4BVYB

Crystal structure of the aimp3-mrs n-terminal domain complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNDGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFSHIQHYPGIRQHLSSVVFIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Aimp3-Mrs N-Terminal Domain Complex
rcsb
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
molecule tags Ligase/translation
source organism Homo sapiens
total genus 57
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bvyB02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bvyB01
3GSTA 1EOGA 5ECMB 1HQOA 5B7CA 1HNCA 1LBKA 4PTSA 2LJRA 4MF5A 3ZFBA 5IQYA 1Q4JA 1PA3A 3Q19A 3KMOA 3M0FA 3N5OA 1PL1A 2YV7A 3GUSA 4KDYA 5D73A 1K3LA 3VK9A 4GF0A 5DAKB 5A4WA 1AQXA 2YCDA 4NHWA 4O7HA 1F3BA 1U87A 2CAQA 5ECPB 3LFLA 1EEMA 4IW9A 4YQMA 3GURA 4G9HA 3FYGA 4I97A 4PX1A 4ACSA 2WDUA 3VI7A 22GSA 3P90A 4GSSA 1OE7A 3ERGA 1K0BA 3P8WA 2PGTA 1ML6A 5F07A 3R3EA 2VCWA 4F0CA 2V6KA 1M0UA 2JL4A 4WR4A 1TDIA 1LJRA 4CHSA 4JZQA 4BL7A 1GLQA 1PKWA 1C72A 2VO4A 4EDZA 5AIXA 1PX7A 1UA5A 5AISA 1F2EA 2A2SA 4GLTA 5ELGA 2CZ2A 3VPTA 4ZB6A 2CZ3A 3KMNA 2GLRA 4G19A 5F8BA 1K0MA 1B8XA 5DALA 5A5KA 3IK7A 4ZXGA 2ON7A 4YQUA 3UARA 2WRTA 1GTAA 4PUAA 2CVDA 2IMKA 4WR5A 4ECCA 3TGZA 1IYIA 1N2AA 4OFMA 4O92A 1VF1A 1K3YA 4BVXA 2HSMB 5JCUA 1DUGA 3W8SA 5EL8A 3CSJA 4MP4A 1AXDA 2F3MA 4MZWA 5AGYA 4LMVA 3TOUA 1JLWA 3MAKA 5D9XA 2CA8A 3H1NA 1XWKA 3BBYA 2C3TA 2OA7A 2DC5A 2VD0A 4KH7A 1YKCA 3GX0A 3PPUA 3DGQA 5ELAA 3Q74A 2R6KA 4AGSA 3M1GA 4USSA 1A0FA 5F06A 1HNAA 2PVQA 3LJRA 5FT3A 1AQWA 4Q5QA 1XW6A 4OFTA 19GSA 4HJ2A 3VPQA 3ERFA 3QR6A 2UZ8A 1PX6A 3KM6A 4KAEA 1VF3A 2R5GA 4E8HA 4ZBDA 7GSSA 5ECIB 2WJUA 3M8NA 5D9VA 1GSSA 2GDRA 3EINA 4L5LA 3F6DA 4HZ4A 3FR6A 4IS0A 1JLVA 2WB9A 3G7IA 3GTUB 3FY7A 3AY8A 5DJLA 4HOJA 4L5OA 4KX4A 5J41A 2C80A 1V2AA 4YAPA 4ID0A 3L0HA 1YQ1A 2NTOA 3LYPA 3CRUA 1Y6EA 5LCZA 4ZBAA 5KEJA 3GSSA 5EY6A 1USBA 2C3QA 5DJMA 6GSSA 5D9WA 2C8UA 3PR8A 4ZB8A 4DEJA 1FHEA 1GWCA 3WYWA 1EOHA 1GNEA 5ECOB 2AAWA 20GSA 4ECJA 3IE3A 3ZFLA 3N9JA 4PNFA 2HSMA 2VCQA 3I6AA 17GSA 4MPFA 4Q5FA 2VCVA 4GTUA 5GSTA 3C8EA 5ECLB 2CAIA 4NAXA 5DQSA 2PERA 4K0GA 2HSNB 4KGIA 1GSQA 2GSTA 3IBHA 1PKZA 4IJIA 2FNOA 3LXZA 3G7JA 1EV9A 1R5AA 3I69A 4G10A 3CSHA 1OYJA 3U6VA 1VF4A 3UVHA 1G7OA 3QAWA 3M3MA 4E8EA 1M99A 3LG6A 2D2ZA 4JBBA 2FHEA 3CBUA 5F05A 1M9BA 1M9AA 1ZGNA 3VWXA 14GSA 2PMTA 4Q5NA 1PL2A 1XWGA 3MDKA 1V40A 1IYHA 5HFKA 5GZZB 1PMTA 4GSTA 5D9TA 1OE8A 3KTLA 1K0OA 5DCGA 1TU8A 1B4PA 1GLPA 4PQIA 5AIVA 1ZL9A 4KE3A 1K0AA 1BAYA 6GSYA 1TW9A 3LSZA 4IKHA 4ISDA 2HNLA 4KDXA 3GTUA 2GSSA 4MF6A 4IQAA 4ZBBA 1BX9A 1Z9HA 5EVOA 1GSYA 3FR3A 1GUHA 3O76A 5JCWA 3VLNA 3ISOA 4RI6A 4PNGA 1K0NA 1JZRA 2X64A 1GUMA 3F6FA 3HKRA 2AHEA 1GUKA 2VCZA 5G5FA 4F0BA 4YQVA 11GSA 5G5EA 4PXOA 1K0CA 4MF7A 3CRTA 6GSWA 5GSSA 3D0ZA 1XW5A 1BG5A 4QQ7A 1FW1A 2GSQA 1GSEA 1K3OA 5FHIA 1OKTA 2VD1A 6GSUA 2OACA 4HZ2A 3HJOA 3FRCA 3HJMA 1GTIA 4PURA 16GSA 1G6WA 4BVYB 5LD0A 5ECSA 4IQ1A 4ZB9A 5ECRB 2GSRA 3EE2A 1YDKA 1E6BA 4ECBA 2C3NA 4KSMA 3KJYA 2HQTA 3RBTA 2PBJA 2OADA 2IL3A 1GSDA 2HRKB 5BMUA 2AB6A 5ECNB 1YJ6A 6GSVA 1B48A 3WD6A 1VF2A 4IVFA 1K0DA 2IMIA 1MTCA 3TOTA 5A4VA 4IBPA 2R3XA 4EDYA 10GSA 5J4UA 2VCXA 1AQVA 4TOPA 2YV9A 1YY7A 3NIVA 3QAVA 8GSSA 2C4JA 1F3AA 5A4UA 3UAPA 1TU7A 4G0IA 1U3IA 9GSSA 1MD3A 4ECIA 4J2FA 4PGTA 3FR9A 4IGJA 1GSUA 3SWLA 3VI5A 1MD4A 1PN9A 4EC0A 18GSA 5F0GA 4N0VA 4FQUA 4Q5RA 4KDUA 4KF9A 1PGTA 5FWGA 1HNBA 5ECKB 1KBNA 1PD21 2F8FA 4YAVA 5J5NA 3IC8A 2VCTA 2DSAA 3QAGA 4EXJA 1GSFA 1GULA 3IR4A 1GTUA 5ECHB 12GSA 1U88A 3ZMLA 4BL7B 6GSXA 4GCIA 3VURA 3KXOA 3LQ7A 4G0KA 2J9HA 4PQHA 4OMVA 4YH2A 4LMWA 3IK9A 3UBLA 4L8EA 1NHYA 4GSNA 3PGTA 5DALB 13GSA 2HRAA 1RK4A 3DD3A 3F63A 4EE0A 4BVYA 1GTBA 4BVXB 2WS2A 4K0NA 2ON5A 4RI7A 5DDLA 3LYKA 4HI7A 1AW9A 3ZMKA 4JEDA 5ECQB 3R2QA 4NHZA 3CSIA 4IELA 4MPGA 1EV4A 2HRKA 2N5FA 4MK3A 4OFNA 4F03A 1GNWA 2A2RA 5DAKA 3LXTA 1G6YA 3O3TA 3Q18A 1BYEA 4G0LA 2R4VA 3GH6A 3UBKA 2GTUA 6GSTA 4MDCA 5AN1A
chains in the Genus database with same CATH superfamily
2I81A 1EOGA 5B6MA 5ECMB 2PWJA 3D22A 5B7CA 1EWXA 4PTSA 2YJ7A 2LJRA 4MF5A 3ZFBA 1PA3A 3Q19A 3M0FA 1M7TA 2CV4A 2YV7A 5KN3A 1K3LA 5DAKB 2X8CA 4NHWA 1F3BA 1MDKA 4YQMA 3GURA 1SVLA 1TK8B 4IJ3A 3HCZA 3IRAA 2ZCTA 1OE7A 3WT1A 2MBSA 1ML6A 4JU5A 3R3EA 3GA4A 2EIRA 3ZRDA 2V6KA 4ILFA 4Z2TA 1LJRA 3DIEA 4JZQA 2LRNA 3H79A 5GAPD 2H74A 3E3EA 2CVKA 3CYNA 5AISA 3DKSA 2CZ2A 4J56E 4TR0A 2YANA 5F8BA 1M3IA 1B8XA 3UVTA 3OR5A 4ZXGA 2REMA 2EFEA 1A8YA 4PUAA 4JE1A 4FXYP 1IYIA 4OFMA 4O92A 2WVZA 1O7UA 1FB0A 2HZEA 1BQ7A 5EL8A 3CSJA 1AXDA 2E2MA 4LMVA 2OT3A 1JLWA 4HUAA 5D9XA 2WVXB 1XWKA 2C3TA 5IMDA 2OA7A 2DC5A 2VD0A 3J7Yk 2H19A 1TTZA 1SL1B 4HSCX 4FYUA 2PVOC 4GQCA 3RDWA 2O89A 3M1GA 2FLSA 4USSA 3LJRA 2PN8A 2VLUA 1URMA 2DJ0A 1B9XC 4YKGA 1XWAA 3H8QA 2H76A 2IN3A 3FZ9A 2VUPA 3TKSA 3ZIVA 4QMKA 1XFLA 1A0RP 2WJUA 3M8NA 2GDRA 4N0ZA 4BIKA 1WE0A 1FAAA 1DSBA 1UN2A 2DBCA 3LW9A 3UL3A 3L0HA 1YQ1A 4FIWA 3IV4A 4X1UA 3EURA 2VM1A 5LCZA 4BWSA 3FZ5A 2YNXA 3L78A 5KN0A 2DIYA 3TJGA 3PR8A 1GWCA 4FH8A 3WYWA 3DMLA 5C04A 5J9CA 2HSHA 1GP1A 4DSSA 1ZCPA 2OBIA 4A5PA 2HSMA 17GSA 2VCVA 4AKHA 5GSTA 5ECLB 2O87A 4PQ1A 3ZITA 2HSNB 1V9WA 2GSTA 1EV9A 1O8XA 1R5AA 4I2TA 1TP9A 2M80A 1V57A 3UVHA 1G7OA 3QAWA 2TIRA 2JADA 3TRQA 4K7IA 5IO0A 2DKIA 3RAZA 4N30A 1N8JA 2EIOA 4G01A 2CX3A 5CO3A 1ZGNA 3FKFA 1Q98A 1ZYEA 3MDKA 2I9HA 1IYHA 4BA7A 1OE8A 3KTLA 1K0OA 5DCGA 1GLPA 4QL9A 2OE0A 2FA4A 2H73A 4KCEA 3HA9A 1K0AA 4HQZA 5IMZA 1WIKA 2O7KA 1F37A 3ZVJD 4ZB7A 2CQ9A 3GTUA 2ALBA 2XBIA 4MF6A 4IQAA 4K7NA 4LL1B 5EVOA 1GUHA 1WPIA 3ISOA 1SJIA 3F0IA 4RI6A 1UC7A 2X64A 1YVLA 3GKKA 3EC3A 4TN8A 4YQVA 1I9DA 3IHQA 6GSWA 4HU9A 3GX8A 3A2WA 2I3YA 3UOMA 2IMFA 2WW2A 3GFKA 5FHIA 2OACA 2B1LA 2LJKA 2IJYA 16GSA 4BVYB 1AIUA 5ECSA 1U6TA 2L4QA 1O81A 2VL2A 1Y1UA 1SYXA 4LA1A 4X43A 3SBCA 4RQXA 2PBJA 3V1WA 2V1MA 5A1NB 5IMCA 5BMUA 1FOHA 4OD7A 1YJ6A 1B48A 3IA1A 4IVFA 1JZOA 4PUFC 5HR0A 4EDYA 5DQYA 10GSA 2VCXA 4XS4A 4TOPA 3NIVA 3QDNA 2YZHA 8GSSA 4G0IA 2DMMA 4L0UA 1GSUA 1TKDB 1WMJA 2VLVA 2X8HA 1MD4A 3DYRA 1BJXA 3F9UA 5E59A 4EC0A 3K8NA 18GSA 4ULXA 2NBSA 2F51A 1HNBA 5ECKB 1KBNA 2F8FA 1JZDA 3GRXA 3J7Yb 2L5OA 2JSZA 3TKSC 3KCMA 1GULA 1GTUA 5L71A 3FMWA 4WKWA 3CQFA 4G0KA 3IK9A 1NHYA 4GSNA 1O85A 3PH9A 3UEMA 2LUSA 3HD5A 1RK4A 3F63A 4EIPA 4EE0A 3KIJA 3G7YA 2DJJA 3IPZA 2AV4A 4L0WA 4EUYA 4ZL9A 1YF0A 5A34A 4K0NA 4RI7A 5DDLA 3C73A 1AUCA 2A2PA 4TXOB 3FHKA 4DVCA 4JEDA 1ILOA 2B3SA 3CSIA 3KD0A 2HRKA 2N5FA 2WW1A 3D4TA 3QD9A 1GNWA 2A2RA 2GZPA 4MA9A 2C0EA 3LXTA 3QFAC 5J4VA 3C1RA 2HLSA 2NPBA 3O3TA 3TKSE 2GTUA 2C0DA 4MDCA 4XS6A 5G30A 2M72A 4NMUA 1Z5YE 2O36A 4HEA2 1HQOA 3P7XA 1HNCA 1Q4JA 1PN0A 3KMOA 2H0HA 4KDYA 1OC9A 5D73A 5HR3A 3VK9A 5J3RA 2YCDA 2YP6A 5ECPB 4TR1A 3ZLPA 1QXHA 4I2UA 5C00A 22GSA 2VOCA 2PGTA 3DVWA 2VCWA 4F0CA 1FG4A 2ZNMA 4PHZC 2JL4A 4WR4A 1TDIA 4BL7A 1GLQA 1VGLA 4GXZA 1C72A 1UVZA 1F9MA 3RGBC 2B7JA 2CZ3A 4Z2RA 4O5UA 3TRPA 1WWJA 4XTSA 3D4MA 5DALA 5A5KA 3IK7A 3P2AA 2H30A 2WRTA 4EKZA 2UV8G 1PRXA 4KA0A 4ECCA 4DSSB 1N2AA 1Y25A 3UIWA 1TK5B 1K3YA 2FWHA 2XC2A 2HSMB 2DJ3A 5H5QA 2GQLA 3W8SA 1ZYPA 4MZWA 5AGYA 1BG1A 3TOUA 3MAKA 4V2MA 3CXGA 3BBYA 4EF0A 2VL2C 4EIQA 2O3EA 3GX0A 1XVWA 2HZFA 3MWHA 3PPUA 5ELAA 2R6KA 1EP8A 1BF5A 4EVMA 1A0FA 2PVQA 1AQWA 4MLYA 3F8UA 1XW6A 19GSA 4HJ2A 3EVIA 2E7PA 1PX6A 3KM6A 2G0FA 4KAEA 1R7HA 1QQ2A 1TI3A 4ZBDA 7GSSA 2H1AA 4V1Ap 5ECIB 4P3YB 4CY8A 3HVSA 1SK1A 4K9ZA 4IS0A 1JLVA 2FGXA 3Q6OA 3GTUB 3AY8A 5DJLA 1MDJA 4TR4A 1X5DA 1W89A 3HJPA 5J41A 2C80A 4ID0A 2GZYA 2GGTA 4W66A 1U3AA 3LYPA 2CX4A 5JWQB 3CRUA 1JZWA 1Y6EA 5KEJA 5EY6A 2OJLA 3APSA 1FHEA 4PI0C 4XIHA 1YZXA 1EOHA 3DVXA 20GSA 2OKAA 3HVNA 