4ECCA

Chimeric gst containing inserts of kininogen peptides
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
228
structure length
206
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chimeric glutathione S-transferases containing inserts of kininogen peptides: potential novel protein therapeutics.
pubmed doi rcsb
molecule keywords chimeric protein between GSHKT10 and domain 5 of kininogen-1
molecule tags Transferase, protein binding
source organism Schistosoma japonicum
total genus 71
structure length 206
sequence length 228
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4eccA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4eccA01
4GRFA 3R3EA 5A4VA 3OR5A 1JZRA 3VPTA 5DALA 3HVXA 3F3RA 1EEJA 1B4PA 4PQHA 6GSWA 1VGLA 3QFBC 2DJJA 3Q19A 1HNBA 4MH2A 16GSA 1EEMA 2OE1A 1X5DA 2YPMA 4GQFA 2VO4A 1NHOA 4EE0A 3IC8A 4ECJA 2HSYA 1AW9A 2NPBA 3GV1A 5KN3A 2FA4A 3G7IA 3FYGA 2HLSA 3HXSA 4MF6A 1TP9A 4FQUA 4N10A 2HYXA 4L0UA 5G30A 1Z7PA 1TK0B 1Z6MA 1A0RP 2CX3A 2VD0A 2C3QA 1EP7A 3LORA 3VI5A 4YQMA 4P3YB 5H5SA 1XOAA 1SL0B 1BAYA 3Q18A 3GL5A 4IKHA 2YWMA 4NMUA 5JCUA 1DSBA 2HZEA 1GTBA 1BJXA 3FR3A 2HE3A 3ZRDA 4Q5FA 2OE0A 3F63A 1ZZYA 4PTSA 4KE3A 1S3CA 2F51A 4TR4A 2H75A 3CTGA 1YKAA 5ECPB 3F4SA 3KM6A 2X8HA 1M99A 3ZIVA 3G7YA 4EDYA 4MLYA 2VM1A 5C00A 4Z7XA 2I4AA 1ERUA 3S9FA 3DVWA 2GGTA 2MZCA 4XS6A 1B9YC 1WJKA 4I5QA 1SJIA 3TRPA 2G0FA 3QPMA 2H1DA 1TU8A 1TOFA 1GULA 1GNWA 3LG6A 1EOHA 5DCGA 5AISA 4OFTA 1A8YA 3QD9A 4FH8A 2WDUA 5LCZA 2R37A 3H8QA 2RM5A 1KBNA 4J56E 1NSWA 4L0WA 1V40A 5IMZA 2PWJA 2CX4A 2HQTA 1O7UA 2H0GA 3IAS2 2GSRA 3D4MA 3WT1A 2WULA 2H1GA 1EZKA 5IOXA 1FAAA 1QQ2A 4L5OA 4MMMA 4KAEA 4TR1B 2GDRA 2HSMA 1M9AA 4D73B 2E7PA 4OO5A 2LJKA 4ECCA 3FKFA 3P90A 3IC4A 3WT2A 4BVYA 4Q5NA 1WOUA 3GKMA 3FZ9A 2HT9A 4POKA 1O6JA 4K7NA 3P7XA 5ID2A 1WMJA 5F05A 3PR8A 5FT3A 2B1KA 3CRUA 2GT6A 3LXZA 1ZOFA 1F37A 2DC5A 2WRTA 4V1Ag 1YQ1A 3GX8A 1GSSA 1PX6A 5HR2A 4NXIA 1X5EA 4TOPA 3WD6A 3ZFBA 1WE0A 2TIRA 4RQRA 2LRTA 2C4JA 1YF1A 5D9VA 5IIZA 2IFQA 3PPUA 3LXTA 2C0EA 3TJJA 1XZOA 1K0NA 3DD3A 2P5QA 4MH3A 3F8UA 5E4WA 5DQSA 2CVDA 5J9BA 4G0KA 2ZUPA 4V2NA 3G7JA 3D4TA 3GN3A 4J2FA 3MDKA 4NWYA 2X8CA 1UVZA 20GSA 5DBQA 3IBHA 5EPFA 1FO5A 4ZB9A 3TKQA 2IIYA 1R5PA 2VLUA 4BVXB 2HFDA 3ME7A 4PQIA 3FEUA 4IN0A 4EL1A 3EMXA 4XRDA 2PGTA 1QFNA 1OC9B 1PKWA 3H79A 4IP1A 3ZREA 1SYRA 4KNDA 2XBQA 4MABA 1NW2A 5CNWA 3M9JA 1K0BA 4JBBA 4HOJA 1BEDA 1BYEA 2PERA 1B8XA 1X5CA 1TKDB 4DSSA 1ZYQB 2OA7A 1K3OA 2L59A 3VI7A 4CDOA 1M2BA 1U3IA 2GSTA 2HZFA 3UJ1A 1FB6A 4ZILA 2LUSA 5B6MA 4KH7A 3L78A 2ZNMA 1YDKA 4XHMA 10GSA 6GSTA 2C8UA 4OFNA 2WS2A 5DALB 3A2WA 2LQQA 2LV3A 2YJHA 1WWJA 2MMAA 1M2AA 2MMOA 1O81A 2JZRA 1X9SB 2IL3A 1QUWA 2WJUA 4WEYA 3TJKA 5G2ZA 2DIYA 2DMMA 4GSTA 1F9MA 1QXHA 3C71A 5GZZB 1G0TA 1MDJA 2FWEA 1WRYA 4EKZA 3IV4A 2GSQA 2L4CA 3UOMA 2I81A 4EO3A 4PUAA 2L57A 3GIXA 2GQMA 2EIRA 5KN1A 1SK1A 3RBTA 2H6YA 1RK4A 3FZAA 3ISOA 3LJRA 2PUKC 4EUYA 4G2EA 3M9KA 3CXGA 5D73A 4KSOA 4J57E 4ULXA 5G5EA 3GKXA 2HZEB 2GZPA 2H72A 1B9XC 2D2ZA 2H74A 3N9JA 4HQZA 1R5AA 4IJ3A 1THXA 3PH9A 1DUGA 2ES7A 2X64A 4EXJA 4OMVA 5IOWA 3GA4A 5LD0A 5IPHA 3LEFA 2IPAA 3O76A 1OC3A 2OBKA 4FYUA 1ZCPA 1FG4A 5ELAA 2ZCTA 1ZMAA 3VWUA 4TR1A 1W4VA 2OJLA 2R3XA 4NHWA 4D73A 3W8SA 3TJBA 1K3YA 3SBCA 5FHIA 1O73A 3HKRA 4POLA 1JZDA 2VL9A 4IGJA 1Z7RA 1TK5B 2XC2A 3LSZA 1URMA 2MBSA 1PN9A 4ZBDA 3EURA 1E6BA 1TK8B 3J7Yk 1BX9A 4AJ7A 5ECKB 3ERFA 1XIYA 2VCZA 1OC8A 4CHSA 4AJ8A 3RHBA 5CP1A 4XCSA 4QL7A 4OCEA 1HD2A 1T3BA 4GSSA 3HHVA 4K2DA 4O5RA 4HEA2 1U3AA 3WYWA 2HSMB 1FHEA 3APOA 1G6WA 3QOUA 3CMIA 4BVYB 4ZBBA 1ERWA 3VWWA 4BVXA 4F2IA 1ABAA 4KCAA 3FHKA 2YZUA 4K9ZA 5ID2B 2VAFA 2WCIA 3EC3A 3DYRA 6GSUA 2B5YA 2OBIA 4IBPA 4X43A 1GL8A 4WBRD 2BJXA 1GTIA 1OKTA 4TKYA 1XWGA 1OVNA 4JU5A 3A3TA 3L9SA 3QAGA 1ON4A 4HU7A 2HXKA 3CYNA 2IFQB 2IMFA 3GUSA 4OWYA 2OACA 5CRHA 3TB2A 5C04A 1PSQA 2VCWA 2DMLA 1GUKA 4JE1A 4WR4A 4XRAA 4KW6A 1SL1B 1GLQA 5IO2A 3QDNA 2HRFA 2AB6A 3QCPA 2FCHA 3MSZA 4FO5A 3WGXA 2GT5A 4RUVA 1AQVA 3PGTA 2B5EA 1XWCA 1YF0A 3HJMA 4BWQA 4IS0A 2WZ9A 4V2MA 5G5FA 3VLNA 1TRUA 2LJRA 4HDEA 1ACVA 3TDGA 4MPFA 1EP8A 4ML6A 3TGZA 4DSSB 2VLVA 2GTUA 5ECQB 1NM3A 2VL2A 2HRAA 4TRXA 2JADA 3LFLA 1MTCA 3UL3A 4EC0A 5B8BA 4NAXA 1J08A 3KP8A 3FR9A 3MAKA 5ECNB 2FWGA 2LRNA 2AHEA 2DIZA 1V9WA 4I2UA 4CW9A 2A2SA 4G9HA 1V98A 4K0GA 4L5LA 3ZIJA 5EVOA 1T4ZA 3BCIA 1EWXA 2KHPA 4XS1A 2RM6A 4IELA 4TN8A 2YV9A 1K3LA 2H0IA 4JRRA 4GWRA 5IMVA 2CAQA 3O6TA 3O3TA 2VCVA 1NHYA 4ECBA 2PMTA 4PURA 3UVTA 4TR3A 4TXOA 5H5RA 1Q4JA 4HZ2A 4GCIA 3FW2A 2VCTA 1XW5A 2I3YA 3L9UA 1F2EA 3GSTA 3DEXA 2PN8A 4K1FA 3TCOA 1ZL9A 2L6CA 1H4OA 1FB0A 5B6NA 3SWLA 5HFKA 5ELGA 3EINA 2YCDA 1C72A 5DQYA 2KOKA 4ECIA 1JLVA 3FRCA 3F3QA 11GSA 1J0FA 5B7CA 5F06A 3TJFA 2NDOA 2Z9SA 3EU3A 2L4QA 4KA0A 1SU9A 2YJ7A 4YQVA 1AQXA 4IJIA 2RUEA 2HRNA 1PX7A 4F0BA 1M2DA 3JCML 1RW1A 2J23A 3IOSA 4I97A 2VLTA 5HFGA 3QAVA 4GXZA 2CZ3A 4XS4A 5L71A 1X9MB 4NV5A 1XWBA 3M0FA 2H1AA 3GTUA 4E8HA 3F4TA 3CSHA 2OKAA 2PVOC 3HJPA 1Y25A 1M9BA 4PNFA 3HD5A 3D5JA 5G1LA 2M46A 1A8LA 1A2LA 1JZWA 3AY8A 2LKUA 2IMEA 2B7JA 3ZYWA 4DSRA 4RI7A 3RAZA 4TW5A 3TRQA 1SYXA 1U88A 1ERTA 1RQMA 3HY2A 2KP1A 5ECHB 2C3TA 1GNEA 6GSXA 2FY6A 1VF4A 13GSA 4V1Ap 3BBYA 1WPIA 2CZ2A 2L5LA 4HZ4A 2RLIA 1Z9HA 5GAPD 2B5XA 2X99A 1N2AA 1UA5A 3ZVJD 4ZBAA 22GSA 3EVIA 5IMCA 1TRSA 3CBUA 1ILOA 2K8VA 4V2LA 4MJEA 3VPQA 3GH6A 3E0UA 4ID0A 1M7TA 3FY7A 19GSA 1SK0A 4HUAA 3M8NA 6GSSA 2DJ3A 3L4NA 3NIVA 3D22A 3TJGA 3M3MA 3KZQA 5DCHA 4O32A 1B48A 2C80A 3GKKA 1HQOA 3GURA 4G0LA 5KN0A 3UARA 1TTZA 12GSA 3IAM2 5HQPA 3APSA 5JWOB 1IYHA 1I5GA 2XPDA 2TRCP 1CQGA 4RQXA 1GP1A 2IMKA 2DBCA 4K6XA 3IPZA 2CVBA 1XPVA 3QR6A 1VF2A 2GZZA 4N30A 1A2JA 4X1UA 2IMDA 2FWHA 2NBSA 3KMNA 3IDVA 3LYKA 3EYTA 1PL1A 4OO4A 2P0GA 3A2XA 3DVXA 2V2GA 1GUMA 3UBKA 1O8XA 3KGKA 4KCEA 5EY6A 4ZIJA 4HQSA 2NTOA 2VIMA 5AIXA 3KD0A 3TKSE 3UBLA 2AV4A 4KB3A 1N8JA 1OAZA 1JHBA 4JR4A 2C1YA 1PKZA 1XOBA 4TXVA 5CRGA 1GSDA 1TU7A 1PA3A 4Q5RA 4HU9A 1EOGA 1ERVA 4WXTA 2JZTA 1XFLA 4QL9A 1HNAA 4QQ7A 1EGOA 3H4KA 2C0FA 3L9VA 2N5BA 2GQKA 1LBKA 3P8WA 3IXRA 4K7IA 3EU4A 2EIQA 3GYKA 5ENUA 3ZTLA 3G9BA 4WR5A 2FWFA 3KCMA 2O89A 4WKWA 2A2RA 2O85A 3EWLA 1T1VA 1MEKA 4HI7A 2PBJA 2J9HA 2YZHA 1ST9A 4AGSA 4NPBA 3I9V2 2FNOA 1TRVA 1R4WA 4Q5QA 1AC1A 2PPTA 4ZB8A 1ML6A 2GSSA 4BA7A 1FVKA 14GSA 1ZGNA 8GSSA 3VK9A 1J9BA 2B7KA 1O8WA 4TXOB 4I6XA 1DE1A 1LU4A 2WB9A 4I2TA 3ZL5A 1AQWA 5F07A 3HZ4A 5D9XA 1JLWA 2K18A 5B8AA 2H0HA 5DDLA 4AF2A 3GMFA 3DXBA 2YOIA 1FVJA 3P2AA 5E59A 5ECIB 3KXOA 5F0GA 3GFKA 3C1SA 3C73A 1TI1A 1KTEA 2P31A 4HJ2A 1PMTA 2H01A 5IMAA 2DSAA 1SD8A 2H73A 1SD9A 5IMDA 4MP4A 1UC7A 1CQHA 1Q98A 2LNSA 2VD1A 4K7OA 3LYPA 1GSEA 2M72A 3N5OA 4XS4B 1O85A 1THOA 2H19A 4FYBA 1H75A 3GTUB 1X9WB 2QSIA 2V41A 17GSA 1OKDA 2AYTA 1PQNA 2ALBA 2PU9C 1V58A 1XWAA 5AGYA 1JFUA 4IW9A 1Y6EA 5ECSA 3E9JB 4XIHA 1BQ7A 2JSZA 2KUCA 4KGIA 1U87A 4PNGA 3I69A 1A0FA 4ZL9A 5ECLB 1JZOA 4PX1A 1GWCA 2H8LA 4MJCA 4GF0A 2R2JA 2XHFA 4AJ6A 2QC7A 2AJQB 2AAWA 18GSA 5J9CA 4PGTA 4RI6A 5J3RA 3UAPA 5G1KA 4ML1A 3U6VA 3HYPA 2QKEA 1G7EA 2FLSA 2MMZA 5D9WA 5DJMA 2C3NA 4F03A 4BL7B 4N0ZA 1PD21 4F0CA 4KX4A 1QGVA 2YWOA 5COHA 2R4VA 3H93A 2IWTA 2O8VB 4MCUA 4K8MA 1EV4A 4FIWA 3MNGA 5GAND 1U6TA 1VF3A 1OE7A 3LWAA 1EGRA 3KH7A 1TDIA 1Z3EA 1F6MC 5D93A 1A24A 2C0DA 2FHEA 3UEMA 1USBA 3UMAA 1V57A 4F82A 5LNKe 4G0IA 4LL4B 1G6YA 2CT6A 2LRCA 3CSJA 2F8FA 3Q6OA 1K0DA 2X8GA 1XW9A 3WGDA 5GSTA 3EMPA 3ZVJA 3UIWA 3E3EA 2VOCA 5CYYA 1SK2A 2LTKA 2LSTA 5ABRA 4USSA 2P5RA 3L0HA 5D96A 3A5WA 4LMWA 2IJYA 2H76A 1UN2A 5IPGA 2LQOA 2LNTA 2RUFA 3GL3A 2YN1A 3D6IA 2A4VA 1GLPA 2VL2C 3FZ5A 1K0AA 4HJMA 2EC4A 1KEBA 1AIUA 3ED3A 3C7MA 3IRAA 3HZ8A 5EL8A 1WIKA 3D0ZA 3ERWA 3DKSA 4WF4A 2CVKA 5A4UA 4KDUA 4BPYA 3IHQA 4LL1B 1WP0A 2F8AA 4BWSA 2V6KA 1K0MA 4ZXGA 2E2MA 2H71A 4PUFC 3RPPA 5ECMB 5D9TA 4ZB6A 3KIJA 2CV4A 5D8IA 4ACSA 4FYCA 2VUPA 4F9ZA 3KTBA 2VL3A 5AIVA 2LS5A 3VURA 2JU5A 4OD7A 3TUEA 2G2QA 4G19A 3F9UA 2OE3A 2L6DA 1F3AA 6GSVA 1TI3A 5INYA 2DJ2A 2GLRA 4LMVA 2R5GA 1MDKA 1TW9A 4MK3A 1QK8A 4IP6A 3TKRA 3H1NA 3HVVA 1FOVA 4GTUA 3APQA 3TOTA 4TVEA 2H70A 3HJOA 4XTSA 1F3BA 4IQ1A 3IE3A 1QMVA 4LA1A 5IM9A 9GSSA 5F8BA 3QFAC 2JACA 2OADA 2VM2A 1B4QA 4KSMA 4GQCA 3KTLA 2YWIA 3RPNA 4IQAA 3ZITA 2FA8A 1T7PB 1VF1A 2BMXA 2I1UA 5H5QA 5JWQB 5ECRB 3MWHA 2WFCA 4MDCA 1GTUA 1VRSD 2REMA 2DLXA 3TKSA 4MF7A 3GNJA 3BOAA 3U5RE 1XVWA 4POMA 2DJKA 2GZYA 1GRXA 4TR0A 1HYUA 1S3DA 2O87A 1DBYA 4MZCA 3F0IA 3TKSC 5JCWA 2YNXA 2H6XA 4BL7A 3PINA 4JR6A 2XBIA 3F6FA 3GKNA 1W89A 2FUG2 2FD3A 3QMXA 2XPEA 1XBSA 3VWVA 1GTAA 5HR0A 5GSSA 2H66A 3DRNA 3KH9A 4PQ1A 4EDZA 1SJZA 2CAIA 3I43A 1A23A 2HI7A 3FR6A 3ME8A 2B1LA 5DAKB 2DJ1A 2GQLA 1ZYEA 2HRKA 1YKCA 3WGEA 3HVSA 5KN2A 1EV9A 3ZMLA 1MDIA 3A2VA 2E0QA 2LEGA 4WF5A 4KDXA 3KJYA 4ZL8A 3EE2A 2H30A 3DGQA 3KP9A 2WGRA 5J41A 1HNCA 2MYGA 3ZFLA 5HR3A 2JZSA 2B6MA 5ECOB 1AXDA 2N5AA 3D21A 4GLTA 4MA9A 4WETA 3HCZA 4POBA 4ZL7A 1GSFA 2HNLA 1XVQA 3DWVA 1MD3A 3BD2A 1V2AA 5IQYA 1GSQA 2FGXA 3KEBA 4WBJA 1TRWA 3CSIA 1LJRA 2V32A 3BCKA 4N0VA 1PRXA 4MZWA 1SKSB 1E2YA 1YJ6A 4N11A 3BJ5A 3V1WA 2HSHA 5JCGA 3ZLPA 4MZBA 2AUVA 4OFMA 5A5KA 1Z6NA 5CRWA 3J7Yb 2CQ9A 2N5FA 1GH2A 2LJAA 3DIEA 4X0XA 2M80A 4KF9A 1R26A 3US3A 5JWRB 3KMOA 2GS3A 1M0UA 1AUCA 1BG5A 1T4YA 2QGVA 4L8EA 3M1GA 5CREA 1YEPA 2UZ8A 2ON5A 3IK9A 3UVHA 4ISDA 2F9SA 5CAXA 2V6OA 4YH2A 4MJBA 1IYIA 4IVFA 4LLRA 2K8SA 2PVQA 3R2QA 5J5NA 1PL2A 5J4UA 1MD4A 3IR4A 2RIIA 3GRXA 4H86A 1SENA 1XCCA 4K0NA 4YAVA 1AAZA 3TKPA 4YQUA 2YV7A 4O92A 3RDWA 3ZMKA 5CO3A 4O7HA 3K8NA 1YEXA 4HS1A 2VCXA 5HFIA 2R6KA 2IMIA 5AN1A 2HSNB 1TJDA 1GSUA 1Z5YE 3ERGA 3GSSA 5IMFA 3NOFA 2H6ZA 2YP6A 1T00A 1SKRB 1A2MA 3NZNA 3C1RA 3TRXA 1SL2B 4I8BA 1YY7A 1OYJA 1S3AA 3FK8A 3RHCA 3LGCA 5G31A 2F3MA 2L5OA 1K0CA 5DJLA 1R7HA 1I9DA 3DMLA 5CRDA 2VCQA 4MPGA 1PGTA 1XW6A 4EF0A 2I9HA 1TXXA 2B3SA 1XXUA 4MF5A 3HA9A 3GX0A 2JL4A 3CTFA 1G7OA 3CRTA 5DVBA 2K6VA 4PXOA 4JZQA 4KDYA 2MBTA 3W6GA 3F4RA 4ILFA 2YANA 2K9FA 3QAWA 2DJ0A 4GSNA 6GSYA 2NVLA 5IO0A 1K0OA 3F6DA 2KLXA 3FZ4A 3VFIA 4YAPA 2IN3A 5DAKA 2GVPA 4NV2A 4KUNA 4MJAA 3W8JA 1GUHA 2H1BA 4DEJA 2V1MA 2O7KA 2JSYA 5HR1A 1OC9A 2YWNA 2ON7A 7GSSA 1GSYA 1X0RA 3HDCA 4OCFA 5A4WA 3Q74A 5BMUA 1OE8A 4NHZA 5FWGA 1SJ6A 1SKWB 3GH9A 1KNGA 4IHUA 3C8EA 4E8EA 3IK7A 4G10A 1XWKA 3I6AA 4EVMA 3GHAA 4DVCA 2EIOA 4DSQA 3TOUA 2CA8A 3LQ7A 1YZXA 2BTOT 1T8EB 2E2GA 1DE2A 2KP2A 2TRXA 2C0GA 3VWXA 2MMNA 4JEDA 3IA1A 3ZZXA 2HRKB 1FW1A 5KEJA
