGE A;  2CVK A;  5B6N A;  3L9S A;  1MEK A;  1ZYE A;  4AKI A;  2O5V A;  2B7K A;  3UJ1 A;  4IBP A;  3L9V A;  1B48 A;  2C0F A;  1U3A A;  2LNS A;  4TR1 B;  3BCK A;  2C8U A;  1EV9 A;  2A2S A;  1XW5 A;  3LQ7 A;  1SVO A;  1I9D A;  2QA1 A;  3HY2 A;  2CAI A;  2VL2 C;  4ECI A;  4Z7X A;  3BBY A;  2JSY A;  4GQC A;  1T7P B;  3H79 A;  3J7Y k;  4YQM A;  2GTU A;  3TJB A;  3TKQ A;  3HD5 A;  1WOU A;  2DKH A;  2VOC A;  3IV4 A;  5J9C A;  5A34 A;  2OKA A;  5DDL A;  2HZF A;  3QFB C;  4POB A;  1GSS A;  1KEB A;  3HVX A;  4EUY A;  2HI7 A;  5ELG A;  5E4W A;  3RHB A;  3FZ9 A;  1VF4 A;  2RM6 A;  1SYX A;  1TU7 A;  4K2X A;  2H0I A;  2HSM B;  1ZYQ B;  1OE7 A;  2R6K A;  1GUM A;  3TKS A;  4EIP A;  1SL0 B;  3TRX A;  4TN8 A;  1ERT A;  2F51 A;  9GSS A;  2L4C A;  3HHV A;  3BOA A;  3NZN A;  3O6T A;  1QMV A;  2KUC A;  3EMP A;  4KSM A;  4V1A g;  5CP1 A;  3HMJ G;  1MD4 A;  2EIR A;  4KSO A;  3UBK A;  2LUS A;  1TXU A;  5CRH A;  1O8X A;  3FZ5 A;  1YJ6 A;  4F82 A;  2HRN A;  4L5L A;  4ZB8 A;  3M9J A;  4AJ6 A;  1UVZ A;  3H1N A;  1M0U A;  2C1Y A;  1YQ1 A;  5BMU A;  3RDW A;  5D9V A;  5GAN D;  1HNA A;  1PMT A;  14GS A;  2R0G A;  3KD0 A;  3QPM A;  1R4W A;  2LS5 A;  2K6V A;  1V9W A;  1T8E B;  2MZC A;  4PX1 A;  4K0G A;  4N3Z A;  5A1N A;  2FA4 A;  3UBL A;  5F05 A;  2JZR A;  1XIY A;  3ZYW A;  4MDC A;  3DRN A;  1EGR A;  1GSD A;  3KP8 A;  2VLU A;  4WEY A;  3CRU A;  4POL A;  3HJP A;  4PGT A;  2X4A A;  5ECL B;  2H1G A;  5KOW A;  4EC0 A;  7GSS A;  1T1V A;  4K8M A;  2CX3 A;  4OO5 A;  4OWY A;  4GF0 A;  3VPT A;  2GSS A;  3TU3 B;  3IAS 2;  3E9J B;  1ML6 A;  3F6F A;  2XBI A;  3H8Q A;  2MMA A;  1PGT A;  1N8J A;  4AGS A;  1ST9 A;  4XS6 A;  8GSS A;  4ZL8 A;  3UOM A;  5AGY A;  1K0A A;  4IP1 A;  5EL8 A;  3UMA A;  3ERW A;  1TKD B;  1Y1U A;  2L6D A;  1EOG A;  2HSN A;  4EDZ A;  3F4T A;  4HU9 A;  3WGD A;  4USS A;  1GTI A;  1B8X A;  1XWG A;  1J9B A;  3VWX A;  1FVK A;  4HSC X;  3MNG A;  4WR5 A;  2M46 A;  1FO5 A;  3HKR A;  4OFT A;  2NPB A;  4TKY A;  2H72 A;  3PR8 A;  1Z6M A;  4XTS A;  1GUH A;  3F4S A;  3D22 A;  1CQG A;  2QGV A;  3GV1 A;  4FYC A;  1Z9H A;  17GS A;  3MAK A;  1PSQ A;  1PX6 A;  3O3T A;  3CQF A;  3L4N A;  3EPT A;  4MP4 A;  2ON5 A;  2EIO A;  2WW3 A;  2HRF A;  4YKG A;  3KP9 A;  3ZZX A;  4N11 A;  3L9U A;  1BX9 A;  3EMX A;  1E6B A;  3N9J A;  5LD0 A;  4MZB A;  5HR3 A;  3ZVJ A;  4BL7 B;  4L5O A;  1PX7 A;  3IPZ A;  2IIY A;  4PUR A;  1V57 A;  5IOX A;  5IMA A;  1XPV A;  1Z7P A;  4J2F A;  2KLX A;  4AKH A;  3KGK A;  3DD3 A;  