4ECJA 1TI1A 4WF5A 3N9JA 2A4HA 4OCEA 5H5RA 4PNFA 2VCQA 4MPFA 1PQNA 3ME7A 1ERVA 1DE1A 3C8EA 4NAXA 2PERA 4K0GA 5D96A 1GSQA 2WZSA 1XZOA 4ZL8A 3TRXA 1R4WA 2OE3A 3VFIA 3I69A 1SL2B 1XXUA 1WRYA 1VF4A 2HRNA 3GKMA 3ZL5A 2O8VB 4POBA 4JBBA 4XS4B 3CBUA 1QUWA 3HMJG 3VWXA 4Q5NA 1PL2A 1V40A 2DJKA 1AAZA 4NWYA 5ID2B 1ZYQB 3HXSA 1A2MA 5D9TA 4Z2UA 3GYKA 4ML6A 3GIXA 1WJKA 3D6IA 3KH7A 2B5YA 3HZ4A 4AKXB 5JWRB 1TW9A 3LSZA 4EL1A 2HNLA 4KDXA 2AYTA 3HVVA 1M2DA 3E9JB 1NM3A 1KEBA 1Z9HA 3O76A 4O32A 3VLNA 2V2GA 3GHAA 1GUMA 3HKRA 1NSWA 1ERUA 2H1GA 1ABAA 4OO5A 2VCZA 11GSA 2M46A 3TJKA 4D73A 1M2AA 4AJ7A 2VD1A 4X4JA 4HZ2A 3RFRC 3GKNA 3HJOA 5ENUA 5A34B 5ECRB 4ZIJA 4MH3A 2GSRA 1YDKA 1FO5A 3F4TA 4WBRD 4NV5A 2HQTA 4MNNA 3BCKA 3IDVA 2OADA 2WGRA 2L4CA 2HRKB 4MZCA 2JZSA 2AB6A 2VIMA 4TVEA 1T1VA 3CTFA 4K2DA 2J23A 3L4NA 3TOTA 3FZAA 4JR6A 1ST9A 5JCGA 3KTBA 5A4VA 4F9ZA 4CDOA 3U5RE 1ZOFA 1FB6A 1TK0B 4AF2A 1F3AA 4TRXA 1TU7A 5E4WA 9GSSA 2EFDA 4ECIA 1ERTA 5KN2A 4IN0A 4F82A 3SWLA 2B7KA 3ZREA 4O5RA 3TKQA 2X4AA 4TR1B 4N0VA 4HU7A 4FQUA 1X9SB 2C0FA 4FO5A 5J4YA 4K5SA 3QAGA 2KHPA 2HYXA 3GL3A 4OO4A 4GQFA 1SU9A 1GSFA 3IR4A 4ZILA 4BL7B 3KP8A 3VURA 4KCAA 2VAFA 2NVLA 4GDFA 2DMLA 1KTEA 3GL5A 2MMOA 5DALB 2HRAA 3DD3A 3LGCA 1DBYA 1X5CA 2YWIA 1HD2A 4OCFA 2MZCA 2V41A 3RPPA 5ECQB 5DBQA 4IELA 4MPGA 4OFNA 4F03A 5DAKA 3M9KA 1BYEA 4WEYA 1GRXA 4OWYA 1A23A 3UBKA 2P31A 3TU3B 4MJCA 5IPGA 3GSTA 1MEKA 1I1IP 5IQYA 4BWQA 3MIXA 1KNGA 4GF0A 5KOWA 1FVJA 3EPTA 4K2XA 2CAQA 2IMDA 1S3RA 2GVPA 4I97A 2RM6A 2P5RA 3P90A 2R37A 1J0FA 5CNWA 4GSSA 3P8WA 3US3A 2PPTA 1XWBA 3GH9A 5HFIA 5F07A 2EFHA 3ZZXA 3D21A 1M0UA 3W6GA 4CHSA 3FW2A 3A2VA 1PKWA 4MMMA 5IPHA 5AIXA 1A24A 1PX7A 2FY6A 2IMEA 1UA5A 2E0QA 4IP6A 2X49A 2A2SA 4GLTA 3VPTA 2BJXA 2OBKA 3KMNA 4G19A 1T4ZA 3HVXA 3MSZA 2ON7A 3UARA 3NZNA 3UMAA 1GTAA 3ME8A 1DE2A 2EIQA 4BVXA 5JCUA 5J40A 1DUGA 4X0XA 4MP4A 2F3MA 1T4YA 2CA8A 4BPYA 2XPDA 3IOSA 3GN3A 1MDIA 2FCHA 2YZUA 4KH7A 1YKCA 3F4RA 1QK8A 1QGVA 3JCML 1Z6MA 3DGQA 4EO3A 3KH9A 3GNJA 4TKYA 3Q74A 3TKPA 2HZEB 2LQQA 4MCUA 3UJ1A 3RHCA 2R2JA 1OC8A 1GH2A 2YN1A 1HNAA 1XPVA 4KSOA 1THOA 4XS1A 4Q5QA 4OFTA 2DKHA 1S3AA 3ERFA 2VM2A 3QR6A 2UZ8A 4IP1A 4V2LA 2WW0A 2R5GA 4E8HA 2LJAA 3EMXA 3I9V2 3HY2A 5D9VA 4L5LA 1B9YC 3F6DA 1BEDA 1CQHA 3F3RA 2B6MA 3FY7A 1T3BA 1FVKA 4KX4A 1V2AA 2L59A 3QCPA 2NTOA 1T00A 4CW9A 2VKZG 4G2EA 3CTGA 2L5LA 2RIIA 2H6ZA 4KB3A 1XIYA 4ZBAA 2JSYA 5DJMA 5D9WA 2IFQA 1QFNA 1YF1A 3A5IA 4PI2C 4DEJA 1GNEA 5ECOB 4AKGA 3WGDA 3C1SA 3IE3A 4XRDA 3DRNA 3ZFLA 2B1KA 2FWFA 2BMXA 4Q5FA 1J9BA 3FEUA 4GTUA 2DLXA 2K8SA 1W4VA 3EYTA 1YKAA 2JZRA 5DQSA 2H71A 2PUKC 1PKZA 4IJIA 2K9FA 2FNOA 4MZBA 1B4QA 4G10A 4MJBA 5J9BA 3M9JA 3TCOA 1PFOA 2PU9C 2R0GA 2L6CA 4FYCA 3DEXA 3IAM2 4WBJA 1M99A 2N5AA 2E2GA 2FHEA 1SD9A 1SKSB 2WFCA 1M9BA 2EC4A 3A3TA 1M9AA 14GSA 2H66A 2PMTA 2YPMA 3APQA 2GQKA 1I5GA 2K18A 4IHUA 1X9MB 1FOVA 4HJMA 5HFKA 5GZZB 4JR4A 4WETA 1E2YA 4GSTA 1Z6NA 2H6XA 1PSQA 1TJDA 4PQIA 4CY6A 5AIVA 4I8BA 2RLIA 1BAYA 1SK0A 2GZZA 1SL0B 3QOUA 2RUEA 4DSQA 5CRWA 4ISDA 4ICYA 1TRUA 3GKXA 1V98A 4ZBBA 5IMFA 1BX9A 2GT5A 3NOFA 1K0NA 1OC3A 3F6FA 5BRTA 2AHEA 1GUKA 5G5FA 3D5JA 5G5EA 1K0CA 2AUVA 1XWCA 3D0ZA 2VL3A 3ZIJA 1XW5A 1BG5A 5A1NA 1S3DA 2H01A 2XPEA 5IMVA 2K8VA 4QQ7A 3A5WA 1GSEA 1K3OA 1J08A 1ZZYA 3FRCA 2LS5A 3FK8A 2RM5A 4PURA 1G6WA 3TUEA 1T7PB 4IQ1A 4ZB9A 3BOAA 2Z9SA 1M3JA 2F8AA 1E6BA 4ECBA 1XBSA 2C3NA 4GRFA 1LU4A 3RBTA 5HQPA 2LV3A 1GSDA 1TRVA 2H6YA 6GSVA 1RW1A 2KOKA 1VF2A 1K0DA 3CHXC 2VLTA 2ZUPA 2P0GA 4NV2A 5A5HA 1AQVA 2B5EA 2P5QA 2YV9A 1YY7A 3QFBC 3QAVA 2C4JA 3UAPA 2G2QA 1U3IA 2FA8A 4PGTA 5CRGA 5BMUB 2RUFA 2FUG2 4K8MA 5IOWA 3VI5A 2LEGA 2YWMA 5F0GA 1ACVA 4KW6A 1XCCA 4ML1A 2XBQA 5H5SA 1GL8A 2H8LA 1OAZA 1TRSA 4ZL7A 5J5NA 2VCTA 5HR2A 5COHA 5IOXA 5G2ZA 2A4VA 12GSA 3ZVJA 1U88A 3TB2A 5JWOB 4LL4B 2LRTA 6GSXA 2DJ2A 1SK2A 4TXOA 4AI6A 3KXOA 3LQ7A 5LNKe 1SKRB 2J9HA 3LEFA 4YH2A 2H0IA 3FZ4A 2KLXA 4L8EA 1JHBA 2MMNA 13GSA 3H4KA 1TRWA 3KEBA 1G7EA 2HFDA 3L9SA 1ZMAA 4TR3A 1GTBA 4BVXB 4QL7A 1N25A 2WS2A 1X5EA 4AJ6A 5G1LA 2GQMA 3LYKA 4HI7A 3MYDA 2KP1A 5IIZA 2JU5A 2R0CA 5INYA 4V2NA 2L6DA 3ERWA 4LLRA 1VRSD 1G6YA 3W8JA 1NW2A 4G0LA 1F6MC 3LWAA 3GH6A 6GSTA 5AN1A 3L9VA 2DJ1A 3O6TA 3EU4A 1T8EB 1SJ6A 4MABA 4H86A 3ZTLA 4I6XA 1LBKA 2QGVA 3HZ8A 2K6VA 4N11A 2L57A 4NPBA 3N5OA 1PL1A 3GUSA 3E0UA 3CMIA 5A4WA 1S3CA 5CAXA 1AQXA 1QMVA 4O7HA 1U87A 3LFLA 1EEMA 4IW9A 3TJJA 4G9HA 3FYGA 3C71A 1SVOA 4PX1A 4ACSA 2WDUA 3VI7A 2FWEA 2QA1A 3IAS2 3ERGA 1K0BA 3QMXA 2LNTA 1OC9B 5J47A 4EDZA 2VO4A 5CP1A 1JFUA 1Z3EA 2H70A 2N5BA 2HSYA 1F2EA 5ELGA 3MNGA 4O5QA 2IFQB 4N3ZA 4ZB6A 4HQSA 1SKWB 2GLRA 4RQRA 4FYBA 3EWLA 1SYRA 1K0MA 2V32A 4YQUA 2CVDA 2IMKA 2F9SA 4WR5A 3TGZA 1THXA 3PINA 1VF1A 2WW3A 1A2LA 4WF4A 3DXBA 3LORA 1ERWA 3H1NA 3BCIA 1ON4A 3QPMA 2I1UA 2QKEA 2WZ9A 2XHFA 5DVBA 4K7OA 2O5VA 2MYGA 4AGSA 5F06A 4YKFA 5FT3A 2KP2A 2YOIA 2WCIA 3VPQA 1VF3A 4K5RA 5KN1A 5B6NA 2X8GA 2GS3A 1GSSA 3VWVA 1WOUA 2LKUA 3EINA 1XOAA 4NXIA 3F3QA 2H1DA 5B8BA 4HZ4A 3FR6A 1SJZA 3S9FA 2WB9A 1YEPA 5CRHA 3G7IA 1SENA 4RUVA 1M2BA 4HOJA 3APOA 4L5OA 4KNDA 4YAPA 1XW9A 4V1Ag 1YEXA 4J57E 5CYYA 3IHGA 5B8AA 3ED3A 3GSSA 1USBA 2C3QA 1TXUA 4MJEA 6GSSA 2C8UA 5IM9A 3A2XA 4ZB8A 5D93A 2CVBA 4KUNA 3HHVA 2AAWA 2ES7A 2HT9A 2IPAA 3L9UA 2LRCA 3I6AA 1Z7PA 3VWUA 3EMPA 2YWOA 2HE3A 2CAIA 1TOFA 2TRCP 1XOBA 4KGIA 3IBHA 4E68A 2WVXA 2VL9A 3LXZA 3TJFA 3G7JA 5ID2A 5G1KA 3RPNA 3CSHA 1OYJA 1X0RA 3CWGA 3U6VA 3KZQA 2QSIA 3KP9A 1OVNA 1A8LA 1G0TA 4N10A 3M3MA 1S4BP 4E8EA 3LG6A 5KOXA 2D2ZA 5A5HB 1SVMA 2QC7A 4HDEA 5F05A 1EEJA 1EP7A 4AJ8A 1H75A 2JACA 1XWGA 3BJ5A 2V6OA 1PMTA 3GMFA 3RHBA 2BTOT 3IXRA 2IIYA 1TU8A 4XHMA 1B4PA 2I4AA 1ZL9A 2EFCA 2LNSA 5ABRA 3IC4A 4KE3A 6GSYA 1NHOA 3WT2A 1SD8A 4IKHA 1O6JA 1H4OA 2GSSA 2R0PA 3TJBA 2MBTA 1GSYA 3FR3A 3DWVA 5JCWA 2H0GA 5HFGA 4PNGA 5IMAA 5D8IA 1JZRA 1OKDA 2H75A 5EPFA 4F0BA 4JRRA 5G31A 4PXOA 2QA2A 4MF7A 3CRTA 2IWTA 5GSSA 3HYPA 3WGXA 1FW1A 1EGRA 2GSQA 2LQOA 1OKTA 6GSUA 1AC1A 3HJMA 1GTIA 1O73A 5LD0A 1TXXA 2H1BA 2YJHA 3EE2A 5CRDA 1EZKA 5CREA 2HSNA 4AKIA 4KSMA 1V58A 4K1FA 3KJYA 4D73B 4POLA 2IL3A 5ECNB 3I43A 1RQMA 3WD6A 2IMIA 1R26A 1MTCA 2LSTA 2GT6A 2FD3A 4IBPA 2R3XA 2B5XA 5J4UA 1A2JA 3H93A 5A4UA 4HS1A 2HXKA 2JZTA 3EU3A 1MD3A 4J2FA 3BD2A 3FR9A 4IGJA 2OE1A 3G9BA 2TRXA 2C1YA 2AJQB 4Z7XA 1ZYNA 1PN9A 2MMZA 4POMA 1YEWC 4Q5RA 4KDUA 4KF9A 1Z7RA 1PGTA 3C7MA 1CQGA 5FWGA 4WXTA 2KUCA 4F2IA 2O85A 1XVQA 1PD21 4YAVA 3IC8A 2DSAA 4EXJA 4XCSA 4TXVA 5IO2A 2WVYA 1WP0A 5ECHB 3ZMLA 4MJAA 4GCIA 4I5QA 3F4SA 1HYUA 4PQHA 4OMVA 1XG8A 4LMWA 3ZYWA 2WULA 3UBLA 2NDOA 3PGTA 3TDGA 3TKRA 4K6XA 4GWRA 5HR1A 2FWGA 4XRAA 1O8WA 2H72A 4BVYA 3HDCA 2HRFA 2DIZA 5DCHA 3KGKA 1EGOA 1X9WB 2CT6A 2ON5A 3GV1A 4POKA 2X99A 3VWWA 3WGEA 3ZMKA 1AW9A 2C0GA 5GAND 3R2QA 1R5PA 4NHZA 2H1LA 1EV4A 4MH2A 4MK3A 2MMAA 2LTKA 2HI7A 4TW5A 3Q18A 4DSRA 2YWNA 2R4VA
chains in the Genus database with same CATH topology
