4E8HA

Structural of bombyx mori glutathione transferase bmgstd1 complex with gtt
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
214
Chain Sequence
HMPVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGEHMTPEYLKMNPQHTIPTMDDNGFILWESRAIQTYLVNAYGKDDSLYPKNPRQRAIIDQRLNFDLGTLYLRYLNLYTPILFRAYDQEKADKFDEALGWLNTFLDGRPFVAGENMTVADITIVVTITNIDAFGYDFSSHENIAKWFERTKKMLEPYGYDEIDVTGAKMLASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural of Bombyx mori glutathione transferase BmGSTD1 complex with GTT
rcsb
molecule keywords Glutathione S-transferase
molecule tags Transferase
source organism Bombyx mori
total genus 80
structure length 214
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4e8hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4e8hA01
4MJEA 3F6FA 1MD3A 4GCIA 3HA9A 3RHCA 2PWJA 3HCZA 4KSOA 2C3TA 2DSAA 3TDGA 1HQOA 4EKZA 5J9CA 5J41A 1X9MB 3F3QA 5IIZA 1U6TA 2H0HA 1XIYA 3ME8A 3QR6A 5D9TA 3P2AA 1SYXA 4O7HA 4HQSA 1MDIA 1PRXA 1ABAA 1SU9A 2NPBA 4K7NA 1BYEA 2V32A 3D21A 3K8NA 1SKSB 1NM3A 2DJ1A 5FHIA 4E8EA 2E7PA 3QPMA 1EOHA 5IQYA 2FY6A 5IMCA 5D8IA 1G6YA 1K3OA 4HOJA 4MH2A 3ZITA 4KF9A 1TP9A 4XS4B 3GNJA 3I69A 2MZCA 2QGVA 4G10A 2VUPA 1DBYA 2O87A 1PA3A 4WF5A 1O6JA 2LRCA 17GSA 3GH9A 1O85A 5JCUA 4LL1B 2FD3A 1BG5A 1SK1A 2HRKB 4TW5A 4PX1A 2VCWA 4WR4A 2EIRA 4N30A 3DVWA 4EUYA 1A8LA 5JWQB 3UVTA 4GRFA 2BJXA 2X8HA 1BJXA 1H75A 1A0FA 4I97A 4LA1A 1KTEA 1YEXA 3FZ9A 3EU4A 3DMLA 3GFKA 5GZZB 5KN3A 3F4RA 2CZ2A 1SENA 5IO2A 1ACVA 4RI6A 2PU9C 3KEBA 2FNOA 2EIOA 4EE0A 1PQNA 2F8AA 1TU8A 5G5FA 4KA0A 1URMA 2FWGA 1TK5B 1JZWA 5ELAA 2V2GA 3NIVA 3TCOA 1PKZA 3TKSA 4MJAA 1PGTA 1DUGA 2LQQA 4EF0A 1AC1A 2OJLA 4BWSA 1DSBA 5ECMB 1Y6EA 4KE3A 1Q98A 4DSSA 5DAKA 2NTOA 1Z5YE 1ZGNA 4J57E 1SL1B 2GSSA 2JL4A 3DYRA 1MDKA 3IPZA 3UIWA 8GSSA 1GSUA 2LJRA 6GSVA 1UVZA 2PN8A 3CSIA 1FAAA 3CXGA 4MZBA 3H79A 2DJKA 5IMFA 4TR0A 3FK8A 1BX9A 3V1WA 4BVYA 2YANA 2H8LA 2XC2A 4LMWA 3IE3A 3O6TA 5IPHA 3IR4A 1Q4JA 2O8VB 2CA8A 3HJMA 1QK8A 3FR9A 2J9HA 4J56E 1GP1A 2B1LA 4IELA 3EMPA 2VCXA 1TJDA 2LKUA 2HYXA 3KH9A 5F0GA 4JBBA 2HRAA 4MDCA 2PVOC 4JEDA 3DVXA 3EINA 2ALBA 3HD5A 2C80A 4ZB9A 1BEDA 1R4WA 4K7OA 4F2IA 1ILOA 4H86A 3OR5A 4NHZA 1XWAA 1SKWB 4IGJA 4KDXA 1ERTA 2M46A 2OE0A 5CYYA 4D73A 2LV3A 2H71A 2C8UA 4O92A 3G7JA 4GQCA 1T1VA 2GQLA 3EMXA 3CTFA 4NMUA 4IVFA 3TJJA 2HSHA 4Q5NA 1X0RA 1TKDB 1ZYEA 3QAVA 2WGRA 1C72A 3RPPA 4IHUA 2CVBA 2H1BA 5G2ZA 2HRNA 2K9FA 4MK3A 4G9HA 4FYBA 2E2GA 3QD9A 1I5GA 1USBA 5D9XA 2K6VA 4DSSB 5LCZA 5DAKB 4KSMA 4G2EA 3CRUA 2B1KA 4I6XA 1ZMAA 1OKTA 3IOSA 2WB9A 4EO3A 3ZIVA 5AIXA 1J08A 3GTUA 1AQWA 5JWOB 2GDRA 1Z3EA 1WOUA 6GSYA 4OWYA 3TJFA 3H1NA 5DCHA 2JZTA 2YV9A 3L9VA 4BVYB 4ECCA 2L4CA 1U3IA 1SJ6A 1ZCPA 4GSTA 4NV2A 5A4UA 2NVLA 4ZBDA 3FZAA 3HJOA 2C3QA 1A2JA 1SL2B 3G7IA 2VOCA 3EWLA 1S3AA 3I9V2 2RUEA 6GSUA 1ERUA 1MDJA 2VCZA 2YZUA 1Y25A 3HHVA 5DCGA 1AQVA 4K9ZA 1M2DA 2J23A 3WYWA 5DALA 3C71A 2H74A 1TDIA 1A24A 5FT3A 3A2XA 1PSQA 2L6DA 4NWYA 2VD0A 2IJYA 2X8GA 3GUSA 4QL9A 2JZSA 2HI7A 4I2UA 1XW6A 3GH6A 1THOA 1F2EA 1X5DA 2E0QA 2YV7A 1R26A 2RIIA 4HUAA 2LUSA 5D96A 1Z9HA 1R5PA 2O89A 2EC4A 1K0MA 2DBCA 2N5BA 4GSNA 2CX4A 3F0IA 4ULXA 5HR3A 2R6KA 2PBJA 3J7Yb 1ERWA 3CSJA 4MJBA 2HZEA 3H93A 2V6KA 3MSZA 2O85A 4K0GA 3P7XA 4BVXA 4PGTA 3N9JA 2DIYA 3UJ1A 1J9BA 2WDUA 5KN0A 4MF5A 4AJ8A 2O7KA 2WRTA 2TRCP 3QFAC 3GKKA 5EPFA 1A2LA 3GL3A 4TR3A 3EVIA 4FQUA 1T3BA 3GTUB 3GA4A 3D0ZA 5DJLA 5A4WA 4GQFA 4HS1A 4K6XA 1K3YA 2E2MA 5HFKA 2FWHA 1U87A 2XPDA 4DSRA 3KTLA 2I4AA 1HNAA 4XIHA 2EIQA 2MMOA 1NHOA 3CTGA 1EGRA 2HE3A 2YCDA 3ERFA 1OE7A 1QQ2A 4POMA 3LSZA 3TJGA 4USSA 1GTUA 1CQHA 2GT6A 1DE1A 2MMNA 4TR1A 4MLYA 3ZVJD 2M72A 2C4JA 5DALB 5ECLB 2RUFA 2R3XA 4GLTA 2H30A 1K0AA 2GT5A 2REMA 2H6ZA 1T7PB 3KMNA 4Q5RA 4XRDA 1TRVA 3JCML 1AQXA 3DKSA 1GTBA 3PH9A 1BQ7A 1G0TA 1F37A 2IPAA 4ECJA 2H73A 4F0CA 2HZEB 4ISDA 3A2WA 3IBHA 3E3EA 4CW9A 4OO5A 4BVXB 1ZYQB 1OYJA 2IMKA 2DIZA 2JACA 2I9HA 5CRDA 3DD3A 4XHMA 5E59A 5F8BA 1TRWA 5D9WA 3I43A 4G0IA 4KDUA 3LEFA 1YJ6A 3R3EA 5ELGA 2MMZA 3VLNA 2GSTA 2LTKA 3F8UA 4OO4A 2CV4A 2L6CA 3N5OA 3NZNA 1HNCA 3LYKA 2JADA 1IYHA 1I9DA 4MPGA 1M9BA 2X8CA 1YQ1A 2GGTA 2FCHA 4JR4A 3WT2A 2OADA 1OVNA 4MMMA 3D6IA 5DBQA 2VCVA 1QXHA 2H1AA 2VLUA 1F9MA 4IBPA 2H0IA 2X99A 3H4KA 4TR1B 3H8QA 4ZB6A 5ECNB 3DEXA 5B8AA 1A23A 1XWKA 1V2AA 3VURA 4V2NA 4YAPA 4ZILA 5ABRA 4L8EA 1TK8B 1ST9A 1PMTA 1A2MA 4G0LA 3QFBC 4F0BA 2IMIA 3U6VA 5F06A 1WMJA 2VD1A 3KM6A 1E2YA 4K7IA 3FKFA 4ZL7A 2FHEA 4AJ7A 3IHQA 1WIKA 1T4YA 4WR5A 1HNBA 5F05A 1SD9A 3GURA 1XWBA 4WBJA 1EEMA 2VO4A 3GKXA 3FY7A 2HFDA 4K8MA 3G7YA 4EVMA 4N0VA 3GSTA 1RK4A 1XBSA 2VIMA 1JLVA 11GSA 1J0FA 4X43A 4TXVA 5J5NA 4OCEA 1XFLA 3WGEA 5GSTA 2P0GA 2GSRA 2JSZA 4MF7A 3GSSA 13GSA 3D4TA 2L4QA 1ZOFA 2IMFA 4HJ2A 5CP1A 3GMFA 5IO0A 4GSSA 4OD7A 5E4WA 3US3A 1PX7A 4RI7A 4OFMA 3HDCA 12GSA 3HY2A 2VL9A 3VPQA 3ZYWA 1LU4A 3ZLPA 4YQMA 2VLVA 2KLXA 4MH3A 5AGYA 3R2QA 5J4UA 4BPYA 1XWCA 3HZ4A 2TIRA 2AJQB 5F07A 1Z6NA 4V1Ag 5ENUA 5AN1A 4HQZA 3RPNA 1GL8A 4L5OA 3LG6A 5B7CA 4O32A 4JR6A 3Q19A 1B9XC 3IA1A 3GN3A 5DQSA 1GSSA 4MA9A 1VF3A 1ZZYA 3ED3A 4EDYA 2F8FA 2C0DA 2OKAA 4IN0A 1EV9A 4RQXA 3L78A 3ZTLA 1VGLA 2YPMA 3F6DA 1JZDA 3BD2A 2CAIA 1YF1A 4HZ2A 1SL0B 1PN9A 1SD8A 2IL3A 1TK0B 1FOVA 4RUVA 1OC9A 3IC4A 2LJAA 4EXJA 2AV4A 1B4QA 2YJHA 4KUNA 1N2AA 2F51A 3TJKA 1VF4A 1TI1A 3IV4A 1PL2A 1V57A 2LRNA 4OFNA 3M8NA 4FIWA 4XS1A 1VF1A 4P3YB 1GSQA 5J3RA 1TI3A 4FYCA 4V1Ap 3TKQA 3LGCA 4I8BA 1CQGA 3KP8A 6GSTA 1JZRA 3RBTA 4KDYA 1OKDA 1RQMA 1QFNA 1AW9A 4HEA2 6GSXA 4ZBBA 2B7JA 2DJ2A 5JWRB 2QSIA 5EVOA 2GQKA 2P31A 3W8JA 3AY8A 3M9KA 3BJ5A 5G31A 2AAWA 2VLTA 2H1DA 1YDKA 3KD0A 5B8BA 1GSFA 1EGOA 1X5CA 2A2RA 4Q5FA 2ES7A 4AGSA 2FA4A 1TOFA 2HZFA 4MZCA 4Z7XA 5C04A 3ZL5A 1MD4A 1KEBA 1LJRA 5KN1A 1O7UA 2C0GA 1XPVA 2PMTA 5D73A 2AYTA 2WULA 3C8EA 2LSTA 3VWUA 1GSDA 4G0KA 2I81A 5ECIB 1S3CA 2GZYA 3QAGA 1NSWA 3CYNA 4X1UA 1GULA 1H4OA 3KTBA 2RM6A 2GS3A 2CVKA 3QOUA 19GSA 1X5EA 5HQPA 1U88A 3HVSA 4OMVA 1E6BA 3KGKA 3GRXA 3TGZA 4PURA 2CZ3A 1ERVA 2CQ9A 5A4VA 1G7OA 4DVCA 3KH7A 5CREA 4ILFA 3NOFA 4LLRA 2HXKA 1MTCA 3APOA 6GSWA 2YOIA 1OC9B 3KP9A 4EC0A 2RLIA 3WGDA 3ERGA 3ISOA 4Q5QA 2DLXA 1WRYA 5HFIA 5C00A 4O5RA 2AHEA 4PQ1A 4TKYA 1PD21 2B5YA 1TTZA 3W8SA 1XOBA 3VK9A 2HSMA 3FRCA 1GUKA 3KJYA 3UMAA 1WJKA 5ECQB 1LBKA 2JU5A 2OE3A 3GYKA 2R5GA 2B6MA 2IN3A 2HSYA 3C1RA 4G19A 4N11A 4LMVA 5HR1A 2LEGA 2AUVA 3C7MA 2PERA 3WD6A 3RHBA 4TXOA 3VFIA 3EURA 1XW5A 5IMDA 3G9BA 2IWTA 5L71A 4KB3A 4F03A 2GZPA 4XTSA 2H76A 4CDOA 2VL2C 1X9WB 2XBQA 4WETA 4ZXGA 1SK0A 2DJJA 1W4VA 3KXOA 2ZUPA 2I1UA 4AJ6A 4TRXA 4KX4A 3GKNA 1MEKA 4BWQA 2FWEA 2QKEA 4PUAA 1Z6MA 1TW9A 1YKCA 3O76A 2MMAA 2WFCA 2B5XA 1T8EB 1GUHA 1WWJA 2BMXA 1K0DA 5HR2A 4POKA 2RM5A 4RQRA 1T00A 4DSQA 3Q74A 4WBRD 5CRWA 5G30A 3W6GA 3TKSE 3TKRA 20GSA 10GSA 2UZ8A 1RW1A 2K8VA 3WT1A 4JZQA 1GSYA 1B48A 3E9JB 2MBSA 2CVDA 4F82A 1EP7A 4JU5A 4PXOA 2GVPA 3FYGA 4I5QA 3EE2A 3LQ7A 2B3SA 1UA5A 3L4NA 1DE2A 2PPTA 2HSNB 1X9SB 4CHSA 1AAZA 4TR4A 2L57A 4IJ3A 3E0UA 4NPBA 3MWHA 3CMIA 2HSMB 1FB6A 4EDZA 4MF6A 3CRTA 4V2LA 2QC7A 3F63A 2VCQA 1GTAA 3KCMA 1EWXA 5ECRB 1Z7PA 5ECKB 3J7Yk 2YWMA 1XVWA 3VI5A 2XHFA 1M99A 3LYPA 4ID0A 4KH7A 4KW6A 2PGTA 4EL1A 4MABA 2FUG2 1K0OA 5GSSA 2A4VA 5CAXA 1OE8A 2FA8A 2YP6A 4JE1A 3KIJA 3LXZA 2WCIA 2JZRA 2HT9A 1NW2A 4TXOB 2IFQA 5G1LA 4KCEA 5ID2A 3SBCA 3D5JA 2KP2A 1PX6A 4KNDA 4IJIA 1G6WA 1O73A 4IP1A 4NXIA 2L59A 5LD0A 3M0FA 3IDVA 1K0CA 5IM9A 3ME7A 4K2DA 2YNXA 4I2TA 2MYGA 5DJMA 2DMMA 3FW2A 3MAKA 4QL7A 4WF4A 2P5QA 1EEJA 1GTIA 3DRNA 4POLA 3TKPA 1O8XA 4XCSA 5D93A 3APSA 9GSSA 4KGIA 1GNEA 3TRXA 3UBLA 1R5AA 1O8WA 1AIUA 3L9SA 1F3BA 1OAZA 5IOXA 2K18A 2DJ3A 1TU7A 4IQAA 3QAWA 5EL8A 3ZVJA 1YF0A 4XRAA 1M0UA 4QQ7A 3LFLA 2H75A 1AXDA 3DIEA 3TB2A 4ZIJA 3ZREA 1K0NA 1GUMA 2C0EA 2GZZA 2H72A 3EYTA 4NHWA 3TKSC 4KAEA 4ECBA 3TJBA 2WS2A 4IQ1A 2HLSA 5DQYA 1OC3A 2G2QA 1BAYA 3ZIJA 1U3AA 4MPFA 1V58A 4BA7A 2OBIA 1UN2A 2JSYA 1GLPA 1M7TA 1K0BA 5D9VA 3GHAA 5GAPD 2FLSA 3F9UA 3D4MA 2D2ZA 1KNGA 4MJCA 1YY7A 7GSSA 1SYRA 1FHEA 5H5RA 4K1FA 3ZFLA 4TN8A 2IFQB 3FHKA 5ID2B 22GSA 4OFTA 1QUWA 4ZBAA 4HU9A 3IK9A 4MCUA 2L5LA 1K3LA 1ML6A 2OA7A 1FVKA 3FEUA 1FO5A 2IMEA 4NAXA 3SWLA 18GSA 5AISA 3UAPA 2YWIA 4GWRA 1YEPA 4ML6A 3Q18A 3ZMLA 1SKRB 3BCKA 1XXUA 3P90A 3VI7A 5EY6A 5COHA 5IMVA 3KMOA 4OCFA 2KP1A 4YAVA 2AB6A 2B5EA 4MZWA 5CRHA 3M9JA 2NDOA 1M2AA 2N5AA 1PL1A 1G7EA 1TRUA 1SJIA 3VWVA 3HXSA 4NV5A 3FR3A 2TRXA 4L5LA 1QGVA 1GNWA 3F4SA 3HVXA 1EOGA 2V41A 4HJMA 2ZCTA 4FO5A 1WPIA 5DVBA 2PUKC 1WE0A 5ECPB 4WXTA 3ZMKA 3F3RA 3A5WA 2WJUA 4N10A 1NHYA 3LORA 5ECSA 1GH2A 3BCIA 4IP6A 4GF0A 4PQHA 5JCWA 3C73A 1M9AA 3FR6A 2YZHA 2LS5A 4MP4A 2FWFA 4F9ZA 4ACSA 2OE1A 4FH8A 3LXTA 4HU7A 1XWGA 2OACA 1JHBA 3QMXA 2L5OA 3F4TA 3HJPA 5IMAA 3MDKA 4GTUA 3UVHA 2KOKA 4PTSA 3IAS2 1XVQA 4FYUA 4N0ZA 2VAFA 2CAQA 5G1KA 5LNKe 2LNSA 5GAND 2H1GA 2WZ9A 4DEJA 5IPGA 2ON7A 3GV1A 4GXZA 2GSQA 2H01A 3S9FA 5IMZA 2MBTA 3GX0A 1W89A 1F3AA 1THXA 4L0WA 1HD2A 1V40A 3TRQA 5DDLA 2H6YA 3EU3A 2V6OA 3LWAA 1QMVA 1VRSD 1Z7RA 3QDNA 3CSHA 5ECOB 3PINA 2K8SA 4POBA 2F3MA 1SK2A 1ZL9A 3I6AA 3DGQA 1OC8A 1V9WA 4PNFA 2H70A 4IS0A 1FB0A 3DXBA 5G5EA 2N5FA 1YZXA 3FZ4A 1XW9A 1PKWA 2M80A 3Q6OA 3VWXA 2Z9SA 2GQMA 2XBIA 2H0GA 2YN1A 1JLWA 2DMLA 4JRRA 5BMUA 4X0XA 5HFGA 4V2MA 3DWVA 1EV4A 2H19A 4BL7A 5INYA 1VF2A 14GSA 2G0FA 1S3DA 5KN2A 5CO3A 2LJKA 2YJ7A 2NBSA 3BOAA 3KZQA 2ON5A 2GLRA 2P5RA 3IK7A 2HRFA 1KBNA 2YWOA 4ZB8A 2ZNMA 4D73B 2HNLA 1YKAA 2LQOA 6GSSA 2V1MA 1FVJA 2VM2A 2IMDA 5B6MA 2VM1A 3BBYA 2DC5A 3PPUA 1R7HA 3ZZXA 3M3MA 2BTOT 3CBUA 5J9BA 4K0NA 1JZOA 3TOTA 1ON4A 2XPEA 4PUFC 4E8HA 3GX8A 4TOPA 3EC3A 1T4ZA 3HZ8A 3ERWA 1B8XA 3GKMA 3UARA 2DJ0A 1UC7A 4WKWA 4YH2A 3TUEA 3RDWA 1M2BA 1SJZA 3L9UA 2CX3A 3GIXA 4PQIA 2C1YA 1A0RP 1IYIA 1FG4A 4LL4B 5AIVA 4XS6A 1FW1A 5H5QA 2CT6A 3VWWA 5IOWA 3GL5A 5JCGA 3M1GA 2FGXA 4ECIA 3VPTA 4KCAA 3HKRA 1N8JA 2I3YA 1GSEA 1AUCA 5H5SA 4ZL9A 1GRXA 4J2FA 3IRAA 3UEMA 3ZRDA 3HYPA 1XZOA 1O81A 3RAZA 5CNWA 5CRGA 1A8YA 4L0UA 5HR0A 4HZ4A 3ZFBA 4BL7B 1GLQA 1B4PA 4YQUA 3PR8A 3UL3A 3WGXA 3IXRA 2B7KA 3A2VA 5A5KA 3C1SA 4XS4A 4HI7A 3TOUA 2LRTA 1EZKA 1GWCA 2X64A 3APQA 1B9YC 1WP0A 3FZ5A 1XOAA 2KHPA 4ZL8A 2VL2A 2R2JA 4YQVA 2GTUA 3LJRA 3HVVA 1F6MC 16GSA 1HYUA 2C3NA 2R37A 3U5RE 4HDEA 2H6XA 5B6NA 4WEYA 2HRKA 3IAM2 2F9SA 3L0HA 2H66A 5KEJA 2OBKA 3QCPA 3D22A 1XCCA 3A3TA 1TRSA 1V98A 3O3TA 2C0FA 2LNTA 4ML1A 1EP8A 5FWGA 2IIYA 2R4VA 4TVEA 4IW9A 4PNGA 3TRPA 2KUCA 2PVQA 2HQTA 4IKHA 3UBKA 2VL3A 2YWNA 2A2SA 2VCTA 1JFUA 1TXXA 3UOMA 4AF2A 5ECHB 3PGTA 3P8WA 3IC8A 3MNGA