1OC9 B;  2B1K A;  4KND A;  3LXT A;  2TRC P;  2YAN A;  2C0D A;  4K7O A;  2H75 A;  3MIX A;  2AAW A;  3A2V A;  1XWK A;  2NVL A;  3Q74 A;  3TKS C;  4NV5 A;  2F9S A;  2HRK A;  2F8F A;  4MCU A;  1WWJ A;  1Z6N A;  1XVW A;  2PU9 C;  2NDO A;  3GX0 A;  5J4U A;  4PQI A;  1SVL A;  3TGZ A;  2LKU A;  4GCI A;  4TR3 A;  5E59 A;  3QR6 A;  2HYX A;  2OBI A;  3WGX A;  4TOP A;  5H5Q A;  4EXJ A;  2A2R A;  5KOX A;  5ENU A;  1SL1 B;  4BVY A;  4XRA A;  3QAV A;  4BVX A;  1T3B A;  4HQZ A;  4IQ1 A;  3F9U A;  4GRF A;  4BIK A;  4TXO B;  2I4A A;  4MZC A;  1FVJ A;  5KN1 A;  1GRX A;  4PI2 C;  2JSZ A;  1QK8 A;  3U6V A;  2G2Q A;  2EFH A;  1CQH A;  2PVQ A;  4HZ2 A;  2K9F A;  2ALB A;  1Z5Y E;  1A24 A;  3IK7 A;  3EYT A;  2ES7 A;  1ACV A;  4MLY A;  4JU5 A;  3EE2 A;  1MD3 A;  1DSB A;  4OCF A;  2IL3 A;  2F3M A;  2IFQ A;  5L71 A;  2N5A A;  4MJC A;  2IN3 A;  2PVO C;  3F8U A;  3DEX A;  5JCW A;  1R7H A;  2YV7 A;  3E3E A;  2OE0 A;  4I6X A;  4JBB A;  1Z7R A;  5B8A A;  3CWG A;  5F0G A;  2OE1 A;  2RII A;  2VM1 A;  4XCS A;  3DML A;  3DKS A;  3FMW A;  5AIS A;  1DUG A;  2B6M A;  2XBQ A;  3TJF A;  2R5G A;  1ON4 A;  1SKR B;  3KTL A;  4FXY P;  4FQU A;  2H70 A;  2WW1 A;  4L0W A;  2E2G A;  4O5Q A;  4RQR A;  1VF1 A;  4WBR D;  3VWV A;  4MPF A;  1YDK A;  2VUP A;  4GLT A;  3MWH A;  1M7T A;  2JZS A;  1B4P A;  5DQY A;  3FYG A;  1A23 A;  2NTO A;  4G10 A;  1NM3 A;  2B7J A;  2DJ0 A;  3IBH A;  4CHS A;  3UAR A;  1AXD A;  5IPH A;  1S3C A;  1O8W A;  4EF0 A;  2N5F A;  1U88 A;  3R3E A;  5ECQ B;  2YPM A;  3DYR A;  3H4K A;  2WUL A;  4Q5N A;  1RQM A;  2LTK A;  3ERF A;  5KEJ A;  2BJX A;  4IKH A;  5IQY A;  4NXI A;  3QAW A;  4E68 A;  1SK0 A;  2HFD A;  4XS4 A;  2LEG A;  2OBK A;  2DJ3 A;  5B7C A;  3GST A;  3W8J A;  2PMT A;  5ID2 A;  2H1B A;  2YV9 A;  2GDR A;  2GQL A;  2WZS A;  1JZO A;  3VI5 A;  3I9V 2;  2YZH A;  2YJ7 A;  1TK8 B;  2R37 A;  4TR1 A;  2UZ8 A;  1EP7 A;  1SKS B;  4WXT A;  1GUK A;  1H4O A;  5H5S A;  2CA8 A;  4EKZ A;  4O7H A;  4KCA A;  5AIX A;  5CNW A;  4NV2 A;  4W66 A;  4X0X A;  4GQF A;  4GSS A;  3PIN A;  5JCG A;  1ILO A;  1FHE A;  1ZL9 A;  1QXH A;  2V32 A;  2JAD A;  1OE8 A;  2FWG A;  3CRT A;  5D9T A;  4XS1 A;  2LJK A; 
#chains in the Genus database with same CATH homology