chains in the Genus database with same CATH superfamily
4GRFA 3R3EA 5A4VA 3OR5A 1JZRA 3VPTA 5DALA 3HVXA 3F3RA 1EEJA 1B4PA 4PQHA 6GSWA 1VGLA 3QFBC 2DJJA 3Q19A 1HNBA 4MH2A 16GSA 1EEMA 2OE1A 1X5DA 2YPMA 4GQFA 2VO4A 1NHOA 4EE0A 3IC8A 4ECJA 2O5VA 2HSYA 1AW9A 2NPBA 3GV1A 5KN3A 2FA4A 3G7IA 3FYGA 2HLSA 3HXSA 4MF6A 1TP9A 4FQUA 4N10A 2HYXA 4L0UA 5G30A 1Z7PA 1TK0B 1Z6MA 1A0RP 2CX3A 2VD0A 2C3QA 1EP7A 3LORA 3VI5A 4YQMA 4P3YB 5H5SA 1XOAA 1SL0B 1BAYA 3Q18A 3GL5A 4IKHA 2YWMA 4NMUA 5JCUA 1DSBA 2HZEA 1GTBA 3CHXC 1BJXA 3FR3A 2HE3A 3ZRDA 4Q5FA 2OE0A 3F63A 1ZZYA 4PTSA 4KE3A 1S3CA 2F51A 4TR4A 2H75A 3CTGA 1YKAA 5ECPB 3F4SA 3KM6A 2X8HA 2HSNA 1M99A 3ZIVA 3G7YA 4EDYA 4MLYA 2VM1A 5C00A 4Z7XA 2I4AA 3RGBC 1ERUA 3S9FA 3DVWA 2GGTA 2MZCA 4XS6A 1B9YC 1WJKA 4I5QA 1SJIA 3TRPA 2G0FA 3A5IA 3QPMA 2H1DA 4CY6A 1TU8A 1TOFA 1GULA 1GNWA 3LG6A 1EOHA 5DCGA 5AISA 4OFTA 1A8YA 3QD9A 4FH8A 2WDUA 5LCZA 2R37A 3H8QA 2RM5A 1KBNA 4J56E 1NSWA 4L0WA 1V40A 5IMZA 4EIQA 4Z2RA 2PWJA 2CX4A 2HQTA 1O7UA 2H0GA 3IAS2 2GSRA 3D4MA 3WT1A 2WULA 2H1GA 1EZKA 5IOXA 1FAAA 1QQ2A 4L5OA 4MMMA 4KAEA 4TR1B 4ZB7A 2GDRA 2HSMA 1ZYPA 1M9AA 4D73B 5A1NA 2WVZA 2E7PA 4OO5A 2LJKA 4ECCA 3FKFA 3P90A 3IC4A 2R0GA 3WT2A 4BVYA 4Q5NA 1WOUA 3GKMA 3FZ9A 2HT9A 4POKA 1O6JA 4K7NA 3P7XA 5ID2A 1WMJA 1S4BP 2EFHA 5F05A 3PR8A 5FT3A 2B1KA 3CRUA 2GT6A 3LXZA 2A2PA 1ZOFA 1F37A 2DC5A 2WRTA 4V1Ag 1YQ1A 3GX8A 1GSSA 1PX6A 5HR2A 4NXIA 1X5EA 4TOPA 3WD6A 3ZFBA 1WE0A 2TIRA 4RQRA 4W66A 2LRTA 2C4JA 1YF1A 5D9VA 5IIZA 2IFQA 3PPUA 3LXTA 2C0EA 3TJJA 1XZOA 1K0NA 3DD3A 2P5QA 4MH3A 3F8UA 5E4WA 5DQSA 2CVDA 5J9BA 4G0KA 2ZUPA 4V2NA 1PFOA 3G7JA 3D4TA 3GN3A 4J2FA 3MDKA 4NWYA 2X8CA 1UVZA 20GSA 5DBQA 3IBHA 5EPFA 1FO5A 4ZB9A 3TKQA 2IIYA 1R5PA 2VLUA 4BVXB 2HFDA 3ME7A 4PQIA 3FEUA 4IN0A 4EL1A 3EMXA 4XRDA 2PGTA 1QFNA 1OC9B 1PKWA 3H79A 4IP1A 3ZREA 1SYRA 4KNDA 2XBQA 4MABA 1NW2A 5CNWA 3M9JA 1K0BA 4JBBA 5BMUB 4HOJA 1BEDA 1BYEA 2PERA 1B8XA 1X5CA 1TKDB 4DSSA 1S3RA 1ZYQB 2OA7A 1K3OA 2L59A 3VI7A 4CDOA 1M2BA 1U3IA 2GSTA 2HZFA 3UJ1A 1FB6A 4ZILA 2LUSA 5B6MA 4KH7A 5J4YA 1FOHA 3L78A 2ZNMA 1YDKA 4XHMA 10GSA 6GSTA 2C8UA 4EIPA 4OFNA 2EFDA 2WS2A 5DALB 3A2WA 2LQQA 2LV3A 2YJHA 1WWJA 4AKHA 2MMAA 1M2AA 2MMOA 1O81A 1YEWC 2JZRA 1X9SB 2IL3A 1QUWA 2EFCA 2WJUA 4WEYA 3TJKA 5G2ZA 2DIYA 2DMMA 4GSTA 1F9MA 1QXHA 4ICYA 3C71A 5GZZB 1G0TA 1MDJA 2FWEA 1SVMA 1WRYA 4EKZA 3IV4A 2GSQA 2L4CA 3UOMA 2I81A 4EO3A 4PUAA 2L57A 3GIXA 2GQMA 2EIRA 5KN1A 1SK1A 3RBTA 2H6YA 1RK4A 3TU3B 3FZAA 3ISOA 3LJRA 2PUKC 4EUYA 4G2EA 3M9KA 3CXGA 5D73A 4KSOA 4J57E 4ULXA 5G5EA 4K5RA 3GKXA 2HZEB 2GZPA 2H72A 2R0CA 4GDFA 1B9XC 2D2ZA 2H74A 3N9JA 4HQZA 1R5AA 4IJ3A 1THXA 3PH9A 1DUGA 2ES7A 2X64A 4EXJA 4OMVA 5IOWA 3GA4A 5LD0A 5IPHA 3LEFA 2IPAA 3O76A 1OC3A 2OBKA 4FYUA 1ZCPA 1FG4A 5ELAA 2ZCTA 1ZMAA 3VWUA 4TR1A 1W4VA 2OJLA 1M3IA 2R3XA 4NHWA 4D73A 3W8SA 3TJBA 1K3YA 3SBCA 5FHIA 1O73A 3HKRA 4POLA 1JZDA 2VL9A 4IGJA 1Z7RA 1TK5B 2XC2A 3LSZA 1URMA 2MBSA 1PN9A 4ZBDA 3EURA 1E6BA 1TK8B 3J7Yk 1BX9A 4AJ7A 5ECKB 3CWGA 3ERFA 1XIYA 2VCZA 1OC8A 4CHSA 4AJ8A 1I1IP 4N3ZA 2UV8G 3RHBA 5CP1A 4XCSA 4QL7A 4OCEA 1HD2A 1T3BA 4GSSA 3HHVA 4K2DA 4O5RA 4HEA2 1U3AA 1Y1UA 3WYWA 2HSMB 1FHEA 3APOA 1G6WA 5A1NB 3QOUA 3CMIA 4BVYB 4ZBBA 1ERWA 3VWWA 4BVXA 4F2IA 1ABAA 4KCAA 3FHKA 2YZUA 4K9ZA 5ID2B 2VAFA 2H1LA 2WCIA 3EC3A 3DYRA 6GSUA 2B5YA 5A5HB 2OBIA 4IBPA 4X43A 1GL8A 4WBRD 2BJXA 1GTIA 1OKTA 4TKYA 1XWGA 1OVNA 4JU5A 3A3TA 3L9SA 3QAGA 1SVOA 1ON4A 4HU7A 2HXKA 3CYNA 2IFQB 2IMFA 3GUSA 4OWYA 2OACA 5CRHA 3TB2A 2DKHA 5C04A 1PSQA 2VCWA 2WW2A 2DMLA 1GUKA 4JE1A 4WR4A 5BRTA 4XRAA 4KW6A 1SL1B 1GLQA 5IO2A 3QDNA 2HRFA 2AB6A 3QCPA 2FCHA 4PHZC 3MSZA 4FO5A 3WGXA 2GT5A 4RUVA 1AQVA 3PGTA 4FXYP 2B5EA 1XWCA 1YF0A 3HJMA 4BWQA 4IS0A 2WZ9A 4V2MA 5G5FA 3VLNA 1TRUA 2LJRA 4HDEA 1ACVA 3TDGA 2WW0A 4MPFA 1EP8A 4ML6A 3TGZA 4DSSB 2VLVA 2GTUA 5ECQB 1NM3A 2VL2A 2HRAA 4TRXA 2JADA 3LFLA 1MTCA 2QA1A 3UL3A 4EC0A 5B8BA 4NAXA 1J08A 3KP8A 3FR9A 3MAKA 5ECNB 2FWGA 2LRNA 2AHEA 1XG8A 2DIZA 1V9WA 4I2UA 4CW9A 2A2SA 4G9HA 1V98A 4K0GA 4L5LA 3ZIJA 5EVOA 1T4ZA 3BCIA 1EWXA 2KHPA 4XS1A 2RM6A 4IELA 4TN8A 2YV9A 1K3LA 2H0IA 4JRRA 4GWRA 5IMVA 2CAQA 3O6TA 3O3TA 2O3EA 2VCVA 1NHYA 4ECBA 2PMTA 2R0PA 4PURA 3UVTA 4TR3A 4TXOA 5H5RA 1Q4JA 4HZ2A 2X49A 4GCIA 3FW2A 2VCTA 1XW5A 2I3YA 3L9UA 1F2EA 3GSTA 3DEXA 2PN8A 4K1FA 3TCOA 1ZL9A 2L6CA 1H4OA 1FB0A 5B6NA 3SWLA 5HFKA 5ELGA 3EINA 2YCDA 1C72A 5DQYA 2KOKA 4ECIA 1JLVA 3FRCA 3F3QA 11GSA 1J0FA 5B7CA 5F06A 3TJFA 2NDOA 2Z9SA 3EU3A 2L4QA 4KA0A 1SU9A 2YJ7A 4YQVA 1AQXA 4IJIA 2RUEA 2HRNA 1PX7A 4F0BA 1M2DA 3JCML 1RW1A 2J23A 3IOSA 4I97A 2VLTA 5HFGA 3QAVA 4GXZA 2CZ3A 4XS4A 5L71A 1X9MB 4NV5A 1XWBA 3M0FA 2H1AA 3GTUA 4E8HA 3F4TA 3CSHA 2OKAA 2PVOC 3HJPA 1Y25A 1M9BA 4PNFA 3HD5A 3D5JA 5G1LA 2M46A 1A8LA 1A2LA 1JZWA 3AY8A 2LKUA 2IMEA 2B7JA 3ZYWA 4DSRA 4RI7A 3RAZA 4TW5A 3TRQA 1SYXA 1U88A 1ERTA 1RQMA 3HY2A 2KP1A 5ECHB 5A5HA 2C3TA 3MIXA 1SVLA 1GNEA 6GSXA 2FY6A 1VF4A 13GSA 4V1Ap 3BBYA 1WPIA 2CZ2A 2L5LA 4HZ4A 2RLIA 1Z9HA 5GAPD 2B5XA 2X99A 1N2AA 1UA5A 3ZVJD 4ZBAA 22GSA 3EVIA 5IMCA 1TRSA 3CBUA 1ILOA 2K8VA 4V2LA 4MJEA 3VPQA 3GH6A 3E0UA 4ID0A 4CY8A 1M7TA 3FY7A 1M3JA 19GSA 1SK0A 4HUAA 3M8NA 6GSSA 2DJ3A 3L4NA 3NIVA 3D22A 3TJGA 3M3MA 3KZQA 4AKXB 5DCHA 4O32A 1B48A 2C80A 3GKKA 1HQOA 3GURA 4Z2TA 4G0LA 5KN0A 3UARA 1TTZA 12GSA 3IAM2 5HQPA 3APSA 5JWOB 1IYHA 1I5GA 2XPDA 2TRCP 1CQGA 4RQXA 1GP1A 2IMKA 2DBCA 4K6XA 3IPZA 2CVBA 1XPVA 3QR6A 1VF2A 2GZZA 4N30A 1A2JA 4X1UA 2IMDA 2FWHA 2NBSA 3KMNA 3IDVA 3LYKA 3EYTA 1PL1A 4OO4A 2P0GA 3A2XA 3DVXA 2V2GA 1GUMA 3UBKA 1O8XA 3KGKA 4KCEA 2EFEA 5EY6A 4ZIJA 4HQSA 2NTOA 2VIMA 5AIXA 3KD0A 3TKSE 3UBLA 2AV4A 4KB3A 1N8JA 1OAZA 1JHBA 4JR4A 2C1YA 1PKZA 1XOBA 4TXVA 5CRGA 1GSDA 1TU7A 1PA3A 4Q5RA 4HU9A 1EOGA 1ERVA 4WXTA 2JZTA 1XFLA 2DKIA 4QL9A 1HNAA 4QQ7A 1EGOA 3H4KA 2C0FA 3L9VA 2N5BA 2WVXB 2GQKA 1LBKA 3P8WA 3IXRA 2VKZG 4K7IA 3EU4A 2EIQA 3GYKA 5ENUA 3ZTLA 3G9BA 4BIKA 4WR5A 2FWFA 3KCMA 2O89A 4WKWA 2A2RA 2O85A 3EWLA 1T1VA 1MEKA 4HI7A 2PBJA 2J9HA 2YZHA 1ST9A 4AGSA 4NPBA 3I9V2 2FNOA 1TRVA 1R4WA 4Q5QA 1AC1A 2PPTA 4ZB8A 1ML6A 2GSSA 4BA7A 1FVKA 14GSA 1ZGNA 8GSSA 3VK9A 1J9BA 2B7KA 1O8WA 4TXOB 4I6XA 1DE1A 1LU4A 4YKFA 2WB9A 4I2TA 3ZL5A 1AQWA 5F07A 3HZ4A 5D9XA 1JLWA 2K18A 5B8AA 2H0HA 5DDLA 4AF2A 3GMFA 3DXBA 2YOIA 1BF5A 1FVJA 3P2AA 5E59A 5ECIB 3KXOA 5F0GA 3GFKA 2X4AA 3C1SA 3C73A 2O36A 1KTEA 1TI1A 2P31A 4HJ2A 1PMTA 2H01A 5IMAA 2DSAA 1SD8A 2H73A 1SD9A 5J40A 5IMDA 4MP4A 1UC7A 1CQHA 5KOWA 1Q98A 2LNSA 2VD1A 4K7OA 3LYPA 4QMKA 1GSEA 4PI0C 2M72A 3N5OA 4XS4B 1O85A 1THOA 2H19A 4FYBA 1H75A 3GTUB 1X9WB 2QSIA 2V41A 17GSA 1OKDA 5J47A 2AYTA 1PQNA 2ALBA 2PU9C 1V58A 1XWAA 5AGYA 1JFUA 4IW9A 1Y6EA 5ECSA 3E9JB 4XIHA 1BQ7A 2JSZA 2KUCA 4KGIA 1U87A 4PNGA 3MYDA 3I69A 1A0FA 4ZL9A 5ECLB 1JZOA 4PX1A 4MNNA 1GWCA 2H8LA 4MJCA 4GF0A 2R2JA 2XHFA 5A34A 4AJ6A 2QC7A 2AJQB 2AAWA 18GSA 5J9CA 4PGTA 4RI6A 5J3RA 3UAPA 5G1KA 4ML1A 3U6VA 3HYPA 2QKEA 1G7EA 2FLSA 2MMZA 5D9WA 5DJMA 2C3NA 4F03A 4BL7B 4N0ZA 1PD21 4F0CA 4KX4A 1QGVA 2YWOA 5COHA 2R4VA 3H93A 2IWTA 2O8VB 4MCUA 4K8MA 1EV4A 4FIWA 3MNGA 5GAND 4Z2UA 1U6TA 1VF3A 1OE7A 3LWAA 1EGRA 3KH7A 1TDIA 1Z3EA 1F6MC 5D93A 1A24A 2C0DA 2FHEA 3UEMA 1USBA 3UMAA 1V57A 4F82A 5LNKe 4G0IA 4LL4B 1G6YA 2CT6A 2LRCA 3CSJA 4X4JA 2F8FA 1TXUA 3Q6OA 1K0DA 2X8GA 1XW9A 3WGDA 5GSTA 3EMPA 3ZVJA 3UIWA 2WVXA 3E3EA 2VOCA 5CYYA 1SK2A 2LTKA 2LSTA 5ABRA 4USSA 2P5RA 3L0HA 5D96A 3A5WA 4LMWA 2IJYA 2H76A 1UN2A 5IPGA 2LQOA 2LNTA 2RUFA 3GL3A 2YN1A 3D6IA 2A4VA 1GLPA 2VL2C 3FZ5A 1K0AA 4HJMA 2EC4A 1KEBA 1AIUA 3ED3A 3C7MA 3IRAA 3HZ8A 5EL8A 1WIKA 3D0ZA 3ERWA 3DKSA 4WF4A 2CVKA 5A4UA 4KDUA 4BPYA 3IHQA 4LL1B 1WP0A 2F8AA 4BWSA 2V6KA 1K0MA 4ZXGA 2E2MA 2H71A 4PUFC 3RPPA 5ECMB 5D9TA 4ZB6A 3KIJA 2CV4A 5D8IA 4YKGA 4ACSA 4FYCA 5J4VA 2VUPA 4F9ZA 3KTBA 2VL3A 5AIVA 2LS5A 3VURA 2JU5A 4OD7A 3TUEA 2G2QA 4G19A 3F9UA 2OE3A 2L6DA 1F3AA 6GSVA 1TI3A 5INYA 2DJ2A 2GLRA 4LMVA 2R5GA 1MDKA 1TW9A 4MK3A 1QK8A 3RFRC 4IP6A 3TKRA 3H1NA 2QA2A 3HVVA 1FOVA 4GTUA 3APQA 3TOTA 4TVEA 2H70A 3HJOA 4XTSA 1F3BA 4IQ1A 3IE3A 1QMVA 4LA1A 5IM9A 9GSSA 5F8BA 3QFAC 2JACA 2OADA 2VM2A 1B4QA 4KSMA 4GQCA 3KTLA 2YWIA 3RPNA 4IQAA 3ZITA 2FA8A 2A4HA 1T7PB 1VF1A 2BMXA 2I1UA 5H5QA 5JWQB 4AI6A 5ECRB 3MWHA 2WFCA 4MDCA 1GTUA 3HMJG 1VRSD 2REMA 2DLXA 3TKSA 4MF7A 1YVLA 3BOAA 3GNJA 3U5RE 1XVWA 4POMA 2DJKA 2GZYA 2WW1A 1GRXA 4TR0A 1HYUA 1S3DA 2O87A 1DBYA 4MZCA 3F0IA 3TKSC 5JCWA 2YNXA 2H6XA 4BL7A 3PINA 4JR6A 4HSCX 2XBIA 2WVYA 3F6FA 3GKNA 1W89A 2FUG2 2FD3A 3QMXA 2XPEA 1XBSA 3VWVA 1GTAA 5HR0A 5GSSA 2H66A 3DRNA 3KH9A 4PQ1A 4EDZA 1SJZA 2CAIA 2WW3A 3I43A 1A23A 2HI7A 3FR6A 3ME8A 2B1LA 5DAKB 2DJ1A 5A34B 2GQLA 1ZYEA 2HRKA 1YKCA 3WGEA 3HVSA 5KN2A 1EV9A 3ZMLA 1MDIA 3A2VA 2E0QA 2LEGA 4WF5A 4KDXA 3KJYA 4ZL8A 3EE2A 2H30A 3DGQA 3KP9A 2WGRA 5J41A 1HNCA 2MYGA 3ZFLA 5HR3A 2JZSA 2B6MA 5ECOB 1AXDA 2N5AA 3D21A 4GLTA 4MA9A 4WETA 3HCZA 4POBA 4O5QA 4ZL7A 1GSFA 