chains in the Genus database with same CATH superfamily
4MJEA 3F6FA 1MD3A 4GCIA 3HA9A 3RHCA 2PWJA 3HCZA 4KSOA 2C3TA 2DSAA 3TDGA 1HQOA 4EKZA 5J9CA 5J41A 1X9MB 3F3QA 5IIZA 1U6TA 2H0HA 1XIYA 3ME8A 3QR6A 5D9TA 3P2AA 1SYXA 4O7HA 4HQSA 1MDIA 1PRXA 1ABAA 1SU9A 2NPBA 4K7NA 1BYEA 2V32A 3D21A 3K8NA 1SKSB 1NM3A 2DJ1A 5FHIA 4E8EA 2E7PA 3QPMA 1EOHA 5IQYA 2FY6A 5IMCA 5D8IA 1G6YA 1K3OA 4HOJA 4MH2A 3ZITA 4KF9A 1TP9A 4XS4B 3GNJA 3I69A 2MZCA 1SVMA 2QGVA 4G10A 2VUPA 1DBYA 2O87A 1PA3A 4WF5A 1O6JA 2LRCA 17GSA 3GH9A 1O85A 5JCUA 4LL1B 2FD3A 1BG5A 1SK1A 2HRKB 4TW5A 4PX1A 2VCWA 4WR4A 2EIRA 4O5UA 4N30A 2R0GA 3DVWA 4EUYA 1A8LA 5JWQB 3UVTA 4GRFA 2BJXA 2X8HA 1BJXA 1H75A 1A0FA 4I97A 4LA1A 1KTEA 1YEXA 3FZ9A 3EU4A 3DMLA 3GFKA 5GZZB 5KN3A 3F4RA 4PHZC 2CZ2A 1SENA 5IO2A 1ACVA 4RI6A 2PU9C 3KEBA 2FNOA 2EIOA 4EE0A 1PQNA 2F8AA 1TU8A 1S3RA 5G5FA 4KA0A 1URMA 2FWGA 1TK5B 1JZWA 5ELAA 2V2GA 3NIVA 3TCOA 1PKZA 3TKSA 4AKGA 4MJAA 1PGTA 1DUGA 2LQQA 4EF0A 1AC1A 1YVLA 2OJLA 4BWSA 1DSBA 5ECMB 1Y6EA 4KE3A 1Q98A 4DSSA 5DAKA 2NTOA 1Z5YE 1ZGNA 4J57E 1SL1B 2GSSA 2JL4A 3DYRA 1MDKA 3IPZA 3UIWA 8GSSA 1GSUA 2LJRA 6GSVA 1UVZA 2PN8A 3CSIA 1FAAA 3CXGA 4MZBA 3H79A 2DJKA 5IMFA 4TR0A 3FK8A 1BX9A 3V1WA 4BVYA 2YANA 2H8LA 2XC2A 4LMWA 3IE3A 3O6TA 5IPHA 3IR4A 1Q4JA 2O8VB 2CA8A 3HJMA 1QK8A 3FR9A 2J9HA 4J56E 2A4HA 1GP1A 2B1LA 4IELA 3EMPA 2VCXA 1TJDA 2LKUA 2HYXA 3KH9A 5F0GA 4JBBA 2HRAA 4MDCA 4A5PA 2PVOC 4JEDA 3DVXA 3EINA 2ALBA 3HD5A 2C80A 4ZB9A 1BEDA 1R4WA 4K7OA 4F2IA 1ILOA 4H86A 3OR5A 4NHZA 1XWAA 1SKWB 4IGJA 4KDXA 1ERTA 2M46A 2OE0A 5CYYA 4D73A 2LV3A 2H71A 2C8UA 4O92A 3G7JA 4GQCA 1T1VA 2GQLA 3EMXA 3CTFA 4NMUA 3FMWA 4IVFA 3TJJA 3RFRC 2HSHA 4Q5NA 1X0RA 1TKDB 1ZYEA 3QAVA 2WGRA 1C72A 3RPPA 4IHUA 2CVBA 2H1BA 5G2ZA 2HRNA 2K9FA 4MK3A 4G9HA 4FYBA 2E2GA 3QD9A 1I5GA 1USBA 5D9XA 2K6VA 4DSSB 5LCZA 5DAKB 4KSMA 4G2EA 3CRUA 2B1KA 4I6XA 1ZMAA 1OKTA 3IOSA 2WB9A 4EO3A 3ZIVA 5AIXA 1J08A 3GTUA 1AQWA 5JWOB 2GDRA 1Z3EA 1WOUA 6GSYA 4OWYA 3TJFA 3H1NA 5DCHA 2JZTA 2YV9A 3L9VA 4BVYB 4ECCA 2L4CA 1U3IA 1SJ6A 1ZCPA 4GSTA 4NV2A 5A4UA 2NVLA 4ZBDA 3FZAA 3HJOA 2C3QA 1A2JA 1SL2B 2X49A 3G7IA 2VOCA 3EWLA 1S3AA 3I9V2 2RUEA 6GSUA 1ERUA 1MDJA 2VCZA 2YZUA 1Y25A 3HHVA 5DCGA 1AQVA 4K9ZA 1M2DA 2J23A 3WYWA 5DALA 3C71A 2H74A 1TDIA 1A24A 5FT3A 2WVYA 3A2XA 1PSQA 2L6DA 4NWYA 2VD0A 2IJYA 2X8GA 3GUSA 4QL9A 2JZSA 2HI7A 4I2UA 4Z2RA 1XW6A 3GH6A 1THOA 1F2EA 2EFEA 1X5DA 2E0QA 2YV7A 1R26A 2RIIA 4HUAA 2LUSA 5D96A 1Z9HA 1R5PA 2O89A 4YKGA 2EC4A 1K0MA 2DBCA 2N5BA 4GSNA 2CX4A 3F0IA 4ULXA 5HR3A 2R6KA 2PBJA 3J7Yb 1ERWA 3CSJA 4MJBA 2HZEA 3H93A 2V6KA 3MSZA 2O85A 4K0GA 3P7XA 4BVXA 1S4BP 4PGTA 3N9JA 2DIYA 3UJ1A 1J9BA 2WDUA 4AI6A 5KN0A 4MF5A 4AJ8A 2O7KA 2WRTA 2TRCP 3QFAC 3GKKA 5EPFA 1A2LA 3GL3A 2WVZA 4TR3A 3EVIA 4FQUA 1T3BA 3GTUB 3GA4A 3D0ZA 5DJLA 5A4WA 4GQFA 4HS1A 4K6XA 1K3YA 2E2MA 5HFKA 2FWHA 4CY6A 1U87A 2XPDA 4DSRA 3KTLA 2I4AA 2WZSA 1HNAA 4XIHA 2EIQA 2MMOA 1NHOA 3CTGA 1EGRA 2HE3A 2YCDA 3ERFA 1OE7A 1QQ2A 4POMA 3LSZA 3TJGA 4USSA 4YKFA 1GTUA 1CQHA 2GT6A 1DE1A 2MMNA 4TR1A 4MLYA 3ZVJD 2M72A 2C4JA 5DALB 5ECLB 2RUFA 5A34A 3RGBC 2R3XA 4GLTA 2H30A 1K0AA 2GT5A 2REMA 2H6ZA 1T7PB 3KMNA 4Q5RA 4XRDA 4HSCX 1TRVA 3JCML 1AQXA 3DKSA 1GTBA 3PH9A 1BQ7A 4EIQA 1G0TA 1F37A 2IPAA 4ECJA 2A2PA 2H73A 4F0CA 2HZEB 4ISDA 3A2WA 3IBHA 3E3EA 2WW2A 1M3JA 4CW9A 4OO5A 4BVXB 1ZYQB 1OYJA 2IMKA 2DIZA 2JACA 2I9HA 5CRDA 3DD3A 4XHMA 5E59A 5F8BA 1TRWA 5D9WA 3I43A 4G0IA 4KDUA 3LEFA 1YJ6A 3R3EA 5ELGA 4QMKA 2MMZA 3VLNA 2GSTA 2LTKA 3F8UA 4OO4A 2CV4A 2L6CA 3N5OA 3NZNA 1HNCA 3LYKA 2JADA 1IYHA 1I9DA 4MPGA 1M9BA 2X8CA 1YQ1A 4AKXB 2GGTA 2FCHA 4JR4A 3WT2A 2OADA 1OVNA 4MMMA 3D6IA 5DBQA 2VCVA 1QXHA 2H1AA 2VLUA 1F9MA 4IBPA 3CQFA 2H0IA 2X99A 1Y1UA 3H4KA 4TR1B 3H8QA 4ZB6A 5ECNB 3DEXA 5B8AA 1A23A 1XWKA 1V2AA 3VURA 5BRTA 5A34B 4V2NA 4YAPA 4ZILA 5ABRA 4L8EA 1TK8B 1ST9A 1PMTA 1A2MA 4G0LA 3QFBC 4F0BA 2IMIA 3U6VA 5F06A 1WMJA 2VD1A 3KM6A 1E2YA 4K7IA 3FKFA 4ZL7A 2FHEA 4AJ7A 1ZYNA 1ZYPA 3IHQA 1WIKA 1T4YA 4WR5A 1HNBA 5F05A 1SD9A 3GURA 1XWBA 4WBJA 1EEMA 2VO4A 3GKXA 3FY7A 2HFDA 4K8MA 3G7YA 4EVMA 4G01A 4N0VA 3GSTA 1RK4A 1XBSA 2VIMA 2EFHA 1JLVA 11GSA 1J0FA 4X43A 4TXVA 5J5NA 4OCEA 1XFLA 3WGEA 5GSTA 5KOXA 2P0GA 2GSRA 2JSZA 4MF7A 5J4VA 3CWGA 13GSA 3GSSA 4Z2TA 3D4TA 2L4QA 1ZOFA 2IMFA 4HJ2A 5CP1A 3GMFA 5IO0A 4GSSA 4OD7A 5E4WA 3US3A 1PX7A 4RI7A 4OFMA 4PI0C 3HDCA 12GSA 3HY2A 2VL9A 3VPQA 3ZYWA 1LU4A 2QA1A 3ZLPA 4YQMA 2VLVA 2KLXA 4MH3A 5AGYA 3R2QA 5J4UA 4BPYA 1XWCA 3HZ4A 4K5RA 2TIRA 2AJQB 5F07A 1Z6NA 4V1Ag 5ENUA 5AN1A 4HQZA 3RPNA 1GL8A 4L5OA 3LG6A 5B7CA 4O32A 4JR6A 3Q19A 1B9XC 3IA1A 3MIXA 3GN3A 5DQSA 1GSSA 4MA9A 1VF3A 1ZZYA 3ED3A 4EDYA 2F8FA 2C0DA 2OKAA 4IN0A 1EV9A 4RQXA 3L78A 3ZTLA 1VGLA 2YPMA 3F6DA 1JZDA 3BD2A 2CAIA 1YF1A 4HZ2A 1SL0B 1PN9A 1SD8A 2IL3A 1TK0B 1FOVA 4RUVA 1OC9A 3IC4A 2LJAA 4EXJA 2AV4A 1B4QA 2YJHA 4KUNA 1N2AA 2F51A 3TJKA 1VF4A 1TI1A 3IV4A 1PL2A 1V57A 2LRNA 4OFNA 3M8NA 4FIWA 4XS1A 1VF1A 4P3YB 1GSQA 5J3RA 1TI3A 4FYCA 4V1Ap 1TXUA 3TKQA 3LGCA 4I8BA 1CQGA 3KP8A 6GSTA 1JZRA 3RBTA 2WW3A 4KDYA 1OKDA 1RQMA 1QFNA 1AW9A 4HEA2 6GSXA 4ZBBA 2B7JA 2DJ2A 5JWRB 2QSIA 5EVOA 2GQKA 2P31A 3W8JA 3AY8A 3M9KA 3BJ5A 5G31A 2AAWA 2VLTA 2H1DA 1YDKA 3KD0A 5B8BA 1GSFA 1EGOA 1X5CA 2A2RA 4Q5FA 2ES7A 4AGSA 2FA4A 1TOFA 2HZFA 4MZCA 4Z7XA 1I1IP 5C04A 5J40A 3ZL5A 1MD4A 1KEBA 1LJRA 5KN1A 1O7UA 2C0GA 1XPVA 2PMTA 5D73A 2AYTA 2WULA 3C8EA 2LSTA 3VWUA 1GSDA 4G0KA 2I81A 5ECIB 1S3CA 2GZYA 3QAGA 1NSWA 3CYNA 4X1UA 1GULA 1H4OA 3KTBA 2RM6A 2GS3A 2CVKA 3QOUA 19GSA 1X5EA 5HQPA 1U88A 3HVSA 4OMVA 1E6BA 3KGKA 3GRXA 3TGZA 4PURA 2CZ3A 1ERVA 2CQ9A 5A4VA 3TU3B 1G7OA 4DVCA 3KH7A 5CREA 4ILFA 3NOFA 4LLRA 2HXKA 1MTCA 3APOA 6GSWA 2YOIA 1OC9B 3KP9A 4EC0A 2RLIA 3WGDA 3ERGA 3ISOA 4Q5QA 2DLXA 1WRYA 5HFIA 5C00A 4O5RA 2AHEA 4PQ1A 4TKYA 2HSNA 1PD21 2B5YA 1TTZA 3W8SA 1XOBA 3VK9A 2HSMA 2O5VA 3EPTA 3FRCA 2R0PA 1GUKA 3KJYA 3UMAA 1WJKA 5ECQB 1LBKA 2JU5A 2OE3A 3GYKA 2R5GA 2B6MA 2IN3A 2HSYA 3C1RA 4G19A 4N11A 4LMVA 5HR1A 2LEGA 2AUVA 3C7MA 2PERA 3WD6A 3RHBA 4TXOA 3VFIA 3EURA 1XW5A 5IMDA 3G9BA 2IWTA 5L71A 4KB3A 4F03A 2GZPA 4XTSA 2H76A 4CDOA 2VL2C 1X9WB 2XBQA 4WETA 4ZXGA 1SK0A 2DJJA 1W4VA 3KXOA 2ZUPA 2I1UA 1M3IA 4AJ6A 4TRXA 4KX4A 3GKNA 1MEKA 4BWQA 2FWEA 1PFOA 4PUAA 2QKEA 4K2XA 1Z6MA 1TW9A 1YKCA 3O76A 2MMAA 2WFCA 2B5XA 1T8EB 1GUHA 1WWJA 2BMXA 3CHXC 1K0DA 5HR2A 4POKA 2RM5A 4RQRA 1T00A 4DSQA 3Q74A 4WBRD 4AKHA 5CRWA 5G30A 3W6GA 3TKSE 3TKRA 20GSA 10GSA 2UZ8A 1RW1A 2K8VA 3WT1A 4JZQA 1GSYA 1B48A 3E9JB 4AKIA 2MBSA 2CVDA 4F82A 1EP7A 4JU5A 4PXOA 2GVPA 1YEWC 3FYGA 4I5QA 3EE2A 3LQ7A 2B3SA 1UA5A 3L4NA 1DE2A 2PPTA 2HSNB 1X9SB 4CHSA 1AAZA 4TR4A 2L57A 4IJ3A 3E0UA 4NPBA 3MWHA 3CMIA 2HSMB 1FB6A 4EDZA 4MF6A 3CRTA 4V2LA 2QC7A 3F63A 2VCQA 1GTAA 3KCMA 1EWXA 5ECRB 1Z7PA 5ECKB 3J7Yk 2YWMA 1XVWA 4ICYA 3VI5A 2XHFA 1M99A 3LYPA 4ID0A 4KH7A 4KW6A 2PGTA 4EL1A 4MABA 2FUG2 1K0OA 5GSSA 2A4VA 5CAXA 1OE8A 2FA8A 2YP6A 4PI2C 4JE1A 3KIJA 3LXZA 2WCIA 2JZRA 2HT9A 1NW2A 4TXOB 2IFQA 5G1LA 4KCEA 5ID2A 2EFDA 3SBCA 3D5JA 2KP2A 1PX6A 4KNDA 4IJIA 1G6WA 4EIPA 1O73A 4IP1A 4NXIA 2L59A 5LD0A 3M0FA 3IDVA 1K0CA 5IM9A 1SVOA 3ME7A 2O36A 4K2DA 2YNXA 4I2TA 2MYGA 5DJMA 2DMMA 3FW2A 3MAKA 4QL7A 4WF4A 2P5QA 1EEJA 1GTIA 3DRNA 4POLA 3TKPA 1O8XA 4XCSA 5D93A 2WVXA 3APSA 9GSSA 4KGIA 1GNEA 3TRXA 3UBLA 1R5AA 1O8WA 1AIUA 3L9SA 1F3BA 1OAZA 5IOXA 2K18A 2DJ3A 1TU7A 4IQAA 3QAWA 5EL8A 3ZVJA 1YF0A 4XRAA 1M0UA 4QQ7A 3LFLA 2H75A 1AXDA 2QA2A 3DIEA 3TB2A 4ZIJA 3ZREA 1K0NA 1GUMA 2C0EA 2GZZA 2H72A 3EYTA 4NHWA 3TKSC 4KAEA 4ECBA 3TJBA 2WS2A 4IQ1A 4FXYP 2HLSA 5DQYA 1OC3A 2G2QA 1BAYA 3ZIJA 1U3AA 4MPFA 1V58A 4BA7A 2OBIA 1UN2A 2JSYA 1GLPA 1M7TA 1K0BA 5D9VA 3GHAA 5GAPD 2FLSA 3F9UA 3D4MA 2D2ZA 1KNGA 4MJCA 1YY7A 7GSSA 1SYRA 1FHEA 5H5RA 4K1FA 3ZFLA 4TN8A 2IFQB 3FHKA 5ID2B 22GSA 1FOHA 4OFTA 1QUWA 4ZBAA 4HU9A 3IK9A 4MCUA 2L5LA 1PN0A 3A5IA 1K3LA 1ML6A 2OA7A 1FVKA 3FEUA 1FO5A 2IMEA 4NAXA 3SWLA 18GSA 5AISA 2O3EA 3UAPA 2YWIA 4GWRA 1YEPA 4ML6A 3Q18A 3ZMLA 1SKRB 3BCKA 1XXUA 3P90A 3VI7A 5EY6A 5COHA 5IMVA 3KMOA 2WW0A 4OCFA 2KP1A 4YAVA 2AB6A 2B5EA 4MZWA 5CRHA 3M9JA 2NDOA 1M2AA 5KOWA 2N5AA 1PL1A 3LW9A 1G7EA 2WVXB 1TRUA 1SJIA 5J4YA 3VWVA 3HXSA 4NV5A 3FR3A 2TRXA 4L5LA 1QGVA 1GNWA 3F4SA 3HVXA 1EOGA 2V41A 4HJMA 2ZCTA 4FO5A 1WPIA 5DVBA 4CY8A 2PUKC 1WE0A 5ECPB 4WXTA 3ZMKA 3F3RA 3A5WA 2WJUA 4N10A 1NHYA 3LORA 5ECSA 1GH2A 3BCIA 4IP6A 4GF0A 2WW1A 4PQHA 2DKIA 5JCWA 3C73A 1M9AA 3FR6A 2YZHA 2LS5A 4MP4A 2FWFA 4F9ZA 4ACSA 2OE1A 4FH8A 3LXTA 4HU7A 1XWGA 2OACA 1JHBA 3QMXA 2L5OA 3F4TA 3HJPA 5IMAA 3MDKA 4GTUA 3UVHA 2KOKA 4GDFA 4PTSA 3IAS2 1N25A 1XVQA 4FYUA 4N0ZA 2VAFA 2CAQA 5J47A 5G1KA 5LNKe 2LNSA 5GAND 2H1GA 2WZ9A 4DEJA 5IPGA 2H1LA 2ON7A 3GV1A 4GXZA 2GSQA 2H01A 3S9FA 5IMZA 2MBTA 3GX0A 1W89A 1F3AA 1THXA 4L0WA 5A5HA 1HD2A 1V40A 3TRQA 5DDLA 2H6YA 3EU3A 2V6OA 