2I81A 1EOGA 5B6MA 5ECMB 2PWJA 3D22A 5B7CA 1EWXA 4PTSA 2YJ7A 2LJRA 4MF5A 3ZFBA 1PA3A 3Q19A 3M0FA 1M7TA 2CV4A 2YV7A 5KN3A 1K3LA 5DAKB 2X8CA 4NHWA 1F3BA 1MDKA 4YQMA 3GURA 1SVLA 1TK8B 4IJ3A 3HCZA 3IRAA 2ZCTA 1OE7A 3WT1A 2MBSA 1ML6A 4JU5A 3R3EA 3GA4A 2EIRA 3ZRDA 2V6KA 4ILFA 4Z2TA 1LJRA 3DIEA 4JZQA 2LRNA 3H79A 5GAPD 2H74A 3E3EA 2CVKA 3CYNA 5AISA 3DKSA 2CZ2A 4J56E 4TR0A 2YANA 5F8BA 1B8XA 3UVTA 3OR5A 4ZXGA 2REMA 2EFEA 1A8YA 4PUAA 4JE1A 1IYIA 4OFMA 4O92A 1O7UA 1FB0A 2HZEA 1BQ7A 5EL8A 3CSJA 1AXDA 2E2MA 4LMVA 2OT3A 1JLWA 4HUAA 5D9XA 1XWKA 2C3TA 5IMDA 2OA7A 2DC5A 2VD0A 3J7Yk 2H19A 1TTZA 1SL1B 4FYUA 2PVOC 4GQCA 3RDWA 2O89A 3M1GA 2FLSA 4USSA 3LJRA 2PN8A 2VLUA 1URMA 2DJ0A 1B9XC 4YKGA 1XWAA 3H8QA 2H76A 2IN3A 3FZ9A 2VUPA 3TKSA 3ZIVA 4QMKA 1XFLA 1A0RP 2WJUA 3M8NA 2GDRA 4N0ZA 1WE0A 1FAAA 1DSBA 1UN2A 2DBCA 3LW9A 3UL3A 3L0HA 1YQ1A 4FIWA 3IV4A 4X1UA 3EURA 2VM1A 5LCZA 4BWSA 3FZ5A 2YNXA 3L78A 5KN0A 2DIYA 3TJGA 3PR8A 1GWCA 4FH8A 3WYWA 3DMLA 5C04A 5J9CA 2HSHA 1GP1A 4DSSA 1ZCPA 2OBIA 4A5PA 2HSMA 17GSA 2VCVA 4AKHA 5GSTA 5ECLB 2O87A 4PQ1A 3ZITA 2HSNB 1V9WA 2GSTA 1EV9A 1O8XA 1R5AA 4I2TA 1TP9A 2M80A 1V57A 3UVHA 1G7OA 3QAWA 2TIRA 2JADA 3TRQA 4K7IA 5IO0A 2DKIA 3RAZA 4N30A 1N8JA 2EIOA 4G01A 2CX3A 5CO3A 1ZGNA 3FKFA 1Q98A 1ZYEA 3MDKA 2I9HA 1IYHA 4BA7A 1OE8A 3KTLA 1K0OA 5DCGA 1GLPA 4QL9A 2OE0A 2FA4A 2H73A 4KCEA 3HA9A 1K0AA 4HQZA 5IMZA 1WIKA 2O7KA 1F37A 3ZVJD 4ZB7A 2CQ9A 3GTUA 2ALBA 2XBIA 4MF6A 4IQAA 4K7NA 4LL1B 5EVOA 1GUHA 1WPIA 3ISOA 1SJIA 3F0IA 4RI6A 1UC7A 2X64A 1YVLA 3GKKA 3EC3A 4TN8A 4YQVA 1I9DA 3IHQA 6GSWA 4HU9A 3GX8A 3A2WA 2I3YA 3UOMA 2IMFA 3GFKA 5FHIA 2OACA 2B1LA 2LJKA 2IJYA 16GSA 4BVYB 1AIUA 5ECSA 1U6TA 2L4QA 1O81A 2VL2A 1Y1UA 1SYXA 4LA1A 4X43A 3SBCA 4RQXA 2PBJA 3V1WA 2V1MA 5A1NB 5IMCA 5BMUA 1FOHA 4OD7A 1YJ6A 1B48A 3IA1A 4IVFA 1JZOA 4PUFC 5HR0A 4EDYA 5DQYA 10GSA 2VCXA 4XS4A 4TOPA 3NIVA 3QDNA 2YZHA 8GSSA 4G0IA 2DMMA 4L0UA 1GSUA 1TKDB 1WMJA 2VLVA 2X8HA 1MD4A 3DYRA 1BJXA 3F9UA 5E59A 4EC0A 3K8NA 18GSA 4ULXA 2NBSA 2F51A 1HNBA 5ECKB 1KBNA 2F8FA 1JZDA 3GRXA 3J7Yb 2L5OA 2JSZA 3TKSC 3KCMA 1GULA 1GTUA 5L71A 3FMWA 4WKWA 4G0KA 3IK9A 1NHYA 4GSNA 1O85A 3PH9A 3UEMA 2LUSA 3HD5A 1RK4A 3F63A 4EIPA 4EE0A 3KIJA 3G7YA 2DJJA 3IPZA 2AV4A 4L0WA 4EUYA 4ZL9A 1YF0A 5A34A 4K0NA 4RI7A 5DDLA 3C73A 1AUCA 2A2PA 4TXOB 3FHKA 4DVCA 4JEDA 1ILOA 2B3SA 3CSIA 3KD0A 2HRKA 2N5FA 3D4TA 3QD9A 1GNWA 2A2RA 2GZPA 4MA9A 2C0EA 3LXTA 3QFAC 5J4VA 3C1RA 2HLSA 2NPBA 3O3TA 3TKSE 2GTUA 2C0DA 4MDCA 4XS6A 5G30A 2M72A 4NMUA 1Z5YE 4HEA2 1HQOA 3P7XA 1HNCA 1Q4JA 1PN0A 3KMOA 2H0HA 4KDYA 1OC9A 5D73A 5HR3A 3VK9A 5J3RA 2YCDA 2YP6A 5ECPB 4TR1A 3ZLPA 1QXHA 4I2UA 5C00A 22GSA 2VOCA 2PGTA 3DVWA 2VCWA 4F0CA 1FG4A 2ZNMA 2JL4A 4WR4A 1TDIA 4BL7A 1GLQA 1VGLA 4GXZA 1C72A 1UVZA 1F9MA 2B7JA 2CZ3A 4Z2RA 4O5UA 3TRPA 1WWJA 4XTSA 3D4MA 5DALA 5A5KA 3IK7A 3P2AA 2H30A 2WRTA 4EKZA 2UV8G 1PRXA 4KA0A 4ECCA 4DSSB 1N2AA 1Y25A 3UIWA 1TK5B 1K3YA 2FWHA 2XC2A 2HSMB 2DJ3A 5H5QA 2GQLA 3W8SA 1ZYPA 4MZWA 5AGYA 1BG1A 3TOUA 3MAKA 4V2MA 3CXGA 3BBYA 4EF0A 2VL2C 4EIQA 3GX0A 1XVWA 2HZFA 3MWHA 3PPUA 5ELAA 2R6KA 1EP8A 1BF5A 4EVMA 1A0FA 2PVQA 1AQWA 4MLYA 3F8UA 1XW6A 19GSA 4HJ2A 3EVIA 2E7PA 1PX6A 3KM6A 2G0FA 4KAEA 1R7HA 1QQ2A 1TI3A 4ZBDA 7GSSA 2H1AA 4V1Ap 5ECIB 4P3YB 4CY8A 3HVSA 1SK1A 4K9ZA 4IS0A 1JLVA 2FGXA 3Q6OA 3GTUB 3AY8A 5DJLA 1MDJA 4TR4A 1X5DA 1W89A 3HJPA 5J41A 2C80A 4ID0A 2GZYA 2GGTA 4W66A 1U3AA 3LYPA 2CX4A 5JWQB 3CRUA 1JZWA 1Y6EA 5KEJA 5EY6A 2OJLA 3APSA 1FHEA 4XIHA 1YZXA 1EOHA 3DVXA 20GSA 2OKAA 4ECJA 1TI1A 4WF5A 3N9JA 2A4HA 4OCEA 5H5RA 4PNFA 2VCQA 4MPFA 1PQNA 3ME7A 1ERVA 1DE1A 3C8EA 4NAXA 2PERA 4K0GA 5D96A 1GSQA 1XZOA 4ZL8A 3TRXA 1R4WA 2OE3A 3VFIA 3I69A 1SL2B 1XXUA 1WRYA 1VF4A 2HRNA 3GKMA 3ZL5A 2O8VB 4POBA 4JBBA 4XS4B 3CBUA 1QUWA 3HMJG 3VWXA 4Q5NA 1PL2A 1V40A 2DJKA 1AAZA 4NWYA 5ID2B 1ZYQB 3HXSA 1A2MA 5D9TA 4Z2UA 3GYKA 4ML6A 3GIXA 1WJKA 3D6IA 3KH7A 2B5YA 3HZ4A 4AKXB 5JWRB 1TW9A 3LSZA 4EL1A 2HNLA 4KDXA 2AYTA 3HVVA 1M2DA 3E9JB 1NM3A 1KEBA 1Z9HA 3O76A 4O32A 3VLNA 2V2GA 3GHAA 1GUMA 3HKRA 1NSWA 1ERUA 2H1GA 1ABAA 4OO5A 2VCZA 11GSA 2M46A 3TJKA 4D73A 1M2AA 4AJ7A 2VD1A 4X4JA 4HZ2A 3GKNA 3HJOA 5ENUA 5A34B 5ECRB 4ZIJA 4MH3A 2GSRA 1YDKA 1FO5A 3F4TA 4WBRD 4NV5A 2HQTA 4MNNA 3BCKA 3IDVA 2OADA 2WGRA 2L4CA 2HRKB 4MZCA 2JZSA 2AB6A 2VIMA 4TVEA 1T1VA 3CTFA 4K2DA 2J23A 3L4NA 3TOTA 3FZAA 4JR6A 1ST9A 5JCGA 3KTBA 5A4VA 4F9ZA 4CDOA 3U5RE 1ZOFA 1FB6A 1TK0B 4AF2A 1F3AA 4TRXA 1TU7A 5E4WA 9GSSA 2EFDA 4ECIA 1ERTA 5KN2A 4IN0A 4F82A 3SWLA 2B7KA 3ZREA 4O5RA 3TKQA 2X4AA 4TR1B 4N0VA 4HU7A 4FQUA 1X9SB 2C0FA 4FO5A 5J4YA 4K5SA 3QAGA 2KHPA 2HYXA 3GL3A 4OO4A 4GQFA 1SU9A 1GSFA 3IR4A 4ZILA 4BL7B 3KP8A 3VURA 4KCAA 2VAFA 2NVLA 4GDFA 2DMLA 1KTEA 3GL5A 2MMOA 5DALB 2HRAA 3DD3A 3LGCA 1DBYA 1X5CA 2YWIA 1HD2A 4OCFA 2MZCA 2V41A 3RPPA 5ECQB 5DBQA 4IELA 4MPGA 4OFNA 4F03A 5DAKA 3M9KA 1BYEA 4WEYA 1GRXA 4OWYA 1A23A 3UBKA 2P31A 3TU3B 4MJCA 5IPGA 3GSTA 1MEKA 5IQYA 4BWQA 3MIXA 1KNGA 4GF0A 5KOWA 1FVJA 3EPTA 4K2XA 2CAQA 2IMDA 2GVPA 4I97A 2RM6A 2P5RA 3P90A 2R37A 1J0FA 5CNWA 4GSSA 3P8WA 3US3A 2PPTA 1XWBA 3GH9A 5HFIA 5F07A 2EFHA 3ZZXA 3D21A 1M0UA 3W6GA 4CHSA 3FW2A 3A2VA 1PKWA 4MMMA 5IPHA 5AIXA 1A24A 1PX7A 2FY6A 2IMEA 1UA5A 2E0QA 4IP6A 2X49A 2A2SA 4GLTA 3VPTA 2BJXA 2OBKA 3KMNA 4G19A 1T4ZA 3HVXA 3MSZA 2ON7A 3UARA 3NZNA 3UMAA 1GTAA 3ME8A 1DE2A 2EIQA 4BVXA 5JCUA 5J40A 1DUGA 4X0XA 4MP4A 2F3MA 1T4YA 2CA8A 4BPYA 2XPDA 3IOSA 3GN3A 1MDIA 2FCHA 2YZUA 4KH7A 1YKCA 3F4RA 1QK8A 1QGVA 3JCML 1Z6MA 3DGQA 4EO3A 3KH9A 3GNJA 4TKYA 3Q74A 3TKPA 2HZEB 2LQQA 4MCUA 3UJ1A 3RHCA 2R2JA 1OC8A 1GH2A 2YN1A 1HNAA 1XPVA 4KSOA 1THOA 4XS1A 4Q5QA 4OFTA 2DKHA 1S3AA 3ERFA 2VM2A 3QR6A 2UZ8A 4IP1A 4V2LA 2R5GA 4E8HA 2LJAA 3EMXA 3I9V2 3HY2A 5D9VA 4L5LA 1B9YC 3F6DA 1BEDA 1CQHA 3F3RA 2B6MA 3FY7A 1T3BA 1FVKA 4KX4A 1V2AA 2L59A 3QCPA 2NTOA 1T00A 4CW9A 2VKZG 4G2EA 3CTGA 2L5LA 2RIIA 2H6ZA 4KB3A 1XIYA 4ZBAA 2JSYA 5DJMA 5D9WA 2IFQA 1QFNA 1YF1A 3A5IA 4DEJA 1GNEA 5ECOB 4AKGA 3WGDA 3C1SA 3IE3A 4XRDA 3DRNA 3ZFLA 2B1KA 2FWFA 2BMXA 4Q5FA 1J9BA 3FEUA 4GTUA 2DLXA 2K8SA 1W4VA 3EYTA 1YKAA 2JZRA 5DQSA 2H71A 2PUKC 1PKZA 4IJIA 2K9FA 2FNOA 4MZBA 1B4QA 4G10A 4MJBA 5J9BA 3M9JA 3TCOA 2PU9C 2R0GA 2L6CA 4FYCA 3DEXA 3IAM2 4WBJA 1M99A 2N5AA 2E2GA 2FHEA 1SD9A 1SKSB 2WFCA 1M9BA 2EC4A 3A3TA 1M9AA 14GSA 2H66A 2PMTA 2YPMA 3APQA 2GQKA 1I5GA 2K18A 4IHUA 1X9MB 1FOVA 4HJMA 5HFKA 5GZZB 4JR4A 4WETA 1E2YA 4GSTA 1Z6NA 2H6XA 1PSQA 1TJDA 4PQIA 4CY6A 5AIVA 4I8BA 2RLIA 1BAYA 1SK0A 2GZZA 1SL0B 3QOUA 2RUEA 4DSQA 5CRWA 4ISDA 4ICYA 1TRUA 3GKXA 1V98A 4ZBBA 5IMFA 1BX9A 2GT5A 3NOFA 1K0NA 1OC3A 3F6FA 5BRTA 2AHEA 1GUKA 5G5FA 3D5JA 5G5EA 1K0CA 2AUVA 1XWCA 3D0ZA 2VL3A 3ZIJA 1XW5A 1BG5A 5A1NA 1S3DA 2H01A 2XPEA 5IMVA 2K8VA 4QQ7A 3A5WA 1GSEA 1K3OA 1J08A 1ZZYA 3FRCA 2LS5A 3FK8A 2RM5A 4PURA 1G6WA 3TUEA 1T7PB 4IQ1A 4ZB9A 3BOAA 2Z9SA 2F8AA 1E6BA 4ECBA 1XBSA 2C3NA 4GRFA 1LU4A 3RBTA 5HQPA 2LV3A 1GSDA 1TRVA 2H6YA 6GSVA 1RW1A 2KOKA 1VF2A 1K0DA 2VLTA 2ZUPA 2P0GA 4NV2A 5A5HA 1AQVA 2B5EA 2P5QA 2YV9A 1YY7A 3QFBC 3QAVA 2C4JA 3UAPA 2G2QA 1U3IA 2FA8A 4PGTA 5CRGA 5BMUB 2RUFA 2FUG2 4K8MA 5IOWA 3VI5A 2LEGA 1ACVA 5F0GA 2YWMA 4KW6A 1XCCA 4ML1A 2XBQA 5H5SA 1GL8A 2H8LA 1OAZA 1TRSA 4ZL7A 5J5NA 2VCTA 5HR2A 5COHA 5IOXA 5G2ZA 2A4VA 12GSA 3ZVJA 1U88A 3TB2A 5JWOB 4LL4B 2LRTA 6GSXA 2DJ2A 1SK2A 4TXOA 4AI6A 3KXOA 3LQ7A 5LNKe 1SKRB 2J9HA 3LEFA 4YH2A 2H0IA 3FZ4A 2KLXA 4L8EA 1JHBA 2MMNA 13GSA 3H4KA 1TRWA 3KEBA 1G7EA 2HFDA 3L9SA 1ZMAA 4TR3A 1GTBA 4BVXB 4QL7A 1N25A 2WS2A 1X5EA 4AJ6A 5G1LA 2GQMA 3LYKA 4HI7A 3MYDA 2KP1A 5IIZA 2JU5A 2R0CA 5INYA 4V2NA 2L6DA 3ERWA 4LLRA 1VRSD 1G6YA 3W8JA 1NW2A 4G0LA 1F6MC 3LWAA 3GH6A 6GSTA 5AN1A 3L9VA 2DJ1A 3O6TA 3EU4A 1T8EB 1SJ6A 4MABA 4H86A 3ZTLA 4I6XA 1LBKA 2QGVA 3HZ8A 2K6VA 4N11A 2L57A 4NPBA 3N5OA 1PL1A 3GUSA 3E0UA 3CMIA 5A4WA 1S3CA 5CAXA 1AQXA 1QMVA 4O7HA 1U87A 3LFLA 1EEMA 4IW9A 3TJJA 4G9HA 3FYGA 3C71A 1SVOA 4PX1A 4ACSA 2WDUA 3VI7A 2FWEA 2QA1A 3IAS2 3ERGA 1K0BA 3QMXA 2LNTA 1OC9B 5J47A 4EDZA 2VO4A 5CP1A 1JFUA 1Z3EA 2H70A 2N5BA 2HSYA 1F2EA 5ELGA 3MNGA 4O5QA 2IFQB 4N3ZA 4ZB6A 4HQSA 1SKWB 2GLRA 4RQRA 4FYBA 3EWLA 1SYRA 1K0MA 2V32A 4YQUA 2CVDA 2IMKA 2F9SA 4WR5A 3TGZA 1THXA 3PINA 1VF1A 1A2LA 4WF4A 3DXBA 3LORA 1ERWA 3H1NA 3BCIA 1ON4A 3QPMA 2I1UA 2QKEA 2WZ9A 2XHFA 5DVBA 4K7OA 2O5VA 2MYGA 4AGSA 5F06A 4YKFA 5FT3A 2KP2A 2YOIA 2WCIA 3VPQA 1VF3A 4K5RA 5KN1A 5B6NA 2X8GA 2GS3A 1GSSA 3VWVA 1WOUA 2LKUA 3EINA 1XOAA 