4ECJA

Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
204
Chain Sequence
VMIDLYTAATPNGHKVSIALEEMGLPYRVHALSFDKKEQKAPEFLRINPNGRIPAIVDRDNDDFAVFESGAILIYLAEKTGQLMPADVKGRSRVIQWLMFQMGGVGPMQGQANVFFRYFPEKLQGAIDRYQHETRRLYEVLDGRLGEAEYLAGDYSIADIATYPWVRIHDWSGVAVDGLDNLQRWIAAIEARPAVQRGLLVPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione S-transferase
publication title Crystal Structure of Glutathione S-Transferase Prk13972 from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 77
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ecjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ecjA01
2LEGA 1N2AA 2F51A 3US3A 5C00A 4WKWA 2WB9A 2QKEA 2V6KA 1K3YA 1F2EA 3ZTLA 1SKRB 3CTFA 4YQMA 3ZFBA 1F9MA 2K9FA 2HSHA 2K8SA 1WIKA 4FH8A 4L0UA 2FD3A 4MP4A 2WGRA 4AF2A 3RBTA 2WCIA 1MD4A 3G9BA 2FA4A 5KEJA 3Q6OA 3GA4A 5JCUA 3CMIA 3HKRA 3UVTA 1YEPA 4MABA 4IW9A 3KIJA 4BVXA 4ECIA 1C72A 4POMA 1ACVA 1CQHA 2VD1A 12GSA 5DAKB 3KJYA 3PR8A 4Q5FA 4QL7A 3WGEA 4V1Ag 3NOFA 4K1FA 3KD0A 3C1SA 4ZILA 1JFUA 2MMAA 5A4UA 3IXRA 3MSZA 1T4ZA 4MH2A 5G30A 2IMKA 2PUKC 4POBA 2DJ2A 1G6YA 3UVHA 3P8WA 5HR3A 3GSTA 1U87A 3I6AA 4ZL7A 2JSYA 3TKSE 1DE2A 2LS5A 2VUPA 1DBYA 1JZRA 2YWIA 3ISOA 2FWEA 1T7PB 2H6YA 1AQWA 1TI1A 4KGIA 1MDIA 4KDUA 5ABRA 2M72A 1YKAA 3DVXA 2C3QA 3FR9A 1A2JA 1X0RA 2VLTA 3FR3A 2B7JA 2AUVA 1XPVA 2YWMA 2HT9A 4EF0A 4MDCA 4EE0A 3I43A 1QXHA 1OE8A 2LQOA 1A8LA 1WWJA 4D73B 5INYA 5AIXA 4QL9A 4ML1A 3O3TA 3DYRA 3KM6A 2R4VA 1GSSA 2PERA 4JZQA 2P31A 5HFKA 4E8HA 3O6TA 4FYBA 1EOHA 1GSDA 5IMDA 3QAGA 3GL5A 4TN8A 1YDKA 3F4SA 4X43A 3F4TA 3CXGA 4POKA 3GH9A 2H8LA 5H5QA 1F6MC 5B6NA 3QAVA 1X5EA 4DSRA 1Y25A 2KUCA 1XWKA 4IELA 3DWVA 2OBIA 4OCEA 5E4WA 4KE3A 3ZLPA 2F9SA 3FKFA 2HRKA 3VPQA 1MD3A 1E6BA 1WOUA 4F82A 3RDWA 1QQ2A 5EPFA 4WR5A 1GLPA 3U5RE 5DALB 5D9VA 3LXZA 3EC3A 5JWOB 2K8VA 4OFTA 1TRUA 3CTGA 1XW9A 5CO3A 4PQIA 4CHSA 1JZWA 1X5DA 2JADA 1X9SB 1YQ1A 2YWOA 3U6VA 2DIZA 4V2MA 2GSSA 5DDLA 1A24A 2H1BA 2AJQB 2LKUA 14GSA 3K8NA 2WRTA 1G6WA 4KW6A 2HRNA 4HZ4A 4TW5A 4ECCA 3D6IA 2BTOT 3I9V2 5ID2A 5DCHA 1QUWA 1TRVA 1Z6MA 16GSA 4TOPA 2JSZA 2GQKA 1TU7A 