2HNLA 1XVQA 3DWVA 1MD3A 3BD2A 1V2AA 5IQYA 1GSQA 2FGXA 3KEBA 1N25A 4WBJA 1TRWA 3CSIA 4K5SA 1LJRA 2V32A 3BCKA 4N0VA 3IHGA 1PRXA 4MZWA 1SKSB 1E2YA 1YJ6A 4N11A 3BJ5A 3V1WA 3FMWA 2HSHA 5JCGA 3ZLPA 4MZBA 2AUVA 4OFMA 5A5KA 1Z6NA 5CRWA 3J7Yb 2CQ9A 2N5FA 1GH2A 2LJAA 3DIEA 4X0XA 2M80A 3HVNA 4KF9A 1R26A 3US3A 4G01A 5JWRB 3KMOA 2GS3A 4O5UA 1M0UA 1AUCA 1BG5A 1T4YA 2QGVA 4L8EA 3M1GA 5CREA 1YEPA 2UZ8A 2ON5A 3IK9A 3UVHA 4ISDA 2F9SA 5CAXA 2V6OA 4YH2A 4MJBA 1IYIA 4IVFA 4LLRA 2K8SA 2PVQA 3R2QA 5J5NA 1PL2A 5J4UA 1MD4A 3IR4A 2RIIA 3GRXA 4H86A 1SENA 1XCCA 4K0NA 4YAVA 1AAZA 3TKPA 4PI2C 4AKGA 4YQUA 2YV7A 4O92A 3RDWA 3ZMKA 5CO3A 4O7HA 3K8NA 1YEXA 4HS1A 2VCXA 5HFIA 2R6KA 2IMIA 5AN1A 2HSNB 1TJDA 1GSUA 1Z5YE 3ERGA 3GSSA 5IMFA 3NOFA 2H6ZA 2YP6A 1T00A 1SKRB 1A2MA 3NZNA 3C1RA 2WZSA 3TRXA 1SL2B 4I8BA 1YY7A 1OYJA 1S3AA 3FK8A 3RHCA 3LGCA 5G31A 3EPTA 2F3MA 2L5OA 1K0CA 5DJLA 1R7HA 1I9DA 4A5PA 3DMLA 5CRDA 2VCQA 3CQFA 4MPGA 1PGTA 1XW6A 4EF0A 2I9HA 1TXXA 2B3SA 1XXUA 4MF5A 3HA9A 3GX0A 2JL4A 3CTFA 1G7OA 3LW9A 1ZYNA 3CRTA 1BG1A 5DVBA 2K6VA 4PXOA 1PN0A 4JZQA 4KDYA 2MBTA 3W6GA 3F4RA 4ILFA 2YANA 2K9FA 3QAWA 2DJ0A 4GSNA 6GSYA 2NVLA 5IO0A 1K0OA 3F6DA 2KLXA 3FZ4A 3VFIA 4YAPA 2IN3A 5DAKA 2GVPA 4NV2A 4KUNA 4E68A 4MJAA 3W8JA 1GUHA 2H1BA 4DEJA 2V1MA 2O7KA 2JSYA 5HR1A 1OC9A 2YWNA 2ON7A 7GSSA 1GSYA 1X0RA 5KOXA 3HDCA 4OCFA 5A4WA 3Q74A 5BMUA 1OE8A 4NHZA 5FWGA 1SJ6A 1SKWB 3GH9A 1KNGA 4IHUA 3C8EA 4E8EA 4K2XA 3IK7A 4G10A 2OT3A 1XWKA 3I6AA 4EVMA 4AKIA 3GHAA 4DVCA 2EIOA 4DSQA 3TOUA 2CA8A 3LQ7A 1YZXA 2BTOT 1T8EB 2E2GA 1DE2A 2KP2A 2TRXA 2C0GA 3VWXA 2MMNA 4JEDA 3IA1A 3ZZXA 2HRKB 1FW1A 5KEJA
chains in the Genus database with same CATH topology
4GRFA 3R3EA 5A4VA 3OR5A 1JZRA 3VPTA 5DALA 3HVXA 3F3RA 1EEJA 1B4PA 4PQHA 6GSWA 1VGLA 3QFBC 2DJJA 3Q19A 1HNBA 4MH2A 16GSA 1EEMA 2OE1A 1X5DA 2YPMA 4GQFA 2VO4A 1NHOA 4EE0A 3IC8A 4ECJA 2O5VA 2HSYA 1AW9A 2NPBA 3GV1A 5KN3A 2FA4A 3G7IA 3FYGA 2HLSA 3HXSA 4MF6A 1TP9A 4FQUA 4N10A 2HYXA 4L0UA 5G30A 1Z7PA 1TK0B 1Z6MA 1A0RP 2CX3A 2VD0A 2C3QA 1EP7A 3LORA 3VI5A 4YQMA 4P3YB 5H5SA 1XOAA 1SL0B 1BAYA 3Q18A 3GL5A 4IKHA 2YWMA 4NMUA 5JCUA 1DSBA 2HZEA 1GTBA 1BJXA 3FR3A 2HE3A 3ZRDA 4Q5FA 2OE0A 3F63A 1ZZYA 4PTSA 4KE3A 1S3CA 2F51A 4TR4A 2H75A 3CTGA 1YKAA 5ECPB 3F4SA 3KM6A 2X8HA 2HSNA 1M99A 3ZIVA 3G7YA 4EDYA 4MLYA 2VM1A 5C00A 4Z7XA 2I4AA 1ERUA 3S9FA 3DVWA 2GGTA 2MZCA 4XS6A 1B9YC 1WJKA 4I5QA 1SJIA 3TRPA 2G0FA 3A5IA 3QPMA 2H1DA 4CY6A 1TU8A 1TOFA 1GULA 1GNWA 3LG6A 1EOHA 5DCGA 5AISA 4OFTA 1A8YA 3QD9A 4FH8A 2WDUA 5LCZA 2R37A 3H8QA 2RM5A 1KBNA 4J56E 1NSWA 4L0WA 1V40A 5IMZA 4EIQA 4Z2RA 2PWJA 2CX4A 2HQTA 1O7UA 2H0GA 3IAS2 2GSRA 3D4MA 3WT1A 2WULA 2H1GA 1EZKA 5IOXA 1FAAA 1QQ2A 4L5OA 4MMMA 4KAEA 4TR1B 4ZB7A 2GDRA 2HSMA 1ZYPA 1M9AA 4D73B 5A1NA 2E7PA 4OO5A 2LJKA 4ECCA 3FKFA 3P90A 3IC4A 2R0GA 3WT2A 4BVYA 4Q5NA 1WOUA 3GKMA 3FZ9A 2HT9A 4POKA 1O6JA 4K7NA 3P7XA 5ID2A 1WMJA 2EFHA 5F05A 3PR8A 5FT3A 2B1KA 3CRUA 2GT6A 3LXZA 2A2PA 1ZOFA 1F37A 2DC5A 2WRTA 4V1Ag 1YQ1A 3GX8A 1GSSA 1PX6A 5HR2A 4NXIA 1X5EA 4TOPA 3WD6A 3ZFBA 1WE0A 2TIRA 4RQRA 4W66A 2LRTA 2C4JA 1YF1A 5D9VA 5IIZA 2IFQA 3PPUA 3LXTA 2C0EA 3TJJA 1XZOA 1K0NA 3DD3A 2P5QA 4MH3A 3F8UA 5E4WA 5DQSA 2CVDA 5J9BA 4G0KA 2ZUPA 4V2NA 3G7JA 3D4TA 3GN3A 4J2FA 3MDKA 4NWYA 2X8CA 1UVZA 20GSA 5DBQA 3IBHA 5EPFA 1FO5A 4ZB9A 3TKQA 2IIYA 1R5PA 2VLUA 4BVXB 2HFDA 3ME7A 4PQIA 3FEUA 4IN0A 4EL1A 3EMXA 4XRDA 2PGTA 1QFNA 1OC9B 1PKWA 3H79A 4IP1A 3ZREA 1SYRA 4KNDA 2XBQA 4MABA 1NW2A 5CNWA 3M9JA 1K0BA 4JBBA 5BMUB 4HOJA 1BEDA 1BYEA 2PERA 1B8XA 1X5CA 1TKDB 4DSSA 1ZYQB 2OA7A 1K3OA 2L59A 3VI7A 4CDOA 1M2BA 1U3IA 2GSTA 2HZFA 3UJ1A 1FB6A 4ZILA 2LUSA 5B6MA 4KH7A 5J4YA 1FOHA 3L78A 2ZNMA 1YDKA 4XHMA 10GSA 6GSTA 2C8UA 4EIPA 4OFNA 2EFDA 2WS2A 5DALB 3A2WA 2LQQA 2LV3A 2YJHA 1WWJA 4AKHA 2MMAA 1M2AA 2MMOA 1O81A 2JZRA 1X9SB 2IL3A 1QUWA 2EFCA 2WJUA 4WEYA 3TJKA 5G2ZA 2DIYA 2DMMA 4GSTA 1F9MA 1QXHA 4ICYA 3C71A 5GZZB 1G0TA 1MDJA 2FWEA 1SVMA 1WRYA 4EKZA 3IV4A 2GSQA 2L4CA 3UOMA 2I81A 4EO3A 4PUAA 2L57A 3GIXA 2GQMA 2EIRA 5KN1A 1SK1A 3RBTA 2H6YA 1RK4A 3TU3B 3FZAA 3ISOA 3LJRA 2PUKC 4EUYA 4G2EA 3M9KA 3CXGA 5D73A 4KSOA 4J57E 4ULXA 5G5EA 4K5RA 3GKXA 2HZEB 2GZPA 2H72A 2R0CA 4GDFA 1B9XC 2D2ZA 2H74A 3N9JA 4HQZA 1R5AA 4IJ3A 1THXA 3PH9A 1DUGA 2ES7A 2X64A 4EXJA 4OMVA 5IOWA 3GA4A 5LD0A 5IPHA 3LEFA 2IPAA 3O76A 1OC3A 2OBKA 4FYUA 1ZCPA 1FG4A 5ELAA 2ZCTA 1ZMAA 3VWUA 4TR1A 1W4VA 2OJLA 2R3XA 4NHWA 4D73A 3W8SA 3TJBA 1K3YA 3SBCA 5FHIA 1O73A 3HKRA 4POLA 1JZDA 2VL9A 4IGJA 1Z7RA 1TK5B 2XC2A 3LSZA 1URMA 2MBSA 1PN9A 4ZBDA 3EURA 1E6BA 1TK8B 3J7Yk 1BX9A 4AJ7A 5ECKB 3CWGA 3ERFA 1XIYA 2VCZA 1OC8A 4CHSA 4AJ8A 4N3ZA 2UV8G 3RHBA 5CP1A 4XCSA 4QL7A 4OCEA 1HD2A 1T3BA 4GSSA 3HHVA 4K2DA 4O5RA 4HEA2 1U3AA 1Y1UA 3WYWA 2HSMB 1FHEA 3APOA 1G6WA 5A1NB 3QOUA 3CMIA 4BVYB 4ZBBA 1ERWA 3VWWA 4BVXA 4F2IA 1ABAA 4KCAA 3FHKA 2YZUA 4K9ZA 5ID2B 2VAFA 2H1LA 2WCIA 3EC3A 3DYRA 6GSUA 2B5YA 5A5HB 2OBIA 4IBPA 4X43A 1GL8A 4WBRD 2BJXA 1GTIA 1OKTA 4TKYA 1XWGA 1OVNA 4JU5A 3A3TA 3L9SA 3QAGA 1SVOA 1ON4A 4HU7A 2HXKA 3CYNA 2IFQB 2IMFA 3GUSA 4OWYA 2OACA 5CRHA 3TB2A 2DKHA 5C04A 1PSQA 2VCWA 2DMLA 1GUKA 4JE1A 4WR4A 5BRTA 4XRAA 4KW6A 1SL1B 1GLQA 5IO2A 3QDNA 2HRFA 2AB6A 3QCPA 2FCHA 3MSZA 4FO5A 3WGXA 2GT5A 4RUVA 1AQVA 3PGTA 2B5EA 1XWCA 1YF0A 3HJMA 4BWQA 4IS0A 2WZ9A 4V2MA 5G5FA 3VLNA 1TRUA 2LJRA 4HDEA 1ACVA 3TDGA 4MPFA 1EP8A 4ML6A 3TGZA 4DSSB 2VLVA 2GTUA 5ECQB 1NM3A 2VL2A 2HRAA 4TRXA 2JADA 3LFLA 1MTCA 2QA1A 3UL3A 4EC0A 5B8BA 4NAXA 1J08A 3KP8A 3FR9A 3MAKA 5ECNB 2FWGA 2LRNA 2AHEA 2DIZA 1V9WA 4I2UA 4CW9A 2A2SA 4G9HA 1V98A 4K0GA 4L5LA 3ZIJA 5EVOA 1T4ZA 3BCIA 1EWXA 2KHPA 4XS1A 2RM6A 4IELA 4TN8A 2YV9A 1K3LA 2H0IA 4JRRA 4GWRA 5IMVA 2CAQA 3O6TA 3O3TA 2VCVA 1NHYA 4ECBA 2PMTA 2R0PA 4PURA 3UVTA 4TR3A 4TXOA 5H5RA 1Q4JA 4HZ2A 2X49A 4GCIA 3FW2A 2VCTA 1XW5A 2I3YA 3L9UA 1F2EA 3GSTA 3DEXA 2PN8A 4K1FA 3TCOA 1ZL9A 2L6CA 1H4OA 1FB0A 5B6NA 3SWLA 5HFKA 5ELGA 3EINA 2YCDA 1C72A 5DQYA 2KOKA 4ECIA 1JLVA 3FRCA 3F3QA 11GSA 1J0FA 5B7CA 5F06A 3TJFA 2NDOA 2Z9SA 3EU3A 2L4QA 4KA0A 1SU9A 2YJ7A 4YQVA 1AQXA 4IJIA 2RUEA 2HRNA 1PX7A 4F0BA 1M2DA 3JCML 1RW1A 2J23A 3IOSA 4I97A 2VLTA 5HFGA 3QAVA 4GXZA 2CZ3A 4XS4A 5L71A 1X9MB 4NV5A 1XWBA 3M0FA 2H1AA 3GTUA 4E8HA 3F4TA 3CSHA 2OKAA 2PVOC 3HJPA 1Y25A 1M9BA 4PNFA 3HD5A 3D5JA 5G1LA 2M46A 1A8LA 1A2LA 1JZWA 3AY8A 2LKUA 2IMEA 2B7JA 3ZYWA 4DSRA 4RI7A 3RAZA 4TW5A 3TRQA 1SYXA 1U88A 1ERTA 1RQMA 3HY2A 2KP1A 5ECHB 5A5HA 2C3TA 3MIXA 1SVLA 1GNEA 6GSXA 2FY6A 1VF4A 13GSA 4V1Ap 3BBYA 1WPIA 2CZ2A 2L5LA 4HZ4A 2RLIA 1Z9HA 5GAPD 2B5XA 2X99A 1N2AA 1UA5A 3ZVJD 4ZBAA 22GSA 3EVIA 5IMCA 1TRSA 3CBUA 1ILOA 2K8VA 4V2LA 4MJEA 3VPQA 3GH6A 3E0UA 4ID0A 4CY8A 1M7TA 3FY7A 19GSA 1SK0A 4HUAA 3M8NA 6GSSA 2DJ3A 3L4NA 3NIVA 3D22A 3TJGA 3M3MA 3KZQA 4AKXB 5DCHA 4O32A 1B48A 2C80A 3GKKA 1HQOA 3GURA 4Z2TA 4G0LA 5KN0A 3UARA 1TTZA 12GSA 3IAM2 5HQPA 3APSA 5JWOB 1IYHA 1I5GA 2XPDA 2TRCP 1CQGA 4RQXA 1GP1A 2IMKA 2DBCA 4K6XA 3IPZA 2CVBA 1XPVA 3QR6A 1VF2A 2GZZA 4N30A 1A2JA 4X1UA 2IMDA 2FWHA 2NBSA 3KMNA 3IDVA 3LYKA 3EYTA 1PL1A 4OO4A 2P0GA 3A2XA 3DVXA 2V2GA 1GUMA 3UBKA 1O8XA 3KGKA 4KCEA 2EFEA 5EY6A 4ZIJA 4HQSA 2NTOA 2VIMA 5AIXA 3KD0A 3TKSE 3UBLA 2AV4A 4KB3A 1N8JA 1OAZA 1JHBA 4JR4A 2C1YA 1PKZA 1XOBA 4TXVA 5CRGA 1GSDA 1TU7A 1PA3A 4Q5RA 4HU9A 1EOGA 1ERVA 4WXTA 2JZTA 1XFLA 2DKIA 4QL9A 1HNAA 4QQ7A 1EGOA 3H4KA 2C0FA 3L9VA 2N5BA 2GQKA 1LBKA 3P8WA 3IXRA 2VKZG 4K7IA 3EU4A 2EIQA 3GYKA 5ENUA 3ZTLA 3G9BA 4WR5A 2FWFA 3KCMA 2O89A 4WKWA 2A2RA 2O85A 3EWLA 1T1VA 1MEKA 4HI7A 2PBJA 2J9HA 2YZHA 1ST9A 4AGSA 4NPBA 3I9V2 2FNOA 1TRVA 1R4WA 4Q5QA 1AC1A 2PPTA 4ZB8A 1ML6A 2GSSA 4BA7A 1FVKA 14GSA 1ZGNA 8GSSA 3VK9A 1J9BA 2B7KA 1O8WA 4TXOB 4I6XA 1DE1A 1LU4A 4YKFA 2WB9A 4I2TA 3ZL5A 1AQWA 5F07A 3HZ4A 5D9XA 1JLWA 2K18A 5B8AA 2H0HA 5DDLA 4AF2A 3GMFA 3DXBA 2YOIA 1BF5A 1FVJA 3P2AA 5E59A 5ECIB 3KXOA 5F0GA 3GFKA 2X4AA 3C1SA 3C73A 1TI1A 1KTEA 2P31A 4HJ2A 1PMTA 2H01A 5IMAA 2DSAA 1SD8A 2H73A 1SD9A 5J40A 5IMDA 4MP4A 1UC7A 1CQHA 5KOWA 1Q98A 2LNSA 2VD1A 4K7OA 3LYPA 4QMKA 1GSEA 2M72A 3N5OA 4XS4B 1O85A 1THOA 2H19A 4FYBA 1H75A 3GTUB 1X9WB 2QSIA 2V41A 17GSA 1OKDA 5J47A 2AYTA 1PQNA 2ALBA 2PU9C 1V58A 1XWAA 5AGYA 1JFUA 4IW9A 1Y6EA 5ECSA 3E9JB 4XIHA 1BQ7A 2JSZA 2KUCA 4KGIA 1U87A 4PNGA 3MYDA 3I69A 1A0FA 4ZL9A 5ECLB 1JZOA 4PX1A 4MNNA 1GWCA 2H8LA 4MJCA 4GF0A 2R2JA 2XHFA 5A34A 4AJ6A 2QC7A 2AJQB 2AAWA 18GSA 5J9CA 4PGTA 4RI6A 5J3RA 3UAPA 5G1KA 4ML1A 3U6VA 3HYPA 2QKEA 1G7EA 2FLSA 2MMZA 5D9WA 5DJMA 2C3NA 4F03A 4BL7B 4N0ZA 1PD21 4F0CA 4KX4A 1QGVA 2YWOA 5COHA 2R4VA 3H93A 2IWTA 2O8VB 4MCUA 4K8MA 1EV4A 4FIWA 3MNGA 5GAND 4Z2UA 1U6TA 1VF3A 1OE7A 3LWAA 1EGRA 3KH7A 1TDIA 1Z3EA 1F6MC 5D93A 1A24A 2C0DA 2FHEA 3UEMA 1USBA 3UMAA 1V57A 4F82A 5LNKe 4G0IA 4LL4B 1G6YA 2CT6A 2LRCA 3CSJA 4X4JA 2F8FA 1TXUA 3Q6OA 1K0DA 2X8GA 1XW9A 3WGDA 5GSTA 3EMPA 3ZVJA 3UIWA 3E3EA 2VOCA 5CYYA 1SK2A 2LTKA 2LSTA 5ABRA 4USSA 2P5RA 3L0HA 5D96A 3A5WA 4LMWA 2IJYA 2H76A 1UN2A 5IPGA 2LQOA 2LNTA 2RUFA 3GL3A 2YN1A 3D6IA 2A4VA 1GLPA 2VL2C 3FZ5A 1K0AA 4HJMA 2EC4A 1KEBA 1AIUA 3ED3A 3C7MA 3IRAA 3HZ8A 5EL8A 1WIKA 3D0ZA 3ERWA 3DKSA 4WF4A 2CVKA 5A4UA 4KDUA 4BPYA 3IHQA 4LL1B 1WP0A 2F8AA 4BWSA 2V6KA 1K0MA 4ZXGA 2E2MA 2H71A 4PUFC 3RPPA 5ECMB 5D9TA 4ZB6A 3KIJA 2CV4A 5D8IA 4YKGA 4ACSA 4FYCA 5J4VA 2VUPA 4F9ZA 3KTBA 2VL3A 5AIVA 2LS5A 3VURA 2JU5A 4OD7A 3TUEA 2G2QA 4G19A 3F9UA 2OE3A 2L6DA 1F3AA 6GSVA 1TI3A 5INYA 2DJ2A 2GLRA 4LMVA 2R5GA 1MDKA 1TW9A 4MK3A 1QK8A 4IP6A 3TKRA 3H1NA 2QA2A 3HVVA 1FOVA 4GTUA 3APQA 3TOTA 4TVEA 2H70A 3HJOA 4XTSA 1F3BA 4IQ1A 3IE3A 1QMVA 4LA1A 5IM9A 9GSSA 5F8BA 3QFAC 2JACA 2OADA 2VM2A 1B4QA 4KSMA 4GQCA 3KTLA 2YWIA 3RPNA 4IQAA 3ZITA 2FA8A 