4NXIA 3F3QA 2H1DA 5B8BA 4HZ4A 3FR6A 1SJZA 3S9FA 2WB9A 1YEPA 5CRHA 3G7IA 1SENA 4RUVA 1M2BA 4HOJA 3APOA 4L5OA 4KNDA 4YAPA 1XW9A 4V1Ag 1YEXA 4J57E 5CYYA 3IHGA 5B8AA 3ED3A 3GSSA 1USBA 2C3QA 1TXUA 4MJEA 6GSSA 2C8UA 5IM9A 3A2XA 4ZB8A 5D93A 2CVBA 4KUNA 3HHVA 2AAWA 2ES7A 2HT9A 2IPAA 3L9UA 2LRCA 3I6AA 1Z7PA 3VWUA 3EMPA 2YWOA 2HE3A 2CAIA 1TOFA 2TRCP 1XOBA 4KGIA 3IBHA 4E68A 2VL9A 3LXZA 3TJFA 3G7JA 5ID2A 5G1KA 3RPNA 3CSHA 1OYJA 1X0RA 3CWGA 3U6VA 3KZQA 2QSIA 3KP9A 1OVNA 1A8LA 1G0TA 4N10A 3M3MA 4E8EA 3LG6A 5KOXA 2D2ZA 5A5HB 1SVMA 2QC7A 4HDEA 5F05A 1EEJA 1EP7A 4AJ8A 1H75A 2JACA 1XWGA 3BJ5A 2V6OA 1PMTA 3GMFA 3RHBA 2BTOT 3IXRA 2IIYA 1TU8A 4XHMA 1B4PA 2I4AA 1ZL9A 2EFCA 2LNSA 5ABRA 3IC4A 4KE3A 6GSYA 1NHOA 3WT2A 1SD8A 4IKHA 1O6JA 1H4OA 2GSSA 2R0PA 3TJBA 2MBTA 1GSYA 3FR3A 3DWVA 5JCWA 2H0GA 5HFGA 4PNGA 5IMAA 5D8IA 1JZRA 1OKDA 2H75A 5EPFA 4F0BA 4JRRA 5G31A 4PXOA 2QA2A 4MF7A 3CRTA 2IWTA 5GSSA 3HYPA 3WGXA 1FW1A 1EGRA 2GSQA 2LQOA 1OKTA 6GSUA 1AC1A 3HJMA 1GTIA 1O73A 5LD0A 1TXXA 2H1BA 2YJHA 3EE2A 5CRDA 1EZKA 5CREA 2HSNA 4AKIA 4KSMA 1V58A 4K1FA 3KJYA 4D73B 4POLA 2IL3A 5ECNB 3I43A 1RQMA 3WD6A 2IMIA 1R26A 1MTCA 2LSTA 2GT6A 2FD3A 4IBPA 2R3XA 2B5XA 5J4UA 1A2JA 3H93A 5A4UA 4HS1A 2HXKA 2JZTA 3EU3A 1MD3A 4J2FA 3BD2A 3FR9A 4IGJA 2OE1A 3G9BA 2TRXA 2C1YA 2AJQB 4Z7XA 1ZYNA 1PN9A 2MMZA 4POMA 4Q5RA 4KDUA 4KF9A 1Z7RA 1PGTA 3C7MA 1CQGA 5FWGA 4WXTA 2KUCA 4F2IA 2O85A 1XVQA 1PD21 4YAVA 3IC8A 2DSAA 4EXJA 4XCSA 4TXVA 5IO2A 1WP0A 5ECHB 3ZMLA 4MJAA 4GCIA 4I5QA 3F4SA 1HYUA 4PQHA 4OMVA 4LMWA 3ZYWA 2WULA 3UBLA 2NDOA 3PGTA 3TDGA 3TKRA 4K6XA 4GWRA 5HR1A 2FWGA 4XRAA 1O8WA 2H72A 4BVYA 3HDCA 2HRFA 2DIZA 5DCHA 3KGKA 1EGOA 1X9WB 2CT6A 2ON5A 3GV1A 4POKA 2X99A 3VWWA 3WGEA 3ZMKA 1AW9A 2C0GA 5GAND 3R2QA 1R5PA 4NHZA 2H1LA 1EV4A 4MH2A 4MK3A 2MMAA 2LTKA 2HI7A 4TW5A 3Q18A 4DSRA 2YWNA 2R4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GST A;  1EOG A;  5ECM B;  1HQO A;  5B7C A;  1HNC A;  1LBK A;  4PTS A;  2LJR A;  4MF5 A;  3ZFB A;  5IQY A;  1Q4J A;  1PA3 A;  3Q19 A;  3KMO A;  3M0F A;  3N5O A;  1PL1 A;  2YV7 A;  3GUS A;  4KDY A;  5D73 A;  1K3L A;  3VK9 A;  4GF0 A;  5DAK B;  5A4W A;  1AQX A;  2YCD A;  4NHW A;  4O7H A;  1F3B A;  1U87 A;  2CAQ A;  5ECP B;  3LFL A;  1EEM A;  4IW9 A;  4YQM A;  3GUR A;  4G9H A;  3FYG A;  4I97 A;  4PX1 A;  4ACS A;  2WDU A;  3VI7 A;  22GS A;  3P90 A;  4GSS A;  1OE7 A;  3ERG A;  1K0B A;  3P8W A;  2PGT A;  1ML6 A;  5F07 A;  3R3E A;  2VCW A;  4F0C A;  2V6K A;  1M0U A;  2JL4 A;  4WR4 A;  1TDI A;  1LJR A;  4CHS A;  4JZQ A;  4BL7 A;  1GLQ A;  1PKW A;  1C72 A;  2VO4 A;  4EDZ A;  5AIX A;  1PX7 A;  1UA5 A;  5AIS A;  1F2E A;  2A2S A;  4GLT A;  5ELG A;  2CZ2 A;  3VPT A;  4ZB6 A;  2CZ3 A;  3KMN A;  2GLR A;  4G19 A;  5F8B A;  1K0M A;  1B8X A;  5DAL A;  5A5K A;  3IK7 A;  4ZXG A;  2ON7 A;  4YQU A;  3UAR A;  2WRT A;  1GTA A;  4PUA A;  2CVD A;  2IMK A;  4WR5 A;  4ECC A;  3TGZ A;  1IYI A;  1N2A A;  4OFM A;  4O92 A;  1VF1 A;  1K3Y A;  4BVX A;  2HSM B;  5JCU A;  1DUG A;  3W8S A;  5EL8 A;  3CSJ A;  4MP4 A;  1AXD A;  2F3M A;  4MZW A;  5AGY A;  4LMV A;  3TOU A;  1JLW A;  3MAK A;  5D9X A;  2CA8 A;  3H1N A;  1XWK A;  3BBY A;  2C3T A;  2OA7 A;  2DC5 A;  2VD0 A;  4KH7 A;  1YKC A;  3GX0 A;  3PPU A;  3DGQ A;  5ELA A;  3Q74 A;  2R6K A;  4AGS A;  3M1G A;  4USS A;  1A0F A;  5F06 A;  1HNA A;  2PVQ A;  3LJR A;  5FT3 A;  1AQW A;  4Q5Q A;  1XW6 A;  4OFT A;  19GS A;  4HJ2 A;  3VPQ A;  3ERF A;  3QR6 A;  2UZ8 A;  1PX6 A;  3KM6 A;  4KAE A;  1VF3 A;  2R5G A;  4E8H A;  4ZBD A;  7GSS A;  5ECI B;  2WJU A;  3M8N A;  5D9V A;  1GSS A;  2GDR A;  3EIN A;  4L5L A;  3F6D A;  4HZ4 A;  3FR6 A;  4IS0 A;  1JLV A;  2WB9 A;  3G7I A;  3GTU B;  3FY7 A;  3AY8 A;  5DJL A;  4HOJ A;  4L5O A;  4KX4 A;  5J41 A;  2C80 A;  1V2A A;  4YAP A;  4ID0 A;  3L0H A;  1YQ1 A;  2NTO A;  3LYP A;  3CRU A;  1Y6E A;  5LCZ A;  4ZBA A;  5KEJ A;  3GSS A;  5EY6 A;  1USB A;  2C3Q A;  5DJM A;  6GSS A;  5D9W A;  2C8U A;  3PR8 A;  4ZB8 A;  4DEJ A;  1FHE A;  1GWC A;  3WYW A;  1EOH A;  1GNE A;  5ECO B;  2AAW A;  20GS A;  4ECJ A;  3IE3 A;  3ZFL A;  3N9J A;  4PNF A;  2HSM A;  2VCQ A;  3I6A A;  17GS A;  4MPF A;  4Q5F A;  2VCV A;  4GTU A;  5GST A;  3C8E A;  5ECL B;  2CAI A;  4NAX A;  5DQS A;  2PER A;  4K0G A;  2HSN B;  4KGI A;  1GSQ A;  2GST A;  3IBH A;  1PKZ A;  4IJI A;  2FNO A;  3LXZ A;  3G7J A;  1EV9 A;  1R5A A;  3I69 A;  4G10 A;  3CSH A;  1OYJ A;  3U6V A;  1VF4 A;  3UVH A;  1G7O A;  3QAW A;  3M3M A;  4E8E A;  1M99 A;  3LG6 A;  2D2Z A;  4JBB A;  2FHE A;  3CBU A;  5F05 A;  1M9B A;  1M9A A;  1ZGN A;  3VWX A;  14GS A;  2PMT A;  4Q5N A;  1PL2 A;  1XWG A;  3MDK A;  1V40 A;  1IYH A;  5HFK A;  5GZZ B;  1PMT A;  4GST A;  5D9T A;  1OE8 A;  3KTL A;  1K0O A;  5DCG A;  1TU8 A;  1B4P A;  1GLP A;  4PQI A;  5AIV A;  1ZL9 A;  4KE3 A;  1K0A A;  1BAY A;  6GSY A;  1TW9 A;  3LSZ A;  4IKH A;  4ISD A;  2HNL A;  4KDX A;  3GTU A;  2GSS A;  4MF6 A;  4IQA A;  4ZBB A;  1BX9 A;  1Z9H A;  5EVO A;  1GSY A;  3FR3 A;  1GUH A;  3O76 A;  5JCW A;  3VLN A;  3ISO A;  4RI6 A;  4PNG A;  1K0N A;  1JZR A;  2X64 A;  1GUM A;  3F6F A;  3HKR A;  2AHE A;  1GUK A;  2VCZ A;  5G5F A;  4F0B A;  4YQV A;  11GS A;  5G5E A;  4PXO A;  1K0C A;  4MF7 A;  3CRT A;  6GSW A;  5GSS A;  3D0Z A;  1XW5 A;  1BG5 A;  4QQ7 A;  1FW1 A;  2GSQ A;  1GSE A;  1K3O A;  5FHI A;  1OKT A;  2VD1 A;  6GSU A;  2OAC A;  4HZ2 A;  3HJO A;  3FRC A;  3HJM A;  1GTI A;  4PUR A;  16GS A;  1G6W A;  4BVY B;  5LD0 A;  5ECS A;  4IQ1 A;  4ZB9 A;  5ECR B;  2GSR A;  3EE2 A;  1YDK A;  1E6B A;  4ECB A;  2C3N A;  4KSM A;  3KJY A;  2HQT A;  3RBT A;  2PBJ A;  2OAD A;  2IL3 A;  1GSD A;  2HRK B;  5BMU A;  2AB6 A;  5ECN B;  1YJ6 A;  6GSV A;  1B48 A;  3WD6 A;  1VF2 A;  4IVF A;  1K0D A;  2IMI A;  1MTC A;  3TOT A;  5A4V A;  4IBP A;  2R3X A;  4EDY A;  10GS A;  5J4U A;  2VCX A;  1AQV A;  4TOP A;  2YV9 A;  1YY7 A;  3NIV A;  3QAV A;  8GSS A;  2C4J A;  1F3A A;  5A4U A;  3UAP A;  1TU7 A;  4G0I A;  1U3I A;  9GSS A;  1MD3 A;  4ECI A;  4J2F A;  4PGT A;  3FR9 A;  4IGJ A;  1GSU A;  3SWL A;  3VI5 A;  1MD4 A;  1PN9 A;  4EC0 A;  18GS A;  5F0G A;  4N0V A;  4FQU A;  4Q5R A;  4KDU A;  4KF9 A;  1PGT A;  5FWG A;  1HNB A;  5ECK B;  1KBN A;  1PD2 1;  2F8F A;  4YAV A;  5J5N A;  3IC8 A;  2VCT A;  2DSA A;  3QAG A;  4EXJ A;  1GSF A;  1GUL A;  3IR4 A;  1GTU A;  5ECH B;  12GS A;  1U88 A;  3ZML A;  4BL7 B;  6GSX A;  4GCI A;  3VUR A;  3KXO A;  3LQ7 A;  4G0K A;  2J9H A;  4PQH A;  4OMV A;  4YH2 A;  4LMW A;  3IK9 A;  3UBL A;  4L8E A;  1NHY A;  4GSN A;  3PGT A;  5DAL B;  13GS A;  2HRA A;  1RK4 A;  3DD3 A;  3F63 A;  4EE0 A;  4BVY A;  1GTB A;  4BVX B;  2WS2 A;  4K0N A;  2ON5 A;  4RI7 A;  5DDL A;  3LYK A;  4HI7 A;  1AW9 A;  3ZMK A;  4JED A;  5ECQ B;  3R2Q A;  4NHZ A;  3CSI A;  4IEL A;  4MPG A;  1EV4 A;  2HRK A;  2N5F A;  4MK3 A;  4OFN A;  4F03 A;  1GNW A;  2A2R A;  5DAK A;  3LXT A;  1G6Y A;  3O3T A;  3Q18 A;  1BYE A;  4G0L A;  2R4V A;  3GH6 A;  3UBK A;  2GTU A;  6GST A;  4MDC A;  5AN1 A; 
#chains in the Genus database with same CATH topology