 4V2N A;  1F9M A;  2VCZ A;  3ZIV A;  4YH2 A;  2MYG A;  4KA0 A;  3LXZ A;  1GLP A;  4DVC A;  4D73 A;  1SEN A;  2GZY A;  4FO5 A;  2L5O A;  3Q6O A;  5KN0 A;  18GS A;  4IVF A;  1AIU A;  5C00 A;  4NMU A;  4WF4 A;  4HQS A;  5ECN B;  2B5Y A;  1FOH A;  3C1R A;  2V1M A;  4E8E A;  6GSW A;  3C1S A;  3GH9 A;  1VRS D;  3TKR A;  2V6O A;  4YQV A;  3EUR A;  3GL3 A;  2GQK A;  4MJA A;  2LQO A;  4LMW A;  1GSU A;  3EC3 A;  4IJI A;  2XPD A;  4X1U A;  4ZIL A;  5FHI A;  3WT2 A;  1GSY A;  1EWX A;  1M2D A;  3GFK A;  3LOR A;  1HYU A;  4MAB A;  4ILF A;  3VUR A;  2E7P A;  3UEM A;  2LNT A;  2R3X A;  2AHE A;  1G7E A;  1K3L A;  2FA8 A;  3EWL A;  3MDK A;  1LBK A;  3IHG A;  1A8L A;  4O92 A;  2B5X A;  2NBS A;  6GSU A;  3Q18 A;  5IMC A;  1YVL A;  4L0U A;  5CO3 A;  3ZTL A;  4PQH A;  3VWW A;  1TK0 B;  5LCZ A;  3DVW A;  3IA1 A;  1M9A A;  2L4Q A;  20GS A;  1GTU A;  4XIH A;  2HRA A;  5COH A;  1OC3 A;  2EC4 A;  1F3B A;  1B9X C;  4TR4 A;  3M8N A;  3VI7 A;  1R5P A;  4MZW A;  1YKA A;  3M3M A;  3QFA C;  3I69 A;  1WPI A;  4KE3 A;  3VK9 A;  2P31 A;  1JZD A;  2C3N A;  2CT6 A;  4IW9 A;  3W6G A;  3WT1 A;  2VCW A;  1ERW A;  4ZB7 A;  3SBC A;  3ZL5 A;  1A0R P;  1BG1 A;  3K8N A;  4G0I A;  1GNW A;  3CYN A;  2PUK C;  1FOV A;  4YKF A;  3RAZ A;  1HNC A;  1AQX A;  1EGO A;  1VF3 A;  3ISO A;  4N0Z A;  3V1W A;  1K0M A;  4F03 A;  4BA7 A;  4ULX A;  3QAG A;  4G9H A;  4KW6 A;  1SD9 A;  4ICY A;  3CTG A;  1YF0 A;  4Z2T A;  2FWF A;  3TRQ A;  4ZL7 A;  5CAX A;  3G7I A;  3HXS A;  16GS A;  1OKD A;  2CVD A;  3TJK A;  5DCH A;  3ED3 A;  1T4Y A;  1BG5 A;  2B1L A;  3ZFB A;  4KDY A;  1A2M A;  4KGI A;  4DSQ A;  3J7Y b;  3QMX A;  1A2L A;  3HVV A;  1XVQ A;  1QUW A;  3TDG A;  1Y25 A;  4RI7 A;  4RI6 A;  4F2I A;  4HI7 A;  6GST A;  2C3Q A;  2MMO A;  1TK5 B;  1FB0 A;  4PUA A;  4GTU A;  2C80 A;  1U87 A;  3GH6 A;  2LJA A;  1XW6 A;  1ABA A;  3FRC A;  4EE0 A;  2YOI A;  2KHP A;  5D73 A;  1OC9 A;  3TJG A;  2JAC A;  4QMK A;  1K3O A;  2VD0 A;  3FHK A;  1ZOF A;  4MA9 A;  6GSY A;  5CYY A;  1AUC A;  2I3Y A;  3IOS A;  1DE2 A;  2CVB A;  1GTA A;  4V2L A;  1GSE A;  2GGT A;  4KAE A;  5G31 A;  3ZIJ A;  3L0H A;  2BTO T;  1AW9 A;  2X8G A;  3VFI A;  4PNG A;  2YWM A;  1JZR A;  12GS A;  4ZB6 A;  3LGC A;  4GXZ A;  1M99 A;  3S9F A;  1FAA A;  4WKW A;  4NPB A;  5HR1 A;  4MMM A;  3A3T A;  4KH7 A;  1JZW A;  1TRV A;  1AAZ A;  3F3R A;  1SJ6 A;  4H86 A;  3UVT A;  1ZMA A;  2P5Q A;  1O7U A;  5A5H A;  5A34 B;  2GVP A;  2GT6 A;  5DAL B;  4IEL A;  1BED A;  2FNO A;  1TI1 A;  4TVE A;  2DJK A;  2WS2 A;  3VWU A;  1SJI A;  1GNE A;  2E2M A;  4IQA A;  5J41 A;  1EP8 A;  2H76 A;  2AB6 A;  2DML A;  4HJ2 A;  5KN2 A;  1ZYN A;  4LL1 B;  4QQ7 A;  1VGL A;  1TRU A;  3F4R A;  1TTZ A;  2JZT A;  2AV4 A;  4GSN A;  2CAQ A;  3TRP A;  2WB9 A;  