2A4HA 1T7PB 1VF1A 2BMXA 2I1UA 5H5QA 5JWQB 4AI6A 5ECRB 3MWHA 2WFCA 4MDCA 1GTUA 3HMJG 1VRSD 2REMA 2DLXA 3TKSA 4MF7A 1YVLA 3BOAA 3GNJA 3U5RE 1XVWA 4POMA 2DJKA 2GZYA 1GRXA 4TR0A 1HYUA 1S3DA 2O87A 1DBYA 4MZCA 3F0IA 3TKSC 5JCWA 2YNXA 2H6XA 4BL7A 3PINA 4JR6A 2XBIA 3F6FA 3GKNA 1W89A 2FUG2 2FD3A 3QMXA 2XPEA 1XBSA 3VWVA 1GTAA 5HR0A 5GSSA 2H66A 3DRNA 3KH9A 4PQ1A 4EDZA 1SJZA 2CAIA 3I43A 1A23A 2HI7A 3FR6A 3ME8A 2B1LA 5DAKB 2DJ1A 5A34B 2GQLA 1ZYEA 2HRKA 1YKCA 3WGEA 3HVSA 5KN2A 1EV9A 3ZMLA 1MDIA 3A2VA 2E0QA 2LEGA 4WF5A 4KDXA 3KJYA 4ZL8A 3EE2A 2H30A 3DGQA 3KP9A 2WGRA 5J41A 1HNCA 2MYGA 3ZFLA 5HR3A 2JZSA 2B6MA 5ECOB 1AXDA 2N5AA 3D21A 4GLTA 4MA9A 4WETA 3HCZA 4POBA 4O5QA 4ZL7A 1GSFA 2HNLA 1XVQA 3DWVA 1MD3A 3BD2A 1V2AA 5IQYA 1GSQA 2FGXA 3KEBA 1N25A 4WBJA 1TRWA 3CSIA 4K5SA 1LJRA 2V32A 3BCKA 4N0VA 3IHGA 1PRXA 4MZWA 1SKSB 1E2YA 1YJ6A 4N11A 3BJ5A 3V1WA 3FMWA 2HSHA 5JCGA 3ZLPA 4MZBA 2AUVA 4OFMA 5A5KA 1Z6NA 5CRWA 3J7Yb 2CQ9A 2N5FA 1GH2A 2LJAA 3DIEA 4X0XA 2M80A 4KF9A 1R26A 3US3A 4G01A 5JWRB 3KMOA 2GS3A 4O5UA 1M0UA 1AUCA 1BG5A 1T4YA 2QGVA 4L8EA 3M1GA 5CREA 1YEPA 2UZ8A 2ON5A 3IK9A 3UVHA 4ISDA 2F9SA 5CAXA 2V6OA 4YH2A 4MJBA 1IYIA 4IVFA 4LLRA 2K8SA 2PVQA 3R2QA 5J5NA 1PL2A 5J4UA 1MD4A 3IR4A 2RIIA 3GRXA 4H86A 1SENA 1XCCA 4K0NA 4YAVA 1AAZA 3TKPA 4AKGA 4YQUA 2YV7A 4O92A 3RDWA 3ZMKA 5CO3A 4O7HA 3K8NA 1YEXA 4HS1A 2VCXA 5HFIA 2R6KA 2IMIA 5AN1A 2HSNB 1TJDA 1GSUA 1Z5YE 3ERGA 3GSSA 5IMFA 3NOFA 2H6ZA 2YP6A 1T00A 1SKRB 1A2MA 3NZNA 3C1RA 3TRXA 1SL2B 4I8BA 1YY7A 1OYJA 1S3AA 3FK8A 3RHCA 3LGCA 5G31A 3EPTA 2F3MA 2L5OA 1K0CA 5DJLA 1R7HA 1I9DA 4A5PA 3DMLA 5CRDA 2VCQA 4MPGA 1PGTA 1XW6A 4EF0A 2I9HA 1TXXA 2B3SA 1XXUA 4MF5A 3HA9A 3GX0A 2JL4A 3CTFA 1G7OA 3LW9A 1ZYNA 3CRTA 1BG1A 5DVBA 2K6VA 4PXOA 1PN0A 4JZQA 4KDYA 2MBTA 3W6GA 3F4RA 4ILFA 2YANA 2K9FA 3QAWA 2DJ0A 4GSNA 6GSYA 2NVLA 5IO0A 1K0OA 3F6DA 2KLXA 3FZ4A 3VFIA 4YAPA 2IN3A 5DAKA 2GVPA 4NV2A 4KUNA 4E68A 4MJAA 3W8JA 1GUHA 2H1BA 4DEJA 2V1MA 2O7KA 2JSYA 5HR1A 1OC9A 2YWNA 2ON7A 7GSSA 1GSYA 1X0RA 5KOXA 3HDCA 4OCFA 5A4WA 3Q74A 5BMUA 1OE8A 4NHZA 5FWGA 1SJ6A 1SKWB 3GH9A 1KNGA 4IHUA 3C8EA 4E8EA 4K2XA 3IK7A 4G10A 2OT3A 1XWKA 3I6AA 4EVMA 4AKIA 3GHAA 4DVCA 2EIOA 4DSQA 3TOUA 2CA8A 3LQ7A 1YZXA 2BTOT 1T8EB 2E2GA 1DE2A 2KP2A 2TRXA 2C0GA 3VWXA 2MMNA 4JEDA 3IA1A 3ZZXA 2HRKB 1FW1A 5KEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GRF A;  3R3E A;  5A4V A;  3OR5 A;  1JZR A;  3VPT A;  5DAL A;  3HVX A;  3F3R A;  1EEJ A;  1B4P A;  4PQH A;  6GSW A;  1VGL A;  3QFB C;  2DJJ A;  3Q19 A;  1HNB A;  4MH2 A;  16GS A;  1EEM A;  2OE1 A;  1X5D A;  2YPM A;  4GQF A;  2VO4 A;  1NHO A;  4EE0 A;  3IC8 A;  4ECJ A;  2HSY A;  1AW9 A;  2NPB A;  3GV1 A;  5KN3 A;  2FA4 A;  3G7I A;  3FYG A;  2HLS A;  3HXS A;  4MF6 A;  1TP9 A;  4FQU A;  4N10 A;  2HYX A;  4L0U A;  5G30 A;  1Z7P A;  1TK0 B;  1Z6M A;  1A0R P;  2CX3 A;  2VD0 A;  2C3Q A;  1EP7 A;  3LOR A;  3VI5 A;  4YQM A;  4P3Y B;  5H5S A;  1XOA A;  1SL0 B;  1BAY A;  3Q18 A;  3GL5 A;  4IKH A;  2YWM A;  4NMU A;  5JCU A;  1DSB A;  2HZE A;  1GTB A;  1BJX A;  3FR3 A;  2HE3 A;  3ZRD A;  4Q5F A;  2OE0 A;  3F63 A;  1ZZY A;  4PTS A;  4KE3 A;  1S3C A;  2F51 A;  4TR4 A;  2H75 A;  3CTG A;  1YKA A;  5ECP B;  3F4S A;  3KM6 A;  2X8H A;  1M99 A;  3ZIV A;  3G7Y A;  4EDY A;  4MLY A;  2VM1 A;  5C00 A;  4Z7X A;  2I4A A;  1ERU A;  3S9F A;  3DVW A;  2GGT A;  2MZC A;  4XS6 A;  1B9Y C;  1WJK A;  4I5Q A;  1SJI A;  3TRP A;  2G0F A;  3QPM A;  2H1D A;  1TU8 A;  1TOF A;  1GUL A;  1GNW A;  3LG6 A;  1EOH A;  5DCG A;  5AIS A;  4OFT A;  1A8Y A;  3QD9 A;  4FH8 A;  2WDU A;  5LCZ A;  2R37 A;  3H8Q A;  2RM5 A;  1KBN A;  4J56 E;  1NSW A;  4L0W A;  1V40 A;  5IMZ A;  2PWJ A;  2CX4 A;  2HQT A;  1O7U A;  2H0G A;  3IAS 2;  2GSR A;  3D4M A;  3WT1 A;  2WUL A;  2H1G A;  1EZK A;  5IOX A;  1FAA A;  1QQ2 A;  4L5O A;  4MMM A;  4KAE A;  4TR1 B;  2GDR A;  2HSM A;  1M9A A;  4D73 B;  2E7P A;  4OO5 A;  2LJK A;  4ECC A;  3FKF A;  3P90 A;  3IC4 A;  3WT2 A;  4BVY A;  4Q5N A;  1WOU A;  3GKM A;  3FZ9 A;  2HT9 A;  4POK A;  1O6J A;  4K7N A;  3P7X A;  5ID2 A;  1WMJ A;  5F05 A;  3PR8 A;  5FT3 A;  2B1K A;  3CRU A;  2GT6 A;  3LXZ A;  1ZOF A;  1F37 A;  2DC5 A;  2WRT A;  4V1A g;  1YQ1 A;  3GX8 A;  1GSS A;  1PX6 A;  5HR2 A;  4NXI A;  1X5E A;  4TOP A;  3WD6 A;  3ZFB A;  1WE0 A;  2TIR A;  4RQR A;  2LRT A;  2C4J A;  1YF1 A;  5D9V A;  5IIZ A;  2IFQ A;  3PPU A;  3LXT A;  2C0E A;  3TJJ A;  1XZO A;  1K0N A;  3DD3 A;  2P5Q A;  4MH3 A;  3F8U A;  5E4W A;  5DQS A;  2CVD A;  5J9B A;  4G0K A;  2ZUP A;  4V2N A;  3G7J A;  3D4T A;  3GN3 A;  4J2F A;  3MDK A;  4NWY A;  2X8C A;  1UVZ A;  20GS A;  5DBQ A;  3IBH A;  5EPF A;  1FO5 A;  4ZB9 A;  3TKQ A;  2IIY A;  1R5P A;  2VLU A;  4BVX B;  2HFD A;  3ME7 A;  4PQI A;  3FEU A;  4IN0 A;  4EL1 A;  3EMX A;  4XRD A;  2PGT A;  1QFN A;  1OC9 B;  1PKW A;  3H79 A;  4IP1 A;  3ZRE A;  1SYR A;  4KND A;  2XBQ A;  4MAB A;  1NW2 A;  5CNW A;  3M9J A;  1K0B A;  4JBB A;  4HOJ A;  1BED A;  1BYE A;  2PER A;  1B8X A;  1X5C A;  1TKD B;  4DSS A;  1ZYQ B;  2OA7 A;  1K3O A;  2L59 A;  3VI7 A;  4CDO A;  1M2B A;  1U3I A;  2GST A;  2HZF A;  3UJ1 A;  1FB6 A;  4ZIL A;  2LUS A;  5B6M A;  4KH7 A;  3L78 A;  2ZNM A;  1YDK A;  4XHM A;  10GS A;  6GST A;  2C8U A;  4OFN A;  2WS2 A;  5DAL B;  3A2W A;  2LQQ A;  2LV3 A;  2YJH A;  1WWJ A;  2MMA A;  1M2A A;  2MMO A;  1O81 A;  2JZR A;  1X9S B;  2IL3 A;  1QUW A;  2WJU A;  4WEY A;  3TJK A;  5G2Z A;  2DIY A;  2DMM A;  4GST A;  1F9M A;  1QXH A;  3C71 A;  5GZZ B;  1G0T A;  1MDJ A;  2FWE A;  1WRY A;  4EKZ A;  3IV4 A;  2GSQ A;  2L4C A;  3UOM A;  2I81 A;  4EO3 A;  4PUA A;  2L57 A;  3GIX A;  2GQM A;  2EIR A;  5KN1 A;  1SK1 A;  3RBT A;  2H6Y A;  1RK4 A;  3FZA A;  3ISO A;  3LJR A;  2PUK C;  4EUY A;  4G2E A;  3M9K A;  3CXG A;  5D73 A;  4KSO A;  4J57 E;  4ULX A;  5G5E A;  3GKX A;  2HZE B;  2GZP A;  2H72 A;  1B9X C;  2D2Z A;  2H74 A;  3N9J A;  4HQZ A;  1R5A A;  4IJ3 A;  1THX A;  3PH9 A;  1DUG A;  2ES7 A;  2X64 A;  4EXJ A;  4OMV A;  5IOW A;  3GA4 A;  5LD0 A;  5IPH A;  3LEF A;  2IPA A;  3O76 A;  1OC3 A;  2OBK A;  4FYU A;  1ZCP A;  1FG4 A;  5ELA A;  2ZCT A;  1ZMA A;  3VWU A;  4TR1 A;  1W4V A;  2OJL A;  2R3X A;  4NHW A;  4D73 A;  3W8S A;  3TJB A;  1K3Y A;  3SBC A;  5FHI A;  1O73 A;  3HKR A;  4POL A;  1JZD A;  2VL9 A;  4IGJ A;  1Z7R A;  1TK5 B;  2XC2 A;  3LSZ A;  1URM A;  2MBS A;  1PN9 A;  4ZBD A;  3EUR A;  1E6B A;  1TK8 B;  3J7Y k;  1BX9 A;  4AJ7 A;  5ECK B;  3ERF A;  1XIY A;  2VCZ A;  1OC8 A;  4CHS A;  4AJ8 A;  3RHB A;  5CP1 A;  4XCS A;  4QL7 A;  4OCE A;  1HD2 A;  1T3B A;  4GSS A;  3HHV A;  4K2D A;  4O5R A;  4HEA 2;  1U3A A;  3WYW A;  2HSM B;  1FHE A;  3APO A;  1G6W A;  3QOU A;  3CMI A;  4BVY B;  4ZBB A;  1ERW A;  3VWW A;  4BVX A;  4F2I A;  1ABA A;  4KCA A;  3FHK A;  2YZU A;  4K9Z A;  5ID2 B;  2VAF A;  2WCI A;  3EC3 A;  3DYR A;  6GSU A;  2B5Y A;  2OBI A;  4IBP A;  4X43 A;  1GL8 A;  4WBR D;  2BJX A;  1GTI A;  1OKT A;  4TKY A;  1XWG A;  1OVN A;  4JU5 A;  3A3T A;  3L9S A;  3QAG A;  1ON4 A;  4HU7 A;  2HXK A;  3CYN A;  2IFQ B;  2IMF A;  3GUS A;  4OWY A;  2OAC A;  5CRH A;  3TB2 A;  5C04 A;  1PSQ A;  2VCW A;  2DML A;  1GUK A;  4JE1 A;  4WR4 A;  4XRA A;  4KW6 A;  1SL1 B;  1GLQ A;  5IO2 A;  3QDN A;  2HRF A;  2AB6 A;  3QCP A;  2FCH A;  3MSZ A;  4FO5 A;  3WGX A;  2GT5 A;  4RUV A;  1AQV A;  3PGT A;  2B5E A;  1XWC A;  1YF0 A;  3HJM A;  4BWQ A;  4IS0 A;  2WZ9 A;  4V2M A;  5G5F A;  3VLN A;  1TRU A;  2LJR A;  4HDE A;  1ACV A;  3TDG A;  4MPF A;  1EP8 A;  4ML6 A;  3TGZ A;  4DSS B;  2VLV A;  2GTU A;  5ECQ B;  1NM3 A;  2VL2 A;  2HRA A;  4TRX A;  2JAD A;  3LFL A;  1MTC A;  3UL3 A;  4EC0 A;  5B8B A;  4NAX A;  1J08 A;  3KP8 A;  3FR9 A;  3MAK A;  5ECN B;  2FWG A;  2LRN A;  2AHE A;  2DIZ A;  1V9W A;  4I2U A;  4CW9 A;  2A2S A;  4G9H A;  1V98 A;  4K0G A;  4L5L A;  3ZIJ A;  5EVO A;  1T4Z A;  3BCI A;  1EWX A;  2KHP A;  4XS1 A;  2RM6 A;  4IEL A;  4TN8 A;  2YV9 A;  1K3L A;  2H0I A;  4JRR A;  4GWR A;  5IMV A;  2CAQ A;  3O6T A;  3O3T A;  2VCV A;  1NHY A;  4ECB A;  2PMT A;  4PUR A;  3UVT A;  4TR3 A;  4TXO A;  5H5R A;  1Q4J A;  4HZ2 A;  4GCI A;  3FW2 A;  2VCT A;  1XW5 A;  2I3Y A;  3L9U A;  1F2E A;  3GST A;  3DEX A;  2PN8 A;  4K1F A;  3TCO A;  1ZL9 A;  2L6C A;  1H4O A;  1FB0 A;  5B6N A;  3SWL A;  5HFK A;  5ELG A;  3EIN A;  2YCD A;  1C72 A;  5DQY A;  2KOK A;  4ECI A;  1JLV A;  3FRC A;  3F3Q A;  11GS A;  1J0F A;  5B7C A;  5F06 A;  3TJF A;  2NDO A;  2Z9S A;  3EU3 A;  2L4Q A;  4KA0 A;  1SU9 A;  2YJ7 A;  4YQV A;  1AQX A;  4IJI A;  2RUE A;  2HRN A;  1PX7 A;  4F0B A;  1M2D A;  3JCM L;  1RW1 A;  2J23 A;  3IOS A;  4I97 A;  2VLT A;  5HFG A;  3QAV A;  4GXZ A;  2CZ3 A;  4XS4 A;  5L71 A;  1X9M B;  4NV5 A;  1XWB A;  3M0F A;  2H1A A;  3GTU A;  4E8H A;  3F4T A;  3CSH A;  2OKA A;  2PVO C;  3HJP A;  1Y25 A;  1M9B A;  4PNF A;  3HD5 A;  3D5J A;  5G1L A;  2M46 A;  1A8L A;  1A2L A;  1JZW A;  3AY8 A;  2LKU A;  2IME A;  2B7J A;  3ZYW A;  4DSR A;  4RI7 A;  3RAZ A;  4TW5 A;  3TRQ A;  1SYX A;  1U88 A;  1ERT A;  1RQM A;  3HY2 A;  2KP1 A;  5ECH B;  2C3T A;  1GNE A;  6GSX A;  2FY6 A;  1VF4 A;  13GS A;  4V1A p;  3BBY A;  1WPI A;  2CZ2 A;  2L5L A;  4HZ4 A;  2RLI A;  1Z9H A;  5GAP D;  2B5X A;  2X99 A;  1N2A A;  1UA5 A;  3ZVJ D;  4ZBA A;  22GS A;  3EVI A;  5IMC A;  1TRS A;  3CBU A;  1ILO A;  2K8V A;  4V2L A;  4MJE A;  3VPQ A;  3GH6 A;  3E0U A;  4ID0 A;  1M7T A;  3FY7 A;  19GS A;  1SK0 A;  4HUA A;  3M8N A;  6GSS A;  2DJ3 A;  3L4N A;  3NIV A;  3D22 A;  3TJG A;  3M3M A;  3KZQ A;  5DCH A;  4O32 A;  1B48 A;  2C80 A;  3GKK A;  1HQO A;  3GUR A;  4G0L A;  5KN0 A;  3UAR