 2I81 A;  1EOG A;  5B6M A;  5ECM B;  2PWJ A;  3D22 A;  5B7C A;  1EWX A;  4PTS A;  2YJ7 A;  2LJR A;  4MF5 A;  3ZFB A;  1PA3 A;  3Q19 A;  3M0F A;  1M7T A;  2CV4 A;  2YV7 A;  5KN3 A;  1K3L A;  5DAK B;  2X8C A;  4NHW A;  1F3B A;  1MDK A;  4YQM A;  3GUR A;  1SVL A;  1TK8 B;  4IJ3 A;  3HCZ A;  3IRA A;  2ZCT A;  1OE7 A;  3WT1 A;  2MBS A;  1ML6 A;  4JU5 A;  3R3E A;  3GA4 A;  2EIR A;  3ZRD A;  2V6K A;  4ILF A;  4Z2T A;  1LJR A;  3DIE A;  4JZQ A;  2LRN A;  3H79 A;  5GAP D;  2H74 A;  3E3E A;  2CVK A;  3CYN A;  5AIS A;  3DKS A;  2CZ2 A;  4J56 E;  4TR0 A;  2YAN A;  5F8B A;  1M3I A;  1B8X A;  3UVT A;  3OR5 A;  4ZXG A;  2REM A;  2EFE A;  1A8Y A;  4PUA A;  4JE1 A;  4FXY P;  1IYI A;  4OFM A;  4O92 A;  2WVZ A;  1O7U A;  1FB0 A;  2HZE A;  1BQ7 A;  5EL8 A;  3CSJ A;  1AXD A;  2E2M A;  4LMV A;  2OT3 A;  1JLW A;  4HUA A;  5D9X A;  2WVX B;  1XWK A;  2C3T A;  5IMD A;  2OA7 A;  2DC5 A;  2VD0 A;  3J7Y k;  2H19 A;  1TTZ A;  1SL1 B;  4HSC X;  4FYU A;  2PVO C;  4GQC A;  3RDW A;  2O89 A;  3M1G A;  2FLS A;  4USS A;  3LJR A;  2PN8 A;  2VLU A;  1URM A;  2DJ0 A;  1B9X C;  4YKG A;  1XWA A;  3H8Q A;  2H76 A;  2IN3 A;  3FZ9 A;  2VUP A;  3TKS A;  3ZIV A;  4QMK A;  1XFL A;  1A0R P;  2WJU A;  3M8N A;  2GDR A;  4N0Z A;  4BIK A;  1WE0 A;  1FAA A;  1DSB A;  1UN2 A;  2DBC A;  3LW9 A;  3UL3 A;  3L0H A;  1YQ1 A;  4FIW A;  3IV4 A;  4X1U A;  3EUR A;  2VM1 A;  5LCZ A;  4BWS A;  3FZ5 A;  2YNX A;  3L78 A;  5KN0 A;  2DIY A;  3TJG A;  3PR8 A;  1GWC A;  4FH8 A;  3WYW A;  3DML A;  5C04 A;  5J9C A;  2HSH A;  1GP1 A;  4DSS A;  1ZCP A;  2OBI A;  4A5P A;  2HSM A;  17GS A;  2VCV A;  4AKH A;  5GST A;  5ECL B;  2O87 A;  4PQ1 A;  3ZIT A;  2HSN B;  1V9W A;  2GST A;  1EV9 A;  1O8X A;  1R5A A;  4I2T A;  1TP9 A;  2M80 A;  1V57 A;  3UVH A;  1G7O A;  3QAW A;  2TIR A;  2JAD A;  3TRQ A;  4K7I A;  5IO0 A;  2DKI A;  3RAZ A;  4N30 A;  1N8J A;  2EIO A;  4G01 A;  2CX3 A;  5CO3 A;  1ZGN A;  3FKF A;  1Q98 A;  1ZYE A;  3MDK A;  2I9H A;  1IYH A;  4BA7 A;  1OE8 A;  3KTL A;  1K0O A;  5DCG A;  1GLP A;  4QL9 A;  2OE0 A;  2FA4 A;  2H73 A;  4KCE A;  3HA9 A;  1K0A A;  4HQZ A;  5IMZ A;  1WIK A;  2O7K A;  1F37 A;  3ZVJ D;  4ZB7 A;  2CQ9 A;  3GTU A;  2ALB A;  2XBI A;  4MF6 A;  4IQA A;  4K7N A;  4LL1 B;  5EVO A;  1GUH A;  1WPI A;  3ISO A;  1SJI A;  3F0I A;  4RI6 A;  1UC7 A;  2X64 A;  1YVL A;  3GKK A;  3EC3 A;  4TN8 A;  4YQV A;  1I9D A;  3IHQ A;  6GSW A;  4HU9 A;  3GX8 A;  3A2W A;  2I3Y A;  3UOM A;  2IMF A;  2WW2 A;  3GFK A;  5FHI A;  2OAC A;  2B1L A;  2LJK A;  2IJY A;  16GS A;  4BVY B;  1AIU A;  5ECS A;  1U6T A;  2L4Q A;  1O81 A;  2VL2 A;  1Y1U A;  1SYX A;  4LA1 A;  4X43 A;  3SBC A;  4RQX A;  2PBJ A;  3V1W A;  2V1M A;  5A1N B;  5IMC A;  5BMU A;  1FOH A;  4OD7 A;  1YJ6 A;  1B48 A;  3IA1 A;  4IVF A;  1JZO A;  4PUF C;  5HR0 A;  4EDY A;  5DQY A;  10GS A;  2VCX A;  4XS4 A;  4TOP A;  3NIV A;  3QDN A;  2YZH A;  8GSS A;  4G0I A;  2DMM A;  4L0U A;  1GSU A;  1TKD B;  1WMJ A;  2VLV A;  2X8H A;  1MD4 A;  3DYR A;  1BJX A;  3F9U A;  5E59 A;  4EC0 A;  3K8N A;  18GS A;  4ULX A;  2NBS A;  2F51 A;  1HNB A;  5ECK B;  1KBN A;  2F8F A;  1JZD A;  3GRX A;  3J7Y b;  2L5O A;  2JSZ A;  3TKS C;  3KCM A;  1GUL A;  1GTU A;  5L71 A;  3FMW A;  4WKW A;  3CQF A;  4G0K A;  3IK9 A;  1NHY A;  4GSN A;  1O85 A;  3PH9 A;  3UEM A;  2LUS A;  3HD5 A;  1RK4 A;  3F63 A;  4EIP A;  4EE0 A;  3KIJ A;  3G7Y A;  2DJJ A;  3IPZ A;  2AV4 A;  4L0W A;  4EUY A;  4ZL9 A;  1YF0 A;  5A34 A;  4K0N A;  4RI7 A;  5DDL A;  3C73 A;  1AUC A;  2A2P A;  4TXO B;  3FHK A;  4DVC A;  4JED A;  1ILO A;  2B3S A;  3CSI A;  3KD0 A;  2HRK A;  2N5F A;  2WW1 A;  3D4T A;  3QD9 A;  1GNW A;  2A2R A;  2GZP A;  4MA9 A;  2C0E A;  3LXT A;  3QFA C;  5J4V A;  3C1R A;  2HLS A;  2NPB A;  3O3T A;  3TKS E;  2GTU A;  2C0D A;  4MDC A;  4XS6 A;  5G30 A;  2M72 A;  4NMU A;  1Z5Y E;  2O36 A;  4HEA 2;  1HQO A;  3P7X A;  1HNC A;  1Q4J A;  1PN0 A;  3KMO A;  2H0H A;  4KDY A;  1OC9 A;  5D73 A;  5HR3 A;  3VK9 A;  5J3R A;  2YCD A;  2YP6 A;  5ECP B;  4TR1 A;  3ZLP A;  1QXH A;  4I2U A;  5C00 A;  22GS A;  2VOC A;  2PGT A;  3DVW A;  2VCW A;  4F0C A;  1FG4 A;  2ZNM A;  4PHZ C;  2JL4 A;  4WR4 A;  1TDI A;  4BL7 A;  1GLQ A;  1VGL A;  4GXZ A;  1C72 A;  1UVZ A;  1F9M A;  3RGB C;  2B7J A;  2CZ3 A;  4Z2R A;  4O5U A;  3TRP A;  1WWJ A;  4XTS A;  3D4M A;  5DAL A;  5A5K A;  3IK7 A;  3P2A A;  2H30 A;  2WRT A;  4EKZ A;  2UV8 G;  1PRX A;  4KA0 A;  4ECC A;  4DSS B;  1N2A A;  1Y25 A;  3UIW A;  1TK5 B;  1K3Y A;  2FWH A;  2XC2 A;  2HSM B;  2DJ3 A;  5H5Q A;  2GQL A;  3W8S A;  1ZYP A;  4MZW A;  5AGY A;  1BG1 A;  3TOU A;  3MAK A;  4V2M A;  3CXG A;  3BBY A;  4EF0 A;  2VL2 C;  4EIQ A;  2O3E A;  3GX0 A;  1XVW A;  2HZF A;  3MWH A;  3PPU A;  5ELA A;  2R6K A;  1EP8 A;  1BF5 A;  4EVM A;  1A0F A;  2PVQ A;  1AQW A;  4MLY A;  3F8U A;  1XW6 A;  19GS A;  4HJ2 A;  3EVI A;  2E7P A;  1PX6 A;  3KM6 A;  2G0F A;  4KAE A;  1R7H A;  1QQ2 A;  1TI3 A;  4ZBD A;  7GSS A;  2H1A A;  4V1A p;  5ECI B;  4P3Y B;  4CY8 A;  3HVS A;  1SK1 A;  4K9Z A;  4IS0 A;  1JLV A;  2FGX A;  3Q6O A;  3GTU B;  3AY8 A;  5DJL A;  1MDJ A;  4TR4 A;  1X5D A;  1W89 A;  3HJP A;  5J41 A;  2C80 A;  4ID0 A;  2GZY A;  2GGT A;  4W66 A;  1U3A A;  3LYP A;  2CX4 A;  5JWQ B;  3CRU A;  1JZW A;  1Y6E A;  5KEJ A;  5EY6 A;  2OJL A;  3APS A;  1FHE A;  4PI0 C;  4XIH A;  1YZX A;  1EOH A;  3DVX A;  20GS A;  2OKA A;  3HVN A;  4ECJ A;  1TI1 A;  4WF5 A;  3N9J A;  2A4H A;  4OCE A;  5H5R A;  4PNF A;  2VCQ A;  4MPF A;  1PQN A;  3ME7 A;  1ERV A;  1DE1 A;  3C8E A;  4NAX A;  2PER A;  4K0G A;  5D96 A;  1GSQ A;  2WZS A;  1XZO A;  4ZL8 A;  3TRX A;  1R4W A;  2OE3 A;  3VFI A;  3I69 A;  1SL2 B;  1XXU A;  1WRY A;  1VF4 A;  2HRN A;  3GKM A;  3ZL5 A;  2O8V B;  4POB A;  4JBB A;  4XS4 B;  3CBU A;  1QUW A;  3HMJ G;  3VWX A;  4Q5N A;  1PL2 A;  1V40 A;  2DJK A;  1AAZ A;  4NWY A;  5ID2 B;  1ZYQ B;  3HXS A;  1A2M A;  5D9T A;  4Z2U A;  3GYK A;  4ML6 A;  3GIX A;  1WJK A;  3D6I A;  3KH7 A;  2B5Y A;  3HZ4 A;  4AKX B;  5JWR B;  1TW9 A;  3LSZ A;  4EL1 A;  2HNL A;  4KDX A;  2AYT A;  3HVV A;  1M2D A;  3E9J B;  1NM3 A;  1KEB A;  1Z9H A;  3O76 A;  4O32 A;  3VLN A;  2V2G A;  3GHA A;  1GUM A;  3HKR A;  1NSW A;  1ERU A;  2H1G A;  1ABA A;  4OO5 A;  2VCZ A;  11GS A;  2M46 A;  3TJK A;  4D73 A;  1M2A A;  4AJ7 A;  2VD1 A;  4X4J A;  4HZ2 A;  3RFR C;  3GKN A;  3HJO A;  5ENU A;  5A34 B;  5ECR B;  4ZIJ A;  4MH3 A;  2GSR A;  1YDK A;  1FO5 A;  3F4T A;  4WBR D;  4NV5 A;  2HQT A;  4MNN A;  3BCK A;  3IDV A;  2OAD A;  2WGR A;  2L4C A;  2HRK B;  4MZC A;  2JZS A;  2AB6 A;  2VIM A;  4TVE A;  1T1V A;  3CTF A;  4K2D A;  2J23 A;  3L4N A;  3TOT A;  3FZA A;  4JR6 A;  1ST9 A;  5JCG A;  3KTB A;  5A4V A;  4F9Z A;  4CDO A;  3U5R E;  1ZOF A;  1FB6 A;  1TK0 B;  4AF2 A;  1F3A A;  4TRX A;  1TU7 A;  5E4W A;  9GSS A;  2EFD A;  4ECI A;  1ERT A;  5KN2 A;  4IN0 A;  4F82 A;  3SWL A;  2B7K A;  3ZRE A;  4O5R A;  3TKQ A;  2X4A A;  4TR1 B;  4N0V A;  4HU7 A;  4FQU A;  1X9S B;  2C0F A;  4FO5 A;  5J4Y A;  4K5S A;  3QAG A;  2KHP A;  2HYX A;  3GL3 A;  4OO4 A;  4GQF A;  1SU9 A;  1GSF A;  3IR4 A;  4ZIL A;  4BL7 B;  3KP8 A;  3VUR A;  4KCA A;  2VAF A;  2NVL A;  4GDF A;  2DML A;  1KTE A;  3GL5 A;  2MMO A;  5DAL B;  2HRA A;  3DD3 A;  3LGC A;  1DBY A;  1X5C A;  2YWI A;  1HD2 A;  4OCF A;  2MZC A;  2V41 A;  3RPP A;  5ECQ B;  5DBQ A;  4IEL A;  4MPG A;  4OFN A;  4F03 A;  5DAK A;  3M9K A;  1BYE A;  4WEY A;  1GRX A;  4OWY A;  1A23 A;  3UBK A;  2P31 A;  3TU3 B;  4MJC A;  5IPG A;  3GST A;  1MEK A;  1I1I P;  5IQY A;  4BWQ A;  3MIX A;  1KNG A;  4GF0 A;  5KOW A;  1FVJ A;  3EPT A;  4K2X A;  2CAQ A;  2IMD A;  1S3R A;  2GVP A;  4I97 A;  2RM6 A;  2P5R A;  3P90 A;  2R37 A;  1J0F A;  5CNW A;  4GSS A;  3P8W A;  3US3 A;  2PPT A;  1XWB A;  3GH9 A;  5HFI A;  5F07 A;  2EFH A;  3ZZX A;  3D21 A;  1M0U A;  3W6G A;  4CHS A;  3FW2 A;  3A2V A;  1PKW A;  4MMM A;  5IPH A;  5AIX A;  1A24 A;  1PX7 A;  2FY6 A;  2IME A;  1UA5 A;  2E0Q A;  4IP6 A;  2X49 A;  2A2S A;  4GLT A;  3VPT A;  2BJX A;  2OBK A;  3KMN A;  4G19 A;  1T4Z A;  3HVX A;  3MSZ A;  2ON7 A;  3UAR A;  3NZN A;  3UMA A;  1GTA A;  3ME8 A;  1DE2 A;  2EIQ A;  4BVX A;  5JCU A;  5J40 A;  1DUG