2QC7 A;  3APS A;  1Y6E A;  4ISD A;  2YWN A;  1XCC A;  2H1L A;  2X99 A;  5ECM B;  1ERU A;  2CX4 A;  1S3D A;  4WET A;  3H93 A;  1RK4 A;  5D9W A;  1KNG A;  5GAP D;  4FYU A;  1F6M C;  4V1A p;  1URM A;  3IR4 A;  4JR6 A;  2L59 A;  3JCM L;  5G2Z A;  2VCX A;  5ECH B;  5JCU A;  2RUF A;  1B4Q A;  1FB6 A;  2HT9 A;  3GTU A;  3UL3 A;  5DAK A;  2OAC A;  2YZU A;  2R0P A;  1Q98 A;  1HD2 A;  2VCT A;  4K5R A;  4MJB A;  3HYP A;  3IC4 A;  5HR2 A;  3LW9 A;  3HJO A;  3RHC A;  5F07 A;  4KB3 A;  2CV4 A;  3QDN A;  4QL9 A;  5F06 A;  4JE1 A;  19GS A;  2XHF A;  3TB2 A;  2AYT A;  2O87 A;  3C8E A;  2BMX A;  3PH9 A;  1WP0 A;  4POM A;  4MF6 A;  5F8B A;  5C04 A;  3HZ8 A;  4IN0 A;  1GSQ A;  4N10 A;  2PBJ A;  4GDF A;  4K6X A;  2XC2 A;  5G5F A;  4MK3 A;  4ECB A;  1TJD A;  2VCQ A;  4DSR A;  2F8A A;  3P7X A;  2PN8 A;  3VPQ A;  2WRT A;  1SYR A;  5DVB A;  1HNB A;  2HSN B;  3R2Q A;  1JLV A;  4ZIJ A;  2C0G A;  3EU3 A;  1THX A;  2GSQ A;  2YWO A;  1H75 A;  3BJ5 A;  4OO4 A;  1E2Y A;  3W8S A;  2C0E A;  3Q19 A;  2EFE A;  4MH2 A;  2O8V B;  1K0C A;  3GRX A;  3VLN A;  2REM A;  3IRA A;  3FEU A;  5IO2 A;  4ZBD A;  2KOK A;  5IMZ A;  4HU7 A;  1J08 A;  4TR0 A;  2VO4 A;  2X49 A;  1NHY A;  2DJ1 A;  5GSS A;  5IM9 A;  3TOU A;  4JED A;  5ECO B;  3GKN A;  1TU8 A;  3FR9 A;  4HZ4 A;  1SK2 A;  4HDE A;  1KBN A;  4I2U A;  1GH2 A;  1TRS A;  5IO0 A;  3HVS A;  1X5C A;  2YJH A;  4MPG A;  4G0L A;  4YAV A;  5ECR B;  4WF5 A;  1X0R A;  4F0B A;  4P3Y B;  2HRK B;  3G7J A;  2DMM A;  2X64 A;  2PPT A;  1X9S B;  1M9B A;  4DSS B;  1MDJ A;  4BWS A;  1YEX A;  1WE0 A;  2O7K A;  3EVI A;  1THO A;  3M9K A;  1XOA A;  2HNL A;  2HZE B;  4WBJ A;  4BVY B;  2I81 A;  2L57 A;  4BVX B;  4ECC A;  2LJR A;  2OA7 A;  2VLT A;  4MJE A;  1NW2 A;  2GS3 A;  5H5R A;  1OAZ A;  2D2Z A;  4A5P A;  4I8B A;  6GSV A;  2V6K A;  2R0C A;  4Q5R A;  3GL5 A;  3NOF A;  2FLS A;  1JHB A;  5GST A;  2WCI A;  5KN3 A;  3KCM A;  4QL7 A;  1KTE A;  4IGJ A;  3UIW A;  2YNX A;  2FGX A;  3HCZ A;  1GLQ A;  3IE3 A;  4AJ8 A;  5D9X A;  4XHM A;  2GZZ A;  4YQU A;  1W89 A;  3LEF A;  1EEM A;  3KEB A;  10GS A;  4NAX A;  5EY6 A;  3PPU A;  2AUV A;  1Z3E A;  5AN1 A;  5CRW A;  3FY7 A;  2IFQ B;  2IMI A;  4JZQ A;  4I2T A;  4I97 A;  5A5K A;  4IJ3 A;  5GZZ B;  2IMK A;  5ECK B;  1YY7 A;  2GSR A;  4XRD A;  3C7M A;  1Q4J A;  3KH7 A;  1X9W B;  1PN9 A;  1XZO A;  2HSM A;  3CXG A;  1GUL A;  3GHA A;  4ZXG A;  3ERG A;  2E0Q A;  5IIZ A;  2FWH A;  1XW9 A;  1K3Y A;  3ZML A;  3RPN A;  2DJ2 A;  3HDC A;  1PKZ A;  