A;  1TTZ A;  12GS A;  3IAM 2;  5HQP A;  3APS A;  5JWO B;  1IYH A;  1I5G A;  2XPD A;  2TRC P;  1CQG A;  4RQX A;  1GP1 A;  2IMK A;  2DBC A;  4K6X A;  3IPZ A;  2CVB A;  1XPV A;  3QR6 A;  1VF2 A;  2GZZ A;  4N30 A;  1A2J A;  4X1U A;  2IMD A;  2FWH A;  2NBS A;  3KMN A;  3IDV A;  3LYK A;  3EYT A;  1PL1 A;  4OO4 A;  2P0G A;  3A2X A;  3DVX A;  2V2G A;  1GUM A;  3UBK A;  1O8X A;  3KGK A;  4KCE A;  5EY6 A;  4ZIJ A;  4HQS A;  2NTO A;  2VIM A;  5AIX A;  3KD0 A;  3TKS E;  3UBL A;  2AV4 A;  4KB3 A;  1N8J A;  1OAZ A;  1JHB A;  4JR4 A;  2C1Y A;  1PKZ A;  1XOB A;  4TXV A;  5CRG A;  1GSD A;  1TU7 A;  1PA3 A;  4Q5R A;  4HU9 A;  1EOG A;  1ERV A;  4WXT A;  2JZT A;  1XFL A;  4QL9 A;  1HNA A;  4QQ7 A;  1EGO A;  3H4K A;  2C0F A;  3L9V A;  2N5B A;  2GQK A;  1LBK A;  3P8W A;  3IXR A;  4K7I A;  3EU4 A;  2EIQ A;  3GYK A;  5ENU A;  3ZTL A;  3G9B A;  4WR5 A;  2FWF A;  3KCM A;  2O89 A;  4WKW A;  2A2R A;  2O85 A;  3EWL A;  1T1V A;  1MEK A;  4HI7 A;  2PBJ A;  2J9H A;  2YZH A;  1ST9 A;  4AGS A;  4NPB A;  3I9V 2;  2FNO A;  1TRV A;  1R4W A;  4Q5Q A;  1AC1 A;  2PPT A;  4ZB8 A;  1ML6 A;  2GSS A;  4BA7 A;  1FVK A;  14GS A;  1ZGN A;  8GSS A;  3VK9 A;  1J9B A;  2B7K A;  1O8W A;  4TXO B;  4I6X A;  1DE1 A;  1LU4 A;  2WB9 A;  4I2T A;  3ZL5 A;  1AQW A;  5F07 A;  3HZ4 A;  5D9X A;  1JLW A;  2K18 A;  5B8A A;  2H0H A;  5DDL A;  4AF2 A;  3GMF A;  3DXB A;  2YOI A;  1FVJ A;  3P2A A;  5E59 A;  5ECI B;  3KXO A;  5F0G A;  3GFK A;  3C1S A;  3C73 A;  1TI1 A;  1KTE A;  2P31 A;  4HJ2 A;  1PMT A;  2H01 A;  5IMA A;  2DSA A;  1SD8 A;  2H73 A;  1SD9 A;  5IMD A;  4MP4 A;  1UC7 A;  1CQH A;  1Q98 A;  2LNS A;  2VD1 A;  4K7O A;  3LYP A;  1GSE A;  2M72 A;  3N5O A;  4XS4 B;  1O85 A;  1THO A;  2H19 A;  4FYB A;  1H75 A;  3GTU B;  1X9W B;  2QSI A;  2V41 A;  17GS A;  1OKD A;  2AYT A;  1PQN A;  2ALB A;  2PU9 C;  1V58 A;  1XWA A;  5AGY A;  1JFU A;  4IW9 A;  1Y6E A;  5ECS A;  3E9J B;  4XIH A;  1BQ7 A;  2JSZ A;  2KUC A;  4KGI A;  1U87 A;  4PNG A;  3I69 A;  1A0F A;  4ZL9 A;  5ECL B;  1JZO A;  4PX1 A;  1GWC A;  2H8L A;  4MJC A;  4GF0 A;  2R2J A;  2XHF A;  4AJ6 A;  2QC7 A;  2AJQ B;  2AAW A;  18GS A;  5J9C A;  4PGT A;  4RI6 A;  5J3R A;  3UAP A;  5G1K A;  4ML1 A;  3U6V A;  3HYP A;  2QKE A;  1G7E A;  2FLS A;  2MMZ A;  5D9W A;  5DJM A;  2C3N A;  4F03 A;  4BL7 B;  4N0Z A;  1PD2 1;  4F0C A;  4KX4 A;  1QGV A;  2YWO A;  5COH A;  2R4V A;  3H93 A;  2IWT A;  2O8V B;  4MCU A;  4K8M A;  1EV4 A;  4FIW A;  3MNG A;  5GAN D;  1U6T A;  1VF3 A;  1OE7 A;  3LWA A;  1EGR A;  3KH7 A;  1TDI A;  1Z3E A;  1F6M C;  5D93 A;  1A24 A;  2C0D A;  2FHE A;  3UEM A;  1USB A;  3UMA A;  1V57 A;  4F82 A;  5LNK e;  4G0I A;  4LL4 B;  1G6Y A;  2CT6 A;  2LRC A;  3CSJ A;  2F8F A;  3Q6O A;  1K0D A;  2X8G A;  1XW9 A;  3WGD A;  5GST A;  3EMP A;  3ZVJ A;  3UIW A;  3E3E A;  2VOC A;  5CYY A;  1SK2 A;  2LTK A;  2LST A;  5ABR A;  4USS A;  2P5R A;  3L0H A;  5D96 A;  3A5W A;  4LMW A;  2IJY A;  2H76 A;  1UN2 A;  5IPG A;  2LQO A;  2LNT A;  2RUF A;  3GL3 A;  2YN1 A;  3D6I A;  2A4V A;  1GLP A;  2VL2 C;  3FZ5 A;  1K0A A;  4HJM A;  2EC4 A;  1KEB A;  1AIU A;  3ED3 A;  3C7M A;  3IRA A;  3HZ8 A;  5EL8 A;  1WIK A;  3D0Z A;  3ERW A;  3DKS A;  4WF4 A;  2CVK A;  5A4U A;  4KDU A;  4BPY A;  3IHQ A;  4LL1 B;  1WP0 A;  2F8A A;  4BWS A;  2V6K A;  1K0M A;  4ZXG A;  2E2M A;  2H71 A;  4PUF C;  3RPP A;  5ECM B;  5D9T A;  4ZB6 A;  3KIJ A;  2CV4 A;  5D8I A;  4ACS A;  4FYC A;  2VUP A;  4F9Z A;  3KTB A;  2VL3 A;  5AIV A;  2LS5 A;  3VUR A;  2JU5 A;  4OD7 A;  3TUE A;  2G2Q A;  4G19 A;  3F9U A;  2OE3 A;  2L6D A;  1F3A A;  6GSV A;  1TI3 A;  5INY A;  2DJ2 A;  2GLR A;  4LMV A;  2R5G A;  1MDK A;  1TW9 A;  4MK3 A;  1QK8 A;  4IP6 A;  3TKR A;  3H1N A;  3HVV A;  1FOV A;  4GTU A;  3APQ A;  3TOT A;  4TVE A;  2H70 A;  3HJO A;  4XTS A;  1F3B A;  4IQ1 A;  3IE3 A;  1QMV A;  4LA1 A;  5IM9 A;  9GSS A;  5F8B A;  3QFA C;  2JAC A;  2OAD A;  2VM2 A;  1B4Q A;  4KSM A;  4GQC A;  3KTL A;  2YWI A;  3RPN A;  4IQA A;  3ZIT A;  2FA8 A;  1T7P B;  1VF1 A;  2BMX A;  2I1U A;  5H5Q A;  5JWQ B;  5ECR B;  3MWH A;  2WFC A;  4MDC A;  1GTU A;  1VRS D;  2REM A;  2DLX A;  3TKS A;  4MF7 A;  3GNJ A;  3BOA A;  3U5R E;  1XVW A;  4POM A;  2DJK A;  2GZY A;  1GRX A;  4TR0 A;  1HYU A;  1S3D A;  2O87 A;  1DBY A;  4MZC A;  3F0I A;  3TKS C;  5JCW A;  2YNX A;  2H6X A;  4BL7 A;  3PIN A;  4JR6 A;  2XBI A;  3F6F A;  3GKN A;  1W89 A;  2FUG 2;  2FD3 A;  3QMX A;  2XPE A;  1XBS A;  3VWV A;  1GTA A;  5HR0 A;  5GSS A;  2H66 A;  3DRN A;  3KH9 A;  4PQ1 A;  4EDZ A;  1SJZ A;  2CAI A;  3I43 A;  1A23 A;  2HI7 A;  3FR6 A;  3ME8 A;  2B1L A;  5DAK B;  2DJ1 A;  2GQL A;  1ZYE A;  2HRK A;  1YKC A;  3WGE A;  3HVS A;  5KN2 A;  1EV9 A;  3ZML A;  1MDI A;  3A2V A;  2E0Q A;  2LEG A;  4WF5 A;  4KDX A;  3KJY A;  4ZL8 A;  3EE2 A;  2H30 A;  3DGQ A;  3KP9 A;  2WGR A;  5J41 A;  1HNC A;  2MYG A;  3ZFL A;  5HR3 A;  2JZS A;  2B6M A;  5ECO B;  1AXD A;  2N5A A;  3D21 A;  4GLT A;  4MA9 A;  4WET A;  3HCZ A;  4POB A;  4ZL7 A;  1GSF A;  2HNL A;  1XVQ A;  3DWV A;  1MD3 A;  3BD2 A;  1V2A A;  5IQY A;  1GSQ A;  2FGX A;  3KEB A;  4WBJ A;  1TRW A;  3CSI A;  1LJR A;  2V32 A;  3BCK A;  4N0V A;  1PRX A;  4MZW A;  1SKS B;  1E2Y A;  1YJ6 A;  4N11 A;  3BJ5 A;  3V1W A;  2HSH A;  5JCG A;  3ZLP A;  4MZB A;  2AUV A;  4OFM A;  5A5K A;  1Z6N A;  5CRW A;  3J7Y b;  2CQ9 A;  2N5F A;  1GH2 A;  2LJA A;  3DIE A;  4X0X A;  2M80 A;  4KF9 A;  1R26 A;  3US3 A;  5JWR B;  3KMO A;  2GS3 A;  1M0U A;  1AUC A;  1BG5 A;  1T4Y A;  2QGV A;  4L8E A;  3M1G A;  5CRE A;  1YEP A;  2UZ8 A;  2ON5 A;  3IK9 A;  3UVH A;  4ISD A;  2F9S A;  5CAX A;  2V6O A;  4YH2 A;  4MJB A;  1IYI A;  4IVF A;  4LLR A;  2K8S A;  2PVQ A;  3R2Q A;  5J5N A;  1PL2 A;  5J4U A;  1MD4 A;  3IR4 A;  2RII A;  3GRX A;  4H86 A;  1SEN A;  1XCC A;  4K0N A;  4YAV A;  1AAZ A;  3TKP A;  4YQU A;  2YV7 A;  4O92 A;  3RDW A;  3ZMK A;  5CO3 A;  4O7H A;  3K8N A;  1YEX A;  4HS1 A;  2VCX A;  5HFI A;  2R6K A;  2IMI A;  5AN1 A;  2HSN B;  1TJD A;  1GSU A;  1Z5Y E;  3ERG A;  3GSS A;  5IMF A;  3NOF A;  2H6Z A;  2YP6 A;  1T00 A;  1SKR B;  1A2M A;  3NZN A;  3C1R A;  3TRX A;  1SL2 B;  4I8B A;  1YY7 A;  1OYJ A;  1S3A A;  3FK8 A;  3RHC A;  3LGC A;  5G31 A;  2F3M A;  2L5O A;  1K0C A;  5DJL A;  1R7H A;  1I9D A;  3DML A;  5CRD A;  2VCQ A;  4MPG A;  1PGT A;  1XW6 A;  4EF0 A;  2I9H A;  1TXX A;  2B3S A;  1XXU A;  4MF5 A;  3HA9 A;  3GX0 A;  2JL4 A;  3CTF A;  1G7O A;  3CRT A;  5DVB A;  2K6V A;  4PXO A;  4JZQ A;  4KDY A;  2MBT A;  3W6G A;  3F4R A;  4ILF A;  2YAN A;  2K9F A;  3QAW A;  2DJ0 A;  4GSN A;  6GSY A;  2NVL A;  5IO0 A;  1K0O A;  3F6D A;  2KLX A;  3FZ4 A;  3VFI A;  4YAP A;  2IN3 A;  5DAK A;  2GVP A;  4NV2 A;  4KUN A;  4MJA A;  3W8J A;  1GUH A;  2H1B A;  4DEJ A;  2V1M A;  2O7K A;  2JSY A;  5HR1 A;  1OC9 A;  2YWN A;  2ON7 A;  7GSS A;  1GSY A;  1X0R A;  3HDC A;  4OCF A;  5A4W A;  3Q74 A;  5BMU A;  1OE8 A;  4NHZ A;  5FWG A;  1SJ6 A;  1SKW B;  3GH9 A;  1KNG A;  4IHU A;  3C8E A;  4E8E A;  3IK7 A;  4G10 A;  1XWK A;  3I6A A;  4EVM A;  3GHA A;  4DVC A;  2EIO A;  4DSQ A;  3TOU A;  2CA8 A;  3LQ7 A;  1YZX A;  2BTO T;  1T8E B;  2E2G A;  1DE2 A;  2KP2 A;  2TRX A;  2C0G A;  3VWX A;  2MMN A;  4JED A;  3IA1 A;  3ZZX A;  2HRK B;  1FW1 A;  5KEJ A; 
#chains in the Genus database with same CATH topology
 4GRF A;  3R3E A;  5A4V A;  3OR5 A;  1JZR A;  3VPT A;  5DAL A;  3HVX A;  3F3R A;  1EEJ A;  1B4P A;  4PQH A;  6GSW A;  1VGL A;  3QFB C;  2DJJ A;  3Q19 A;  1HNB A;  4MH2 A;  16GS A;  1EEM A;  2OE1 A;  1X5D A;  2YPM A;  4GQF A;  2VO4 A;  1NHO A;  4EE0 A;  3IC8 A;  4ECJ A;  2O5V A;  2HSY A;  1AW9 A;  2NPB A;  3GV1 A;  5KN3 A;  2FA4 A;  3G7I A;  3FYG A;  2HLS A;  3HXS A;  4MF6 A;  1TP9 A;  4FQU A;  4N10 A;  2HYX A;  4L0U A;  5G30 A;  1Z7P A;  1TK0 B;  1Z6M A;  1A0R P;  2CX3 A;  2VD0 A;  2C3Q A;  1EP7 A;  3LOR A;  3VI5 A;  4YQM A;  4P3Y B;  5H5S A;  1XOA A;  1SL0 B;  1BAY A;  3Q18 A;  3GL5 A;  4IKH A;  2YWM A;  4NMU A;  5JCU A;  1DSB A;  2HZE A;  1GTB A;  3CHX C;  1BJX A;  3FR3 A;  2HE3 A;  3ZRD A;  4Q5F A;  2OE0 A;  3F63 A;  1ZZY A;  4PTS A;  4KE3 A;  1S3C A;  2F51 A;  4TR4 A;  2H75 A;  3CTG A;  1YKA A;  5ECP B;  3F4S A;  3KM6 A;  2X8H A;  2HSN A;  1M99 A;  3ZIV A;  3G7Y A;  4EDY A;  4MLY A;  2VM1 A;  5C00 A;  4Z7X A;  2I4A A;  3RGB C;  1ERU A;  3S9F A;  3DVW A;  2GGT A;  2MZC A;  4XS6 A;  1B9Y C;  1WJK A;  4I5Q A;  1SJI A;  3TRP A;  2G0F A;  3A5I A;  3QPM A;  2H1D A;  4CY6 A;  1TU8 A;  1TOF A;  1GUL A;  1GNW A;  3LG6 A;  1EOH A;  5DCG A;  5AIS A;  4OFT A;  1A8Y A;  3QD9 A;  4FH8 A;  2WDU A;  5LCZ A;  2R37 A;  3H8Q A;  2RM5 A;  1KBN A;  4J56 E;  1NSW A;  4L0W A;  1V40 A;  5IMZ A;  4EIQ A;  4Z2R A;  2PWJ A;  2CX4 A;  2HQT A;  1O7U A;  2H0G A;  3IAS 2;  2GSR A;  3D4M A;  3WT1 A;  2WUL A;  2H1G A;  1EZK A;  5IOX A;  1FAA A;  1QQ2 A;  4L5O A;  4MMM A;  4KAE A;  4TR1 B;  4ZB7 A;  2GDR A;  2HSM A;  1ZYP A;  1M9A A;  4D73 B;  5A1N A;  2WVZ A;  2E7P A;  4OO5 A;  2LJK A;  4ECC A;  3FKF A;  3P90 A;  3IC4 A;  2R0G A;  3WT2 A;  4BVY A;  4Q5N A;  1WOU A;  3GKM A;  3FZ9 A;  2HT9 A;  4POK A;  1O6J A;  4K7N A;  3P7X A;  5ID2 A;  1WMJ A;  1S4B P;  2EFH A;  5F05 A;  3PR8 A;  5FT3 A;  2B1K A;  3CRU A;  2GT6 A;  3LXZ A;  2A2P A;  1ZOF A;  1F37 A;  2DC5 A;  2WRT A;  4V1A g;  1YQ1 A;  3GX8 A;  1GSS A;  1PX6 A;  5HR2 A;  4NXI A;  1X5E A;  4TOP A;  3WD6 A;  3ZFB A;  1WE0 A;  2TIR A;  4RQR A;  4W66 A;  2LRT A;  2C4J A;  1YF1 A;  5D9V A;  5IIZ A;  2IFQ A;  3PPU A;  3LXT A;  2C0E A;  3TJJ A;  1XZO A;  1K0N A;  3DD3 A;  2P5Q A;  4MH3 A;  3F8U A;  5E4W