A;  4X0X A;  4MP4 A;  2F3M A;  1T4Y A;  2CA8 A;  4BPY A;  2XPD A;  3IOS A;  3GN3 A;  1MDI A;  2FCH A;  2YZU A;  4KH7 A;  1YKC A;  3F4R A;  1QK8 A;  1QGV A;  3JCM L;  1Z6M A;  3DGQ A;  4EO3 A;  3KH9 A;  3GNJ A;  4TKY A;  3Q74 A;  3TKP A;  2HZE B;  2LQQ A;  4MCU A;  3UJ1 A;  3RHC A;  2R2J A;  1OC8 A;  1GH2 A;  2YN1 A;  1HNA A;  1XPV A;  4KSO A;  1THO A;  4XS1 A;  4Q5Q A;  4OFT A;  2DKH A;  1S3A A;  3ERF A;  2VM2 A;  3QR6 A;  2UZ8 A;  4IP1 A;  4V2L A;  2WW0 A;  2R5G A;  4E8H A;  2LJA A;  3EMX A;  3I9V 2;  3HY2 A;  5D9V A;  4L5L A;  1B9Y C;  3F6D A;  1BED A;  1CQH A;  3F3R A;  2B6M A;  3FY7 A;  1T3B A;  1FVK A;  4KX4 A;  1V2A A;  2L59 A;  3QCP A;  2NTO A;  1T00 A;  4CW9 A;  2VKZ G;  4G2E A;  3CTG A;  2L5L A;  2RII A;  2H6Z A;  4KB3 A;  1XIY A;  4ZBA A;  2JSY A;  5DJM A;  5D9W A;  2IFQ A;  1QFN A;  1YF1 A;  3A5I A;  4PI2 C;  4DEJ A;  1GNE A;  5ECO B;  4AKG A;  3WGD A;  3C1S A;  3IE3 A;  4XRD A;  3DRN A;  3ZFL A;  2B1K A;  2FWF A;  2BMX A;  4Q5F A;  1J9B A;  3FEU A;  4GTU A;  2DLX A;  2K8S A;  1W4V A;  3EYT A;  1YKA A;  2JZR A;  5DQS A;  2H71 A;  2PUK C;  1PKZ A;  4IJI A;  2K9F A;  2FNO A;  4MZB A;  1B4Q A;  4G10 A;  4MJB A;  5J9B A;  3M9J A;  3TCO A;  1PFO A;  2PU9 C;  2R0G A;  2L6C A;  4FYC A;  3DEX A;  3IAM 2;  4WBJ A;  1M99 A;  2N5A A;  2E2G A;  2FHE A;  1SD9 A;  1SKS B;  2WFC A;  1M9B A;  2EC4 A;  3A3T A;  1M9A A;  14GS A;  2H66 A;  2PMT A;  2YPM A;  3APQ A;  2GQK A;  1I5G A;  2K18 A;  4IHU A;  1X9M B;  1FOV A;  4HJM A;  5HFK A;  5GZZ B;  4JR4 A;  4WET A;  1E2Y A;  4GST A;  1Z6N A;  2H6X A;  1PSQ A;  1TJD A;  4PQI A;  4CY6 A;  5AIV A;  4I8B A;  2RLI A;  1BAY A;  1SK0 A;  2GZZ A;  1SL0 B;  3QOU A;  2RUE A;  4DSQ A;  5CRW A;  4ISD A;  4ICY A;  1TRU A;  3GKX A;  1V98 A;  4ZBB A;  5IMF A;  1BX9 A;  2GT5 A;  3NOF A;  1K0N A;  1OC3 A;  3F6F A;  5BRT A;  2AHE A;  1GUK A;  5G5F A;  3D5J A;  5G5E A;  1K0C A;  2AUV A;  1XWC A;  3D0Z A;  2VL3 A;  3ZIJ A;  1XW5 A;  1BG5 A;  5A1N A;  1S3D A;  2H01 A;  2XPE A;  5IMV A;  2K8V A;  4QQ7 A;  3A5W A;  1GSE A;  1K3O A;  1J08 A;  1ZZY A;  3FRC A;  2LS5 A;  3FK8 A;  2RM5 A;  4PUR A;  1G6W A;  3TUE A;  1T7P B;  4IQ1 A;  4ZB9 A;  3BOA A;  2Z9S A;  1M3J A;  2F8A A;  1E6B A;  4ECB A;  1XBS A;  2C3N A;  4GRF A;  1LU4 A;  3RBT A;  5HQP A;  2LV3 A;  1GSD A;  1TRV A;  2H6Y A;  6GSV A;  1RW1 A;  2KOK A;  1VF2 A;  1K0D A;  3CHX C;  2VLT A;  2ZUP A;  2P0G A;  4NV2 A;  5A5H A;  1AQV A;  2B5E A;  2P5Q A;  2YV9 A;  1YY7 A;  3QFB C;  3QAV A;  2C4J A;  3UAP A;  2G2Q A;  1U3I A;  2FA8 A;  4PGT A;  5CRG A;  5BMU B;  2RUF A;  2FUG 2;  4K8M A;  5IOW A;  3VI5 A;  2LEG A;  2YWM A;  5F0G A;  1ACV A;  4KW6 A;  1XCC A;  4ML1 A;  2XBQ A;  5H5S A;  1GL8 A;  2H8L A;  1OAZ A;  1TRS A;  4ZL7 A;  5J5N A;  2VCT A;  5HR2 A;  5COH A;  5IOX A;  5G2Z A;  2A4V A;  12GS A;  3ZVJ A;  1U88 A;  3TB2 A;  5JWO B;  4LL4 B;  2LRT A;  6GSX A;  2DJ2 A;  1SK2 A;  4TXO A;  4AI6 A;  3KXO A;  3LQ7 A;  5LNK e;  1SKR B;  2J9H A;  3LEF A;  4YH2 A;  2H0I A;  3FZ4 A;  2KLX A;  4L8E A;  1JHB A;  2MMN A;  13GS A;  3H4K A;  1TRW A;  3KEB A;  1G7E A;  2HFD A;  3L9S A;  1ZMA A;  4TR3 A;  1GTB A;  4BVX B;  4QL7 A;  1N25 A;  2WS2 A;  1X5E A;  4AJ6 A;  5G1L A;  2GQM A;  3LYK A;  4HI7 A;  3MYD A;  2KP1 A;  5IIZ A;  2JU5 A;  2R0C A;  5INY A;  4V2N A;  2L6D A;  3ERW A;  4LLR A;  1VRS D;  1G6Y A;  3W8J A;  1NW2 A;  4G0L A;  1F6M C;  3LWA A;  3GH6 A;  6GST A;  5AN1 A;  3L9V A;  2DJ1 A;  3O6T A;  3EU4 A;  1T8E B;  1SJ6 A;  4MAB A;  4H86 A;  3ZTL A;  4I6X A;  1LBK A;  2QGV A;  3HZ8 A;  2K6V A;  4N11 A;  2L57 A;  4NPB A;  3N5O A;  1PL1 A;  3GUS A;  3E0U A;  3CMI A;  5A4W A;  1S3C A;  5CAX A;  1AQX A;  1QMV A;  4O7H A;  1U87 A;  3LFL A;  1EEM A;  4IW9 A;  3TJJ A;  4G9H A;  3FYG A;  3C71 A;  1SVO A;  4PX1 A;  4ACS A;  2WDU A;  3VI7 A;  2FWE A;  2QA1 A;  3IAS 2;  3ERG A;  1K0B A;  3QMX A;  2LNT A;  1OC9 B;  5J47 A;  4EDZ A;  2VO4 A;  5CP1 A;  1JFU A;  1Z3E A;  2H70 A;  2N5B A;  2HSY A;  1F2E A;  5ELG A;  3MNG A;  4O5Q A;  2IFQ B;  4N3Z A;  4ZB6 A;  4HQS A;  1SKW B;  2GLR A;  4RQR A;  4FYB A;  3EWL A;  1SYR A;  1K0M A;  2V32 A;  4YQU A;  2CVD A;  2IMK A;  2F9S A;  4WR5 A;  3TGZ A;  1THX A;  3PIN A;  1VF1 A;  2WW3 A;  1A2L A;  4WF4 A;  3DXB A;  3LOR A;  1ERW A;  3H1N A;  3BCI A;  1ON4 A;  3QPM A;  2I1U A;  2QKE A;  2WZ9 A;  2XHF A;  5DVB A;  4K7O A;  2O5V A;  2MYG A;  4AGS A;  5F06 A;  4YKF A;  5FT3 A;  2KP2 A;  2YOI A;  2WCI A;  3VPQ A;  1VF3 A;  4K5R A;  5KN1 A;  5B6N A;  2X8G A;  2GS3 A;  1GSS A;  3VWV A;  1WOU A;  2LKU A;  3EIN A;  1XOA A;  4NXI A;  3F3Q A;  2H1D A;  5B8B A;  4HZ4 A;  3FR6 A;  1SJZ A;  3S9F A;  2WB9 A;  1YEP A;  5CRH A;  3G7I A;  1SEN A;  4RUV A;  1M2B A;  4HOJ A;  3APO A;  4L5O A;  4KND A;  4YAP A;  1XW9 A;  4V1A g;  1YEX A;  4J57 E;  5CYY A;  3IHG A;  5B8A A;  3ED3 A;  3GSS A;  1USB A;  2C3Q A;  1TXU A;  4MJE A;  6GSS A;  2C8U A;  5IM9 A;  3A2X A;  4ZB8 A;  5D93 A;  2CVB A;  4KUN A;  3HHV A;  2AAW A;  2ES7 A;  2HT9 A;  2IPA A;  3L9U A;  2LRC A;  3I6A A;  1Z7P A;  3VWU A;  3EMP A;  2YWO A;  2HE3 A;  2CAI A;  1TOF A;  2TRC P;  1XOB A;  4KGI A;  3IBH A;  4E68 A;  2WVX A;  2VL9 A;  3LXZ A;  3TJF A;  3G7J A;  5ID2 A;  5G1K A;  3RPN A;  3CSH A;  1OYJ A;  1X0R A;  3CWG A;  3U6V A;  3KZQ A;  2QSI A;  3KP9 A;  1OVN A;  1A8L A;  1G0T A;  4N10 A;  3M3M A;  1S4B P;  4E8E A;  3LG6 A;  5KOX A;  2D2Z A;  5A5H B;  1SVM A;  2QC7 A;  4HDE A;  5F05 A;  1EEJ A;  1EP7 A;  4AJ8 A;  1H75 A;  2JAC A;  1XWG A;  3BJ5 A;  2V6O A;  1PMT A;  3GMF A;  3RHB A;  2BTO T;  3IXR A;  2IIY A;  1TU8 A;  4XHM A;  1B4P A;  2I4A A;  1ZL9 A;  2EFC A;  2LNS A;  5ABR A;  3IC4 A;  4KE3 A;  6GSY A;  1NHO A;  3WT2 A;  1SD8 A;  4IKH A;  1O6J A;  1H4O A;  2GSS A;  2R0P A;  3TJB A;  2MBT A;  1GSY A;  3FR3 A;  3DWV A;  5JCW A;  2H0G A;  5HFG A;  4PNG A;  5IMA A;  5D8I A;  1JZR A;  1OKD A;  2H75 A;  5EPF A;  4F0B A;  4JRR A;  5G31 A;  4PXO A;  2QA2 A;  4MF7 A;  3CRT A;  2IWT A;  5GSS A;  3HYP A;  3WGX A;  1FW1 A;  1EGR A;  2GSQ A;  2LQO A;  1OKT A;  6GSU A;  1AC1 A;  3HJM A;  1GTI A;  1O73 A;  5LD0 A;  1TXX A;  2H1B A;  2YJH A;  3EE2 A;  5CRD A;  1EZK A;  5CRE A;  2HSN A;  4AKI A;  4KSM A;  1V58 A;  4K1F A;  3KJY A;  4D73 B;  4POL A;  2IL3 A;  5ECN B;  3I43 A;  1RQM A;  3WD6 A;  2IMI A;  1R26 A;  1MTC A;  2LST A;  2GT6 A;  2FD3 A;  4IBP A;  2R3X A;  2B5X A;  5J4U A;  1A2J A;  3H93 A;  5A4U A;  4HS1 A;  2HXK A;  2JZT A;  3EU3 A;  1MD3 A;  4J2F A;  3BD2 A;  3FR9 A;  4IGJ A;  2OE1 A;  3G9B A;  2TRX A;  2C1Y A;  2AJQ B;  4Z7X A;  1ZYN A;  1PN9 A;  2MMZ A;  4POM A;  1YEW C;  4Q5R A;  4KDU A;  4KF9 A;  1Z7R A;  1PGT A;  3C7M A;  1CQG A;  5FWG A;  4WXT A;  2KUC A;  4F2I A;  2O85 A;  1XVQ A;  1PD2 1;  4YAV A;  3IC8 A;  2DSA A;  4EXJ A;  4XCS A;  4TXV A;  5IO2 A;  2WVY A;  1WP0 A;  5ECH B;  3ZML A;  4MJA A;  4GCI A;  4I5Q A;  3F4S A;  1HYU A;  4PQH A;  4OMV A;  1XG8 A;  4LMW A;  3ZYW A;  2WUL A;  3UBL A;  2NDO A;  3PGT A;  3TDG A;  3TKR A;  4K6X A;  4GWR A;  5HR1 A;  2FWG A;  4XRA A;  1O8W A;  2H72 A;  4BVY A;  3HDC A;  2HRF A;  2DIZ A;  5DCH A;  3KGK A;  1EGO A;  1X9W B;  2CT6 A;  2ON5 A;  3GV1 A;  4POK A;  2X99 A;  3VWW A;  3WGE A;  3ZMK A;  1AW9 A;  2C0G A;  5GAN D;  3R2Q A;  1R5P A;  4NHZ A;  2H1L A;  1EV4 A;  4MH2 A;  4MK3 A;  2MMA A;  2LTK A;  2HI7 A;  4TW5 A;  3Q18 A;  4DSR A;  2YWN A;  2R4V A; 
#chains in the Genus database with same CATH homology