3LWAA 1QMVA 1VRSD 1Z7RA 3QDNA 3CSHA 5ECOB 3PINA 2EFCA 2K8SA 4POBA 2F3MA 1SK2A 2VKZG 1ZL9A 3I6AA 3DGQA 2DKHA 1OC8A 1V9WA 4PNFA 2H70A 4IS0A 1FB0A 3DXBA 5G5EA 2N5FA 1YZXA 3FZ4A 1XW9A 1PKWA 2OT3A 2M80A 3Q6OA 3VWXA 2Z9SA 2GQMA 2XBIA 2H0GA 2YN1A 1JLWA 2DMLA 1XG8A 4JRRA 2X4AA 5BMUA 4X0XA 5HFGA 4O5QA 4V2MA 3HMJG 3DWVA 1EV4A 2H19A 4BL7A 5INYA 1VF2A 14GSA 4BIKA 2G0FA 1S3DA 5KN2A 5CO3A 1BG1A 2LJKA 2YJ7A 2NBSA 3BOAA 3KZQA 2ON5A 2GLRA 3IHGA 2P5RA 3IK7A 2HRFA 1KBNA 2YWOA 4ZB8A 2ZNMA 4D73B 2HNLA 1YKAA 2LQOA 6GSSA 4E68A 2V1MA 1FVJA 2VM2A 2IMDA 5B6MA 2VM1A 3BBYA 2DC5A 3PPUA 1R7HA 3ZZXA 3M3MA 2BTOT 3CBUA 5A5HB 5J9BA 4K0NA 1JZOA 3TOTA 1ON4A 2XPEA 4PUFC 4E8HA 3GX8A 4TOPA 3EC3A 4ZB7A 5A1NA 2UV8G 1T4ZA 3HZ8A 3ERWA 1B8XA 3GKMA 3UARA 2DJ0A 1UC7A 4WKWA 4YH2A 3TUEA 3RDWA 1M2BA 1SJZA 3L9UA 2CX3A 3HVNA 3GIXA 4PQIA 4K5SA 2C1YA 1A0RP 1IYIA 1FG4A 4LL4B 5AIVA 4XS6A 1FW1A 5H5QA 2CT6A 3VWWA 5IOWA 3GL5A 5JCGA 3M1GA 2FGXA 4ECIA 3VPTA 4KCAA 3HKRA 1N8JA 2I3YA 1GSEA 3MYDA 1AUCA 5H5SA 4ZL9A 1GRXA 4J2FA 3IRAA 5BMUB 3UEMA 3ZRDA 3HYPA 1XZOA 1O81A 3RAZA 5CNWA 5CRGA 1A8YA 4L0UA 5HR0A 4HZ4A 3ZFBA 4BL7B 1GLQA 1B4PA 4YQUA 3PR8A 3UL3A 3WGXA 3IXRA 1BF5A 2B7KA 3A2VA 5A5KA 3C1SA 4XS4A 4HI7A 3TOUA 2LRTA 4W66A 1EZKA 1GWCA 2X64A 3APQA 1B9YC 1WP0A 3FZ5A 1XOAA 2KHPA 4ZL8A 2VL2A 2R2JA 4YQVA 2GTUA 3LJRA 3HVVA 1F6MC 16GSA 1HYUA 2C3NA 4Z2UA 2R37A 3U5RE 4HDEA 2H6XA 5B6NA 4WEYA 2HRKA 3IAM2 2F9SA 3L0HA 2H66A 5KEJA 2OBKA 3QCPA 3D22A 1XCCA 3A3TA 1TRSA 1V98A 3O3TA 2C0FA 4MNNA 2R0CA 4N3ZA 1SVLA 2LNTA 4ML1A 1EP8A 5FWGA 2IIYA 2R4VA 4TVEA 4IW9A 4PNGA 3TRPA 2KUCA 2PVQA 2HQTA 4IKHA 3UBKA 2VL3A 2YWNA 2A2SA 2VCTA 1JFUA 1TXXA 5A1NB 3UOMA 4AF2A 4X4JA 5ECHB 3PGTA 3P8WA 3IC8A 3MNGA
chains in the Genus database with same CATH topology
4MJEA 3F6FA 1MD3A 4GCIA 3HA9A 3RHCA 2PWJA 3HCZA 4KSOA 2C3TA 2DSAA 3TDGA 1HQOA 4EKZA 5J9CA 5J41A 1X9MB 3F3QA 5IIZA 1U6TA 2H0HA 1XIYA 3ME8A 3QR6A 5D9TA 3P2AA 1SYXA 4O7HA 4HQSA 1MDIA 1PRXA 1ABAA 1SU9A 2NPBA 4K7NA 1BYEA 2V32A 3D21A 3K8NA 1SKSB 1NM3A 2DJ1A 5FHIA 4E8EA 2E7PA 3QPMA 1EOHA 5IQYA 2FY6A 5IMCA 5D8IA 1G6YA 1K3OA 4HOJA 4MH2A 3ZITA 4KF9A 1TP9A 4XS4B 3GNJA 3I69A 2MZCA 1SVMA 2QGVA 4G10A 2VUPA 1DBYA 2O87A 1PA3A 4WF5A 1O6JA 2LRCA 17GSA 3GH9A 1O85A 5JCUA 4LL1B 2FD3A 1BG5A 1SK1A 2HRKB 4TW5A 4PX1A 2VCWA 4WR4A 2EIRA 4O5UA 4N30A 2R0GA 3DVWA 4EUYA 1A8LA 5JWQB 3UVTA 4GRFA 2BJXA 2X8HA 1BJXA 1H75A 1A0FA 4I97A 4LA1A 1KTEA 1YEXA 3FZ9A 3EU4A 3DMLA 3GFKA 5GZZB 5KN3A 3F4RA 2CZ2A 1SENA 5IO2A 1ACVA 4RI6A 2PU9C 3KEBA 2FNOA 2EIOA 4EE0A 1PQNA 2F8AA 1TU8A 5G5FA 4KA0A 1URMA 2FWGA 1TK5B 1JZWA 5ELAA 2V2GA 3NIVA 3TCOA 1PKZA 3TKSA 4AKGA 4MJAA 1PGTA 1DUGA 2LQQA 4EF0A 1AC1A 1YVLA 2OJLA 4BWSA 1DSBA 5ECMB 1Y6EA 4KE3A 1Q98A 4DSSA 5DAKA 2NTOA 1Z5YE 1ZGNA 4J57E 1SL1B 2GSSA 2JL4A 3DYRA 1MDKA 3IPZA 3UIWA 8GSSA 1GSUA 2LJRA 6GSVA 1UVZA 2PN8A 3CSIA 1FAAA 3CXGA 4MZBA 3H79A 2DJKA 5IMFA 4TR0A 3FK8A 1BX9A 3V1WA 4BVYA 2YANA 2H8LA 2XC2A 4LMWA 3IE3A 3O6TA 5IPHA 3IR4A 1Q4JA 2O8VB 2CA8A 3HJMA 1QK8A 3FR9A 2J9HA 4J56E 2A4HA 1GP1A 2B1LA 4IELA 3EMPA 2VCXA 1TJDA 2LKUA 2HYXA 3KH9A 5F0GA 4JBBA 2HRAA 4MDCA 4A5PA 2PVOC 4JEDA 3DVXA 3EINA 2ALBA 3HD5A 2C80A 4ZB9A 1BEDA 1R4WA 4K7OA 4F2IA 1ILOA 4H86A 3OR5A 4NHZA 1XWAA 1SKWB 4IGJA 4KDXA 1ERTA 2M46A 2OE0A 5CYYA 4D73A 2LV3A 2H71A 2C8UA 4O92A 3G7JA 4GQCA 1T1VA 2GQLA 3EMXA 3CTFA 4NMUA 3FMWA 4IVFA 3TJJA 2HSHA 4Q5NA 1X0RA 1TKDB 1ZYEA 3QAVA 2WGRA 1C72A 3RPPA 4IHUA 2CVBA 2H1BA 5G2ZA 2HRNA 2K9FA 4MK3A 4G9HA 4FYBA 2E2GA 3QD9A 1I5GA 1USBA 5D9XA 2K6VA 4DSSB 5LCZA 5DAKB 4KSMA 4G2EA 3CRUA 2B1KA 4I6XA 1ZMAA 1OKTA 3IOSA 2WB9A 4EO3A 3ZIVA 5AIXA 1J08A 3GTUA 1AQWA 5JWOB 2GDRA 1Z3EA 1WOUA 6GSYA 4OWYA 3TJFA 3H1NA 5DCHA 2JZTA 2YV9A 3L9VA 4BVYB 4ECCA 2L4CA 1U3IA 1SJ6A 1ZCPA 4GSTA 4NV2A 5A4UA 2NVLA 4ZBDA 3FZAA 3HJOA 2C3QA 1A2JA 1SL2B 2X49A 3G7IA 2VOCA 3EWLA 1S3AA 3I9V2 2RUEA 6GSUA 1ERUA 1MDJA 2VCZA 2YZUA 1Y25A 3HHVA 5DCGA 1AQVA 4K9ZA 1M2DA 2J23A 3WYWA 5DALA 3C71A 2H74A 1TDIA 1A24A 5FT3A 3A2XA 1PSQA 2L6DA 4NWYA 2VD0A 2IJYA 2X8GA 3GUSA 4QL9A 2JZSA 2HI7A 4I2UA 4Z2RA 1XW6A 3GH6A 1THOA 1F2EA 2EFEA 1X5DA 2E0QA 2YV7A 1R26A 2RIIA 4HUAA 2LUSA 5D96A 1Z9HA 1R5PA 2O89A 4YKGA 2EC4A 1K0MA 2DBCA 2N5BA 4GSNA 2CX4A 3F0IA 4ULXA 5HR3A 2R6KA 2PBJA 3J7Yb 1ERWA 3CSJA 4MJBA 2HZEA 3H93A 2V6KA 3MSZA 2O85A 4K0GA 3P7XA 4BVXA 4PGTA 3N9JA 2DIYA 3UJ1A 1J9BA 2WDUA 4AI6A 5KN0A 4MF5A 4AJ8A 2O7KA 2WRTA 2TRCP 3QFAC 3GKKA 5EPFA 1A2LA 3GL3A 4TR3A 3EVIA 4FQUA 1T3BA 3GTUB 3GA4A 3D0ZA 5DJLA 5A4WA 4GQFA 4HS1A 4K6XA 1K3YA 2E2MA 5HFKA 2FWHA 4CY6A 1U87A 2XPDA 4DSRA 3KTLA 2I4AA 1HNAA 4XIHA 2EIQA 2MMOA 1NHOA 3CTGA 1EGRA 2HE3A 2YCDA 3ERFA 1OE7A 1QQ2A 4POMA 3LSZA 3TJGA 4USSA 4YKFA 1GTUA 1CQHA 2GT6A 1DE1A 2MMNA 4TR1A 4MLYA 3ZVJD 2M72A 2C4JA 5DALB 5ECLB 2RUFA 5A34A 2R3XA 4GLTA 2H30A 1K0AA 2GT5A 2REMA 2H6ZA 1T7PB 3KMNA 4Q5RA 4XRDA 1TRVA 3JCML 1AQXA 3DKSA 1GTBA 3PH9A 1BQ7A 4EIQA 1G0TA 1F37A 2IPAA 4ECJA 2A2PA 2H73A 4F0CA 2HZEB 4ISDA 3A2WA 3IBHA 3E3EA 4CW9A 4OO5A 4BVXB 1ZYQB 1OYJA 2IMKA 2DIZA 2JACA 2I9HA 5CRDA 3DD3A 4XHMA 5E59A 5F8BA 1TRWA 5D9WA 3I43A 4G0IA 4KDUA 3LEFA 1YJ6A 3R3EA 5ELGA 4QMKA 2MMZA 3VLNA 2GSTA 2LTKA 3F8UA 4OO4A 2CV4A 2L6CA 3N5OA 3NZNA 1HNCA 3LYKA 2JADA 1IYHA 1I9DA 4MPGA 1M9BA 2X8CA 1YQ1A 4AKXB 2GGTA 2FCHA 4JR4A 3WT2A 2OADA 1OVNA 4MMMA 3D6IA 5DBQA 2VCVA 1QXHA 2H1AA 2VLUA 1F9MA 4IBPA 2H0IA 2X99A 1Y1UA 3H4KA 4TR1B 3H8QA 4ZB6A 5ECNB 3DEXA 5B8AA 1A23A 1XWKA 1V2AA 3VURA 5BRTA 5A34B 4V2NA 4YAPA 4ZILA 5ABRA 4L8EA 1TK8B 1ST9A 1PMTA 1A2MA 4G0LA 3QFBC 4F0BA 2IMIA 3U6VA 5F06A 1WMJA 2VD1A 3KM6A 1E2YA 4K7IA 3FKFA 4ZL7A 2FHEA 4AJ7A 1ZYNA 1ZYPA 3IHQA 1WIKA 1T4YA 4WR5A 1HNBA 5F05A 1SD9A 3GURA 1XWBA 4WBJA 1EEMA 2VO4A 3GKXA 3FY7A 2HFDA 4K8MA 3G7YA 4EVMA 4G01A 4N0VA 3GSTA 1RK4A 1XBSA 2VIMA 2EFHA 1JLVA 11GSA 1J0FA 4X43A 4TXVA 5J5NA 4OCEA 1XFLA 3WGEA 5GSTA 5KOXA 2P0GA 2GSRA 2JSZA 4MF7A 5J4VA 3CWGA 13GSA 3GSSA 4Z2TA 3D4TA 2L4QA 1ZOFA 2IMFA 4HJ2A 5CP1A 3GMFA 5IO0A 4GSSA 4OD7A 5E4WA 3US3A 1PX7A 4RI7A 4OFMA 3HDCA 12GSA 3HY2A 2VL9A 3VPQA 3ZYWA 1LU4A 2QA1A 3ZLPA 4YQMA 2VLVA 2KLXA 4MH3A 5AGYA 3R2QA 5J4UA 4BPYA 1XWCA 3HZ4A 4K5RA 2TIRA 2AJQB 5F07A 1Z6NA 4V1Ag 5ENUA 5AN1A 4HQZA 3RPNA 1GL8A 4L5OA 3LG6A 5B7CA 4O32A 4JR6A 3Q19A 1B9XC 3IA1A 3MIXA 3GN3A 5DQSA 1GSSA 4MA9A 1VF3A 1ZZYA 3ED3A 4EDYA 2F8FA 2C0DA 2OKAA 4IN0A 1EV9A 4RQXA 3L78A 3ZTLA 1VGLA 2YPMA 3F6DA 1JZDA 3BD2A 2CAIA 1YF1A 4HZ2A 1SL0B 1PN9A 1SD8A 2IL3A 1TK0B 1FOVA 4RUVA 1OC9A 3IC4A 2LJAA 4EXJA 2AV4A 1B4QA 2YJHA 4KUNA 1N2AA 2F51A 3TJKA 1VF4A 1TI1A 3IV4A 1PL2A 1V57A 2LRNA 4OFNA 3M8NA 4FIWA 4XS1A 1VF1A 4P3YB 1GSQA 5J3RA 1TI3A 4FYCA 4V1Ap 1TXUA 3TKQA 3LGCA 4I8BA 1CQGA 3KP8A 6GSTA 1JZRA 3RBTA 4KDYA 1OKDA 1RQMA 1QFNA 1AW9A 4HEA2 6GSXA 4ZBBA 2B7JA 2DJ2A 5JWRB 2QSIA 5EVOA 2GQKA 2P31A 3W8JA 3AY8A 3M9KA 3BJ5A 5G31A 2AAWA 2VLTA 2H1DA 1YDKA 3KD0A 5B8BA 1GSFA 1EGOA 1X5CA 2A2RA 4Q5FA 2ES7A 4AGSA 2FA4A 1TOFA 2HZFA 4MZCA 4Z7XA 5C04A 5J40A 3ZL5A 1MD4A 1KEBA 1LJRA 5KN1A 1O7UA 2C0GA 1XPVA 2PMTA 5D73A 2AYTA 2WULA 3C8EA 2LSTA 3VWUA 1GSDA 4G0KA 2I81A 5ECIB 1S3CA 2GZYA 3QAGA 1NSWA 3CYNA 4X1UA 1GULA 1H4OA 3KTBA 2RM6A 2GS3A 2CVKA 3QOUA 19GSA 1X5EA 5HQPA 1U88A 3HVSA 4OMVA 1E6BA 3KGKA 3GRXA 3TGZA 4PURA 2CZ3A 1ERVA 2CQ9A 5A4VA 3TU3B 1G7OA 4DVCA 3KH7A 5CREA 4ILFA 3NOFA 4LLRA 2HXKA 1MTCA 3APOA 6GSWA 2YOIA 1OC9B 3KP9A 4EC0A 2RLIA 3WGDA 3ERGA 3ISOA 4Q5QA 2DLXA 1WRYA 5HFIA 5C00A 4O5RA 2AHEA 4PQ1A 4TKYA 2HSNA 1PD21 2B5YA 1TTZA 3W8SA 1XOBA 3VK9A 2HSMA 2O5VA 3EPTA 3FRCA 2R0PA 1GUKA 3KJYA 3UMAA 1WJKA 5ECQB 1LBKA 2JU5A 2OE3A 3GYKA 2R5GA 2B6MA 2IN3A 2HSYA 3C1RA 4G19A 4N11A 4LMVA 5HR1A 2LEGA 2AUVA 3C7MA 2PERA 3WD6A 3RHBA 4TXOA 3VFIA 3EURA 1XW5A 5IMDA 3G9BA 2IWTA 5L71A 4KB3A 4F03A 2GZPA 4XTSA 2H76A 4CDOA 2VL2C 1X9WB 2XBQA 4WETA 4ZXGA 1SK0A 2DJJA 1W4VA 3KXOA 2ZUPA 2I1UA 4AJ6A 4TRXA 4KX4A 3GKNA 1MEKA 4BWQA 2FWEA 2QKEA 4PUAA 4K2XA 1Z6MA 1TW9A 1YKCA 3O76A 2MMAA 2WFCA 2B5XA 1T8EB 1GUHA 1WWJA 2BMXA 1K0DA 5HR2A 4POKA 2RM5A 4RQRA 1T00A 4DSQA 3Q74A 4WBRD 4AKHA 5CRWA 5G30A 3W6GA 3TKSE 3TKRA 20GSA 10GSA 2UZ8A 1RW1A 2K8VA 3WT1A 4JZQA 1GSYA 1B48A 3E9JB 4AKIA 2MBSA 2CVDA 4F82A 1EP7A 4JU5A 4PXOA 2GVPA 3FYGA 4I5QA 3EE2A 3LQ7A 2B3SA 1UA5A 3L4NA 1DE2A 2PPTA 2HSNB 1X9SB 4CHSA 1AAZA 4TR4A 2L57A 4IJ3A 3E0UA 4NPBA 3MWHA 3CMIA 2HSMB 1FB6A 4EDZA 4MF6A 3CRTA 4V2LA 2QC7A 3F63A 2VCQA 1GTAA 3KCMA 1EWXA 5ECRB 1Z7PA 5ECKB 3J7Yk 2YWMA 1XVWA 4ICYA 3VI5A 2XHFA 1M99A 3LYPA 4ID0A 4KH7A 4KW6A 2PGTA 4EL1A 4MABA 2FUG2 1K0OA 5GSSA 2A4VA 5CAXA 1OE8A 2FA8A 2YP6A 4JE1A 3KIJA 3LXZA 2WCIA 2JZRA 2HT9A 1NW2A 4TXOB 2IFQA 5G1LA 4KCEA 5ID2A 2EFDA 3SBCA 3D5JA 2KP2A 1PX6A 4KNDA 4IJIA 1G6WA 4EIPA 1O73A 4IP1A 4NXIA 2L59A 5LD0A 3M0FA 3IDVA 1K0CA 5IM9A 1SVOA 3ME7A 4K2DA 2YNXA 4I2TA 2MYGA 5DJMA 2DMMA 3FW2A 3MAKA 4QL7A 4WF4A 2P5QA 1EEJA 1GTIA 3DRNA 4POLA 3TKPA 1O8XA 4XCSA 5D93A 3APSA 9GSSA 4KGIA 1GNEA 3TRXA 3UBLA 1R5AA 1O8WA 1AIUA 3L9SA 1F3BA 1OAZA 5IOXA 2K18A 2DJ3A 1TU7A 4IQAA 3QAWA 5EL8A 3ZVJA 1YF0A 4XRAA 1M0UA 4QQ7A 3LFLA 2H75A 1AXDA 2QA2A 3DIEA 3TB2A 4ZIJA 3ZREA 1K0NA 1GUMA 2C0EA 2GZZA 2H72A 3EYTA 4NHWA 3TKSC 4KAEA 4ECBA 3TJBA 2WS2A 4IQ1A 2HLSA 5DQYA 1OC3A 2G2QA 1BAYA 3ZIJA 1U3AA 4MPFA 1V58A 4BA7A 2OBIA 1UN2A 2JSYA 1GLPA 1M7TA 1K0BA 5D9VA 3GHAA 5GAPD 2FLSA 3F9UA 3D4MA 2D2ZA 1KNGA 4MJCA 1YY7A 7GSSA 1SYRA 1FHEA 5H5RA 4K1FA 3ZFLA 4TN8A 2IFQB 3FHKA 5ID2B 22GSA 1FOHA 4OFTA 1QUWA 4ZBAA 4HU9A 3IK9A 4MCUA 2L5LA 1PN0A 3A5IA 1K3LA 1ML6A 2OA7A 1FVKA 3FEUA 1FO5A 2IMEA 4NAXA 3SWLA 18GSA 5AISA 3UAPA 2YWIA 4GWRA 1YEPA 4ML6A 3Q18A 3ZMLA 1SKRB 3BCKA 1XXUA 3P90A 3VI7A 5EY6A 5COHA 5IMVA 3KMOA 4OCFA 2KP1A 4YAVA 2AB6A 2B5EA 4MZWA 5CRHA 3M9JA 2NDOA 1M2AA 5KOWA 2N5AA 