A;  5DQS A;  2CVD A;  5J9B A;  4G0K A;  2ZUP A;  4V2N A;  1PFO A;  3G7J A;  3D4T A;  3GN3 A;  4J2F A;  3MDK A;  4NWY A;  2X8C A;  1UVZ A;  20GS A;  5DBQ A;  3IBH A;  5EPF A;  1FO5 A;  4ZB9 A;  3TKQ A;  2IIY A;  1R5P A;  2VLU A;  4BVX B;  2HFD A;  3ME7 A;  4PQI A;  3FEU A;  4IN0 A;  4EL1 A;  3EMX A;  4XRD A;  2PGT A;  1QFN A;  1OC9 B;  1PKW A;  3H79 A;  4IP1 A;  3ZRE A;  1SYR A;  4KND A;  2XBQ A;  4MAB A;  1NW2 A;  5CNW A;  3M9J A;  1K0B A;  4JBB A;  5BMU B;  4HOJ A;  1BED A;  1BYE A;  2PER A;  1B8X A;  1X5C A;  1TKD B;  4DSS A;  1S3R A;  1ZYQ B;  2OA7 A;  1K3O A;  2L59 A;  3VI7 A;  4CDO A;  1M2B A;  1U3I A;  2GST A;  2HZF A;  3UJ1 A;  1FB6 A;  4ZIL A;  2LUS A;  5B6M A;  4KH7 A;  5J4Y A;  1FOH A;  3L78 A;  2ZNM A;  1YDK A;  4XHM A;  10GS A;  6GST A;  2C8U A;  4EIP A;  4OFN A;  2EFD A;  2WS2 A;  5DAL B;  3A2W A;  2LQQ A;  2LV3 A;  2YJH A;  1WWJ A;  4AKH A;  2MMA A;  1M2A A;  2MMO A;  1O81 A;  1YEW C;  2JZR A;  1X9S B;  2IL3 A;  1QUW A;  2EFC A;  2WJU A;  4WEY A;  3TJK A;  5G2Z A;  2DIY A;  2DMM A;  4GST A;  1F9M A;  1QXH A;  4ICY A;  3C71 A;  5GZZ B;  1G0T A;  1MDJ A;  2FWE A;  1SVM A;  1WRY A;  4EKZ A;  3IV4 A;  2GSQ A;  2L4C A;  3UOM A;  2I81 A;  4EO3 A;  4PUA A;  2L57 A;  3GIX A;  2GQM A;  2EIR A;  5KN1 A;  1SK1 A;  3RBT A;  2H6Y A;  1RK4 A;  3TU3 B;  3FZA A;  3ISO A;  3LJR A;  2PUK C;  4EUY A;  4G2E A;  3M9K A;  3CXG A;  5D73 A;  4KSO A;  4J57 E;  4ULX A;  5G5E A;  4K5R A;  3GKX A;  2HZE B;  2GZP A;  2H72 A;  2R0C A;  4GDF A;  1B9X C;  2D2Z A;  2H74 A;  3N9J A;  4HQZ A;  1R5A A;  4IJ3 A;  1THX A;  3PH9 A;  1DUG A;  2ES7 A;  2X64 A;  4EXJ A;  4OMV A;  5IOW A;  3GA4 A;  5LD0 A;  5IPH A;  3LEF A;  2IPA A;  3O76 A;  1OC3 A;  2OBK A;  4FYU A;  1ZCP A;  1FG4 A;  5ELA A;  2ZCT A;  1ZMA A;  3VWU A;  4TR1 A;  1W4V A;  2OJL A;  1M3I A;  2R3X A;  4NHW A;  4D73 A;  3W8S A;  3TJB A;  1K3Y A;  3SBC A;  5FHI A;  1O73 A;  3HKR A;  4POL A;  1JZD A;  2VL9 A;  4IGJ A;  1Z7R A;  1TK5 B;  2XC2 A;  3LSZ A;  1URM A;  2MBS A;  1PN9 A;  4ZBD A;  3EUR A;  1E6B A;  1TK8 B;  3J7Y k;  1BX9 A;  4AJ7 A;  5ECK B;  3CWG A;  3ERF A;  1XIY A;  2VCZ A;  1OC8 A;  4CHS A;  4AJ8 A;  1I1I P;  4N3Z A;  2UV8 G;  3RHB A;  5CP1 A;  4XCS A;  4QL7 A;  4OCE A;  1HD2 A;  1T3B A;  4GSS A;  3HHV A;  4K2D A;  4O5R A;  4HEA 2;  1U3A A;  1Y1U A;  3WYW A;  2HSM B;  1FHE A;  3APO A;  1G6W A;  5A1N B;  3QOU A;  3CMI A;  4BVY B;  4ZBB A;  1ERW A;  3VWW A;  4BVX A;  4F2I A;  1ABA A;  4KCA A;  3FHK A;  2YZU A;  4K9Z A;  5ID2 B;  2VAF A;  2H1L A;  2WCI A;  3EC3 A;  3DYR A;  6GSU A;  2B5Y A;  5A5H B;  2OBI A;  4IBP A;  4X43 A;  1GL8 A;  4WBR D;  2BJX A;  1GTI A;  1OKT A;  4TKY A;  1XWG A;  1OVN A;  4JU5 A;  3A3T A;  3L9S A;  3QAG A;  1SVO A;  1ON4 A;  4HU7 A;  2HXK A;  3CYN A;  2IFQ B;  2IMF A;  3GUS A;  4OWY A;  2OAC A;  5CRH A;  3TB2 A;  2DKH A;  5C04 A;  1PSQ A;  2VCW A;  2WW2 A;  2DML A;  1GUK A;  4JE1 A;  4WR4 A;  5BRT A;  4XRA A;  4KW6 A;  1SL1 B;  1GLQ A;  5IO2 A;  3QDN A;  2HRF A;  2AB6 A;  3QCP A;  2FCH A;  4PHZ C;  3MSZ A;  4FO5 A;  3WGX A;  2GT5 A;  4RUV A;  1AQV A;  3PGT A;  4FXY P;  2B5E A;  1XWC A;  1YF0 A;  3HJM A;  4BWQ A;  4IS0 A;  2WZ9 A;  4V2M A;  5G5F A;  3VLN A;  1TRU A;  2LJR A;  4HDE A;  1ACV A;  3TDG A;  2WW0 A;  4MPF A;  1EP8 A;  4ML6 A;  3TGZ A;  4DSS B;  2VLV A;  2GTU A;  5ECQ B;  1NM3 A;  2VL2 A;  2HRA A;  4TRX A;  2JAD A;  3LFL A;  1MTC A;  2QA1 A;  3UL3 A;  4EC0 A;  5B8B A;  4NAX A;  1J08 A;  3KP8 A;  3FR9 A;  3MAK A;  5ECN B;  2FWG A;  2LRN A;  2AHE A;  1XG8 A;  2DIZ A;  1V9W A;  4I2U A;  4CW9 A;  2A2S A;  4G9H A;  1V98 A;  4K0G A;  4L5L A;  3ZIJ A;  5EVO A;  1T4Z A;  3BCI A;  1EWX A;  2KHP A;  4XS1 A;  2RM6 A;  4IEL A;  4TN8 A;  2YV9 A;  1K3L A;  2H0I A;  4JRR A;  4GWR A;  5IMV A;  2CAQ A;  3O6T A;  3O3T A;  2O3E A;  2VCV A;  1NHY A;  4ECB A;  2PMT A;  2R0P A;  4PUR A;  3UVT A;  4TR3 A;  4TXO A;  5H5R A;  1Q4J A;  4HZ2 A;  2X49 A;  4GCI A;  3FW2 A;  2VCT A;  1XW5 A;  2I3Y A;  3L9U A;  1F2E A;  3GST A;  3DEX A;  2PN8 A;  4K1F A;  3TCO A;  1ZL9 A;  2L6C A;  1H4O A;  1FB0 A;  5B6N A;  3SWL A;  5HFK A;  5ELG A;  3EIN A;  2YCD A;  1C72 A;  5DQY A;  2KOK A;  4ECI A;  1JLV A;  3FRC A;  3F3Q A;  11GS A;  1J0F A;  5B7C A;  5F06 A;  3TJF A;  2NDO A;  2Z9S A;  3EU3 A;  2L4Q A;  4KA0 A;  1SU9 A;  2YJ7 A;  4YQV A;  1AQX A;  4IJI A;  2RUE A;  2HRN A;  1PX7 A;  4F0B A;  1M2D A;  3JCM L;  1RW1 A;  2J23 A;  3IOS A;  4I97 A;  2VLT A;  5HFG A;  3QAV A;  4GXZ A;  2CZ3 A;  4XS4 A;  5L71 A;  1X9M B;  4NV5 A;  1XWB A;  3M0F A;  2H1A A;  3GTU A;  4E8H A;  3F4T A;  3CSH A;  2OKA A;  2PVO C;  3HJP A;  1Y25 A;  1M9B A;  4PNF A;  3HD5 A;  3D5J A;  5G1L A;  2M46 A;  1A8L A;  1A2L A;  1JZW A;  3AY8 A;  2LKU A;  2IME A;  2B7J A;  3ZYW A;  4DSR A;  4RI7 A;  3RAZ A;  4TW5 A;  3TRQ A;  1SYX A;  1U88 A;  1ERT A;  1RQM A;  3HY2 A;  2KP1 A;  5ECH B;  5A5H A;  2C3T A;  3MIX A;  1SVL A;  1GNE A;  6GSX A;  2FY6 A;  1VF4 A;  13GS A;  4V1A p;  3BBY A;  1WPI A;  2CZ2 A;  2L5L A;  4HZ4 A;  2RLI A;  1Z9H A;  5GAP D;  2B5X A;  2X99 A;  1N2A A;  1UA5 A;  3ZVJ D;  4ZBA A;  22GS A;  3EVI A;  5IMC A;  1TRS A;  3CBU A;  1ILO A;  2K8V A;  4V2L A;  4MJE A;  3VPQ A;  3GH6 A;  3E0U A;  4ID0 A;  4CY8 A;  1M7T A;  3FY7 A;  1M3J A;  19GS A;  1SK0 A;  4HUA A;  3M8N A;  6GSS A;  2DJ3 A;  3L4N A;  3NIV A;  3D22 A;  3TJG A;  3M3M A;  3KZQ A;  4AKX B;  5DCH A;  4O32 A;  1B48 A;  2C80 A;  3GKK A;  1HQO A;  3GUR A;  4Z2T A;  4G0L A;  5KN0 A;  3UAR A;  1TTZ A;  12GS A;  3IAM 2;  5HQP A;  3APS A;  5JWO B;  1IYH A;  1I5G A;  2XPD A;  2TRC P;  1CQG A;  4RQX A;  1GP1 A;  2IMK A;  2DBC A;  4K6X A;  3IPZ A;  2CVB A;  1XPV A;  3QR6 A;  1VF2 A;  2GZZ A;  4N30 A;  1A2J A;  4X1U A;  2IMD A;  2FWH A;  2NBS A;  3KMN A;  3IDV A;  3LYK A;  3EYT A;  1PL1 A;  4OO4 A;  2P0G A;  3A2X A;  3DVX A;  2V2G A;  1GUM A;  3UBK A;  1O8X A;  3KGK A;  4KCE A;  2EFE A;  5EY6 A;  4ZIJ A;  4HQS A;  2NTO A;  2VIM A;  5AIX A;  3KD0 A;  3TKS E;  3UBL A;  2AV4 A;  4KB3 A;  1N8J A;  1OAZ A;  1JHB A;  4JR4 A;  2C1Y A;  1PKZ A;  1XOB A;  4TXV A;  5CRG A;  1GSD A;  1TU7 A;  1PA3 A;  4Q5R A;  4HU9 A;  1EOG A;  1ERV A;  4WXT A;  2JZT A;  1XFL A;  2DKI A;  4QL9 A;  1HNA A;  4QQ7 A;  1EGO A;  3H4K A;  2C0F A;  3L9V A;  2N5B A;  2WVX B;  2GQK A;  1LBK A;  3P8W A;  3IXR A;  2VKZ G;  4K7I A;  3EU4 A;  2EIQ A;  3GYK A;  5ENU A;  3ZTL A;  3G9B A;  4BIK A;  4WR5 A;  2FWF A;  3KCM A;  2O89 A;  4WKW A;  2A2R A;  2O85 A;  3EWL A;  1T1V A;  1MEK A;  4HI7 A;  2PBJ A;  2J9H A;  2YZH A;  1ST9 A;  4AGS A;  4NPB A;  3I9V 2;  2FNO A;  1TRV A;  1R4W A;  4Q5Q A;  1AC1 A;  2PPT A;  4ZB8 A;  1ML6 A;  2GSS A;  4BA7 A;  1FVK A;  14GS A;  1ZGN A;  8GSS A;  3VK9 A;  1J9B A;  2B7K A;  1O8W A;  4TXO B;  4I6X A;  1DE1 A;  1LU4 A;  4YKF A;  2WB9 A;  4I2T A;  3ZL5 A;  1AQW A;  5F07 A;  3HZ4 A;  5D9X A;  1JLW A;  2K18 A;  5B8A A;  2H0H A;  5DDL A;  4AF2 A;  3GMF A;  3DXB A;  2YOI A;  1BF5 A;  1FVJ A;  3P2A A;  5E59 A;  5ECI B;  3KXO A;  5F0G A;  3GFK A;  2X4A A;  3C1S A;  3C73 A;  2O36 A;  1KTE A;  1TI1 A;  2P31 A;  4HJ2 A;  1PMT A;  2H01 A;  5IMA A;  2DSA A;  1SD8 A;  2H73 A;  1SD9 A;  5J40 A;  5IMD A;  4MP4 A;  1UC7 A;  1CQH A;  5KOW A;  1Q98 A;  2LNS A;  2VD1 A;  4K7O A;  3LYP A;  4QMK A;  1GSE A;  4PI0 C;  2M72 A;  3N5O A;  4XS4 B;  1O85 A;  1THO A;  2H19 A;  4FYB A;  1H75 A;  3GTU B;  1X9W B;  2QSI A;  2V41 A;  17GS A;  1OKD A;  5J47 A;  2AYT A;  1PQN A;  2ALB A;  2PU9 C;  1V58 A;  1XWA A;  5AGY A;  1JFU A;  4IW9 A;  1Y6E A;  5ECS A;  3E9J B;  4XIH A;  1BQ7 A;  2JSZ A;  2KUC A;  4KGI A;  1U87 A;  4PNG A;  3MYD A;  3I69 A;  1A0F A;  4ZL9 A;  5ECL B;  1JZO A;  4PX1 A;  4MNN A;  1GWC A;  2H8L A;  4MJC A;  4GF0 A;  2R2J A;  2XHF A;  5A34 A;  4AJ6 A;  2QC7 A;  2AJQ B;  2AAW A;  18GS A;  5J9C A;  4PGT A;  4RI6 A;  5J3R A;  3UAP A;  5G1K A;  4ML1 A;  3U6V A;  3HYP A;  2QKE A;  1G7E A;  2FLS A;  2MMZ A;  5D9W A;  5DJM A;  2C3N A;  4F03 A;  4BL7 B;  4N0Z A;  1PD2 1;  4F0C A;  4KX4 A;  1QGV A;  2YWO A;  5COH A;  2R4V A;  3H93 A;  2IWT A;  2O8V B;  4MCU A;  4K8M A;  1EV4 A;  4FIW A;  3MNG A;  5GAN D;  4Z2U A;  1U6T A;  1VF3 A;  1OE7 A;  3LWA A;  1EGR A;  3KH7 A;  1TDI A;  1Z3E A;  1F6M C;  5D93 A;  1A24 A;  2C0D A;  2FHE A;  3UEM A;  1USB A;  3UMA A;  1V57 A;  4F82 A;  5LNK e;  4G0I A;  4LL4 B;  1G6Y A;  2CT6 A;  2LRC A;  3CSJ A;  4X4J A;  2F8F A;  1TXU A;  3Q6O A;  1K0D A;  2X8G A;  1XW9 A;  3WGD A;  5GST A;  3EMP A;  3ZVJ A;  3UIW A;  2WVX A;  3E3E A;  2VOC A;  5CYY A;  1SK2 A;  2LTK A;  2LST A;  5ABR A;  4USS A;  2P5R A;  3L0H A;  5D96 A;  3A5W A;  4LMW A;  2IJY A;  2H76 A;  1UN2 A;  5IPG A;  2LQO A;  2LNT A;  2RUF A;  3GL3 A;  2YN1 A;  3D6I A;  2A4V A;  1GLP A;  2VL2 C;  3FZ5 A;  1K0A A;  4HJM A;  2EC4 A;  1KEB A;  1AIU A;  3ED3 A;  3C7M A;  3IRA A;  3HZ8 A;  5EL8 A;  1WIK A;  3D0Z A;  3ERW A;  3DKS A;  4WF4 A;  2CVK A;  5A4U A;  4KDU A;  4BPY A;  3IHQ A;  4LL1 B;  1WP0 A;  2F8A A;  4BWS A;  2V6K A;  1K0M A;  4ZXG A;  2E2M A;  2H71 A;  4PUF C;  3RPP A;  5ECM B;  5D9T A;  4ZB6 A;  3KIJ A;  2CV4 A;  5D8I A;  4YKG A;  4ACS A;  4FYC A;  5J4V A;  2VUP A;  4F9Z A;  3KTB A;  2VL3 A;  5AIV A;  2LS5 A;  3VUR A;  2JU5 A;  4OD7 A;  3TUE A;  2G2Q A;  4G19 A;  3F9U A;  2OE3 A;  2L6D A;  1F3A A;  6GSV A;  1TI3 A;  5INY A;  2DJ2 A;  2GLR A;  4LMV A;  2R5G A;  1MDK A;  1TW9 A;  4MK3 A;  1QK8 A;  3RFR C;  4IP6 A;  3TKR A;  3H1N A;  2QA2 A;  3HVV A;  1FOV A;  4GTU A;  3APQ A;  3TOT A;  4TVE A;  2H70 A;  3HJO A;  4XTS A;  