 2I81 A;  1EOG A;  5B6M A;  5ECM B;  2PWJ A;  3D22 A;  5B7C A;  1EWX A;  4PTS A;  2YJ7 A;  2LJR A;  4MF5 A;  3ZFB A;  1PA3 A;  3Q19 A;  3M0F A;  1M7T A;  2CV4 A;  2YV7 A;  5KN3 A;  1K3L A;  5DAK B;  2X8C A;  4NHW A;  1F3B A;  1MDK A;  4YQM A;  3GUR A;  1SVL A;  1TK8 B;  4IJ3 A;  3HCZ A;  3IRA A;  2ZCT A;  1OE7 A;  3WT1 A;  2MBS A;  1ML6 A;  4JU5 A;  3R3E A;  3GA4 A;  2EIR A;  3ZRD A;  2V6K A;  4ILF A;  4Z2T A;  1LJR A;  3DIE A;  4JZQ A;  2LRN A;  3H79 A;  5GAP D;  2H74 A;  3E3E A;  2CVK A;  3CYN A;  5AIS A;  3DKS A;  2CZ2 A;  4J56 E;  4TR0 A;  2YAN A;  5F8B A;  1B8X A;  3UVT A;  3OR5 A;  4ZXG A;  2REM A;  2EFE A;  1A8Y A;  4PUA A;  4JE1 A;  1IYI A;  4OFM A;  4O92 A;  1O7U A;  1FB0 A;  2HZE A;  1BQ7 A;  5EL8 A;  3CSJ A;  1AXD A;  2E2M A;  4LMV A;  2OT3 A;  1JLW A;  4HUA A;  5D9X A;  1XWK A;  2C3T A;  5IMD A;  2OA7 A;  2DC5 A;  2VD0 A;  3J7Y k;  2H19 A;  1TTZ A;  1SL1 B;  4FYU A;  2PVO C;  4GQC A;  3RDW A;  2O89 A;  3M1G A;  2FLS A;  4USS A;  3LJR A;  2PN8 A;  2VLU A;  1URM A;  2DJ0 A;  1B9X C;  4YKG A;  1XWA A;  3H8Q A;  2H76 A;  2IN3 A;  3FZ9 A;  2VUP A;  3TKS A;  3ZIV A;  4QMK A;  1XFL A;  1A0R P;  2WJU A;  3M8N A;  2GDR A;  4N0Z A;  1WE0 A;  1FAA A;  1DSB A;  1UN2 A;  2DBC A;  3LW9 A;  3UL3 A;  3L0H A;  1YQ1 A;  4FIW A;  3IV4 A;  4X1U A;  3EUR A;  2VM1 A;  5LCZ A;  4BWS A;  3FZ5 A;  2YNX A;  3L78 A;  5KN0 A;  2DIY A;  3TJG A;  3PR8 A;  1GWC A;  4FH8 A;  3WYW A;  3DML A;  5C04 A;  5J9C A;  2HSH A;  1GP1 A;  4DSS A;  1ZCP A;  2OBI A;  4A5P A;  2HSM A;  17GS A;  2VCV A;  4AKH A;  5GST A;  5ECL B;  2O87 A;  4PQ1 A;  3ZIT A;  2HSN B;  1V9W A;  2GST A;  1EV9 A;  1O8X A;  1R5A A;  4I2T A;  1TP9 A;  2M80 A;  1V57 A;  3UVH A;  1G7O A;  3QAW A;  2TIR A;  2JAD A;  3TRQ A;  4K7I A;  5IO0 A;  2DKI A;  3RAZ A;  4N30 A;  1N8J A;  2EIO A;  4G01 A;  2CX3 A;  5CO3 A;  1ZGN A;  3FKF A;  1Q98 A;  1ZYE A;  3MDK A;  2I9H A;  1IYH A;  4BA7 A;  1OE8 A;  3KTL A;  1K0O A;  5DCG A;  1GLP A;  4QL9 A;  2OE0 A;  2FA4 A;  2H73 A;  4KCE A;  3HA9 A;  1K0A A;  4HQZ A;  5IMZ A;  1WIK A;  2O7K A;  1F37 A;  3ZVJ D;  4ZB7 A;  2CQ9 A;  3GTU A;  2ALB A;  2XBI A;  4MF6 A;  4IQA A;  4K7N A;  4LL1 B;  5EVO A;  1GUH A;  1WPI A;  3ISO A;  1SJI A;  3F0I A;  4RI6 A;  1UC7 A;  2X64 A;  1YVL A;  3GKK A;  3EC3 A;  4TN8 A;  4YQV A;  1I9D A;  3IHQ A;  6GSW A;  4HU9 A;  3GX8 A;  3A2W A;  2I3Y A;  3UOM A;  2IMF A;  3GFK A;  5FHI A;  2OAC A;  2B1L A;  2LJK A;  2IJY A;  16GS A;  4BVY B;  1AIU A;  5ECS A;  1U6T A;  2L4Q A;  1O81 A;  2VL2 A;  1Y1U A;  1SYX A;  4LA1 A;  4X43 A;  3SBC A;  4RQX A;  2PBJ A;  3V1W A;  2V1M A;  5A1N B;  5IMC A;  5BMU A;  1FOH A;  4OD7 A;  1YJ6 A;  1B48 A;  3IA1 A;  4IVF A;  1JZO A;  4PUF C;  5HR0 A;  4EDY A;  5DQY A;  10GS A;  2VCX A;  4XS4 A;  4TOP A;  3NIV A;  3QDN A;  2YZH A;  8GSS A;  4G0I A;  2DMM A;  4L0U A;  1GSU A;  1TKD B;  1WMJ A;  2VLV A;  2X8H A;  1MD4 A;  3DYR A;  1BJX A;  3F9U A;  5E59 A;  4EC0 A;  3K8N A;  18GS A;  4ULX A;  2NBS A;  2F51 A;  1HNB A;  5ECK B;  1KBN A;  2F8F A;  1JZD A;  3GRX A;  3J7Y b;  2L5O A;  2JSZ A;  3TKS C;  3KCM A;  1GUL A;  1GTU A;  5L71 A;  3FMW A;  4WKW A;  4G0K A;  3IK9 A;  1NHY A;  4GSN A;  1O85 A;  3PH9 A;  3UEM A;  2LUS A;  3HD5 A;  1RK4 A;  3F63 A;  4EIP A;  4EE0 A;  3KIJ A;  3G7Y A;  2DJJ A;  3IPZ A;  2AV4 A;  4L0W A;  4EUY A;  4ZL9 A;  1YF0 A;  5A34 A;  4K0N A;  4RI7 A;  5DDL A;  3C73 A;  1AUC A;  2A2P A;  4TXO B;  3FHK A;  4DVC A;  4JED A;  1ILO A;  2B3S A;  3CSI A;  3KD0 A;  2HRK A;  2N5F A;  3D4T A;  3QD9 A;  1GNW A;  2A2R A;  2GZP A;  4MA9 A;  2C0E A;  3LXT A;  3QFA C;  5J4V A;  3C1R A;  2HLS A;  2NPB A;  3O3T A;  3TKS E;  2GTU A;  2C0D A;  4MDC A;  4XS6 A;  5G30 A;  2M72 A;  4NMU A;  1Z5Y E;  4HEA 2;  1HQO A;  3P7X A;  1HNC A;  1Q4J A;  1PN0 A;  3KMO A;  2H0H A;  4KDY A;  1OC9 A;  5D73 A;  5HR3 A;  3VK9 A;  5J3R A;  2YCD A;  2YP6 A;  5ECP B;  4TR1 A;  3ZLP A;  1QXH A;  4I2U A;  5C00 A;  22GS A;  2VOC A;  2PGT A;  3DVW A;  2VCW A;  4F0C A;  1FG4 A;  2ZNM A;  2JL4 A;  4WR4 A;  1TDI A;  4BL7 A;  1GLQ A;  1VGL A;  4GXZ A;  1C72 A;  1UVZ A;  1F9M A;  2B7J A;  2CZ3 A;  4Z2R A;  4O5U A;  3TRP A;  1WWJ A;  4XTS A;  3D4M A;  5DAL A;  5A5K A;  3IK7 A;  3P2A A;  2H30 A;  2WRT A;  4EKZ A;  2UV8 G;  1PRX A;  4KA0 A;  4ECC A;  4DSS B;  1N2A A;  1Y25 A;  3UIW A;  1TK5 B;  1K3Y A;  2FWH A;  2XC2 A;  2HSM B;  2DJ3 A;  5H5Q A;  2GQL A;  3W8S A;  1ZYP A;  4MZW A;  5AGY A;  1BG1 A;  3TOU A;  3MAK A;  4V2M A;  3CXG A;  3BBY A;  4EF0 A;  2VL2 C;  4EIQ A;  3GX0 A;  1XVW A;  2HZF A;  3MWH A;  3PPU A;  5ELA A;  2R6K A;  1EP8 A;  1BF5 A;  4EVM A;  1A0F A;  2PVQ A;  1AQW A;  4MLY A;  3F8U A;  1XW6 A;  19GS A;  4HJ2 A;  3EVI A;  2E7P A;  1PX6 A;  3KM6 A;  2G0F A;  4KAE A;  1R7H A;  1QQ2 A;  1TI3 A;  4ZBD A;  7GSS A;  2H1A A;  4V1A p;  5ECI B;  4P3Y B;  4CY8 A;  3HVS A;  1SK1 A;  4K9Z A;  4IS0 A;  1JLV A;  2FGX A;  3Q6O A;  3GTU B;  3AY8 A;  5DJL A;  1MDJ A;  4TR4 A;  1X5D A;  1W89 A;  3HJP A;  5J41 A;  2C80 A;  4ID0 A;  2GZY A;  2GGT A;  4W66 A;  1U3A A;  3LYP A;  2CX4 A;  5JWQ B;  3CRU A;  1JZW A;  1Y6E A;  5KEJ A;  5EY6 A;  2OJL A;  3APS A;  1FHE A;  4XIH A;  1YZX A;  1EOH A;  3DVX A;  20GS A;  2OKA A;  4ECJ A;  1TI1 A;  4WF5 A;  3N9J A;  2A4H A;  4OCE A;  5H5R A;  4PNF A;  2VCQ A;  4MPF A;  1PQN A;  3ME7 A;  1ERV A;  1DE1 A;  3C8E A;  4NAX A;  2PER A;  4K0G A;  5D96 A;  1GSQ A;  1XZO A;  4ZL8 A;  3TRX A;  1R4W A;  2OE3 A;  3VFI A;  3I69 A;  1SL2 B;  1XXU A;  1WRY A;  1VF4 A;  2HRN A;  3GKM A;  3ZL5 A;  2O8V B;  4POB A;  4JBB A;  4XS4 B;  3CBU A;  1QUW A;  3HMJ G;  3VWX A;  4Q5N A;  1PL2 A;  1V40 A;  2DJK A;  1AAZ A;  4NWY A;  5ID2 B;  1ZYQ B;  3HXS A;  1A2M A;  5D9T A;  4Z2U A;  3GYK A;  4ML6 A;  3GIX A;  1WJK A;  3D6I A;  3KH7 A;  2B5Y A;  3HZ4 A;  4AKX B;  5JWR B;  1TW9 A;  3LSZ A;  4EL1 A;  2HNL A;  4KDX A;  2AYT A;  3HVV A;  1M2D A;  3E9J B;  1NM3 A;  1KEB A;  1Z9H A;  3O76 A;  4O32 A;  3VLN A;  2V2G A;  3GHA A;  1GUM A;  3HKR A;  1NSW A;  1ERU A;  2H1G A;  1ABA A;  4OO5 A;  2VCZ A;  11GS A;  2M46 A;  3TJK A;  4D73 A;  1M2A A;  4AJ7 A;  2VD1 A;  4X4J A;  4HZ2 A;  3GKN A;  3HJO A;  5ENU A;  5A34 B;  5ECR B;  4ZIJ A;  4MH3 A;  2GSR A;  1YDK A;  1FO5 A;  3F4T A;  4WBR D;  4NV5 A;  2HQT A;  4MNN A;  3BCK A;  3IDV A;  2OAD A;  2WGR A;  2L4C A;  2HRK B;  4MZC A;  2JZS A;  2AB6 A;  2VIM A;  4TVE A;  1T1V A;  3CTF A;  4K2D A;  2J23 A;  3L4N A;  3TOT A;  3FZA A;  4JR6 A;  1ST9 A;  5JCG A;  3KTB A;  5A4V A;  4F9Z A;  4CDO A;  3U5R E;  1ZOF A;  1FB6 A;  1TK0 B;  4AF2 A;  1F3A A;  4TRX A;  1TU7 A;  5E4W A;  9GSS A;  2EFD A;  4ECI A;  1ERT A;  5KN2 A;  4IN0 A;  4F82 A;  3SWL A;  2B7K A;  3ZRE A;  4O5R A;  3TKQ A;  2X4A A;  4TR1 B;  4N0V A;  4HU7 A;  4FQU A;  1X9S B;  2C0F A;  4FO5 A;  5J4Y A;  4K5S A;  3QAG A;  2KHP A;  2HYX A;  3GL3 A;  4OO4 A;  4GQF A;  1SU9 A;  1GSF A;  3IR4 A;  4ZIL A;  4BL7 B;  3KP8 A;  3VUR A;  4KCA A;  2VAF A;  2NVL A;  4GDF A;  2DML A;  1KTE A;  3GL5 A;  2MMO A;  5DAL B;  2HRA A;  3DD3 A;  3LGC A;  1DBY A;  1X5C A;  2YWI A;  1HD2 A;  4OCF A;  2MZC A;  2V41 A;  3RPP A;  5ECQ B;  5DBQ A;  4IEL A;  4MPG A;  4OFN A;  4F03 A;  5DAK A;  3M9K A;  1BYE A;  4WEY A;  1GRX A;  4OWY A;  1A23 A;  3UBK A;  2P31 A;  3TU3 B;  4MJC A;  5IPG A;  3GST A;  1MEK A;  5IQY A;  4BWQ A;  3MIX A;  1KNG A;  4GF0 A;  5KOW A;  1FVJ A;  3EPT A;  4K2X A;  2CAQ A;  2IMD A;  2GVP A;  4I97 A;  2RM6 A;  2P5R A;  3P90 A;  2R37 A;  1J0F A;  5CNW A;  4GSS A;  3P8W A;  3US3 A;  2PPT A;  1XWB A;  3GH9 A;  5HFI A;  5F07 A;  2EFH A;  3ZZX A;  3D21 A;  1M0U A;  3W6G A;  4CHS A;  3FW2 A;  3A2V A;  1PKW A;  4MMM A;  5IPH A;  5AIX A;  1A24 A;  1PX7 A;  2FY6 A;  