1PL1A 3LW9A 1G7EA 1TRUA 1SJIA 5J4YA 3VWVA 3HXSA 4NV5A 3FR3A 2TRXA 4L5LA 1QGVA 1GNWA 3F4SA 3HVXA 1EOGA 2V41A 4HJMA 2ZCTA 4FO5A 1WPIA 5DVBA 4CY8A 2PUKC 1WE0A 5ECPB 4WXTA 3ZMKA 3F3RA 3A5WA 2WJUA 4N10A 1NHYA 3LORA 5ECSA 1GH2A 3BCIA 4IP6A 4GF0A 4PQHA 2DKIA 5JCWA 3C73A 1M9AA 3FR6A 2YZHA 2LS5A 4MP4A 2FWFA 4F9ZA 4ACSA 2OE1A 4FH8A 3LXTA 4HU7A 1XWGA 2OACA 1JHBA 3QMXA 2L5OA 3F4TA 3HJPA 5IMAA 3MDKA 4GTUA 3UVHA 2KOKA 4GDFA 4PTSA 3IAS2 1N25A 1XVQA 4FYUA 4N0ZA 2VAFA 2CAQA 5J47A 5G1KA 5LNKe 2LNSA 5GAND 2H1GA 2WZ9A 4DEJA 5IPGA 2H1LA 2ON7A 3GV1A 4GXZA 2GSQA 2H01A 3S9FA 5IMZA 2MBTA 3GX0A 1W89A 1F3AA 1THXA 4L0WA 5A5HA 1HD2A 1V40A 3TRQA 5DDLA 2H6YA 3EU3A 2V6OA 3LWAA 1QMVA 1VRSD 1Z7RA 3QDNA 3CSHA 5ECOB 3PINA 2EFCA 2K8SA 4POBA 2F3MA 1SK2A 2VKZG 1ZL9A 3I6AA 3DGQA 2DKHA 1OC8A 1V9WA 4PNFA 2H70A 4IS0A 1FB0A 3DXBA 5G5EA 2N5FA 1YZXA 3FZ4A 1XW9A 1PKWA 2OT3A 2M80A 3Q6OA 3VWXA 2Z9SA 2GQMA 2XBIA 2H0GA 2YN1A 1JLWA 2DMLA 4JRRA 2X4AA 5BMUA 4X0XA 5HFGA 4O5QA 4V2MA 3HMJG 3DWVA 1EV4A 2H19A 4BL7A 5INYA 1VF2A 14GSA 2G0FA 1S3DA 5KN2A 5CO3A 1BG1A 2LJKA 2YJ7A 2NBSA 3BOAA 3KZQA 2ON5A 2GLRA 3IHGA 2P5RA 3IK7A 2HRFA 1KBNA 2YWOA 4ZB8A 2ZNMA 4D73B 2HNLA 1YKAA 2LQOA 6GSSA 4E68A 2V1MA 1FVJA 2VM2A 2IMDA 5B6MA 2VM1A 3BBYA 2DC5A 3PPUA 1R7HA 3ZZXA 3M3MA 2BTOT 3CBUA 5A5HB 5J9BA 4K0NA 1JZOA 3TOTA 1ON4A 2XPEA 4PUFC 4E8HA 3GX8A 4TOPA 3EC3A 4ZB7A 5A1NA 2UV8G 1T4ZA 3HZ8A 3ERWA 1B8XA 3GKMA 3UARA 2DJ0A 1UC7A 4WKWA 4YH2A 3TUEA 3RDWA 1M2BA 1SJZA 3L9UA 2CX3A 3GIXA 4PQIA 4K5SA 2C1YA 1A0RP 1IYIA 1FG4A 4LL4B 5AIVA 4XS6A 1FW1A 5H5QA 2CT6A 3VWWA 5IOWA 3GL5A 5JCGA 3M1GA 2FGXA 4ECIA 3VPTA 4KCAA 3HKRA 1N8JA 2I3YA 1GSEA 3MYDA 1AUCA 5H5SA 4ZL9A 1GRXA 4J2FA 3IRAA 5BMUB 3UEMA 3ZRDA 3HYPA 1XZOA 1O81A 3RAZA 5CNWA 5CRGA 1A8YA 4L0UA 5HR0A 4HZ4A 3ZFBA 4BL7B 1GLQA 1B4PA 4YQUA 3PR8A 3UL3A 3WGXA 3IXRA 1BF5A 2B7KA 3A2VA 5A5KA 3C1SA 4XS4A 4HI7A 3TOUA 2LRTA 4W66A 1EZKA 1GWCA 2X64A 3APQA 1B9YC 1WP0A 3FZ5A 1XOAA 2KHPA 4ZL8A 2VL2A 2R2JA 4YQVA 2GTUA 3LJRA 3HVVA 1F6MC 16GSA 1HYUA 2C3NA 4Z2UA 2R37A 3U5RE 4HDEA 2H6XA 5B6NA 4WEYA 2HRKA 3IAM2 2F9SA 3L0HA 2H66A 5KEJA 2OBKA 3QCPA 3D22A 1XCCA 3A3TA 1TRSA 1V98A 3O3TA 2C0FA 4MNNA 2R0CA 4N3ZA 1SVLA 2LNTA 4ML1A 1EP8A 5FWGA 2IIYA 2R4VA 4TVEA 4IW9A 4PNGA 3TRPA 2KUCA 2PVQA 2HQTA 4IKHA 3UBKA 2VL3A 2YWNA 2A2SA 2VCTA 1JFUA 1TXXA 5A1NB 3UOMA 4AF2A 4X4JA 5ECHB 3PGTA 3P8WA 3IC8A 3MNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJE A;  3F6F A;  1MD3 A;  4GCI A;  3HA9 A;  3RHC A;  2PWJ A;  3HCZ A;  4KSO A;  2C3T A;  2DSA A;  3TDG A;  1HQO A;  4EKZ A;  5J9C A;  5J41 A;  1X9M B;  3F3Q A;  5IIZ A;  1U6T A;  2H0H A;  1XIY A;  3ME8 A;  3QR6 A;  5D9T A;  3P2A A;  1SYX A;  4O7H A;  4HQS A;  1MDI A;  1PRX A;  1ABA A;  1SU9 A;  2NPB A;  4K7N A;  1BYE A;  2V32 A;  3D21 A;  3K8N A;  1SKS B;  1NM3 A;  2DJ1 A;  5FHI A;  4E8E A;  2E7P A;  3QPM A;  1EOH A;  5IQY A;  2FY6 A;  5IMC A;  5D8I A;  1G6Y A;  1K3O A;  4HOJ A;  4MH2 A;  3ZIT A;  4KF9 A;  1TP9 A;  4XS4 B;  3GNJ A;  3I69 A;  2MZC A;  2QGV A;  4G10 A;  2VUP A;  1DBY A;  2O87 A;  1PA3 A;  4WF5 A;  1O6J A;  2LRC A;  17GS A;  3GH9 A;  1O85 A;  5JCU A;  4LL1 B;  2FD3 A;  1BG5 A;  1SK1 A;  2HRK B;  4TW5 A;  4PX1 A;  2VCW A;  4WR4 A;  2EIR A;  4N30 A;  3DVW A;  4EUY A;  1A8L A;  5JWQ B;  3UVT A;  4GRF A;  2BJX A;  2X8H A;  1BJX A;  1H75 A;  1A0F A;  4I97 A;  4LA1 A;  1KTE A;  1YEX A;  3FZ9 A;  3EU4 A;  3DML A;  3GFK A;  5GZZ B;  5KN3 A;  3F4R A;  2CZ2 A;  1SEN A;  5IO2 A;  1ACV A;  4RI6 A;  2PU9 C;  3KEB A;  2FNO A;  2EIO A;  4EE0 A;  1PQN A;  2F8A A;  1TU8 A;  5G5F A;  4KA0 A;  1URM A;  2FWG A;  1TK5 B;  1JZW A;  5ELA A;  2V2G A;  3NIV A;  3TCO A;  1PKZ A;  3TKS A;  4MJA A;  1PGT A;  1DUG A;  2LQQ A;  4EF0 A;  1AC1 A;  2OJL A;  4BWS A;  1DSB A;  5ECM B;  1Y6E A;  4KE3 A;  1Q98 A;  4DSS A;  5DAK A;  2NTO A;  1Z5Y E;  1ZGN A;  4J57 E;  1SL1 B;  2GSS A;  2JL4 A;  3DYR A;  1MDK A;  3IPZ A;  3UIW A;  8GSS A;  1GSU A;  2LJR A;  6GSV A;  1UVZ A;  2PN8 A;  3CSI A;  1FAA A;  3CXG A;  4MZB A;  3H79 A;  2DJK A;  5IMF A;  4TR0 A;  3FK8 A;  1BX9 A;  3V1W A;  4BVY A;  2YAN A;  2H8L A;  2XC2 A;  4LMW A;  3IE3 A;  3O6T A;  5IPH A;  3IR4 A;  1Q4J A;  2O8V B;  2CA8 A;  3HJM A;  1QK8 A;  3FR9 A;  2J9H A;  4J56 E;  1GP1 A;  2B1L A;  4IEL A;  3EMP A;  2VCX A;  1TJD A;  2LKU A;  2HYX A;  3KH9 A;  5F0G A;  4JBB A;  2HRA A;  4MDC A;  2PVO C;  4JED A;  3DVX A;  3EIN A;  2ALB A;  3HD5 A;  2C80 A;  4ZB9 A;  1BED A;  1R4W A;  4K7O A;  4F2I A;  1ILO A;  4H86 A;  3OR5 A;  4NHZ A;  1XWA A;  1SKW B;  4IGJ A;  4KDX A;  1ERT A;  2M46 A;  2OE0 A;  5CYY A;  4D73 A;  2LV3 A;  2H71 A;  2C8U A;  4O92 A;  3G7J A;  4GQC A;  1T1V A;  2GQL A;  3EMX A;  3CTF A;  4NMU A;  4IVF A;  3TJJ A;  2HSH A;  4Q5N A;  1X0R A;  1TKD B;  1ZYE A;  3QAV A;  2WGR A;  1C72 A;  3RPP A;  4IHU A;  2CVB A;  2H1B A;  5G2Z A;  2HRN A;  2K9F A;  4MK3 A;  4G9H A;  4FYB A;  2E2G A;  3QD9 A;  1I5G A;  1USB A;  5D9X A;  2K6V A;  4DSS B;  5LCZ A;  5DAK B;  4KSM A;  4G2E A;  3CRU A;  2B1K A;  4I6X A;  1ZMA A;  1OKT A;  3IOS A;  2WB9 A;  4EO3 A;  3ZIV A;  5AIX A;  1J08 A;  3GTU A;  1AQW A;  5JWO B;  2GDR A;  1Z3E A;  1WOU A;  6GSY A;  4OWY A;  3TJF A;  3H1N A;  5DCH A;  2JZT A;  2YV9 A;  3L9V A;  4BVY B;  4ECC A;  2L4C A;  1U3I A;  1SJ6 A;  1ZCP A;  4GST A;  4NV2 A;  5A4U A;  2NVL A;  4ZBD A;  3FZA A;  3HJO A;  2C3Q A;  1A2J A;  1SL2 B;  3G7I A;  2VOC A;  3EWL A;  1S3A A;  3I9V 2;  2RUE A;  6GSU A;  1ERU A;  1MDJ A;  2VCZ A;  2YZU A;  1Y25 A;  3HHV A;  5DCG A;  1AQV A;  4K9Z A;  1M2D A;  2J23 A;  3WYW A;  5DAL A;  3C71 A;  2H74 A;  1TDI A;  1A24 A;  5FT3 A;  3A2X A;  1PSQ A;  2L6D A;  4NWY A;  2VD0 A;  2IJY A;  2X8G A;  3GUS A;  4QL9 A;  2JZS A;  2HI7 A;  4I2U A;  1XW6 A;  3GH6 A;  1THO A;  1F2E A;  1X5D A;  2E0Q A;  2YV7 A;  1R26 A;  2RII A;  4HUA A;  2LUS A;  5D96 A;  1Z9H A;  1R5P A;  2O89 A;  2EC4 A;  1K0M A;  2DBC A;  2N5B A;  4GSN A;  2CX4 A;  3F0I A;  4ULX A;  5HR3 A;  2R6K A;  2PBJ A;  3J7Y b;  1ERW A;  3CSJ A;  4MJB A;  2HZE A;  3H93 A;  2V6K A;  3MSZ A;  2O85 A;  4K0G A;  3P7X A;  4BVX A;  4PGT A;  3N9J A;  2DIY A;  3UJ1 A;  1J9B A;  2WDU A;  5KN0 A;  4MF5 A;  4AJ8 A;  2O7K A;  2WRT A;  2TRC P;  3QFA C;  3GKK A;  5EPF A;  1A2L A;  3GL3 A;  4TR3 A;  3EVI A;  4FQU A;  1T3B A;  3GTU B;  3GA4 A;  3D0Z A;  5DJL A;  5A4W A;  4GQF A;  4HS1 A;  4K6X A;  1K3Y A;  2E2M A;  5HFK A;  2FWH A;  1U87 A;  2XPD A;  4DSR A;  3KTL A;  2I4A A;  1HNA A;  4XIH A;  2EIQ A;  2MMO A;  1NHO A;  3CTG A;  1EGR A;  2HE3 A;  2YCD A;  3ERF A;  1OE7 A;  1QQ2 A;  4POM A;  3LSZ A;  3TJG A;  4USS A;  1GTU A;  1CQH A;  2GT6 A;  1DE1 A;  2MMN A;  4TR1 A;  4MLY A;  3ZVJ D;  2M72 A;  2C4J A;  5DAL B;  5ECL B;  2RUF A;  2R3X A;  4GLT A;  2H30 A;  1K0A A;  2GT5 A;  2REM A;  2H6Z A;  1T7P B;  3KMN A;  4Q5R A;  4XRD A;  1TRV A;  3JCM L;  1AQX A;  3DKS A;  1GTB A;  3PH9 A;  1BQ7 A;  1G0T A;  1F37 A;  2IPA A;  4ECJ A;  2H73 A;  4F0C A;  2HZE B;  4ISD A;  3A2W A;  3IBH A;  3E3E A;  4CW9 A;  4OO5 A;  4BVX B;  1ZYQ B;  1OYJ A;  2IMK A;  2DIZ A;  2JAC A;  2I9H A;  5CRD A;  3DD3 A;  4XHM A;  5E59 A;  5F8B A;  1TRW A;  5D9W A;  3I43 A;  4G0I A;  4KDU A;  3LEF A;  1YJ6 A;  3R3E A;  5ELG A;  2MMZ A;  3VLN A;  2GST A;  2LTK A;  3F8U A;  4OO4 A;  2CV4 A;  2L6C A;  3N5O A;  3NZN A;  1HNC A;  3LYK A;  2JAD A;  1IYH A;  1I9D A;  4MPG A;  1M9B A;  2X8C A;  1YQ1 A;  2GGT A;  2FCH A;  4JR4 A;  3WT2 A;  2OAD A;  1OVN A;  4MMM A;  3D6I A;  5DBQ A;  2VCV A;  1QXH A;  2H1A A;  2VLU A;  1F9M A;  4IBP A;  2H0I A;  2X99 A;  3H4K A;  4TR1 B;  3H8Q A;  4ZB6 A;  5ECN B;  3DEX A;  5B8A A;  1A23 A;  1XWK A;  1V2A A;  3VUR A;  4V2N A;  4YAP A;  4ZIL A;  5ABR A;  4L8E A;  1TK8 B;  1ST9 A;  1PMT A;  1A2M A;  4G0L A;  3QFB C;  4F0B A;  2IMI A;  3U6V A;  5F06 A;  1WMJ A;  2VD1 A;  3KM6 A;  1E2Y A;  4K7I A;  3FKF A;  4ZL7 A;  2FHE A;  4AJ7 A;  3IHQ A;  1WIK A;  1T4Y A;  4WR5 A;  1HNB A;  5F05 A;  1SD9 A;  3GUR A;  1XWB A;  4WBJ A;  1EEM A;  2VO4 A;  3GKX A;  3FY7 A;  2HFD A;  4K8M A;  3G7Y A;  4EVM A;  4N0V A;  3GST A;  1RK4 A;  1XBS A;  2VIM A;  1JLV A;  11GS A;  1J0F A;  4X43 A;  4TXV A;  5J5N A;  4OCE A;  1XFL A;  3WGE A;  5GST A;  2P0G A;  2GSR A;  2JSZ A;  4MF7 A;  3GSS A;  13GS A;  3D4T A;  2L4Q A;  1ZOF A;  2IMF A;  4HJ2 A;  5CP1 A;  3GMF A;  5IO0 A;  4GSS A;  4OD7 A;  5E4W A;  3US3 A;  1PX7 A;  4RI7 A;  4OFM A;  3HDC A;  12GS A;  3HY2 A;  2VL9 A;  3VPQ A;  3ZYW A;  1LU4 A;  3ZLP A;  4YQM A;  2VLV A;  2KLX A;  4MH3 A;  5AGY A;  3R2Q A;  5J4U A;  4BPY A;  1XWC A;  3HZ4 A;  2TIR A;  2AJQ B;  5F07 A;  1Z6N A;  4V1A g;  5ENU A;  5AN1 A;  4HQZ A;  3RPN A;  1GL8 A;  4L5O A;  3LG6 A;  5B7C A;  4O32 A;  4JR6 A;  3Q19 A;  1B9X C;  3IA1 A;  3GN3 A;  5DQS A;  1GSS A;  4MA9 A;  1VF3 A;  1ZZY A;  3ED3 A;  4EDY A;  2F8F A;  2C0D A;  2OKA A;  4IN0 A;  1EV9 A;  4RQX A;  3L78 A;  3ZTL A;  1VGL A;  2YPM A;  3F6D A;  1JZD A;  3BD2 A;  2CAI A;  1YF1 A;  4HZ2 A;  1SL0 B;  1PN9 A;  1SD8 A;  2IL3 A;  1TK0 B;  1FOV A;  4RUV A;  1OC9 A;  3IC4 A;  2LJA A;  4EXJ A;  2AV4 A;  1B4Q A;  2YJH A;  4KUN A;  1N2A A;  2F51 A;  3TJK A;  1VF4 A;  1TI1 A;  3IV4 A;  1PL2 A;  1V57 A;  2LRN A;  4OFN A;  3M8N A;  4FIW A;  4XS1 A;  1VF1 A;  4P3Y B;  1GSQ A;  5J3R A;  1TI3 A;  4FYC A;  4V1A p;  3TKQ A;  3LGC A;  4I8B A;  1CQG A;  3KP8 A;  6GST A;  1JZR A;  3RBT A;  4KDY A;  1OKD A;  1RQM A;  1QFN A;  1AW9 A;  4HEA 2;  6GSX A;  4ZBB A;  2B7J A;  2DJ2 A;  5JWR B;  2QSI A;  5EVO A;  2GQK A;  2P31 A;  3W8J A;  3AY8 A;  3M9K A;  3BJ5 A;  5G31 A;  2AAW A;  