4L8E A;  2YN1 A;  4ZBB A;  4LA1 A;  3CMI A;  2HLS A;  1GSF A;  4HOJ A;  3F0I A;  4FYB A;  1YZX A;  2LRC A;  3D4M A;  4ACS A;  2ZUP A;  3IXR A;  4NHZ A;  2V41 A;  3CTF A;  1OYJ A;  1LU4 A;  1ERV A;  1XXU A;  3HZ4 A;  3UVH A;  3GMF A;  1QFN A;  4LMV A;  3KIJ A;  5INY A;  2H8L A;  3ZIT A;  4MF7 A;  1XWA A;  1XBS A;  3O76 A;  1TOF A;  4JRR A;  5EVO A;  2OJL A;  4J56 E;  1V58 A;  2RLI A;  4ECJ A;  4CDO A;  2LST A;  3TOT A;  1TDI A;  5J47 A;  3GSS A;  4AKG A;  4FH8 A;  3NIV A;  2OAD A;  4AI6 A;  2DBC A;  4E8H A;  2Z9S A;  1OKT A;  2GT5 A;  1EEJ A;  1JFU A;  3C73 A;  2GLR A;  5IPG A;  5ID2 B;  4K2D A;  3N5O A;  2H6X A;  2ZCT A;  4AKX B;  1DBY A;  1M2B A;  4NWY A;  1AQW A;  5EPF A;  4EDY A;  5CRD A;  5HFG A;  2WDU A;  3KMO A;  1AC1 A;  4K7N A;  3UAP A;  5G1L A;  5ECI B;  5A4V A;  2DC5 A;  3E0U A;  5ABR A;  2J23 A;  3GN3 A;  5DAL A;  4PQ1 A;  3LWA A;  5HR0 A;  4O5R A;  3G7Y A;  2H6Z A;  4D73 B;  3SWL A;  1A0F A;  4KDU A;  22GS A;  3KTB A;  3I43 A;  3GNJ A;  5DQS A;  2LRN A;  1N2A A;  2H74 A;  5G30 A;  1AQV A;  3DIE A;  2C3T A;  4GWR A;  4HEA 2;  2WZ9 A;  1G6Y A;  4BL7 A;  3C71 A;  4ZL9 A;  4G19 A;  1S3A A;  2H71 A;  1X5D A;  2IMD A;  3GUR A;  4PNF A;  3BD2 A;  5G1K A;  1C72 A;  2H1A A;  4K0N A;  3TCO A;  5J3R A;  3DWV A;  2H1D A;  2H0G A;  3LSZ A;  3APQ A;  3BCI A;  2QKE A;  1ZCP A;  3F3Q A;  4Q5F A;  5IMD A;  3RPP A;  3GUS A;  2MBS A;  4O32 A;  5G5E A;  1A2J A;  3D0Z A;  5B8B A;  5BRT A;  1G7O A;  2IJY A;  3ME8 A;  3P2A A;  1SVM A;  2WJU A;  4TW5 A;  4N0V A;  11GS A;  3CBU A;  4KUN A;  3LJR A;  1K0D A;  2DSA A;  1T00 A;  4TXO A;  1YEP A;  2M80 A;  3F6D A;  2VLV A;  2MBT A;  4EVM A;  1FW1 A;  3FZA A;  5DJL A;  1XOB A;  1IYI A;  1X9M B;  1V2A A;  4CY8 A;  3GKX A;  1SKW B;  1YKC A;  2VCV A;  1OC8 A;  1TRW A;  4NHW A;  5JWR B;  2GZP A;  3QOU A;  4F0C A;  3A2W A;  2DIZ A;  2FUG 2;  2RM5 A;  3OR5 A;  3MSZ A;  3TUE A;  3GKK A;  1OVN A;  3DXB A;  4EL1 A;  1LJR A;  2H73 A;  4KCE A;  3KM6 A;  5J4V A;  4HJM A;  2A2P A;  2GST A;  3CSJ A;  1M2A A;  4GST A;  4G01 A;  3DVX A;  4OCE A;  3EIN A;  2HSH A;  1F37 A;  4OFN A;  4WR4 A;  2HE3 A;  4CY6 A;  1ZGN A;  3M1G A;  1EZK A;  1MTC A;  2N5B A;  5JWO B;  2G0F A;  6GSX A;  3DGQ A;  2R4V A;  4CW9 A;  3IDV A;  5D96 A;  2LRT A;  1O73 A;  3HJM A;  3EU4 A;  1SD8 A;  2KP1 A;  3P90 A;  3IC8 A;  3ME7 A;  1EV4 A;  2YWI A;  1UA5 A;  3WYW A;  1PL1 A;  1SK1 A;  2TRX A;  3M0F A;  1PN0 A;  4PXO A;  1I5G A;  5BMU B;  5DJM A;  2K8V A;  3CSH