1F3B A;  4IQ1 A;  3IE3 A;  1QMV A;  4LA1 A;  5IM9 A;  9GSS A;  5F8B A;  3QFA C;  2JAC A;  2OAD A;  2VM2 A;  1B4Q A;  4KSM A;  4GQC A;  3KTL A;  2YWI A;  3RPN A;  4IQA A;  3ZIT A;  2FA8 A;  2A4H A;  1T7P B;  1VF1 A;  2BMX A;  2I1U A;  5H5Q A;  5JWQ B;  4AI6 A;  5ECR B;  3MWH A;  2WFC A;  4MDC A;  1GTU A;  3HMJ G;  1VRS D;  2REM A;  2DLX A;  3TKS A;  4MF7 A;  1YVL A;  3BOA A;  3GNJ A;  3U5R E;  1XVW A;  4POM A;  2DJK A;  2GZY A;  2WW1 A;  1GRX A;  4TR0 A;  1HYU A;  1S3D A;  2O87 A;  1DBY A;  4MZC A;  3F0I A;  3TKS C;  5JCW A;  2YNX A;  2H6X A;  4BL7 A;  3PIN A;  4JR6 A;  4HSC X;  2XBI A;  2WVY A;  3F6F A;  3GKN A;  1W89 A;  2FUG 2;  2FD3 A;  3QMX A;  2XPE A;  1XBS A;  3VWV A;  1GTA A;  5HR0 A;  5GSS A;  2H66 A;  3DRN A;  3KH9 A;  4PQ1 A;  4EDZ A;  1SJZ A;  2CAI A;  2WW3 A;  3I43 A;  1A23 A;  2HI7 A;  3FR6 A;  3ME8 A;  2B1L A;  5DAK B;  2DJ1 A;  5A34 B;  2GQL A;  1ZYE A;  2HRK A;  1YKC A;  3WGE A;  3HVS A;  5KN2 A;  1EV9 A;  3ZML A;  1MDI A;  3A2V A;  2E0Q A;  2LEG A;  4WF5 A;  4KDX A;  3KJY A;  4ZL8 A;  3EE2 A;  2H30 A;  3DGQ A;  3KP9 A;  2WGR A;  5J41 A;  1HNC A;  2MYG A;  3ZFL A;  5HR3 A;  2JZS A;  2B6M A;  5ECO B;  1AXD A;  2N5A A;  3D21 A;  4GLT A;  4MA9 A;  4WET A;  3HCZ A;  4POB A;  4O5Q A;  4ZL7 A;  1GSF A;  2HNL A;  1XVQ A;  3DWV A;  1MD3 A;  3BD2 A;  1V2A A;  5IQY A;  1GSQ A;  2FGX A;  3KEB A;  1N25 A;  4WBJ A;  1TRW A;  3CSI A;  4K5S A;  1LJR A;  2V32 A;  3BCK A;  4N0V A;  3IHG A;  1PRX A;  4MZW A;  1SKS B;  1E2Y A;  1YJ6 A;  4N11 A;  3BJ5 A;  3V1W A;  3FMW A;  2HSH A;  5JCG A;  3ZLP A;  4MZB A;  2AUV A;  4OFM A;  5A5K A;  1Z6N A;  5CRW A;  3J7Y b;  2CQ9 A;  2N5F A;  1GH2 A;  2LJA A;  3DIE A;  4X0X A;  2M80 A;  3HVN A;  4KF9 A;  1R26 A;  3US3 A;  4G01 A;  5JWR B;  3KMO A;  2GS3 A;  4O5U A;  1M0U A;  1AUC A;  1BG5 A;  1T4Y A;  2QGV A;  4L8E A;  3M1G A;  5CRE A;  1YEP A;  2UZ8 A;  2ON5 A;  3IK9 A;  3UVH A;  4ISD A;  2F9S A;  5CAX A;  2V6O A;  4YH2 A;  4MJB A;  1IYI A;  4IVF A;  4LLR A;  2K8S A;  2PVQ A;  3R2Q A;  5J5N A;  1PL2 A;  5J4U A;  1MD4 A;  3IR4 A;  2RII A;  3GRX A;  4H86 A;  1SEN A;  1XCC A;  4K0N A;  4YAV A;  1AAZ A;  3TKP A;  4PI2 C;  4AKG A;  4YQU A;  2YV7 A;  4O92 A;  3RDW A;  3ZMK A;  5CO3 A;  4O7H A;  3K8N A;  1YEX A;  4HS1 A;  2VCX A;  5HFI A;  2R6K A;  2IMI A;  5AN1 A;  2HSN B;  1TJD A;  1GSU A;  1Z5Y E;  3ERG A;  3GSS A;  5IMF A;  3NOF A;  2H6Z A;  2YP6 A;  1T00 A;  1SKR B;  1A2M A;  3NZN A;  3C1R A;  2WZS A;  3TRX A;  1SL2 B;  4I8B A;  1YY7 A;  1OYJ A;  1S3A A;  3FK8 A;  3RHC A;  3LGC A;  5G31 A;  3EPT A;  2F3M A;  2L5O A;  1K0C A;  5DJL A;  1R7H A;  1I9D A;  4A5P A;  3DML A;  5CRD A;  2VCQ A;  3CQF A;  4MPG A;  1PGT A;  1XW6 A;  4EF0 A;  2I9H A;  1TXX A;  2B3S A;  1XXU A;  4MF5 A;  3HA9 A;  3GX0 A;  2JL4 A;  3CTF A;  1G7O A;  3LW9 A;  1ZYN A;  3CRT A;  1BG1 A;  5DVB A;  2K6V A;  4PXO A;  1PN0 A;  4JZQ A;  4KDY A;  2MBT A;  3W6G A;  3F4R A;  4ILF A;  2YAN A;  2K9F A;  3QAW A;  2DJ0 A;  4GSN A;  6GSY A;  2NVL A;  5IO0 A;  1K0O A;  3F6D A;  2KLX A;  3FZ4 A;  3VFI A;  4YAP A;  2IN3 A;  5DAK A;  2GVP A;  4NV2 A;  4KUN A;  4E68 A;  4MJA A;  3W8J A;  1GUH A;  2H1B A;  4DEJ A;  2V1M A;  2O7K A;  2JSY A;  5HR1 A;  1OC9 A;  2YWN A;  2ON7 A;  7GSS A;  1GSY A;  1X0R A;  5KOX A;  3HDC A;  4OCF A;  5A4W A;  3Q74 A;  5BMU A;  1OE8 A;  4NHZ A;  5FWG A;  1SJ6 A;  1SKW B;  3GH9 A;  1KNG A;  4IHU A;  3C8E A;  4E8E A;  4K2X A;  3IK7 A;  4G10 A;  2OT3 A;  1XWK A;  3I6A A;  4EVM A;  4AKI A;  3GHA A;  4DVC A;  2EIO A;  4DSQ A;  3TOU A;  2CA8 A;  3LQ7 A;  1YZX A;  2BTO T;  1T8E B;  2E2G A;  1DE2 A;  2KP2 A;  2TRX A;  2C0G A;  3VWX A;  2MMN A;  4JED A;  3IA1 A;  3ZZX A;  2HRK B;  1FW1 A;  5KEJ A; 
#chains in the Genus database with same CATH homology
 4GRF A;  3R3E A;  5A4V A;  3OR5 A;  1JZR A;  3VPT A;  5DAL A;  3HVX A;  3F3R A;  1EEJ A;  1B4P A;  4PQH A;  6GSW A;  1VGL A;  3QFB C;  2DJJ A;  3Q19 A;  1HNB A;  4MH2 A;  16GS A;  1EEM A;  2OE1 A;  1X5D A;  2YPM A;  4GQF A;  2VO4 A;  1NHO A;  4EE0 A;  3IC8 A;  4ECJ A;  2O5V A;  2HSY A;  1AW9 A;  2NPB A;  3GV1 A;  5KN3 A;  2FA4 A;  3G7I A;  3FYG A;  2HLS A;  3HXS A;  4MF6 A;  1TP9 A;  4FQU A;  4N10 A;  2HYX A;  4L0U A;  5G30 A;  1Z7P A;  1TK0 B;  1Z6M A;  1A0R P;  2CX3 A;  2VD0 A;  2C3Q A;  1EP7 A;  3LOR A;  3VI5 A;  4YQM A;  4P3Y B;  5H5S A;  1XOA A;  1SL0 B;  1BAY A;  3Q18 A;  3GL5 A;  4IKH A;  2YWM A;  4NMU A;  5JCU A;  1DSB A;  2HZE A;  1GTB A;  1BJX A;  3FR3 A;  2HE3 A;  3ZRD A;  4Q5F A;  2OE0 A;  3F63 A;  1ZZY A;  4PTS A;  4KE3 A;  1S3C A;  2F51 A;  4TR4 A;  2H75 A;  3CTG A;  1YKA A;  5ECP B;  3F4S A;  3KM6 A;  2X8H A;  2HSN A;  1M99 A;  3ZIV A;  3G7Y A;  4EDY A;  4MLY A;  2VM1 A;  5C00 A;  4Z7X A;  2I4A A;  1ERU A;  3S9F A;  3DVW A;  2GGT A;  2MZC A;  4XS6 A;  1B9Y C;  1WJK A;  4I5Q A;  1SJI A;  3TRP A;  2G0F A;  3A5I A;  3QPM A;  2H1D A;  4CY6 A;  1TU8 A;  1TOF A;  1GUL A;  1GNW A;  3LG6 A;  1EOH A;  5DCG A;  5AIS A;  4OFT A;  1A8Y A;  3QD9 A;  4FH8 A;  2WDU A;  5LCZ A;  2R37 A;  3H8Q A;  2RM5 A;  1KBN A;  4J56 E;  1NSW A;  4L0W A;  1V40 A;  5IMZ A;  4EIQ A;  4Z2R A;  2PWJ A;  2CX4 A;  2HQT A;  1O7U A;  2H0G A;  3IAS 2;  2GSR A;  3D4M A;  3WT1 A;  2WUL A;  2H1G A;  1EZK A;  5IOX A;  1FAA A;  1QQ2 A;  4L5O A;  4MMM A;  4KAE A;  4TR1 B;  4ZB7 A;  2GDR A;  2HSM A;  1ZYP A;  1M9A A;  4D73 B;  5A1N A;  2E7P A;  4OO5 A;  2LJK A;  4ECC A;  3FKF A;  3P90 A;  3IC4 A;  2R0G A;  3WT2 A;  4BVY A;  4Q5N A;  1WOU A;  3GKM A;  3FZ9 A;  2HT9 A;  4POK A;  1O6J A;  4K7N A;  3P7X A;  5ID2 A;  1WMJ A;  2EFH A;  5F05 A;  3PR8 A;  5FT3 A;  2B1K A;  3CRU A;  2GT6 A;  3LXZ A;  2A2P A;  1ZOF A;  1F37 A;  2DC5 A;  2WRT A;  4V1A g;  1YQ1 A;  3GX8 A;  1GSS A;  1PX6 A;  5HR2 A;  4NXI A;  1X5E A;  4TOP A;  3WD6 A;  3ZFB A;  1WE0 A;  2TIR A;  4RQR A;  4W66 A;  2LRT A;  2C4J A;  1YF1 A;  5D9V A;  5IIZ A;  2IFQ A;  3PPU A;  3LXT A;  2C0E A;  3TJJ A;  1XZO A;  1K0N A;  3DD3 A;  2P5Q A;  4MH3 A;  3F8U A;  5E4W A;  5DQS A;  2CVD A;  5J9B A;  4G0K A;  2ZUP A;  4V2N A;  3G7J A;  3D4T A;  3GN3 A;  4J2F A;  3MDK A;  4NWY A;  2X8C A;  1UVZ A;  20GS A;  5DBQ A;  3IBH A;  5EPF A;  1FO5 A;  4ZB9 A;  3TKQ A;  2IIY A;  1R5P A;  2VLU A;  4BVX B;  2HFD A;  3ME7 A;  4PQI A;  3FEU A;  4IN0 A;  4EL1 A;  3EMX A;  4XRD A;  2PGT A;  1QFN A;  1OC9 B;  1PKW A;  3H79 A;  4IP1 A;  3ZRE A;  1SYR A;  4KND A;  2XBQ A;  4MAB A;  1NW2 A;  5CNW A;  3M9J A;  1K0B A;  4JBB A;  5BMU B;  4HOJ A;  1BED A;  1BYE A;  2PER A;  1B8X A;  1X5C A;  1TKD B;  4DSS A;  1ZYQ B;  2OA7 A;  1K3O A;  2L59 A;  3VI7 A;  4CDO A;  1M2B A;  1U3I A;  2GST A;  2HZF A;  3UJ1 A;  1FB6 A;  4ZIL A;  2LUS A;  5B6M A;  4KH7 A;  5J4Y A;  1FOH A;  3L78 A;  2ZNM A;  1YDK A;  4XHM A;  10GS A;  6GST A;  2C8U A;  4EIP A;  4OFN A;  2EFD A;  2WS2 A;  5DAL B;  3A2W A;  2LQQ A;  2LV3 A;  2YJH A;  1WWJ A;  4AKH A;  2MMA A;  1M2A A;  2MMO A;  1O81 A;  2JZR A;  1X9S B;  2IL3 A;  1QUW A;  2EFC A;  2WJU A;  4WEY A;  3TJK A;  5G2Z A;  2DIY A;  2DMM A;  4GST A;  1F9M A;  1QXH A;  4ICY A;  3C71 A;  5GZZ B;  1G0T A;  1MDJ A;  2FWE A;  1SVM A;  1WRY A;  4EKZ A;  3IV4 A;  2GSQ A;  2L4C A;  3UOM A;  2I81 A;  4EO3 A;  4PUA A;  2L57 A;  3GIX A;  2GQM A;  2EIR A;  5KN1 A;  1SK1 A;  3RBT A;  2H6Y A;  1RK4 A;  3TU3 B;  3FZA A;  3ISO A;  3LJR A;  2PUK C;  4EUY A;  4G2E A;  3M9K A;  3CXG A;  5D73 A;  4KSO A;  4J57 E;  4ULX A;  5G5E A;  4K5R A;  3GKX A;  2HZE B;  2GZP A;  2H72 A;  2R0C A;  4GDF A;  1B9X C;  2D2Z A;  2H74 A;  3N9J A;  4HQZ A;  1R5A A;  4IJ3 A;  1THX A;  3PH9 A;  1DUG A;  2ES7 A;  2X64 A;  4EXJ A;  4OMV A;  5IOW A;  3GA4 A;  5LD0 A;  5IPH A;  3LEF A;  2IPA A;  3O76 A;  1OC3 A;  2OBK A;  4FYU A;  1ZCP A;  1FG4 A;  5ELA A;  2ZCT A;  1ZMA A;  3VWU A;  4TR1 A;  1W4V A;  2OJL A;  2R3X A;  4NHW A;  4D73 A;  3W8S A;  3TJB A;  1K3Y A;  3SBC A;  5FHI A;  1O73 A;  3HKR A;  4POL A;  1JZD A;  2VL9 A;  4IGJ A;  1Z7R A;  1TK5 B;  2XC2 A;  3LSZ A;  1URM A;  2MBS A;  1PN9 A;  4ZBD A;  3EUR A;  1E6B A;  1TK8 B;  3J7Y k;  1BX9 A;  4AJ7 A;  5ECK B;  3CWG A;  3ERF A;  1XIY A;  2VCZ A;  1OC8 A;  4CHS A;  4AJ8 A;  4N3Z A;  2UV8 G;  3RHB A;  5CP1 A;  4XCS A;  4QL7 A;  4OCE A;  1HD2 A;  1T3B A;  4GSS A;  3HHV A;  4K2D A;  4O5R A;  4HEA 2;  1U3A A;  1Y1U A;  3WYW A;  2HSM B;  1FHE A;  3APO A;  1G6W A;  5A1N B;  3QOU A;  3CMI A;  4BVY B;  4ZBB A;  1ERW A;  3VWW A;  4BVX A;  4F2I A;  1ABA A;  4KCA A;  3FHK A;  2YZU A;  4K9Z A;  5ID2 B;  2VAF A;  2H1L A;  2WCI A;  3EC3 A;  3DYR A;  6GSU A;  2B5Y A;  5A5H B;  2OBI A;  4IBP A;  4X43 A;  1GL8 A;  4WBR D;  2BJX A;  1GTI A;  1OKT A;  4TKY A;  1XWG A;  1OVN A;  4JU5 A;  3A3T A;  3L9S A;  3QAG A;  1SVO A;  1ON4 A;  4HU7 A;  2HXK A;  3CYN A;  2IFQ B;  2IMF A;  3GUS A;  4OWY A;  2OAC A;  5CRH A;  3TB2 A;  2DKH A;  5C04 A;  1PSQ A;  2VCW A;  2DML A;  1GUK A;  4JE1 A;  4WR4 A;  5BRT A;  4XRA A;  4KW6 A;  1SL1 B;  1GLQ A;  5IO2 A;  3QDN A;  2HRF A;  2AB6 A;  3QCP A;  2FCH A;  3MSZ A;  4FO5 A;  3WGX A;  2GT5 A;  4RUV A;  1AQV A;  3PGT A;  2B5E A;  1XWC A;  1YF0 A;  3HJM A;  4BWQ A;  4IS0 A;  2WZ9 A;  4V2M A;  5G5F A;  3VLN A;  1TRU A;  2LJR A;  4HDE A;  1ACV A;  3TDG A;  4MPF A;  1EP8 A;  4ML6 A;  3TGZ A;  4DSS B;  2VLV A;  2GTU A;  5ECQ B;  1NM3 A;  2VL2 A;  2HRA A;  4TRX A;  2JAD A;  3LFL A;  1MTC A;  2QA1 A;  3UL3 A;  4EC0 A;  5B8B A;  4NAX A;  1J08 A;  3KP8 A;  3FR9 A;  3MAK A;  5ECN B;  2FWG A;  2LRN A;  2AHE A;  2DIZ A;  1V9W A;  4I2U A;  4CW9 A;  2A2S A;  4G9H A;  1V98 A;  4K0G A;  