2VLT A;  2H1D A;  1YDK A;  3KD0 A;  5B8B A;  1GSF A;  1EGO A;  1X5C A;  2A2R A;  4Q5F A;  2ES7 A;  4AGS A;  2FA4 A;  1TOF A;  2HZF A;  4MZC A;  4Z7X A;  5C04 A;  3ZL5 A;  1MD4 A;  1KEB A;  1LJR A;  5KN1 A;  1O7U A;  2C0G A;  1XPV A;  2PMT A;  5D73 A;  2AYT A;  2WUL A;  3C8E A;  2LST A;  3VWU A;  1GSD A;  4G0K A;  2I81 A;  5ECI B;  1S3C A;  2GZY A;  3QAG A;  1NSW A;  3CYN A;  4X1U A;  1GUL A;  1H4O A;  3KTB A;  2RM6 A;  2GS3 A;  2CVK A;  3QOU A;  19GS A;  1X5E A;  5HQP A;  1U88 A;  3HVS A;  4OMV A;  1E6B A;  3KGK A;  3GRX A;  3TGZ A;  4PUR A;  2CZ3 A;  1ERV A;  2CQ9 A;  5A4V A;  1G7O A;  4DVC A;  3KH7 A;  5CRE A;  4ILF A;  3NOF A;  4LLR A;  2HXK A;  1MTC A;  3APO A;  6GSW A;  2YOI A;  1OC9 B;  3KP9 A;  4EC0 A;  2RLI A;  3WGD A;  3ERG A;  3ISO A;  4Q5Q A;  2DLX A;  1WRY A;  5HFI A;  5C00 A;  4O5R A;  2AHE A;  4PQ1 A;  4TKY A;  1PD2 1;  2B5Y A;  1TTZ A;  3W8S A;  1XOB A;  3VK9 A;  2HSM A;  3FRC A;  1GUK A;  3KJY A;  3UMA A;  1WJK A;  5ECQ B;  1LBK A;  2JU5 A;  2OE3 A;  3GYK A;  2R5G A;  2B6M A;  2IN3 A;  2HSY A;  3C1R A;  4G19 A;  4N11 A;  4LMV A;  5HR1 A;  2LEG A;  2AUV A;  3C7M A;  2PER A;  3WD6 A;  3RHB A;  4TXO A;  3VFI A;  3EUR A;  1XW5 A;  5IMD A;  3G9B A;  2IWT A;  5L71 A;  4KB3 A;  4F03 A;  2GZP A;  4XTS A;  2H76 A;  4CDO A;  2VL2 C;  1X9W B;  2XBQ A;  4WET A;  4ZXG A;  1SK0 A;  2DJJ A;  1W4V A;  3KXO A;  2ZUP A;  2I1U A;  4AJ6 A;  4TRX A;  4KX4 A;  3GKN A;  1MEK A;  4BWQ A;  2FWE A;  2QKE A;  4PUA A;  1Z6M A;  1TW9 A;  1YKC A;  3O76 A;  2MMA A;  2WFC A;  2B5X A;  1T8E B;  1GUH A;  1WWJ A;  2BMX A;  1K0D A;  5HR2 A;  4POK A;  2RM5 A;  4RQR A;  1T00 A;  4DSQ A;  3Q74 A;  4WBR D;  5CRW A;  5G30 A;  3W6G A;  3TKS E;  3TKR A;  20GS A;  10GS A;  2UZ8 A;  1RW1 A;  2K8V A;  3WT1 A;  4JZQ A;  1GSY A;  1B48 A;  3E9J B;  2MBS A;  2CVD A;  4F82 A;  1EP7 A;  4JU5 A;  4PXO A;  2GVP A;  3FYG A;  4I5Q A;  3EE2 A;  3LQ7 A;  2B3S A;  1UA5 A;  3L4N A;  1DE2 A;  2PPT A;  2HSN B;  1X9S B;  4CHS A;  1AAZ A;  4TR4 A;  2L57 A;  4IJ3 A;  3E0U A;  4NPB A;  3MWH A;  3CMI A;  2HSM B;  1FB6 A;  4EDZ A;  4MF6 A;  3CRT A;  4V2L A;  2QC7 A;  3F63 A;  2VCQ A;  1GTA A;  3KCM A;  1EWX A;  5ECR B;  1Z7P A;  5ECK B;  3J7Y k;  2YWM A;  1XVW A;  3VI5 A;  2XHF A;  1M99 A;  3LYP A;  4ID0 A;  4KH7 A;  4KW6 A;  2PGT A;  4EL1 A;  4MAB A;  2FUG 2;  1K0O A;  5GSS A;  2A4V A;  5CAX A;  1OE8 A;  2FA8 A;  2YP6 A;  4JE1 A;  3KIJ A;  3LXZ A;  2WCI A;  2JZR A;  2HT9 A;  1NW2 A;  4TXO B;  2IFQ A;  5G1L A;  4KCE A;  5ID2 A;  3SBC A;  3D5J A;  2KP2 A;  1PX6 A;  4KND A;  4IJI A;  1G6W A;  1O73 A;  4IP1 A;  4NXI A;  2L59 A;  5LD0 A;  3M0F A;  3IDV A;  1K0C A;  5IM9 A;  3ME7 A;  4K2D A;  2YNX A;  4I2T A;  2MYG A;  5DJM A;  2DMM A;  3FW2 A;  3MAK A;  4QL7 A;  4WF4 A;  2P5Q A;  1EEJ A;  1GTI A;  3DRN A;  4POL A;  3TKP A;  1O8X A;  4XCS A;  5D93 A;  3APS A;  9GSS A;  4KGI A;  1GNE A;  3TRX A;  3UBL A;  1R5A A;  1O8W A;  1AIU A;  3L9S A;  1F3B A;  1OAZ A;  5IOX A;  2K18 A;  2DJ3 A;  1TU7 A;  4IQA A;  3QAW A;  5EL8 A;  3ZVJ A;  1YF0 A;  4XRA A;  1M0U A;  4QQ7 A;  3LFL A;  2H75 A;  1AXD A;  3DIE A;  3TB2 A;  4ZIJ A;  3ZRE A;  1K0N A;  1GUM A;  2C0E A;  2GZZ A;  2H72 A;  3EYT A;  4NHW A;  3TKS C;  4KAE A;  4ECB A;  3TJB A;  2WS2 A;  4IQ1 A;  2HLS A;  5DQY A;  1OC3 A;  2G2Q A;  1BAY A;  3ZIJ A;  1U3A A;  4MPF A;  1V58 A;  4BA7 A;  2OBI A;  1UN2 A;  2JSY A;  1GLP A;  1M7T A;  1K0B A;  5D9V A;  3GHA A;  5GAP D;  2FLS A;  3F9U A;  3D4M A;  2D2Z A;  1KNG A;  4MJC A;  1YY7 A;  7GSS A;  1SYR A;  1FHE A;  5H5R A;  4K1F A;  3ZFL A;  4TN8 A;  2IFQ B;  3FHK A;  5ID2 B;  22GS A;  4OFT A;  1QUW A;  4ZBA A;  4HU9 A;  3IK9 A;  4MCU A;  2L5L A;  1K3L A;  1ML6 A;  2OA7 A;  1FVK A;  3FEU A;  1FO5 A;  2IME A;  4NAX A;  3SWL A;  18GS A;  5AIS A;  3UAP A;  2YWI A;  4GWR A;  1YEP A;  4ML6 A;  3Q18 A;  3ZML A;  1SKR B;  3BCK A;  1XXU A;  3P90 A;  3VI7 A;  5EY6 A;  5COH A;  5IMV A;  3KMO A;  4OCF A;  2KP1 A;  4YAV A;  2AB6 A;  2B5E A;  4MZW A;  5CRH A;  3M9J A;  2NDO A;  1M2A A;  2N5A A;  1PL1 A;  1G7E A;  1TRU A;  1SJI A;  3VWV A;  3HXS A;  4NV5 A;  3FR3 A;  2TRX A;  4L5L A;  1QGV A;  1GNW A;  3F4S A;  3HVX A;  1EOG A;  2V41 A;  4HJM A;  2ZCT A;  4FO5 A;  1WPI A;  5DVB A;  2PUK C;  1WE0 A;  5ECP B;  4WXT A;  3ZMK A;  3F3R A;  3A5W A;  2WJU A;  4N10 A;  1NHY A;  3LOR A;  5ECS A;  1GH2 A;  3BCI A;  4IP6 A;  4GF0 A;  4PQH A;  5JCW A;  3C73 A;  1M9A A;  3FR6 A;  2YZH A;  2LS5 A;  4MP4 A;  2FWF A;  4F9Z A;  4ACS A;  2OE1 A;  4FH8 A;  3LXT A;  4HU7 A;  1XWG A;  2OAC A;  1JHB A;  3QMX A;  2L5O A;  3F4T A;  3HJP A;  5IMA A;  3MDK A;  4GTU A;  3UVH A;  2KOK A;  4PTS A;  3IAS 2;  1XVQ A;  4FYU A;  4N0Z A;  2VAF A;  2CAQ A;  5G1K A;  5LNK e;  2LNS A;  5GAN D;  2H1G A;  2WZ9 A;  4DEJ A;  5IPG A;  2ON7 A;  3GV1 A;  4GXZ A;  2GSQ A;  2H01 A;  3S9F A;  5IMZ A;  2MBT A;  3GX0 A;  1W89 A;  1F3A A;  1THX A;  4L0W A;  1HD2 A;  1V40 A;  3TRQ A;  5DDL A;  2H6Y A;  3EU3 A;  2V6O A;  3LWA A;  1QMV A;  1VRS D;  1Z7R A;  3QDN A;  3CSH A;  5ECO B;  3PIN A;  2K8S A;  4POB A;  2F3M A;  1SK2 A;  1ZL9 A;  3I6A A;  3DGQ A;  1OC8 A;  1V9W A;  4PNF A;  2H70 A;  4IS0 A;  1FB0 A;  3DXB A;  5G5E A;  2N5F A;  1YZX A;  3FZ4 A;  1XW9 A;  1PKW A;  2M80 A;  3Q6O A;  3VWX A;  2Z9S A;  2GQM A;  2XBI A;  2H0G A;  2YN1 A;  1JLW A;  2DML A;  4JRR A;  5BMU A;  4X0X A;  5HFG A;  4V2M A;  3DWV A;  1EV4 A;  2H19 A;  4BL7 A;  5INY A;  1VF2 A;  14GS A;  2G0F A;  1S3D A;  5KN2 A;  5CO3 A;  2LJK A;  2YJ7 A;  2NBS A;  3BOA A;  3KZQ A;  2ON5 A;  2GLR A;  2P5R A;  3IK7 A;  2HRF A;  1KBN A;  2YWO A;  4ZB8 A;  2ZNM A;  4D73 B;  2HNL A;  1YKA A;  2LQO A;  6GSS A;  2V1M A;  1FVJ A;  2VM2 A;  2IMD A;  5B6M A;  2VM1 A;  3BBY A;  2DC5 A;  3PPU A;  1R7H A;  3ZZX A;  3M3M A;  2BTO T;  3CBU A;  5J9B A;  4K0N A;  1JZO A;  3TOT A;  1ON4 A;  2XPE A;  4PUF C;  4E8H A;  3GX8 A;  4TOP A;  3EC3 A;  1T4Z A;  3HZ8 A;  3ERW A;  1B8X A;  3GKM A;  3UAR A;  2DJ0 A;  1UC7 A;  4WKW A;  4YH2 A;  3TUE A;  3RDW A;  1M2B A;  1SJZ A;  3L9U A;  2CX3 A;  3GIX A;  4PQI A;  2C1Y A;  1A0R P;  1IYI A;  1FG4 A;  4LL4 B;  5AIV A;  4XS6 A;  1FW1 A;  5H5Q A;  2CT6 A;  3VWW A;  5IOW A;  3GL5 A;  5JCG A;  3M1G A;  2FGX A;  4ECI A;  3VPT A;  4KCA A;  3HKR A;  1N8J A;  2I3Y A;  1GSE A;  1AUC A;  5H5S A;  4ZL9 A;  1GRX A;  4J2F A;  3IRA A;  3UEM A;  3ZRD A;  3HYP A;  1XZO A;  1O81 A;  3RAZ A;  5CNW A;  5CRG A;  1A8Y A;  4L0U A;  5HR0 A;  4HZ4 A;  3ZFB A;  4BL7 B;  1GLQ A;  1B4P A;  4YQU A;  3PR8 A;  3UL3 A;  3WGX A;  3IXR A;  2B7K A;  3A2V A;  5A5K A;  3C1S A;  4XS4 A;  4HI7 A;  3TOU A;  2LRT A;  1EZK A;  1GWC A;  2X64 A;  3APQ A;  1B9Y C;  1WP0 A;  3FZ5 A;  1XOA A;  2KHP A;  4ZL8 A;  2VL2 A;  2R2J A;  4YQV A;  2GTU A;  3LJR A;  3HVV A;  1F6M C;  16GS A;  1HYU A;  2C3N A;  2R37 A;  3U5R E;  4HDE A;  2H6X A;  5B6N A;  4WEY A;  2HRK A;  3IAM 2;  2F9S A;  3L0H A;  2H66 A;  5KEJ A;  2OBK A;  3QCP A;  3D22 A;  1XCC A;  3A3T A;  1TRS A;  1V98 A;  3O3T A;  2C0F A;  2LNT A;  4ML1 A;  1EP8 A;  5FWG A;  2IIY A;  2R4V A;  4TVE A;  4IW9 A;  4PNG A;  3TRP A;  2KUC A;  2PVQ A;  2HQT A;  4IKH A;  3UBK A;  2VL3 A;  2YWN A;  2A2S A;  2VCT A;  1JFU A;  1TXX A;  3UOM A;  4AF2 A;  5ECH B;  3PGT A;  3P8W A;  3IC8 A;  3MNG A; 
#chains in the Genus database with same CATH topology
 4MJE A;  3F6F A;  1MD3 A;  4GCI A;  3HA9 A;  3RHC A;  2PWJ A;  3HCZ A;  4KSO A;  2C3T A;  2DSA A;  3TDG A;  1HQO A;  4EKZ A;  5J9C A;  5J41 A;  1X9M B;  3F3Q A;  5IIZ A;  1U6T A;  2H0H A;  1XIY A;  3ME8 A;  3QR6 A;  5D9T A;  3P2A A;  1SYX A;  4O7H A;  4HQS A;  1MDI A;  1PRX A;  1ABA A;  1SU9 A;  2NPB A;  4K7N A;  1BYE A;  2V32 A;  3D21 A;  3K8N A;  1SKS B;  1NM3 A;  2DJ1 A;  5FHI A;  4E8E A;  2E7P A;  3QPM A;  1EOH A;  5IQY A;  2FY6 A;  5IMC A;  5D8I A;  1G6Y A;  1K3O A;  4HOJ A;  4MH2 A;  3ZIT A;  4KF9 A;  1TP9 A;  4XS4 B;  3GNJ A;  3I69 A;  2MZC A;  1SVM A;  2QGV A;  4G10 A;  2VUP A;  1DBY A;  2O87 A;  1PA3 A;  4WF5 A;  1O6J A;  2LRC A;  17GS A;  3GH9 A;  1O85 A;  5JCU A;  4LL1 B;  2FD3 A;  1BG5 A;  1SK1 A;  2HRK B;  4TW5 A;  4PX1 A;  2VCW A;  4WR4 A;  2EIR A;  4O5U A;  4N30 A;  2R0G A;  3DVW A;  4EUY A;  1A8L A;  5JWQ B;  3UVT A;  4GRF A;  2BJX A;  2X8H A;  1BJX A;  1H75 A;  1A0F A;  4I97 A;  4LA1 A;  1KTE A;  1YEX A;  3FZ9 A;  3EU4 A;  3DML A;  3GFK A;  5GZZ B;  5KN3 A;  3F4R A;  4PHZ C;  2CZ2 A;  1SEN A;  5IO2 A;  1ACV A;  4RI6 A;  2PU9 C;  3KEB A;  2FNO A;  2EIO A;  4EE0 A;  1PQN A;  2F8A A;  1TU8 A;  1S3R A;  5G5F A;  4KA0 A;  1URM A;  2FWG A;  1TK5 B;  1JZW A;  5ELA A;  2V2G A;  3NIV A;  3TCO A;  1PKZ A;  3TKS A;  4AKG A;  4MJA A;  1PGT A;  1DUG A;  2LQQ A;  4EF0 A;  1AC1 A;  1YVL A;  2OJL A;  4BWS A;  1DSB A;  5ECM B;  1Y6E A;  4KE3 A;  1Q98 A;  4DSS A;  5DAK A;  2NTO A;  1Z5Y E;  1ZGN A;  4J57 E;  1SL1 B;  2GSS A;  2JL4 A;  3DYR A;  1MDK A;  3IPZ A;  3UIW A;  8GSS A;  1GSU A;  2LJR A;  6GSV A;  1UVZ A;  2PN8 A;  3CSI A;  1FAA A;  3CXG A;  4MZB A;  3H79 A;  2DJK A;  5IMF A;  4TR0 A;  3FK8 A;  1BX9 A;  3V1W A;  4BVY A;  2YAN A;  2H8L A;  2XC2 A;  4LMW A;  3IE3 A;  3O6T A;  5IPH A;  3IR4 A;  1Q4J A;  2O8V B;  2CA8 A;  3HJM A;  1QK8 A;  3FR9 A;  2J9H A;  4J56 E;  2A4H A;  1GP1 A;  2B1L A;  4IEL A;  3EMP A;  2VCX A;  1TJD A;  2LKU A;  2HYX A;  3KH9 A;  5F0G A;  4JBB A;  2HRA A;  4MDC A;  4A5P A;  2PVO C;  4JED A;  3DVX A;  3EIN A;  2ALB A;  3HD5 A;  2C80 A;  4ZB9 A;  1BED A;  1R4W A;  4K7O A;  4F2I A;  1ILO A;  4H86 A;  3OR5 A;  4NHZ A;  1XWA A;  1SKW B;  4IGJ A;  4KDX A;  