A;  2P0G A;  4Q5Q A;  3F63 A;  3L78 A;  2DJJ A;  4K5S A;  4EIQ A;  3ZRE A;  1G6W A;  4BWQ A;  3IHQ A;  5A1N B;  4IP6 A;  2I9H A;  2DLX A;  2WFC A;  1U6T A;  1DE1 A;  1TP9 A;  1O85 A;  4PTS A;  1ZZY A;  2MMZ A;  4DSS A;  3KH9 A;  4PUF C;  5DCG A;  3TJJ A;  5FT3 A;  3GIX A;  4MH3 A;  3US3 A;  1TW9 A;  1TXX A;  4IHU A;  4AF2 A;  1BYE A;  4Z2R A;  1SJZ A;  5JWQ B;  2I1U A;  2HXK A;  2HZE A;  1K0B A;  1PD2 1;  2PER A;  4RQX A;  2CZ3 A;  1BF5 A;  2X8H A;  2VAF A;  3G9B A;  4KF9 A;  4ZB9 A;  1F3A A;  1SU9 A;  2HSY A;  2H6Y A;  3ZRD A;  1QGV A;  3IAM 2;  1IYH A;  4RUV A;  4O5U A;  3A5I A;  4ID0 A;  1QQ2 A;  5IMV A;  2R2J A;  4DEJ A;  1FG4 A;  2X8C A;  2PWJ A;  2LQQ A;  2O89 A;  4OD7 A;  5ECS A;  3FZ4 A;  1O81 A;  5FWG A;  5A5H B;  2XPE A;  2YP6 A;  4K7I A;  2IME A;  2K18 A;  2VL3 A;  3LYP A;  2A4H A;  1JLW A;  1R26 A;  2JL4 A;  13GS A;  1MDI A;  2EFC A;  4EO3 A;  1PQN A;  1SL2 B;  3FR6 A;  5HQP A;  3WD6 A;  2FHE A;  1UC7 A;  3CSI A;  1USB A;  5A4U A;  3GA4 A;  5A4W A;  2ZNM A;  2CQ9 A;  2FD3 A;  4YAP A;  4ML6 A;  1TI3 A;  1V98 A;  3FKF A;  2EIQ A;  6GSS A;  2FY6 A;  5LNK e;  2UV8 G;  3KJY A;  2FCH A;  2HQT A;  1V40 A;  3PGT A;  4MNN A;  1B9Y C;  1WJK A;  3D5J A;  2H19 A;  2IMF A;  2H66 A;  3GX8 A;  3AY8 A;  3FK8 A;  2QA2 A;  2KP2 A;  5HFK A;  3GTU B;  2J9H A;  5DAK B;  2DKI A;  2LV3 A;  1PRX A;  3MYD A;  4N30 A;  4JR4 A;  3LG6 A;  3I6A A;  2VL2 A;  5CRE A;  4I5Q A;  3TKS E;  1GTB A;  1A8Y A;  4X4J A;  4KDX A;  1R5A A;  1J0F A;  5J40 A;  1XWB A;  3ZVJ D;  1XFL A;  4LLR A;  1WRY A;  1GWC A;  4F9Z A;  3D4T A;  1RW1 A;  5CRG A;  4OMV A;  3KXO A;  1GL8 A;  3FW2 A;  1G0T A;  3TKP A;  3GKM A;  4OFM A;  1WMJ A;  2RUE A;  2JU5 A;  1T4Z A;  1O6J A;  1EOH A;  1W4V A;  3QCP A;  1WIK A;  1BAY A;  2L5L A;  2CZ2 A;  5DBQ A;  3RBT A;  4TRX A;  4KX4 A;  1PA3 A;  3U5R E;  3LYK A;  4POK A;  1F2E A;  2H01 A;  2IWT A;  2OE3 A;  4MF5 A;  2TIR A;  2ON7 A;  1YF1 A;  3D21 A;  1K0N A;  1U3I A;  2FWE A;  5D93 A;  2A4V A;  3IK9 A;  5ELA A;  2C4J A;  2OT3 A;  5IMF A;  2PGT A;  1VF2 A;  2EFD A;  2VD1 A;  4X43 A;  2WGR A;  2MMN A;  2H30 A;  3A5W A;  4K9Z A;  1NHO A;  4K1F A;  1X5E A;  4LL4 B;  4AJ7 A;  1UN2 A;  2GQM A;  3QD9 A;  2AJQ B;  5J5N A;  1BQ7 A;  3APO A;  4FIW A;  2IPA A;  3FR3 A;  4ZBA A;  4G2E A;  2O85 A;  1N25 A;  4TXV A;  2K8S A;  2B3S A;  2V2G A;  2L6C A;  2VKZ G;  5HFI A;  3ZMK A;  1MDK A;  4IS0 A;  1BJX A;  1HQO A;  1ZYP A;  5B6M A;  1PL2 A;  3LFL A;  4ML1 A;  5J9B A;  1PKW