2IME A;  1UA5 A;  2E0Q A;  4IP6 A;  2X49 A;  2A2S A;  4GLT A;  3VPT A;  2BJX A;  2OBK A;  3KMN A;  4G19 A;  1T4Z A;  3HVX A;  3MSZ A;  2ON7 A;  3UAR A;  3NZN A;  3UMA A;  1GTA A;  3ME8 A;  1DE2 A;  2EIQ A;  4BVX A;  5JCU A;  5J40 A;  1DUG A;  4X0X A;  4MP4 A;  2F3M A;  1T4Y A;  2CA8 A;  4BPY A;  2XPD A;  3IOS A;  3GN3 A;  1MDI A;  2FCH A;  2YZU A;  4KH7 A;  1YKC A;  3F4R A;  1QK8 A;  1QGV A;  3JCM L;  1Z6M A;  3DGQ A;  4EO3 A;  3KH9 A;  3GNJ A;  4TKY A;  3Q74 A;  3TKP A;  2HZE B;  2LQQ A;  4MCU A;  3UJ1 A;  3RHC A;  2R2J A;  1OC8 A;  1GH2 A;  2YN1 A;  1HNA A;  1XPV A;  4KSO A;  1THO A;  4XS1 A;  4Q5Q A;  4OFT A;  2DKH A;  1S3A A;  3ERF A;  2VM2 A;  3QR6 A;  2UZ8 A;  4IP1 A;  4V2L A;  2R5G A;  4E8H A;  2LJA A;  3EMX A;  3I9V 2;  3HY2 A;  5D9V A;  4L5L A;  1B9Y C;  3F6D A;  1BED A;  1CQH A;  3F3R A;  2B6M A;  3FY7 A;  1T3B A;  1FVK A;  4KX4 A;  1V2A A;  2L59 A;  3QCP A;  2NTO A;  1T00 A;  4CW9 A;  2VKZ G;  4G2E A;  3CTG A;  2L5L A;  2RII A;  2H6Z A;  4KB3 A;  1XIY A;  4ZBA A;  2JSY A;  5DJM A;  5D9W A;  2IFQ A;  1QFN A;  1YF1 A;  3A5I A;  4DEJ A;  1GNE A;  5ECO B;  4AKG A;  3WGD A;  3C1S A;  3IE3 A;  4XRD A;  3DRN A;  3ZFL A;  2B1K A;  2FWF A;  2BMX A;  4Q5F A;  1J9B A;  3FEU A;  4GTU A;  2DLX A;  2K8S A;  1W4V A;  3EYT A;  1YKA A;  2JZR A;  5DQS A;  2H71 A;  2PUK C;  1PKZ A;  4IJI A;  2K9F A;  2FNO A;  4MZB A;  1B4Q A;  4G10 A;  4MJB A;  5J9B A;  3M9J A;  3TCO A;  2PU9 C;  2R0G A;  2L6C A;  4FYC A;  3DEX A;  3IAM 2;  4WBJ A;  1M99 A;  2N5A A;  2E2G A;  2FHE A;  1SD9 A;  1SKS B;  2WFC A;  1M9B A;  2EC4 A;  3A3T A;  1M9A A;  14GS A;  2H66 A;  2PMT A;  2YPM A;  3APQ A;  2GQK A;  1I5G A;  2K18 A;  4IHU A;  1X9M B;  1FOV A;  4HJM A;  5HFK A;  5GZZ B;  4JR4 A;  4WET A;  1E2Y A;  4GST A;  1Z6N A;  2H6X A;  1PSQ A;  1TJD A;  4PQI A;  4CY6 A;  5AIV A;  4I8B A;  2RLI A;  1BAY A;  1SK0 A;  2GZZ A;  1SL0 B;  3QOU A;  2RUE A;  4DSQ A;  5CRW A;  4ISD A;  4ICY A;  1TRU A;  3GKX A;  1V98 A;  4ZBB A;  5IMF A;  1BX9 A;  2GT5 A;  3NOF A;  1K0N A;  1OC3 A;  3F6F A;  5BRT A;  2AHE A;  1GUK A;  5G5F A;  3D5J A;  5G5E A;  1K0C A;  2AUV A;  1XWC A;  3D0Z A;  2VL3 A;  3ZIJ A;  1XW5 A;  1BG5 A;  5A1N A;  1S3D A;  2H01 A;  2XPE A;  5IMV A;  2K8V A;  4QQ7 A;  3A5W A;  1GSE A;  1K3O A;  1J08 A;  1ZZY A;  3FRC A;  2LS5 A;  3FK8 A;  2RM5 A;  4PUR A;  1G6W A;  3TUE A;  1T7P B;  4IQ1 A;  4ZB9 A;  3BOA A;  2Z9S A;  2F8A A;  1E6B A;  4ECB A;  1XBS A;  2C3N A;  4GRF A;  1LU4 A;  3RBT A;  5HQP A;  2LV3 A;  1GSD A;  1TRV A;  2H6Y A;  6GSV A;  1RW1 A;  2KOK A;  1VF2 A;  1K0D A;  2VLT A;  2ZUP A;  2P0G A;  4NV2 A;  5A5H A;  1AQV A;  2B5E A;  2P5Q A;  2YV9 A;  1YY7 A;  3QFB C;  3QAV A;  2C4J A;  3UAP A;  2G2Q A;  1U3I A;  2FA8 A;  4PGT A;  5CRG A;  5BMU B;  2RUF A;  2FUG 2;  4K8M A;  5IOW A;  3VI5 A;  2LEG A;  1ACV A;  5F0G A;  2YWM A;  4KW6 A;  1XCC A;  4ML1 A;  2XBQ A;  5H5S A;  1GL8 A;  2H8L A;  1OAZ A;  1TRS A;  4ZL7 A;  5J5N A;  2VCT A;  5HR2 A;  5COH A;  5IOX A;  5G2Z A;  2A4V A;  12GS A;  3ZVJ A;  1U88 A;  3TB2 A;  5JWO B;  4LL4 B;  2LRT A;  6GSX A;  2DJ2 A;  1SK2 A;  4TXO A;  4AI6 A;  3KXO A;  3LQ7 A;  5LNK e;  1SKR B;  2J9H A;  3LEF A;  4YH2 A;  2H0I A;  3FZ4 A;  2KLX A;  4L8E A;  1JHB A;  2MMN A;  13GS A;  3H4K A;  1TRW A;  3KEB A;  1G7E A;  2HFD A;  3L9S A;  1ZMA A;  4TR3 A;  1GTB A;  4BVX B;  4QL7 A;  1N25 A;  2WS2 A;  1X5E A;  4AJ6 A;  5G1L A;  2GQM A;  3LYK A;  4HI7 A;  3MYD A;  2KP1 A;  5IIZ A;  2JU5 A;  2R0C A;  5INY A;  4V2N A;  2L6D A;  3ERW A;  4LLR A;  1VRS D;  1G6Y A;  3W8J A;  1NW2 A;  4G0L A;  1F6M C;  3LWA A;  3GH6 A;  6GST A;  5AN1 A;  3L9V A;  2DJ1 A;  3O6T A;  3EU4 A;  1T8E B;  1SJ6 A;  4MAB A;  4H86 A;  3ZTL A;  4I6X A;  1LBK A;  2QGV A;  3HZ8 A;  2K6V A;  4N11 A;  2L57 A;  4NPB A;  3N5O A;  1PL1 A;  3GUS A;  3E0U A;  3CMI A;  5A4W A;  1S3C A;  5CAX A;  1AQX A;  1QMV A;  4O7H A;  1U87 A;  3LFL A;  1EEM A;  4IW9 A;  3TJJ A;  4G9H A;  3FYG A;  3C71 A;  1SVO A;  4PX1 A;  4ACS A;  2WDU A;  3VI7 A;  2FWE A;  2QA1 A;  3IAS 2;  3ERG A;  1K0B A;  3QMX A;  2LNT A;  1OC9 B;  5J47 A;  4EDZ A;  2VO4 A;  5CP1 A;  1JFU A;  1Z3E A;  2H70 A;  2N5B A;  2HSY A;  1F2E A;  5ELG A;  3MNG A;  4O5Q A;  2IFQ B;  4N3Z A;  4ZB6 A;  4HQS A;  1SKW B;  2GLR A;  4RQR A;  4FYB A;  3EWL A;  1SYR A;  1K0M A;  2V32 A;  4YQU A;  2CVD A;  2IMK A;  2F9S A;  4WR5 A;  3TGZ A;  1THX A;  3PIN A;  1VF1 A;  1A2L A;  4WF4 A;  3DXB A;  3LOR A;  1ERW A;  3H1N A;  3BCI A;  1ON4 A;  3QPM A;  2I1U A;  2QKE A;  2WZ9 A;  2XHF A;  5DVB A;  4K7O A;  2O5V A;  2MYG A;  4AGS A;  5F06 A;  4YKF A;  5FT3 A;  2KP2 A;  2YOI A;  2WCI A;  3VPQ A;  1VF3 A;  4K5R A;  5KN1 A;  5B6N A;  2X8G A;  2GS3 A;  1GSS A;  3VWV A;  1WOU A;  2LKU A;  3EIN A;  1XOA A;  4NXI A;  3F3Q A;  2H1D A;  5B8B A;  4HZ4 A;  3FR6 A;  1SJZ A;  3S9F A;  2WB9 A;  1YEP A;  5CRH A;  3G7I A;  1SEN A;  4RUV A;  1M2B A;  4HOJ A;  3APO A;  4L5O A;  4KND A;  4YAP A;  1XW9 A;  4V1A g;  1YEX A;  4J57 E;  5CYY A;  3IHG A;  5B8A A;  3ED3 A;  3GSS A;  1USB A;  2C3Q A;  1TXU A;  4MJE A;  6GSS A;  2C8U A;  5IM9 A;  3A2X A;  4ZB8 A;  5D93 A;  2CVB A;  4KUN A;  3HHV A;  2AAW A;  2ES7 A;  2HT9 A;  2IPA A;  3L9U A;  2LRC A;  3I6A A;  1Z7P A;  3VWU A;  3EMP A;  2YWO A;  2HE3 A;  2CAI A;  1TOF A;  2TRC P;  1XOB A;  4KGI A;  3IBH A;  4E68 A;  2VL9 A;  3LXZ A;  3TJF A;  3G7J A;  5ID2 A;  5G1K A;  3RPN A;  3CSH A;  1OYJ A;  1X0R A;  3CWG A;  3U6V A;  3KZQ A;  2QSI A;  3KP9 A;  1OVN A;  1A8L A;  1G0T A;  4N10 A;  3M3M A;  4E8E A;  3LG6 A;  5KOX A;  2D2Z A;  5A5H B;  1SVM A;  2QC7 A;  4HDE A;  5F05 A;  1EEJ A;  1EP7 A;  4AJ8 A;  1H75 A;  2JAC A;  1XWG A;  3BJ5 A;  2V6O A;  1PMT A;  3GMF A;  3RHB A;  2BTO T;  3IXR A;  2IIY A;  1TU8 A;  4XHM A;  1B4P A;  2I4A A;  1ZL9 A;  2EFC A;  2LNS A;  5ABR A;  3IC4 A;  4KE3 A;  6GSY A;  1NHO A;  3WT2 A;  1SD8 A;  4IKH A;  1O6J A;  1H4O A;  2GSS A;  2R0P A;  3TJB A;  2MBT A;  1GSY A;  3FR3 A;  3DWV A;  5JCW A;  2H0G A;  5HFG A;  4PNG A;  5IMA A;  5D8I A;  1JZR A;  1OKD A;  2H75 A;  5EPF A;  4F0B A;  4JRR A;  5G31 A;  4PXO A;  2QA2 A;  4MF7 A;  3CRT A;  2IWT A;  5GSS A;  3HYP A;  3WGX A;  1FW1 A;  1EGR A;  2GSQ A;  2LQO A;  1OKT A;  6GSU A;  1AC1 A;  3HJM A;  1GTI A;  1O73 A;  5LD0 A;  1TXX A;  2H1B A;  2YJH A;  3EE2 A;  5CRD A;  1EZK A;  5CRE A;  2HSN A;  4AKI A;  4KSM A;  1V58 A;  4K1F A;  3KJY A;  4D73 B;  4POL A;  2IL3 A;  5ECN B;  3I43 A;  1RQM A;  3WD6 A;  2IMI A;  1R26 A;  1MTC A;  2LST A;  2GT6 A;  2FD3 A;  4IBP A;  2R3X A;  2B5X A;  5J4U A;  1A2J A;  3H93 A;  5A4U A;  4HS1 A;  2HXK A;  2JZT A;  3EU3 A;  1MD3 A;  4J2F A;  3BD2 A;  3FR9 A;  4IGJ A;  2OE1 A;  3G9B A;  2TRX A;  2C1Y A;  2AJQ B;  4Z7X A;  1ZYN A;  1PN9 A;  2MMZ A;  4POM A;  4Q5R A;  4KDU A;  4KF9 A;  1Z7R A;  1PGT A;  3C7M A;  1CQG A;  5FWG A;  4WXT A;  2KUC A;  4F2I A;  2O85 A;  1XVQ A;  1PD2 1;  4YAV A;  3IC8 A;  2DSA A;  4EXJ A;  4XCS A;  4TXV A;  5IO2 A;  1WP0 A;  5ECH B;  3ZML A;  4MJA A;  4GCI A;  4I5Q A;  3F4S A;  1HYU A;  4PQH A;  4OMV A;  4LMW A;  3ZYW A;  2WUL A;  3UBL A;  2NDO A;  3PGT A;  3TDG A;  3TKR A;  4K6X A;  4GWR A;  5HR1 A;  2FWG A;  4XRA A;  1O8W A;  2H72 A;  4BVY A;  3HDC A;  2HRF A;  2DIZ A;  5DCH A;  3KGK A;  1EGO A;  1X9W B;  2CT6 A;  2ON5 A;  3GV1 A;  4POK A;  2X99 A;  3VWW A;  3WGE A;  3ZMK A;  1AW9 A;  2C0G A;  5GAN D;  3R2Q A;  1R5P A;  4NHZ A;  2H1L A;  1EV4 A;  4MH2 A;  4MK3 A;  2MMA A;  2LTK A;  2HI7 A;  4TW5 A;  3Q18 A;  4DSR A;  2YWN A;  2R4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...