1ERT A;  2M46 A;  2OE0 A;  5CYY A;  4D73 A;  2LV3 A;  2H71 A;  2C8U A;  4O92 A;  3G7J A;  4GQC A;  1T1V A;  2GQL A;  3EMX A;  3CTF A;  4NMU A;  3FMW A;  4IVF A;  3TJJ A;  3RFR C;  2HSH A;  4Q5N A;  1X0R A;  1TKD B;  1ZYE A;  3QAV A;  2WGR A;  1C72 A;  3RPP A;  4IHU A;  2CVB A;  2H1B A;  5G2Z A;  2HRN A;  2K9F A;  4MK3 A;  4G9H A;  4FYB A;  2E2G A;  3QD9 A;  1I5G A;  1USB A;  5D9X A;  2K6V A;  4DSS B;  5LCZ A;  5DAK B;  4KSM A;  4G2E A;  3CRU A;  2B1K A;  4I6X A;  1ZMA A;  1OKT A;  3IOS A;  2WB9 A;  4EO3 A;  3ZIV A;  5AIX A;  1J08 A;  3GTU A;  1AQW A;  5JWO B;  2GDR A;  1Z3E A;  1WOU A;  6GSY A;  4OWY A;  3TJF A;  3H1N A;  5DCH A;  2JZT A;  2YV9 A;  3L9V A;  4BVY B;  4ECC A;  2L4C A;  1U3I A;  1SJ6 A;  1ZCP A;  4GST A;  4NV2 A;  5A4U A;  2NVL A;  4ZBD A;  3FZA A;  3HJO A;  2C3Q A;  1A2J A;  1SL2 B;  2X49 A;  3G7I A;  2VOC A;  3EWL A;  1S3A A;  3I9V 2;  2RUE A;  6GSU A;  1ERU A;  1MDJ A;  2VCZ A;  2YZU A;  1Y25 A;  3HHV A;  5DCG A;  1AQV A;  4K9Z A;  1M2D A;  2J23 A;  3WYW A;  5DAL A;  3C71 A;  2H74 A;  1TDI A;  1A24 A;  5FT3 A;  2WVY A;  3A2X A;  1PSQ A;  2L6D A;  4NWY A;  2VD0 A;  2IJY A;  2X8G A;  3GUS A;  4QL9 A;  2JZS A;  2HI7 A;  4I2U A;  4Z2R A;  1XW6 A;  3GH6 A;  1THO A;  1F2E A;  2EFE A;  1X5D A;  2E0Q A;  2YV7 A;  1R26 A;  2RII A;  4HUA A;  2LUS A;  5D96 A;  1Z9H A;  1R5P A;  2O89 A;  4YKG A;  2EC4 A;  1K0M A;  2DBC A;  2N5B A;  4GSN A;  2CX4 A;  3F0I A;  4ULX A;  5HR3 A;  2R6K A;  2PBJ A;  3J7Y b;  1ERW A;  3CSJ A;  4MJB A;  2HZE A;  3H93 A;  2V6K A;  3MSZ A;  2O85 A;  4K0G A;  3P7X A;  4BVX A;  1S4B P;  4PGT A;  3N9J A;  2DIY A;  3UJ1 A;  1J9B A;  2WDU A;  4AI6 A;  5KN0 A;  4MF5 A;  4AJ8 A;  2O7K A;  2WRT A;  2TRC P;  3QFA C;  3GKK A;  5EPF A;  1A2L A;  3GL3 A;  2WVZ A;  4TR3 A;  3EVI A;  4FQU A;  1T3B A;  3GTU B;  3GA4 A;  3D0Z A;  5DJL A;  5A4W A;  4GQF A;  4HS1 A;  4K6X A;  1K3Y A;  2E2M A;  5HFK A;  2FWH A;  4CY6 A;  1U87 A;  2XPD A;  4DSR A;  3KTL A;  2I4A A;  2WZS A;  1HNA A;  4XIH A;  2EIQ A;  2MMO A;  1NHO A;  3CTG A;  1EGR A;  2HE3 A;  2YCD A;  3ERF A;  1OE7 A;  1QQ2 A;  4POM A;  3LSZ A;  3TJG A;  4USS A;  4YKF A;  1GTU A;  1CQH A;  2GT6 A;  1DE1 A;  2MMN A;  4TR1 A;  4MLY A;  3ZVJ D;  2M72 A;  2C4J A;  5DAL B;  5ECL B;  2RUF A;  5A34 A;  3RGB C;  2R3X A;  4GLT A;  2H30 A;  1K0A A;  2GT5 A;  2REM A;  2H6Z A;  1T7P B;  3KMN A;  4Q5R A;  4XRD A;  4HSC X;  1TRV A;  3JCM L;  1AQX A;  3DKS A;  1GTB A;  3PH9 A;  1BQ7 A;  4EIQ A;  1G0T A;  1F37 A;  2IPA A;  4ECJ A;  2A2P A;  2H73 A;  4F0C A;  2HZE B;  4ISD A;  3A2W A;  3IBH A;  3E3E A;  2WW2 A;  1M3J A;  4CW9 A;  4OO5 A;  4BVX B;  1ZYQ B;  1OYJ A;  2IMK A;  2DIZ A;  2JAC A;  2I9H A;  5CRD A;  3DD3 A;  4XHM A;  5E59 A;  5F8B A;  1TRW A;  5D9W A;  3I43 A;  4G0I A;  4KDU A;  3LEF A;  1YJ6 A;  3R3E A;  5ELG A;  4QMK A;  2MMZ A;  3VLN A;  2GST A;  2LTK A;  3F8U A;  4OO4 A;  2CV4 A;  2L6C A;  3N5O A;  3NZN A;  1HNC A;  3LYK A;  2JAD A;  1IYH A;  1I9D A;  4MPG A;  1M9B A;  2X8C A;  1YQ1 A;  4AKX B;  2GGT A;  2FCH A;  4JR4 A;  3WT2 A;  2OAD A;  1OVN A;  4MMM A;  3D6I A;  5DBQ A;  2VCV A;  1QXH A;  2H1A A;  2VLU A;  1F9M A;  4IBP A;  3CQF A;  2H0I A;  2X99 A;  1Y1U A;  3H4K A;  4TR1 B;  3H8Q A;  4ZB6 A;  5ECN B;  3DEX A;  5B8A A;  1A23 A;  1XWK A;  1V2A A;  3VUR A;  5BRT A;  5A34 B;  4V2N A;  4YAP A;  4ZIL A;  5ABR A;  4L8E A;  1TK8 B;  1ST9 A;  1PMT A;  1A2M A;  4G0L A;  3QFB C;  4F0B A;  2IMI A;  3U6V A;  5F06 A;  1WMJ A;  2VD1 A;  3KM6 A;  1E2Y A;  4K7I A;  3FKF A;  4ZL7 A;  2FHE A;  4AJ7 A;  1ZYN A;  1ZYP A;  3IHQ A;  1WIK A;  1T4Y A;  4WR5 A;  1HNB A;  5F05 A;  1SD9 A;  3GUR A;  1XWB A;  4WBJ A;  1EEM A;  2VO4 A;  3GKX A;  3FY7 A;  2HFD A;  4K8M A;  3G7Y A;  4EVM A;  4G01 A;  4N0V A;  3GST A;  1RK4 A;  1XBS A;  2VIM A;  2EFH A;  1JLV A;  11GS A;  1J0F A;  4X43 A;  4TXV A;  5J5N A;  4OCE A;  1XFL A;  3WGE A;  5GST A;  5KOX A;  2P0G A;  2GSR A;  2JSZ A;  4MF7 A;  5J4V A;  3CWG A;  13GS A;  3GSS A;  4Z2T A;  3D4T A;  2L4Q A;  1ZOF A;  2IMF A;  4HJ2 A;  5CP1 A;  3GMF A;  5IO0 A;  4GSS A;  4OD7 A;  5E4W A;  3US3 A;  1PX7 A;  4RI7 A;  4OFM A;  4PI0 C;  3HDC A;  12GS A;  3HY2 A;  2VL9 A;  3VPQ A;  3ZYW A;  1LU4 A;  2QA1 A;  3ZLP A;  4YQM A;  2VLV A;  2KLX A;  4MH3 A;  5AGY A;  3R2Q A;  5J4U A;  4BPY A;  1XWC A;  3HZ4 A;  4K5R A;  2TIR A;  2AJQ B;  5F07 A;  1Z6N A;  4V1A g;  5ENU A;  5AN1 A;  4HQZ A;  3RPN A;  1GL8 A;  4L5O A;  3LG6 A;  5B7C A;  4O32 A;  4JR6 A;  3Q19 A;  1B9X C;  3IA1 A;  3MIX A;  3GN3 A;  5DQS A;  1GSS A;  4MA9 A;  1VF3 A;  1ZZY A;  3ED3 A;  4EDY A;  2F8F A;  2C0D A;  2OKA A;  4IN0 A;  1EV9 A;  4RQX A;  3L78 A;  3ZTL A;  1VGL A;  2YPM A;  3F6D A;  1JZD A;  3BD2 A;  2CAI A;  1YF1 A;  4HZ2 A;  1SL0 B;  1PN9 A;  1SD8 A;  2IL3 A;  1TK0 B;  1FOV A;  4RUV A;  1OC9 A;  3IC4 A;  2LJA A;  4EXJ A;  2AV4 A;  1B4Q A;  2YJH A;  4KUN A;  1N2A A;  2F51 A;  3TJK A;  1VF4 A;  1TI1 A;  3IV4 A;  1PL2 A;  1V57 A;  2LRN A;  4OFN A;  3M8N A;  4FIW A;  4XS1 A;  1VF1 A;  4P3Y B;  1GSQ A;  5J3R A;  1TI3 A;  4FYC A;  4V1A p;  1TXU A;  3TKQ A;  3LGC A;  4I8B A;  1CQG A;  3KP8 A;  6GST A;  1JZR A;  3RBT A;  2WW3 A;  4KDY A;  1OKD A;  1RQM A;  1QFN A;  1AW9 A;  4HEA 2;  6GSX A;  4ZBB A;  2B7J A;  2DJ2 A;  5JWR B;  2QSI A;  5EVO A;  2GQK A;  2P31 A;  3W8J A;  3AY8 A;  3M9K A;  3BJ5 A;  5G31 A;  2AAW A;  2VLT A;  2H1D A;  1YDK A;  3KD0 A;  5B8B A;  1GSF A;  1EGO A;  1X5C A;  2A2R A;  4Q5F A;  2ES7 A;  4AGS A;  2FA4 A;  1TOF A;  2HZF A;  4MZC A;  4Z7X A;  1I1I P;  5C04 A;  5J40 A;  3ZL5 A;  1MD4 A;  1KEB A;  1LJR A;  5KN1 A;  1O7U A;  2C0G A;  1XPV A;  2PMT A;  5D73 A;  2AYT A;  2WUL A;  3C8E A;  2LST A;  3VWU A;  1GSD A;  4G0K A;  2I81 A;  5ECI B;  1S3C A;  2GZY A;  3QAG A;  1NSW A;  3CYN A;  4X1U A;  1GUL A;  1H4O A;  3KTB A;  2RM6 A;  2GS3 A;  2CVK A;  3QOU A;  19GS A;  1X5E A;  5HQP A;  1U88 A;  3HVS A;  4OMV A;  1E6B A;  3KGK A;  3GRX A;  3TGZ A;  4PUR A;  2CZ3 A;  1ERV A;  2CQ9 A;  5A4V A;  3TU3 B;  1G7O A;  4DVC A;  3KH7 A;  5CRE A;  4ILF A;  3NOF A;  4LLR A;  2HXK A;  1MTC A;  3APO A;  6GSW A;  2YOI A;  1OC9 B;  3KP9 A;  4EC0 A;  2RLI A;  3WGD A;  3ERG A;  3ISO A;  4Q5Q A;  2DLX A;  1WRY A;  5HFI A;  5C00 A;  4O5R A;  2AHE A;  4PQ1 A;  4TKY A;  2HSN A;  1PD2 1;  2B5Y A;  1TTZ A;  3W8S A;  1XOB A;  3VK9 A;  2HSM A;  2O5V A;  3EPT A;  3FRC A;  2R0P A;  1GUK A;  3KJY A;  3UMA A;  1WJK A;  5ECQ B;  1LBK A;  2JU5 A;  2OE3 A;  3GYK A;  2R5G A;  2B6M A;  2IN3 A;  2HSY A;  3C1R A;  4G19 A;  4N11 A;  4LMV A;  5HR1 A;  2LEG A;  2AUV A;  3C7M A;  2PER A;  3WD6 A;  3RHB A;  4TXO A;  3VFI A;  3EUR A;  1XW5 A;  5IMD A;  3G9B A;  2IWT A;  5L71 A;  4KB3 A;  4F03 A;  2GZP A;  4XTS A;  2H76 A;  4CDO A;  2VL2 C;  1X9W B;  2XBQ A;  4WET A;  4ZXG A;  1SK0 A;  2DJJ A;  1W4V A;  3KXO A;  2ZUP A;  2I1U A;  1M3I A;  4AJ6 A;  4TRX A;  4KX4 A;  3GKN A;  1MEK A;  4BWQ A;  2FWE A;  1PFO A;  4PUA A;  2QKE A;  4K2X A;  1Z6M A;  1TW9 A;  1YKC A;  3O76 A;  2MMA A;  2WFC A;  2B5X A;  1T8E B;  1GUH A;  1WWJ A;  2BMX A;  3CHX C;  1K0D A;  5HR2 A;  4POK A;  2RM5 A;  4RQR A;  1T00 A;  4DSQ A;  3Q74 A;  4WBR D;  4AKH A;  5CRW A;  5G30 A;  3W6G A;  3TKS E;  3TKR A;  20GS A;  10GS A;  2UZ8 A;  1RW1 A;  2K8V A;  3WT1 A;  4JZQ A;  1GSY A;  1B48 A;  3E9J B;  4AKI A;  2MBS A;  2CVD A;  4F82 A;  1EP7 A;  4JU5 A;  4PXO A;  2GVP A;  1YEW C;  3FYG A;  4I5Q A;  3EE2 A;  3LQ7 A;  2B3S A;  1UA5 A;  3L4N A;  1DE2 A;  2PPT A;  2HSN B;  1X9S B;  4CHS A;  1AAZ A;  4TR4 A;  2L57 A;  4IJ3 A;  3E0U A;  4NPB A;  3MWH A;  3CMI A;  2HSM B;  1FB6 A;  4EDZ A;  4MF6 A;  3CRT A;  4V2L A;  2QC7 A;  3F63 A;  2VCQ A;  1GTA A;  3KCM A;  1EWX A;  5ECR B;  1Z7P A;  5ECK B;  3J7Y k;  2YWM A;  1XVW A;  4ICY A;  3VI5 A;  2XHF A;  1M99 A;  3LYP A;  4ID0 A;  4KH7 A;  4KW6 A;  2PGT A;  4EL1 A;  4MAB A;  2FUG 2;  1K0O A;  5GSS A;  2A4V A;  5CAX A;  1OE8 A;  2FA8 A;  2YP6 A;  4PI2 C;  4JE1 A;  3KIJ A;  3LXZ A;  2WCI A;  2JZR A;  2HT9 A;  1NW2 A;  4TXO B;  2IFQ A;  5G1L A;  4KCE A;  5ID2 A;  2EFD A;  3SBC A;  3D5J A;  2KP2 A;  1PX6 A;  4KND A;  4IJI A;  1G6W A;  4EIP A;  1O73 A;  4IP1 A;  4NXI A;  2L59 A;  5LD0 A;  3M0F A;  3IDV A;  1K0C A;  5IM9 A;  1SVO A;  3ME7 A;  2O36 A;  4K2D A;  2YNX A;  4I2T A;  2MYG A;  5DJM A;  2DMM A;  3FW2 A;  3MAK A;  4QL7 A;  4WF4 A;  2P5Q A;  1EEJ A;  1GTI A;  3DRN A;  4POL A;  3TKP A;  1O8X A;  4XCS A;  5D93 A;  2WVX A;  3APS A;  9GSS A;  4KGI A;  1GNE A;  3TRX A;  3UBL A;  1R5A A;  1O8W A;  1AIU A;  3L9S A;  1F3B A;  1OAZ A;  5IOX A;  2K18 A;  2DJ3 A;  1TU7 A;  4IQA A;  3QAW A;  5EL8 A;  3ZVJ A;  1YF0 A;  4XRA A;  1M0U A;  4QQ7 A;  3LFL A;  2H75 A;  1AXD A;  2QA2 A;  3DIE A;  3TB2 A;  4ZIJ A;  3ZRE A;  1K0N A;  1GUM A;  2C0E A;  2GZZ A;  2H72 A;  3EYT A;  4NHW A;  3TKS C;  4KAE A;  4ECB A;  3TJB A;  2WS2 A;  4IQ1 A;  4FXY P;  2HLS A;  5DQY A;  1OC3 A;  2G2Q A;  1BAY A;  3ZIJ A;  1U3A A;  4MPF A;  1V58 A;  4BA7 A;  2OBI A;  1UN2 A;  2JSY A;  1GLP A;  1M7T A;  1K0B A;  5D9V A;  3GHA A;  5GAP D;  2FLS A;  3F9U A;  3D4M A;  2D2Z A;  1KNG A;  4MJC A;  1YY7 A;  7GSS A;  1SYR A;  1FHE A;  5H5R A;  4K1F A;  3ZFL A;  4TN8 A;  2IFQ B;  3FHK A;  5ID2 B;  22GS A;  1FOH A;  4OFT A;  1QUW A;  4ZBA A;  4HU9 A;  3IK9 A;  4MCU A;  2L5L A;  1PN0 A;  3A5I A;  1K3L A;  1ML6 A;  2OA7 A;  1FVK A;  3FEU A;  1FO5 A;  2IME A;  4NAX A;  3SWL A;  18GS A;  5AIS A;  2O3E A;  3UAP A;  2YWI A;  4GWR A;  1YEP A;  4ML6 A;  3Q18 A;  3ZML A;  1SKR B;  3BCK A;  1XXU A;  3P90 A;  3VI7 A;  5EY6 