A;  4J57 E;  2VM2 A;  3GYK A;  4HUA A;  3KMN A;  2H0H A;  5AIV A;  4Z2U A;  2DIY A;  1GP1 A;  5ECP B;  2P5R A;  3D6I A;  4V2M A;  4G0K A;  5IOW A;  1NSW A;  1XWC A;  3P8W A;  3HA9 A;  3A2X A;  2QSI A;  2B5E A;  2YCD A;  4HS1 A;  3ZLP A;  2VL9 A;  4BPY A;  1K0O A;  5D8I A;  4XS4 B;  2M72 A;  5J4Y A;  3KZQ A;  3ZFL A;  2VIM A;  3WGE A;  2CVK A;  5B6N A;  3L9S A;  1MEK A;  1ZYE A;  4AKI A;  2O5V A;  2B7K A;  3UJ1 A;  4IBP A;  3L9V A;  1B48 A;  2C0F A;  1U3A A;  2LNS A;  4TR1 B;  3BCK A;  2C8U A;  1EV9 A;  2A2S A;  1XW5 A;  3LQ7 A;  1SVO A;  1I9D A;  2QA1 A;  3HY2 A;  2CAI A;  2VL2 C;  4ECI A;  4Z7X A;  3BBY A;  2JSY A;  4GQC A;  1T7P B;  3H79 A;  3J7Y k;  4YQM A;  2GTU A;  3TJB A;  3TKQ A;  3HD5 A;  1WOU A;  2DKH A;  2VOC A;  3IV4 A;  5J9C A;  5A34 A;  2OKA A;  5DDL A;  2HZF A;  3QFB C;  4POB A;  1GSS A;  1KEB A;  3HVX A;  4EUY A;  2HI7 A;  5ELG A;  5E4W A;  3RHB A;  3FZ9 A;  1VF4 A;  2RM6 A;  1SYX A;  1TU7 A;  4K2X A;  2H0I A;  2HSM B;  1ZYQ B;  1OE7 A;  2R6K A;  1GUM A;  3TKS A;  4EIP A;  1SL0 B;  3TRX A;  4TN8 A;  1ERT A;  2F51 A;  9GSS A;  2L4C A;  3HHV A;  3BOA A;  3NZN A;  3O6T A;  1QMV A;  2KUC A;  3EMP A;  4KSM A;  4V1A g;  5CP1 A;  3HMJ G;  1MD4 A;  2EIR A;  4KSO A;  3UBK A;  2LUS A;  1TXU A;  5CRH A;  1O8X A;  3FZ5 A;  1YJ6 A;  4F82 A;  2HRN A;  4L5L A;  4ZB8 A;  3M9J A;  4AJ6 A;  1UVZ A;  3H1N A;  1M0U A;  2C1Y A;  1YQ1 A;  5BMU A;  3RDW A;  5D9V A;  5GAN D;  1HNA A;  1PMT A;  14GS A;  2R0G A;  3KD0 A;  3QPM A;  1R4W A;  2LS5 A;  2K6V A;  1V9W A;  1T8E B;  2MZC A;  4PX1 A;  4K0G A;  4N3Z A;  5A1N A;  2FA4 A;  3UBL A;  5F05 A;  2JZR A;  1XIY A;  3ZYW A;  4MDC A;  3DRN A;  1EGR A;  1GSD A;  3KP8 A;  2VLU A;  4WEY A;  3CRU A;  4POL A;  3HJP A;  4PGT A;  2X4A A;  5ECL B;  2H1G A;  5KOW A;  4EC0 A;  7GSS A;  1T1V A;  4K8M A;  2CX3 A;  4OO5 A;  4OWY A;  4GF0 A;  3VPT A;  2GSS A;  3TU3 B;  3IAS 2;  3E9J B;  1ML6 A;  3F6F A;  2XBI A;  3H8Q A;  2MMA A;  1PGT A;  1N8J A;  4AGS A;  1ST9 A;  4XS6 A;  8GSS A;  4ZL8 A;  3UOM A;  5AGY A;  1K0A A;  4IP1 A;  5EL8 A;  3UMA A;  3ERW A;  1TKD B;  1Y1U A;  2L6D A;  1EOG A;  2HSN A;  4EDZ A;  3F4T A;  4HU9 A;  3WGD A;  4USS A;  1GTI A;  1B8X A;  1XWG A;  1J9B A;  3VWX A;  1FVK A;  3MNG A;  4WR5 A;  2M46 A;  1FO5 A;  3HKR A;  4OFT A;  2NPB A;  4TKY A;  2H72 A;  3PR8 A;  1Z6M A;  4XTS A;  1GUH A;  3F4S A;  3D22 A;  1CQG A;  2QGV A;  3GV1 A;  4FYC A;  1Z9H A;  17GS A;  3MAK A;  1PSQ A;  1PX6 A;  3O3T A;  3L4N A;  3EPT