4L5L A;  3ZIJ A;  5EVO A;  1T4Z A;  3BCI A;  1EWX A;  2KHP A;  4XS1 A;  2RM6 A;  4IEL A;  4TN8 A;  2YV9 A;  1K3L A;  2H0I A;  4JRR A;  4GWR A;  5IMV A;  2CAQ A;  3O6T A;  3O3T A;  2VCV A;  1NHY A;  4ECB A;  2PMT A;  2R0P A;  4PUR A;  3UVT A;  4TR3 A;  4TXO A;  5H5R A;  1Q4J A;  4HZ2 A;  2X49 A;  4GCI A;  3FW2 A;  2VCT A;  1XW5 A;  2I3Y A;  3L9U A;  1F2E A;  3GST A;  3DEX A;  2PN8 A;  4K1F A;  3TCO A;  1ZL9 A;  2L6C A;  1H4O A;  1FB0 A;  5B6N A;  3SWL A;  5HFK A;  5ELG A;  3EIN A;  2YCD A;  1C72 A;  5DQY A;  2KOK A;  4ECI A;  1JLV A;  3FRC A;  3F3Q A;  11GS A;  1J0F A;  5B7C A;  5F06 A;  3TJF A;  2NDO A;  2Z9S A;  3EU3 A;  2L4Q A;  4KA0 A;  1SU9 A;  2YJ7 A;  4YQV A;  1AQX A;  4IJI A;  2RUE A;  2HRN A;  1PX7 A;  4F0B A;  1M2D A;  3JCM L;  1RW1 A;  2J23 A;  3IOS A;  4I97 A;  2VLT A;  5HFG A;  3QAV A;  4GXZ A;  2CZ3 A;  4XS4 A;  5L71 A;  1X9M B;  4NV5 A;  1XWB A;  3M0F A;  2H1A A;  3GTU A;  4E8H A;  3F4T A;  3CSH A;  2OKA A;  2PVO C;  3HJP A;  1Y25 A;  1M9B A;  4PNF A;  3HD5 A;  3D5J A;  5G1L A;  2M46 A;  1A8L A;  1A2L A;  1JZW A;  3AY8 A;  2LKU A;  2IME A;  2B7J A;  3ZYW A;  4DSR A;  4RI7 A;  3RAZ A;  4TW5 A;  3TRQ A;  1SYX A;  1U88 A;  1ERT A;  1RQM A;  3HY2 A;  2KP1 A;  5ECH B;  5A5H A;  2C3T A;  3MIX A;  1SVL A;  1GNE A;  6GSX A;  2FY6 A;  1VF4 A;  13GS A;  4V1A p;  3BBY A;  1WPI A;  2CZ2 A;  2L5L A;  4HZ4 A;  2RLI A;  1Z9H A;  5GAP D;  2B5X A;  2X99 A;  1N2A A;  1UA5 A;  3ZVJ D;  4ZBA A;  22GS A;  3EVI A;  5IMC A;  1TRS A;  3CBU A;  1ILO A;  2K8V A;  4V2L A;  4MJE A;  3VPQ A;  3GH6 A;  3E0U A;  4ID0 A;  4CY8 A;  1M7T A;  3FY7 A;  19GS A;  1SK0 A;  4HUA A;  3M8N A;  6GSS A;  2DJ3 A;  3L4N A;  3NIV A;  3D22 A;  3TJG A;  3M3M A;  3KZQ A;  4AKX B;  5DCH A;  4O32 A;  1B48 A;  2C80 A;  3GKK A;  1HQO A;  3GUR A;  4Z2T A;  4G0L A;  5KN0 A;  3UAR A;  1TTZ A;  12GS A;  3IAM 2;  5HQP A;  3APS A;  5JWO B;  1IYH A;  1I5G A;  2XPD A;  2TRC P;  1CQG A;  4RQX A;  1GP1 A;  2IMK A;  2DBC A;  4K6X A;  3IPZ A;  2CVB A;  1XPV A;  3QR6 A;  1VF2 A;  2GZZ A;  4N30 A;  1A2J A;  4X1U A;  2IMD A;  2FWH A;  2NBS A;  3KMN A;  3IDV A;  3LYK A;  3EYT A;  1PL1 A;  4OO4 A;  2P0G A;  3A2X A;  3DVX A;  2V2G A;  1GUM A;  3UBK A;  1O8X A;  3KGK A;  4KCE A;  2EFE A;  5EY6 A;  4ZIJ A;  4HQS A;  2NTO A;  2VIM A;  5AIX A;  3KD0 A;  3TKS E;  3UBL A;  2AV4 A;  4KB3 A;  1N8J A;  1OAZ A;  1JHB A;  4JR4 A;  2C1Y A;  1PKZ A;  1XOB A;  4TXV A;  5CRG A;  1GSD A;  1TU7 A;  1PA3 A;  4Q5R A;  4HU9 A;  1EOG A;  1ERV A;  4WXT A;  2JZT A;  1XFL A;  2DKI A;  4QL9 A;  1HNA A;  4QQ7 A;  1EGO A;  3H4K A;  2C0F A;  3L9V A;  2N5B A;  2GQK A;  1LBK A;  3P8W A;  3IXR A;  2VKZ G;  4K7I A;  3EU4 A;  2EIQ A;  3GYK A;  5ENU A;  3ZTL A;  3G9B A;  4WR5 A;  2FWF A;  3KCM A;  2O89 A;  4WKW A;  2A2R A;  2O85 A;  3EWL A;  1T1V A;  1MEK A;  4HI7 A;  2PBJ A;  2J9H A;  2YZH A;  1ST9 A;  4AGS A;  4NPB A;  3I9V 2;  2FNO A;  1TRV A;  1R4W A;  4Q5Q A;  1AC1 A;  2PPT A;  4ZB8 A;  1ML6 A;  2GSS A;  4BA7 A;  1FVK A;  14GS A;  1ZGN A;  8GSS A;  3VK9 A;  1J9B A;  2B7K A;  1O8W A;  4TXO B;  4I6X A;  1DE1 A;  1LU4 A;  4YKF A;  2WB9 A;  4I2T A;  3ZL5 A;  1AQW A;  5F07 A;  3HZ4 A;  5D9X A;  1JLW A;  2K18 A;  5B8A A;  2H0H A;  5DDL A;  4AF2 A;  3GMF A;  3DXB A;  2YOI A;  1BF5 A;  1FVJ A;  3P2A A;  5E59 A;  5ECI B;  3KXO A;  5F0G A;  3GFK A;  2X4A A;  3C1S A;  3C73 A;  1TI1 A;  1KTE A;  2P31 A;  4HJ2 A;  1PMT A;  2H01 A;  5IMA A;  2DSA A;  1SD8 A;  2H73 A;  1SD9 A;  5J40 A;  5IMD A;  4MP4 A;  1UC7 A;  1CQH A;  5KOW A;  1Q98 A;  2LNS A;  2VD1 A;  4K7O A;  3LYP A;  4QMK A;  1GSE A;  2M72 A;  3N5O A;  4XS4 B;  1O85 A;  1THO A;  2H19 A;  4FYB A;  1H75 A;  3GTU B;  1X9W B;  2QSI A;  2V41 A;  17GS A;  1OKD A;  5J47 A;  2AYT A;  1PQN A;  2ALB A;  2PU9 C;  1V58 A;  1XWA A;  5AGY A;  1JFU A;  4IW9 A;  1Y6E A;  5ECS A;  3E9J B;  4XIH A;  1BQ7 A;  2JSZ A;  2KUC A;  4KGI A;  1U87 A;  4PNG A;  3MYD A;  3I69 A;  1A0F A;  4ZL9 A;  5ECL B;  1JZO A;  4PX1 A;  4MNN A;  1GWC A;  2H8L A;  4MJC A;  4GF0 A;  2R2J A;  2XHF A;  5A34 A;  4AJ6 A;  2QC7 A;  2AJQ B;  2AAW A;  18GS A;  5J9C A;  4PGT A;  4RI6 A;  5J3R A;  3UAP A;  5G1K A;  4ML1 A;  3U6V A;  3HYP A;  2QKE A;  1G7E A;  2FLS A;  2MMZ A;  5D9W A;  5DJM A;  2C3N A;  4F03 A;  4BL7 B;  4N0Z A;  1PD2 1;  4F0C A;  4KX4 A;  1QGV A;  2YWO A;  5COH A;  2R4V A;  3H93 A;  2IWT A;  2O8V B;  4MCU A;  4K8M A;  1EV4 A;  4FIW A;  3MNG A;  5GAN D;  4Z2U A;  1U6T A;  1VF3 A;  1OE7 A;  3LWA A;  1EGR A;  3KH7 A;  1TDI A;  1Z3E A;  1F6M C;  5D93 A;  1A24 A;  2C0D A;  2FHE A;  3UEM A;  1USB A;  3UMA A;  1V57 A;  4F82 A;  5LNK e;  4G0I A;  4LL4 B;  1G6Y A;  2CT6 A;  2LRC A;  3CSJ A;  4X4J A;  2F8F A;  1TXU A;  3Q6O A;  1K0D A;  2X8G A;  1XW9 A;  3WGD A;  5GST A;  3EMP A;  3ZVJ A;  3UIW A;  3E3E A;  2VOC A;  5CYY A;  1SK2 A;  2LTK A;  2LST A;  5ABR A;  4USS A;  2P5R A;  3L0H A;  5D96 A;  3A5W A;  4LMW A;  2IJY A;  2H76 A;  1UN2 A;  5IPG A;  2LQO A;  2LNT A;  2RUF A;  3GL3 A;  2YN1 A;  3D6I A;  2A4V A;  1GLP A;  2VL2 C;  3FZ5 A;  1K0A A;  4HJM A;  2EC4 A;  1KEB A;  1AIU A;  3ED3 A;  3C7M A;  3IRA A;  3HZ8 A;  5EL8 A;  1WIK A;  3D0Z A;  3ERW A;  3DKS A;  4WF4 A;  2CVK A;  5A4U A;  4KDU A;  4BPY A;  3IHQ A;  4LL1 B;  1WP0 A;  2F8A A;  4BWS A;  2V6K A;  1K0M A;  4ZXG A;  2E2M A;  2H71 A;  4PUF C;  3RPP A;  5ECM B;  5D9T A;  4ZB6 A;  3KIJ A;  2CV4 A;  5D8I A;  4YKG A;  4ACS A;  4FYC A;  5J4V A;  2VUP A;  4F9Z A;  3KTB A;  2VL3 A;  5AIV A;  2LS5 A;  3VUR A;  2JU5 A;  4OD7 A;  3TUE A;  2G2Q A;  4G19 A;  3F9U A;  2OE3 A;  2L6D A;  1F3A A;  6GSV A;  1TI3 A;  5INY A;  2DJ2 A;  2GLR A;  4LMV A;  2R5G A;  1MDK A;  1TW9 A;  4MK3 A;  1QK8 A;  4IP6 A;  3TKR A;  3H1N A;  2QA2 A;  3HVV A;  1FOV A;  4GTU A;  3APQ A;  3TOT A;  4TVE A;  2H70 A;  3HJO A;  4XTS A;  1F3B A;  4IQ1 A;  3IE3 A;  1QMV A;  4LA1 A;  5IM9 A;  9GSS A;  5F8B A;  3QFA C;  2JAC A;  2OAD A;  2VM2 A;  1B4Q A;  4KSM A;  4GQC A;  3KTL A;  2YWI A;  3RPN A;  4IQA A;  3ZIT A;  2FA8 A;  2A4H A;  1T7P B;  1VF1 A;  2BMX A;  2I1U A;  5H5Q A;  5JWQ B;  4AI6 A;  5ECR B;  3MWH A;  2WFC A;  4MDC A;  1GTU A;  3HMJ G;  1VRS D;  2REM A;  2DLX A;  3TKS A;  4MF7 A;  1YVL A;  3BOA A;  3GNJ A;  3U5R E;  1XVW A;  4POM A;  2DJK A;  2GZY A;  1GRX A;  4TR0 A;  1HYU A;  1S3D A;  2O87 A;  1DBY A;  4MZC A;  3F0I A;  3TKS C;  5JCW A;  2YNX A;  2H6X A;  4BL7 A;  3PIN A;  4JR6 A;  2XBI A;  3F6F A;  3GKN A;  1W89 A;  2FUG 2;  2FD3 A;  3QMX A;  2XPE A;  1XBS A;  3VWV A;  1GTA A;  5HR0 A;  5GSS A;  2H66 A;  3DRN A;  3KH9 A;  4PQ1 A;  4EDZ A;  1SJZ A;  2CAI A;  3I43 A;  1A23 A;  2HI7 A;  3FR6 A;  3ME8 A;  2B1L A;  5DAK B;  2DJ1 A;  5A34 B;  2GQL A;  1ZYE A;  2HRK A;  1YKC A;  3WGE A;  3HVS A;  5KN2 A;  1EV9 A;  3ZML A;  1MDI A;  3A2V A;  2E0Q A;  2LEG A;  4WF5 A;  4KDX A;  3KJY A;  4ZL8 A;  3EE2 A;  2H30 A;  3DGQ A;  3KP9 A;  2WGR A;  5J41 A;  1HNC A;  2MYG A;  3ZFL A;  5HR3 A;  2JZS A;  2B6M A;  5ECO B;  1AXD A;  2N5A A;  3D21 A;  4GLT A;  4MA9 A;  4WET A;  3HCZ A;  4POB A;  4O5Q A;  4ZL7 A;  1GSF A;  2HNL A;  1XVQ A;  3DWV A;  1MD3 A;  3BD2 A;  1V2A A;  5IQY A;  1GSQ A;  2FGX A;  3KEB A;  1N25 A;  4WBJ A;  1TRW A;  3CSI A;  4K5S A;  1LJR A;  2V32 A;  3BCK A;  4N0V A;  3IHG A;  1PRX A;  4MZW A;  1SKS B;  1E2Y A;  1YJ6 A;  4N11 A;  3BJ5 A;  3V1W A;  3FMW A;  2HSH A;  5JCG A;  3ZLP A;  4MZB A;  2AUV A;  4OFM A;  5A5K A;  1Z6N A;  5CRW A;  3J7Y b;  2CQ9 A;  2N5F A;  1GH2 A;  2LJA A;  3DIE A;  4X0X A;  2M80 A;  4KF9 A;  1R26 A;  3US3 A;  4G01 A;  5JWR B;  3KMO A;  2GS3 A;  4O5U A;  1M0U A;  1AUC A;  1BG5 A;  1T4Y A;  2QGV A;  4L8E A;  3M1G A;  5CRE A;  1YEP A;  2UZ8 A;  2ON5 A;  3IK9 A;  3UVH A;  4ISD A;  2F9S A;  5CAX A;  2V6O A;  4YH2 A;  4MJB A;  1IYI A;  4IVF A;  4LLR A;  2K8S A;  2PVQ A;  3R2Q A;  5J5N A;  1PL2 A;  5J4U A;  1MD4 A;  3IR4 A;  2RII A;  3GRX A;  4H86 A;  1SEN A;  1XCC A;  4K0N A;  4YAV A;  1AAZ A;  3TKP A;  4AKG A;  4YQU A;  2YV7 A;  4O92 A;  3RDW A;  3ZMK A;  5CO3 A;  4O7H A;  3K8N A;  1YEX A;  4HS1 A;  2VCX A;  5HFI A;  2R6K A;  2IMI A;  5AN1 A;  2HSN B;  1TJD A;  1GSU A;  1Z5Y E;  3ERG A;  3GSS A;  5IMF A;  3NOF A;  2H6Z A;  2YP6 A;  1T00 A;  1SKR B;  1A2M A;  3NZN A;  3C1R A;  3TRX A;  1SL2 B;  4I8B A;  1YY7 A;  1OYJ A;  1S3A A;  3FK8 A;  3RHC A;  3LGC A;  5G31 A;  3EPT A;  2F3M A;  2L5O A;  1K0C A;  5DJL A;  1R7H A;  1I9D A;  4A5P A;  3DML A;  5CRD A;  2VCQ A;  4MPG A;  1PGT A;  1XW6 A;  4EF0 A;  2I9H A;  1TXX A;  2B3S A;  1XXU A;  4MF5 A;  3HA9 A;  3GX0 A;  2JL4 A;  3CTF A;  1G7O A;  3LW9 A;  1ZYN A;  3CRT A;  1BG1 A;  5DVB A;  2K6V A;  4PXO A;  1PN0 A;  4JZQ A;  4KDY A;  2MBT A;  3W6G A;  3F4R A;  4ILF A;  2YAN A;  2K9F A;  3QAW A;  2DJ0 A;  4GSN A;  6GSY A;  2NVL A;  5IO0 A;  1K0O A;  3F6D A;  2KLX A;  3FZ4 A;  3VFI A;  4YAP A;  2IN3 A;  5DAK A;  2GVP A;  4NV2 A;  4KUN A;  4E68 A;  4MJA A;  3W8J A;  1GUH A;  2H1B A;  4DEJ A;  2V1M A;  2O7K A;  2JSY A;  5HR1 A;  1OC9 A;  2YWN A;  2ON7 A;  7GSS A;  1GSY A;  1X0R A;  5KOX A;  3HDC A;  4OCF A;  5A4W A;  3Q74 A;  5BMU A;  1OE8 A;  4NHZ A;  5FWG A;  1SJ6 A;  1SKW B;  3GH9 A;  1KNG A;  4IHU A;  3C8E A;  4E8E A;  4K2X A;  3IK7 A;  4G10 A;  2OT3 A;  1XWK A;  3I6A A;  4EVM A;  4AKI A;  3GHA A;  4DVC A;  2EIO A;  4DSQ A;  3TOU A;  2CA8 A;  3LQ7 A;  1YZX A;  2BTO T;  1T8E B;  2E2G A;  1DE2 A;  2KP2 A;  2TRX A;  2C0G A;  3VWX A;  2MMN A;  4JED A;  3IA1 A;  3ZZX A;  2HRK B;  1FW1 A;  5KEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...