A;  5COH A;  5IMV A;  3KMO A;  2WW0 A;  4OCF A;  2KP1 A;  4YAV A;  2AB6 A;  2B5E A;  4MZW A;  5CRH A;  3M9J A;  2NDO A;  1M2A A;  5KOW A;  2N5A A;  1PL1 A;  3LW9 A;  1G7E A;  2WVX B;  1TRU A;  1SJI A;  5J4Y A;  3VWV A;  3HXS A;  4NV5 A;  3FR3 A;  2TRX A;  4L5L A;  1QGV A;  1GNW A;  3F4S A;  3HVX A;  1EOG A;  2V41 A;  4HJM A;  2ZCT A;  4FO5 A;  1WPI A;  5DVB A;  4CY8 A;  2PUK C;  1WE0 A;  5ECP B;  4WXT A;  3ZMK A;  3F3R A;  3A5W A;  2WJU A;  4N10 A;  1NHY A;  3LOR A;  5ECS A;  1GH2 A;  3BCI A;  4IP6 A;  4GF0 A;  2WW1 A;  4PQH A;  2DKI A;  5JCW A;  3C73 A;  1M9A A;  3FR6 A;  2YZH A;  2LS5 A;  4MP4 A;  2FWF A;  4F9Z A;  4ACS A;  2OE1 A;  4FH8 A;  3LXT A;  4HU7 A;  1XWG A;  2OAC A;  1JHB A;  3QMX A;  2L5O A;  3F4T A;  3HJP A;  5IMA A;  3MDK A;  4GTU A;  3UVH A;  2KOK A;  4GDF A;  4PTS A;  3IAS 2;  1N25 A;  1XVQ A;  4FYU A;  4N0Z A;  2VAF A;  2CAQ A;  5J47 A;  5G1K A;  5LNK e;  2LNS A;  5GAN D;  2H1G A;  2WZ9 A;  4DEJ A;  5IPG A;  2H1L A;  2ON7 A;  3GV1 A;  4GXZ A;  2GSQ A;  2H01 A;  3S9F A;  5IMZ A;  2MBT A;  3GX0 A;  1W89 A;  1F3A A;  1THX A;  4L0W A;  5A5H A;  1HD2 A;  1V40 A;  3TRQ A;  5DDL A;  2H6Y A;  3EU3 A;  2V6O A;  3LWA A;  1QMV A;  1VRS D;  1Z7R A;  3QDN A;  3CSH A;  5ECO B;  3PIN A;  2EFC A;  2K8S A;  4POB A;  2F3M A;  1SK2 A;  2VKZ G;  1ZL9 A;  3I6A A;  3DGQ A;  2DKH A;  1OC8 A;  1V9W A;  4PNF A;  2H70 A;  4IS0 A;  1FB0 A;  3DXB A;  5G5E A;  2N5F A;  1YZX A;  3FZ4 A;  1XW9 A;  1PKW A;  2OT3 A;  2M80 A;  3Q6O A;  3VWX A;  2Z9S A;  2GQM A;  2XBI A;  2H0G A;  2YN1 A;  1JLW A;  2DML A;  1XG8 A;  4JRR A;  2X4A A;  5BMU A;  4X0X A;  5HFG A;  4O5Q A;  4V2M A;  3HMJ G;  3DWV A;  1EV4 A;  2H19 A;  4BL7 A;  5INY A;  1VF2 A;  14GS A;  4BIK A;  2G0F A;  1S3D A;  5KN2 A;  5CO3 A;  1BG1 A;  2LJK A;  2YJ7 A;  2NBS A;  3BOA A;  3KZQ A;  2ON5 A;  2GLR A;  3IHG A;  2P5R A;  3IK7 A;  2HRF A;  1KBN A;  2YWO A;  4ZB8 A;  2ZNM A;  4D73 B;  2HNL A;  1YKA A;  2LQO A;  6GSS A;  4E68 A;  2V1M A;  1FVJ A;  2VM2 A;  2IMD A;  5B6M A;  2VM1 A;  3BBY A;  2DC5 A;  3PPU A;  1R7H A;  3ZZX A;  3M3M A;  2BTO T;  3CBU A;  5A5H B;  5J9B A;  4K0N A;  1JZO A;  3TOT A;  1ON4 A;  2XPE A;  4PUF C;  4E8H A;  3GX8 A;  4TOP A;  3EC3 A;  4ZB7 A;  5A1N A;  2UV8 G;  1T4Z A;  3HZ8 A;  3ERW A;  1B8X A;  3GKM A;  3UAR A;  2DJ0 A;  1UC7 A;  4WKW A;  4YH2 A;  3TUE A;  3RDW A;  1M2B A;  1SJZ A;  3L9U A;  2CX3 A;  3HVN A;  3GIX A;  4PQI A;  4K5S A;  2C1Y A;  1A0R P;  1IYI A;  1FG4 A;  4LL4 B;  5AIV A;  4XS6 A;  1FW1 A;  5H5Q A;  2CT6 A;  3VWW A;  5IOW A;  3GL5 A;  5JCG A;  3M1G A;  2FGX A;  4ECI A;  3VPT A;  4KCA A;  3HKR A;  1N8J A;  2I3Y A;  1GSE A;  3MYD A;  1AUC A;  5H5S A;  4ZL9 A;  1GRX A;  4J2F A;  3IRA A;  5BMU B;  3UEM A;  3ZRD A;  3HYP A;  1XZO A;  1O81 A;  3RAZ A;  5CNW A;  5CRG A;  1A8Y A;  4L0U A;  5HR0 A;  4HZ4 A;  3ZFB A;  4BL7 B;  1GLQ A;  1B4P A;  4YQU A;  3PR8 A;  3UL3 A;  3WGX A;  3IXR A;  1BF5 A;  2B7K A;  3A2V A;  5A5K A;  3C1S A;  4XS4 A;  4HI7 A;  3TOU A;  2LRT A;  4W66 A;  1EZK A;  1GWC A;  2X64 A;  3APQ A;  1B9Y C;  1WP0 A;  3FZ5 A;  1XOA A;  2KHP A;  4ZL8 A;  2VL2 A;  2R2J A;  4YQV A;  2GTU A;  3LJR A;  3HVV A;  1F6M C;  16GS A;  1HYU A;  2C3N A;  4Z2U A;  2R37 A;  3U5R E;  4HDE A;  2H6X A;  5B6N A;  4WEY A;  2HRK A;  3IAM 2;  2F9S A;  3L0H A;  2H66 A;  5KEJ A;  2OBK A;  3QCP A;  3D22 A;  1XCC A;  3A3T A;  1TRS A;  1V98 A;  3O3T A;  2C0F A;  4MNN A;  2R0C A;  4N3Z A;  1SVL A;  2LNT A;  4ML1 A;  1EP8 A;  5FWG A;  2IIY A;  2R4V A;  4TVE A;  4IW9 A;  4PNG A;  3TRP A;  2KUC A;  2PVQ A;  2HQT A;  4IKH A;  3UBK A;  2VL3 A;  2YWN A;  2A2S A;  2VCT A;  1JFU A;  1TXX A;  5A1N B;  3UOM A;  4AF2 A;  4X4J A;  5ECH B;  3PGT A;  3P8W A;  3IC8 A;  3MNG A; 
#chains in the Genus database with same CATH homology
 4MJE A;  3F6F A;  1MD3 A;  4GCI A;  3HA9 A;  3RHC A;  2PWJ A;  3HCZ A;  4KSO A;  2C3T A;  2DSA A;  3TDG A;  1HQO A;  4EKZ A;  5J9C A;  5J41 A;  1X9M B;  3F3Q A;  5IIZ A;  1U6T A;  2H0H A;  1XIY A;  3ME8 A;  3QR6 A;  5D9T A;  3P2A A;  1SYX A;  4O7H A;  4HQS A;  1MDI A;  1PRX A;  1ABA A;  1SU9 A;  2NPB A;  4K7N A;  1BYE A;  2V32 A;  3D21 A;  3K8N A;  1SKS B;  1NM3 A;  2DJ1 A;  5FHI A;  4E8E A;  2E7P A;  3QPM A;  1EOH A;  5IQY A;  2FY6 A;  5IMC A;  5D8I A;  1G6Y A;  1K3O A;  4HOJ A;  4MH2 A;  3ZIT A;  4KF9 A;  1TP9 A;  4XS4 B;  3GNJ A;  3I69 A;  2MZC A;  1SVM A;  2QGV A;  4G10 A;  2VUP A;  1DBY A;  2O87 A;  1PA3 A;  4WF5 A;  1O6J A;  2LRC A;  17GS A;  3GH9 A;  1O85 A;  5JCU A;  4LL1 B;  2FD3 A;  1BG5 A;  1SK1 A;  2HRK B;  4TW5 A;  4PX1 A;  2VCW A;  4WR4 A;  2EIR A;  4O5U A;  4N30 A;  2R0G A;  3DVW A;  4EUY A;  1A8L A;  5JWQ B;  3UVT A;  4GRF A;  2BJX A;  2X8H A;  1BJX A;  1H75 A;  1A0F A;  4I97 A;  4LA1 A;  1KTE A;  1YEX A;  3FZ9 A;  3EU4 A;  3DML A;  3GFK A;  5GZZ B;  5KN3 A;  3F4R A;  2CZ2 A;  1SEN A;  5IO2 A;  1ACV A;  4RI6 A;  2PU9 C;  3KEB A;  2FNO A;  2EIO A;  4EE0 A;  1PQN A;  2F8A A;  1TU8 A;  5G5F A;  4KA0 A;  1URM A;  2FWG A;  1TK5 B;  1JZW A;  5ELA A;  2V2G A;  3NIV A;  3TCO A;  1PKZ A;  3TKS A;  4AKG A;  4MJA A;  1PGT A;  1DUG A;  2LQQ A;  4EF0 A;  1AC1 A;  1YVL A;  2OJL A;  4BWS A;  1DSB A;  5ECM B;  1Y6E A;  4KE3 A;  1Q98 A;  4DSS A;  5DAK A;  2NTO A;  1Z5Y E;  1ZGN A;  4J57 E;  1SL1 B;  2GSS A;  2JL4 A;  3DYR A;  1MDK A;  3IPZ A;  3UIW A;  8GSS A;  1GSU A;  2LJR A;  6GSV A;  1UVZ A;  2PN8 A;  3CSI A;  1FAA A;  3CXG A;  4MZB A;  3H79 A;  2DJK A;  5IMF A;  4TR0 A;  3FK8 A;  1BX9 A;  3V1W A;  4BVY A;  2YAN A;  2H8L A;  2XC2 A;  4LMW A;  3IE3 A;  3O6T A;  5IPH A;  3IR4 A;  1Q4J A;  2O8V B;  2CA8 A;  3HJM A;  1QK8 A;  3FR9 A;  2J9H A;  4J56 E;  2A4H A;  1GP1 A;  2B1L A;  4IEL A;  3EMP A;  2VCX A;  1TJD A;  2LKU A;  2HYX A;  3KH9 A;  5F0G A;  4JBB A;  2HRA A;  4MDC A;  4A5P A;  2PVO C;  4JED A;  3DVX A;  3EIN A;  2ALB A;  3HD5 A;  2C80 A;  4ZB9 A;  1BED A;  1R4W A;  4K7O A;  4F2I A;  1ILO A;  4H86 A;  3OR5 A;  4NHZ A;  1XWA A;  1SKW B;  4IGJ A;  4KDX A;  1ERT A;  2M46 A;  2OE0 A;  5CYY A;  4D73 A;  2LV3 A;  2H71 A;  2C8U A;  4O92 A;  3G7J A;  4GQC A;  1T1V A;  2GQL A;  3EMX A;  3CTF A;  4NMU A;  3FMW A;  4IVF A;  3TJJ A;  2HSH A;  4Q5N A;  1X0R A;  1TKD B;  1ZYE A;  3QAV A;  2WGR A;  1C72 A;  3RPP A;  4IHU A;  2CVB A;  2H1B A;  5G2Z A;  2HRN A;  2K9F A;  4MK3 A;  4G9H A;  4FYB A;  2E2G A;  3QD9 A;  1I5G A;  1USB A;  5D9X A;  2K6V A;  4DSS B;  5LCZ A;  5DAK B;  4KSM A;  4G2E A;  3CRU A;  2B1K A;  4I6X A;  1ZMA A;  1OKT A;  3IOS A;  2WB9 A;  4EO3 A;  3ZIV A;  5AIX A;  1J08 A;  3GTU A;  1AQW A;  5JWO B;  2GDR A;  1Z3E A;  1WOU A;  6GSY A;  4OWY A;  3TJF A;  3H1N A;  5DCH A;  2JZT A;  2YV9 A;  3L9V A;  4BVY B;  4ECC A;  2L4C A;  1U3I A;  1SJ6 A;  1ZCP A;  4GST A;  4NV2 A;  5A4U A;  2NVL A;  4ZBD A;  3FZA A;  3HJO A;  2C3Q A;  1A2J A;  1SL2 B;  2X49 A;  3G7I A;  2VOC A;  3EWL A;  1S3A A;  3I9V 2;  2RUE A;  6GSU A;  1ERU A;  1MDJ A;  2VCZ A;  2YZU A;  1Y25 A;  3HHV A;  5DCG A;  1AQV A;  4K9Z A;  1M2D A;  2J23 A;  3WYW A;  5DAL A;  3C71 A;  2H74 A;  1TDI A;  1A24 A;  5FT3 A;  3A2X A;  1PSQ A;  2L6D A;  4NWY A;  2VD0 A;  2IJY A;  2X8G A;  3GUS A;  4QL9 A;  2JZS A;  2HI7 A;  4I2U A;  4Z2R A;  1XW6 A;  3GH6 A;  1THO A;  1F2E A;  2EFE A;  1X5D A;  2E0Q A;  2YV7 A;  1R26 A;  2RII A;  4HUA A;  2LUS A;  5D96 A;  1Z9H A;  1R5P A;  2O89 A;  4YKG A;  2EC4 A;  1K0M A;  2DBC A;  2N5B A;  4GSN A;  2CX4 A;  3F0I A;  4ULX A;  5HR3 A;  2R6K A;  2PBJ A;  3J7Y b;  1ERW A;  3CSJ A;  4MJB A;  2HZE A;  3H93 A;  2V6K A;  3MSZ A;  2O85 A;  4K0G A;  3P7X A;  4BVX A;  4PGT A;  3N9J A;  2DIY A;  3UJ1 A;  1J9B A;  2WDU A;  4AI6 A;  5KN0 A;  4MF5 A;  4AJ8 A;  2O7K A;  2WRT A;  2TRC P;  3QFA C;  3GKK A;  5EPF A;  1A2L A;  3GL3 A;  4TR3 A;  3EVI A;  4FQU A;  1T3B A;  3GTU B;  3GA4 A;  3D0Z A;  5DJL A;  5A4W A;  4GQF A;  4HS1 A;  4K6X A;  1K3Y A;  2E2M A;  5HFK A;  2FWH A;  4CY6 A;  1U87 A;  2XPD A;  4DSR A;  3KTL A;  2I4A A;  1HNA A;  4XIH A;  2EIQ A;  2MMO A;  1NHO A;  3CTG A;  1EGR A;  2HE3 A;  2YCD A;  3ERF A;  1OE7 A;  1QQ2 A;  4POM A;  3LSZ A;  3TJG A;  4USS A;  4YKF A;  1GTU A;  1CQH A;  2GT6 A;  1DE1 A;  2MMN A;  4TR1 A;  4MLY A;  3ZVJ D;  2M72 A;  2C4J A;  5DAL B;  5ECL B;  2RUF A;  5A34 A;  2R3X A;  4GLT A;  2H30 A;  1K0A A;  2GT5 A;  2REM A;  2H6Z A;  1T7P B;  3KMN A;  4Q5R A;  4XRD A;  1TRV A;  3JCM L;  1AQX A;  3DKS A;  1GTB A;  3PH9 A;  1BQ7 A;  4EIQ A;  1G0T A;  1F37 A;  2IPA A;  4ECJ A;  2A2P A;  2H73 A;  4F0C A;  2HZE B;  4ISD A;  3A2W A;  3IBH A;  3E3E A;  4CW9 A;  4OO5 A;  4BVX B;  1ZYQ B;  1OYJ A;  2IMK A;  2DIZ A;  2JAC A;  2I9H A;  5CRD A;  3DD3 A;  4XHM A;  5E59 A;  5F8B A;  1TRW A;  5D9W A;  3I43 A;  4G0I A;  4KDU A;  3LEF A;  1YJ6 A;  3R3E A;  5ELG A;  4QMK A;  2MMZ A;  3VLN A;  2GST A;  2LTK A;  3F8U A;  4OO4 A;  2CV4 A;  2L6C A;  3N5O A;  3NZN A;  1HNC A;  3LYK A;  2JAD A;  1IYH A;  1I9D A;  4MPG A;  1M9B A;  2X8C A;  1YQ1 A;  4AKX B;  2GGT A;  2FCH A;  4JR4 A;  3WT2 A;  2OAD A;  1OVN A;  4MMM A;  3D6I A;  5DBQ A;  2VCV A;  1QXH A;  2H1A A;  2VLU A;  1F9M A;  4IBP A;  2H0I A;  2X99 A;  1Y1U A;  3H4K A;  4TR1 B;  3H8Q A;  4ZB6 A;  5ECN B;  3DEX A;  5B8A A;  1A23 A;  1XWK A;  1V2A A;  3VUR A;  5BRT A;  5A34 B;  4V2N A;  4YAP A;  4ZIL A;  5ABR A;  4L8E A;  1TK8 B;  1ST9 A;  1PMT A;  1A2M A;  4G0L A;  3QFB C;  4F0B A;  2IMI A;  3U6V A;  5F06 A;  1WMJ A;  2VD1 A;  3KM6 A;  1E2Y A;  4K7I A;  3FKF A;  4ZL7 A;  2FHE A;  4AJ7 A;  1ZYN A;  1ZYP A;  3IHQ A;  1WIK A;  1T4Y A;  4WR5 A;  1HNB A;  5F05 