A;  4MP4 A;  2ON5 A;  2EIO A;  2HRF A;  4YKG A;  3KP9 A;  3ZZX A;  4N11 A;  3L9U A;  1BX9 A;  3EMX A;  3N9J A;  1E6B A;  5LD0 A;  4MZB A;  5HR3 A;  3ZVJ A;  4BL7 B;  4L5O A;  1PX7 A;  3IPZ A;  2IIY A;  4PUR A;  1V57 A;  5IOX A;  5IMA A;  1XPV A;  1Z7P A;  4J2F A;  2KLX A;  4AKH A;  3KGK A;  3DD3 A;  1OC9 B;  2B1K A;  4KND A;  3LXT A;  2TRC P;  2YAN A;  2C0D A;  4K7O A;  2H75 A;  3MIX A;  2AAW A;  3A2V A;  1XWK A;  2NVL A;  3Q74 A;  3TKS C;  4NV5 A;  2F9S A;  2HRK A;  2F8F A;  4MCU A;  1WWJ A;  1Z6N A;  1XVW A;  2PU9 C;  2NDO A;  3GX0 A;  5J4U A;  4PQI A;  1SVL A;  3TGZ A;  2LKU A;  4GCI A;  4TR3 A;  5E59 A;  3QR6 A;  2HYX A;  2OBI A;  3WGX A;  4TOP A;  5H5Q A;  4EXJ A;  2A2R A;  5KOX A;  5ENU A;  1SL1 B;  4BVY A;  4XRA A;  3QAV A;  4BVX A;  1T3B A;  4HQZ A;  4IQ1 A;  3F9U A;  4GRF A;  4TXO B;  2I4A A;  4MZC A;  1FVJ A;  5KN1 A;  1GRX A;  2JSZ A;  1QK8 A;  3U6V A;  2G2Q A;  2EFH A;  1CQH A;  2PVQ A;  4HZ2 A;  2K9F A;  2ALB A;  1Z5Y E;  1A24 A;  3IK7 A;  3EYT A;  2ES7 A;  1ACV A;  4MLY A;  4JU5 A;  3EE2 A;  1MD3 A;  1DSB A;  4OCF A;  2IL3 A;  2F3M A;  2IFQ A;  5L71 A;  2N5A A;  4MJC A;  2IN3 A;  2PVO C;  3F8U A;  3DEX A;  5JCW A;  1R7H A;  2YV7 A;  3E3E A;  2OE0 A;  4I6X A;  4JBB A;  1Z7R A;  5B8A A;  3CWG A;  5F0G A;  2OE1 A;  2RII A;  2VM1 A;  4XCS A;  3DML A;  3DKS A;  3FMW A;  5AIS A;  1DUG A;  2B6M A;  2XBQ A;  3TJF A;  2R5G A;  1ON4 A;  1SKR B;  3KTL A;  4FQU A;  2H70 A;  4L0W A;  2E2G A;  4O5Q A;  4RQR A;  1VF1 A;  4WBR D;  3VWV A;  4MPF A;  1YDK A;  2VUP A;  4GLT A;  3MWH A;  1M7T A;  2JZS A;  1B4P A;  5DQY A;  3FYG A;  1A23 A;  2NTO A;  4G10 A;  1NM3 A;  2B7J A;  2DJ0 A;  3IBH A;  4CHS A;  3UAR A;  1AXD A;  5IPH A;  1S3C A;  1O8W A;  4EF0 A;  2N5F A;  1U88 A;  3R3E A;  5ECQ B;  2YPM A;  3DYR A;  3H4K A;  2WUL A;  4Q5N A;  1RQM A;  2LTK A;  3ERF A;  5KEJ A;  2BJX A;  4IKH A;  5IQY A;  4NXI A;  3QAW A;  4E68 A;  1SK0 A;  2HFD A;  4XS4 A;  2LEG A;  2OBK A;  2DJ3 A;  5B7C A;  3GST A;  3W8J A;  2PMT A;  5ID2 A;  2H1B A;  2YV9 A;  2GDR A;  2GQL A;  1JZO A;  3VI5 A;  3I9V 2;  2YZH A;  2YJ7 A;  1TK8 B;  2R37 A;  4TR1 A;  2UZ8 A;  1EP7 A;  1SKS B;  4WXT A;  1GUK A;  1H4O A;  5H5S A;  2CA8 A;  4EKZ A;  4O7H A;  4KCA A;  5AIX A;  5CNW A;  4NV2 A;  4W66 A;  4X0X A;  4GQF A;  4GSS A;  3PIN A;  5JCG A;  1ILO A;  1FHE A;  1ZL9 A;  1QXH A;  2V32 A;  2JAD A;  1OE8 A;  2FWG A;  3CRT A;  5D9T A;  4XS1 A;  2LJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...