A;  1SD9 A;  3GUR A;  1XWB A;  4WBJ A;  1EEM A;  2VO4 A;  3GKX A;  3FY7 A;  2HFD A;  4K8M A;  3G7Y A;  4EVM A;  4G01 A;  4N0V A;  3GST A;  1RK4 A;  1XBS A;  2VIM A;  2EFH A;  1JLV A;  11GS A;  1J0F A;  4X43 A;  4TXV A;  5J5N A;  4OCE A;  1XFL A;  3WGE A;  5GST A;  5KOX A;  2P0G A;  2GSR A;  2JSZ A;  4MF7 A;  5J4V A;  3CWG A;  13GS A;  3GSS A;  4Z2T A;  3D4T A;  2L4Q A;  1ZOF A;  2IMF A;  4HJ2 A;  5CP1 A;  3GMF A;  5IO0 A;  4GSS A;  4OD7 A;  5E4W A;  3US3 A;  1PX7 A;  4RI7 A;  4OFM A;  3HDC A;  12GS A;  3HY2 A;  2VL9 A;  3VPQ A;  3ZYW A;  1LU4 A;  2QA1 A;  3ZLP A;  4YQM A;  2VLV A;  2KLX A;  4MH3 A;  5AGY A;  3R2Q A;  5J4U A;  4BPY A;  1XWC A;  3HZ4 A;  4K5R A;  2TIR A;  2AJQ B;  5F07 A;  1Z6N A;  4V1A g;  5ENU A;  5AN1 A;  4HQZ A;  3RPN A;  1GL8 A;  4L5O A;  3LG6 A;  5B7C A;  4O32 A;  4JR6 A;  3Q19 A;  1B9X C;  3IA1 A;  3MIX A;  3GN3 A;  5DQS A;  1GSS A;  4MA9 A;  1VF3 A;  1ZZY A;  3ED3 A;  4EDY A;  2F8F A;  2C0D A;  2OKA A;  4IN0 A;  1EV9 A;  4RQX A;  3L78 A;  3ZTL A;  1VGL A;  2YPM A;  3F6D A;  1JZD A;  3BD2 A;  2CAI A;  1YF1 A;  4HZ2 A;  1SL0 B;  1PN9 A;  1SD8 A;  2IL3 A;  1TK0 B;  1FOV A;  4RUV A;  1OC9 A;  3IC4 A;  2LJA A;  4EXJ A;  2AV4 A;  1B4Q A;  2YJH A;  4KUN A;  1N2A A;  2F51 A;  3TJK A;  1VF4 A;  1TI1 A;  3IV4 A;  1PL2 A;  1V57 A;  2LRN A;  4OFN A;  3M8N A;  4FIW A;  4XS1 A;  1VF1 A;  4P3Y B;  1GSQ A;  5J3R A;  1TI3 A;  4FYC A;  4V1A p;  1TXU A;  3TKQ A;  3LGC A;  4I8B A;  1CQG A;  3KP8 A;  6GST A;  1JZR A;  3RBT A;  4KDY A;  1OKD A;  1RQM A;  1QFN A;  1AW9 A;  4HEA 2;  6GSX A;  4ZBB A;  2B7J A;  2DJ2 A;  5JWR B;  2QSI A;  5EVO A;  2GQK A;  2P31 A;  3W8J A;  3AY8 A;  3M9K A;  3BJ5 A;  5G31 A;  2AAW A;  2VLT A;  2H1D A;  1YDK A;  3KD0 A;  5B8B A;  1GSF A;  1EGO A;  1X5C A;  2A2R A;  4Q5F A;  2ES7 A;  4AGS A;  2FA4 A;  1TOF A;  2HZF A;  4MZC A;  4Z7X A;  5C04 A;  5J40 A;  3ZL5 A;  1MD4 A;  1KEB A;  1LJR A;  5KN1 A;  1O7U A;  2C0G A;  1XPV A;  2PMT A;  5D73 A;  2AYT A;  2WUL A;  3C8E A;  2LST A;  3VWU A;  1GSD A;  4G0K A;  2I81 A;  5ECI B;  1S3C A;  2GZY A;  3QAG A;  1NSW A;  3CYN A;  4X1U A;  1GUL A;  1H4O A;  3KTB A;  2RM6 A;  2GS3 A;  2CVK A;  3QOU A;  19GS A;  1X5E A;  5HQP A;  1U88 A;  3HVS A;  4OMV A;  1E6B A;  3KGK A;  3GRX A;  3TGZ A;  4PUR A;  2CZ3 A;  1ERV A;  2CQ9 A;  5A4V A;  3TU3 B;  1G7O A;  4DVC A;  3KH7 A;  5CRE A;  4ILF A;  3NOF A;  4LLR A;  2HXK A;  1MTC A;  3APO A;  6GSW A;  2YOI A;  1OC9 B;  3KP9 A;  4EC0 A;  2RLI A;  3WGD A;  3ERG A;  3ISO A;  4Q5Q A;  2DLX A;  1WRY A;  5HFI A;  5C00 A;  4O5R A;  2AHE A;  4PQ1 A;  4TKY A;  2HSN A;  1PD2 1;  2B5Y A;  1TTZ A;  3W8S A;  1XOB A;  3VK9 A;  2HSM A;  2O5V A;  3EPT A;  3FRC A;  2R0P A;  1GUK A;  3KJY A;  3UMA A;  1WJK A;  5ECQ B;  1LBK A;  2JU5 A;  2OE3 A;  3GYK A;  2R5G A;  2B6M A;  2IN3 A;  2HSY A;  3C1R A;  4G19 A;  4N11 A;  4LMV A;  5HR1 A;  2LEG A;  2AUV A;  3C7M A;  2PER A;  3WD6 A;  3RHB A;  4TXO A;  3VFI A;  3EUR A;  1XW5 A;  5IMD A;  3G9B A;  2IWT A;  5L71 A;  4KB3 A;  4F03 A;  2GZP A;  4XTS A;  2H76 A;  4CDO A;  2VL2 C;  1X9W B;  2XBQ A;  4WET A;  4ZXG A;  1SK0 A;  2DJJ A;  1W4V A;  3KXO A;  2ZUP A;  2I1U A;  4AJ6 A;  4TRX A;  4KX4 A;  3GKN A;  1MEK A;  4BWQ A;  2FWE A;  2QKE A;  4PUA A;  4K2X A;  1Z6M A;  1TW9 A;  1YKC A;  3O76 A;  2MMA A;  2WFC A;  2B5X A;  1T8E B;  1GUH A;  1WWJ A;  2BMX A;  1K0D A;  5HR2 A;  4POK A;  2RM5 A;  4RQR A;  1T00 A;  4DSQ A;  3Q74 A;  4WBR D;  4AKH A;  5CRW A;  5G30 A;  3W6G A;  3TKS E;  3TKR A;  20GS A;  10GS A;  2UZ8 A;  1RW1 A;  2K8V A;  3WT1 A;  4JZQ A;  1GSY A;  1B48 A;  3E9J B;  4AKI A;  2MBS A;  2CVD A;  4F82 A;  1EP7 A;  4JU5 A;  4PXO A;  2GVP A;  3FYG A;  4I5Q A;  3EE2 A;  3LQ7 A;  2B3S A;  1UA5 A;  3L4N A;  1DE2 A;  2PPT A;  2HSN B;  1X9S B;  4CHS A;  1AAZ A;  4TR4 A;  2L57 A;  4IJ3 A;  3E0U A;  4NPB A;  3MWH A;  3CMI A;  2HSM B;  1FB6 A;  4EDZ A;  4MF6 A;  3CRT A;  4V2L A;  2QC7 A;  3F63 A;  2VCQ A;  1GTA A;  3KCM A;  1EWX A;  5ECR B;  1Z7P A;  5ECK B;  3J7Y k;  2YWM A;  1XVW A;  4ICY A;  3VI5 A;  2XHF A;  1M99 A;  3LYP A;  4ID0 A;  4KH7 A;  4KW6 A;  2PGT A;  4EL1 A;  4MAB A;  2FUG 2;  1K0O A;  5GSS A;  2A4V A;  5CAX A;  1OE8 A;  2FA8 A;  2YP6 A;  4JE1 A;  3KIJ A;  3LXZ A;  2WCI A;  2JZR A;  2HT9 A;  1NW2 A;  4TXO B;  2IFQ A;  5G1L A;  4KCE A;  5ID2 A;  2EFD A;  3SBC A;  3D5J A;  2KP2 A;  1PX6 A;  4KND A;  4IJI A;  1G6W A;  4EIP A;  1O73 A;  4IP1 A;  4NXI A;  2L59 A;  5LD0 A;  3M0F A;  3IDV A;  1K0C A;  5IM9 A;  1SVO A;  3ME7 A;  4K2D A;  2YNX A;  4I2T A;  2MYG A;  5DJM A;  2DMM A;  3FW2 A;  3MAK A;  4QL7 A;  4WF4 A;  2P5Q A;  1EEJ A;  1GTI A;  3DRN A;  4POL A;  3TKP A;  1O8X A;  4XCS A;  5D93 A;  3APS A;  9GSS A;  4KGI A;  1GNE A;  3TRX A;  3UBL A;  1R5A A;  1O8W A;  1AIU A;  3L9S A;  1F3B A;  1OAZ A;  5IOX A;  2K18 A;  2DJ3 A;  1TU7 A;  4IQA A;  3QAW A;  5EL8 A;  3ZVJ A;  1YF0 A;  4XRA A;  1M0U A;  4QQ7 A;  3LFL A;  2H75 A;  1AXD A;  2QA2 A;  3DIE A;  3TB2 A;  4ZIJ A;  3ZRE A;  1K0N A;  1GUM A;  2C0E A;  2GZZ A;  2H72 A;  3EYT A;  4NHW A;  3TKS C;  4KAE A;  4ECB A;  3TJB A;  2WS2 A;  4IQ1 A;  2HLS A;  5DQY A;  1OC3 A;  2G2Q A;  1BAY A;  3ZIJ A;  1U3A A;  4MPF A;  1V58 A;  4BA7 A;  2OBI A;  1UN2 A;  2JSY A;  1GLP A;  1M7T A;  1K0B A;  5D9V A;  3GHA A;  5GAP D;  2FLS A;  3F9U A;  3D4M A;  2D2Z A;  1KNG A;  4MJC A;  1YY7 A;  7GSS A;  1SYR A;  1FHE A;  5H5R A;  4K1F A;  3ZFL A;  4TN8 A;  2IFQ B;  3FHK A;  5ID2 B;  22GS A;  1FOH A;  4OFT A;  1QUW A;  4ZBA A;  4HU9 A;  3IK9 A;  4MCU A;  2L5L A;  1PN0 A;  3A5I A;  1K3L A;  1ML6 A;  2OA7 A;  1FVK A;  3FEU A;  1FO5 A;  2IME A;  4NAX A;  3SWL A;  18GS A;  5AIS A;  3UAP A;  2YWI A;  4GWR A;  1YEP A;  4ML6 A;  3Q18 A;  3ZML A;  1SKR B;  3BCK A;  1XXU A;  3P90 A;  3VI7 A;  5EY6 A;  5COH A;  5IMV A;  3KMO A;  4OCF A;  2KP1 A;  4YAV A;  2AB6 A;  2B5E A;  4MZW A;  5CRH A;  3M9J A;  2NDO A;  1M2A A;  5KOW A;  2N5A A;  1PL1 A;  3LW9 A;  1G7E A;  1TRU A;  1SJI A;  5J4Y A;  3VWV A;  3HXS A;  4NV5 A;  3FR3 A;  2TRX A;  4L5L A;  1QGV A;  1GNW A;  3F4S A;  3HVX A;  1EOG A;  2V41 A;  4HJM A;  2ZCT A;  4FO5 A;  1WPI A;  5DVB A;  4CY8 A;  2PUK C;  1WE0 A;  5ECP B;  4WXT A;  3ZMK A;  3F3R A;  3A5W A;  2WJU A;  4N10 A;  1NHY A;  3LOR A;  5ECS A;  1GH2 A;  3BCI A;  4IP6 A;  4GF0 A;  4PQH A;  2DKI A;  5JCW A;  3C73 A;  1M9A A;  3FR6 A;  2YZH A;  2LS5 A;  4MP4 A;  2FWF A;  4F9Z A;  4ACS A;  2OE1 A;  4FH8 A;  3LXT A;  4HU7 A;  1XWG A;  2OAC A;  1JHB A;  3QMX A;  2L5O A;  3F4T A;  3HJP A;  5IMA A;  3MDK A;  4GTU A;  3UVH A;  2KOK A;  4GDF A;  4PTS A;  3IAS 2;  1N25 A;  1XVQ A;  4FYU A;  4N0Z A;  2VAF A;  2CAQ A;  5J47 A;  5G1K A;  5LNK e;  2LNS A;  5GAN D;  2H1G A;  2WZ9 A;  4DEJ A;  5IPG A;  2H1L A;  2ON7 A;  3GV1 A;  4GXZ A;  2GSQ A;  2H01 A;  3S9F A;  5IMZ A;  2MBT A;  3GX0 A;  1W89 A;  1F3A A;  1THX A;  4L0W A;  5A5H A;  1HD2 A;  1V40 A;  3TRQ A;  5DDL A;  2H6Y A;  3EU3 A;  2V6O A;  3LWA A;  1QMV A;  1VRS D;  1Z7R A;  3QDN A;  3CSH A;  5ECO B;  3PIN A;  2EFC A;  2K8S A;  4POB A;  2F3M A;  1SK2 A;  2VKZ G;  1ZL9 A;  3I6A A;  3DGQ A;  2DKH A;  1OC8 A;  1V9W A;  4PNF A;  2H70 A;  4IS0 A;  1FB0 A;  3DXB A;  5G5E A;  2N5F A;  1YZX A;  3FZ4 A;  1XW9 A;  1PKW A;  2OT3 A;  2M80 A;  3Q6O A;  3VWX A;  2Z9S A;  2GQM A;  2XBI A;  2H0G A;  2YN1 A;  1JLW A;  2DML A;  4JRR A;  2X4A A;  5BMU A;  4X0X A;  5HFG A;  4O5Q A;  4V2M A;  3HMJ G;  3DWV A;  1EV4 A;  2H19 A;  4BL7 A;  5INY A;  1VF2 A;  14GS A;  2G0F A;  1S3D A;  5KN2 A;  5CO3 A;  1BG1 A;  2LJK A;  2YJ7 A;  2NBS A;  3BOA A;  3KZQ A;  2ON5 A;  2GLR A;  3IHG A;  2P5R A;  3IK7 A;  2HRF A;  1KBN A;  2YWO A;  4ZB8 A;  2ZNM A;  4D73 B;  2HNL A;  1YKA A;  2LQO A;  6GSS A;  4E68 A;  2V1M A;  1FVJ A;  2VM2 A;  2IMD A;  5B6M A;  2VM1 A;  3BBY A;  2DC5 A;  3PPU A;  1R7H A;  3ZZX A;  3M3M A;  2BTO T;  3CBU A;  5A5H B;  5J9B A;  4K0N A;  1JZO A;  3TOT A;  1ON4 A;  2XPE A;  4PUF C;  4E8H A;  3GX8 A;  4TOP A;  3EC3 A;  4ZB7 A;  5A1N A;  2UV8 G;  1T4Z A;  3HZ8 A;  3ERW A;  1B8X A;  3GKM A;  3UAR A;  2DJ0 A;  1UC7 A;  4WKW A;  4YH2 A;  3TUE A;  3RDW A;  1M2B A;  1SJZ A;  3L9U A;  2CX3 A;  3GIX A;  4PQI A;  4K5S A;  2C1Y A;  1A0R P;  1IYI A;  1FG4 A;  4LL4 B;  5AIV A;  4XS6 A;  1FW1 A;  5H5Q A;  2CT6 A;  3VWW A;  5IOW A;  3GL5 A;  5JCG A;  3M1G A;  2FGX A;  4ECI A;  3VPT A;  4KCA A;  3HKR A;  1N8J A;  2I3Y A;  1GSE A;  3MYD A;  1AUC A;  5H5S A;  4ZL9 A;  1GRX A;  4J2F A;  3IRA A;  5BMU B;  3UEM A;  3ZRD A;  3HYP A;  1XZO A;  1O81 A;  3RAZ A;  5CNW A;  5CRG A;  1A8Y A;  4L0U A;  5HR0 A;  4HZ4 A;  3ZFB A;  4BL7 B;  1GLQ A;  1B4P A;  4YQU A;  3PR8 A;  3UL3 A;  3WGX A;  3IXR A;  1BF5 A;  2B7K A;  3A2V A;  5A5K A;  3C1S A;  4XS4 A;  4HI7 A;  3TOU A;  2LRT A;  4W66 A;  1EZK A;  1GWC A;  2X64 A;  3APQ A;  1B9Y C;  1WP0 A;  3FZ5 A;  1XOA A;  2KHP A;  4ZL8 A;  2VL2 A;  2R2J A;  4YQV A;  2GTU A;  3LJR A;  3HVV A;  1F6M C;  16GS A;  1HYU A;  2C3N A;  4Z2U A;  2R37 A;  3U5R E;  4HDE A;  2H6X A;  5B6N A;  4WEY A;  2HRK A;  3IAM 2;  2F9S A;  3L0H A;  2H66 A;  5KEJ A;  2OBK A;  3QCP A;  3D22 A;  1XCC A;  3A3T A;  1TRS A;  1V98 A;  3O3T A;  2C0F A;  4MNN A;  2R0C A;  4N3Z A;  1SVL A;  2LNT A;  4ML1 A;  1EP8 A;  5FWG A;  2IIY A;  2R4V A;  4TVE A;  4IW9 A;  4PNG A;  3TRP A;  2KUC A;  2PVQ A;  2HQT A;  4IKH A;  3UBK A;  2VL3 A;  2YWN A;  2A2S A;  2VCT A;  1JFU A;  1TXX A;  5A1N B;  3UOM A;  4AF2 A;  4X4J A;  5ECH B;  3PGT A;  3P8W A;  3IC8 A;  3MNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...