1B4QA 2L5LA 3TJKA 4TR3A 1AQVA 2MMOA 3N5OA 2YWNA 4I97A 3M9JA 1XBSA 3D0ZA 2V41A 1S3CA 2KP2A 4YH2A 2LJAA 3FHKA 1EP8A 3GFKA 1FVKA 5B7CA 3VWUA 2AHEA 4K0NA 3VURA 1A8YA 4G0KA 4L0WA 3M8NA 2C8UA 5ECMB 3KP8A 3L9SA 2IFQB 1OC8A 2VLUA 4XIHA 20GSA 2E0QA 1OC9A 1QK8A 4KDYA 1GUMA 5JCWA 5ECQB 5G5EA 1M99A 1R7HA 5DCGA 1TK0B 1TI3A 4TR1B 5AN1A 2IL3A 1GL8A 2CVDA 1XW6A 3HXSA 5A4VA 3KXOA 4YAPA 4BL7B 3D21A 3FZ5A 2L59A 4AGSA 5GZZB 4L5LA 2HSMB 2VL9A 3CBUA 4MH3A 4I6XA 1RK4A 1OAZA 3LSZA 5GAPD 3IA1A 2ZUPA 2QC7A 3ERWA 3D22A 5HFIA 1FW1A 4Q5QA 3PINA 2FWFA 1FOVA 3LYPA 5G31A 4MK3A 1VGLA 4XS1A 1K0AA 4AJ7A 1XZOA 3TKSC 1AUCA 2HZEB 1RQMA 6GSYA 5ELAA 3KMNA 3ZZXA 2TRCP 2H74A 2P0GA 2I4AA 3J7Yk 2JL4A 4V2LA 8GSSA 1TOFA 2VCTA 5ENUA 1SK2A 3LJRA 2R6KA 2PVOC 2V1MA 3FK8A 3UOMA 3KZQA 3GNJA 2O7KA 2GSQA 1AC1A 1PQNA 3ZMLA 2OBKA 2CX4A 4OWYA 4WBJA 2P5RA 4V1Ap 4EUYA 3ME8A 3QPMA 1M9BA 4PTSA 2R3XA 2MYGA 1EOGA 3GV1A 3SWLA 4WBRD 22GSA 1K3LA 1JLWA 1YKCA 2KLXA 2O87A 5F07A 2VCVA 5A4WA 4NMUA 2H76A 2VCWA 1W4VA 5AISA 2JACA 2MMNA 2BMXA 2F8AA 3C8EA 5E59A 5CP1A 4HEA2 4PUAA 3HA9A 2H0GA 3PH9A 1KTEA 5D9WA 3TRPA 3GSSA 2H1GA 2KP1A 4IN0A 1BX9A 3F8UA 4ZB6A 4BPYA 3M3MA 5JWRB 1EV4A 4ZB8A 1O7UA 2NVLA 4WR4A 3O76A 10GSA 3S9FA 2H6XA 4K7OA 4GWRA 4LL4B 3W8JA 3TKSA 1G7OA 2NTOA 2LSTA 1E2YA 1S3AA 3DVWA 1PMTA 1EP7A 1GULA 3APOA 5B8BA 4KA0A 4MMMA 2J9HA 2GS3A 4KSMA 4ZXGA 3F0IA 4I2UA 3UL3A 1GTIA 2CQ9A 4XS4B 1NW2A 3QD9A 1SYRA 2L6DA 5ECLB 2J23A 2GSRA 1XCCA 2GSTA 4RUVA 1OE7A 2RIIA 2REMA 5ECPB 3VI7A 1VF1A 1GTAA 3GUSA 1KBNA 4MZCA 3IR4A 1VF3A 4JBBA 3HJOA 3WGDA 4KX4A 4F03A 2HLSA 6GSUA 1XWGA 2O8VB 2ALBA 1SENA 1M2AA 2M80A 2YPMA 4IQ1A 4TXOB 2XHFA 1WRYA 2B1LA 5IO2A 3IK7A 2G0FA 3VWWA 4QQ7A 2IWTA 5L71A 2CV4A 1PX7A 3CSHA 1XIYA 5B6MA 2TIRA 1Z7RA 1S3DA 1GRXA 1GP1A 3L0HA 1FO5A 2C3NA 1PGTA 5EL8A 2YCDA 2HZFA 4ZIJA 4ZB9A 1A0RP 3KP9A 2I1UA 2YJHA 1QFNA 1GSEA 4G9HA 4N0VA 4BVXB 5J5NA 4WEYA 4F2IA 3QCPA 4KDXA 3CSIA 4MA9A 2H70A 5G1KA 1UA5A 3ZIVA 4NHWA 2CAQA 1EWXA 4J56E 2YP6A 2VO4A 3IE3A 4GXZA 2C0EA 4HS1A 3ZIJA 3HJMA 3GMFA 5D9TA 2B1KA 5AGYA 3RPPA 3DIEA 1RW1A 3P7XA 1R26A 4K7IA 1B9XC 2OJLA 3TKQA 4IP1A 2H30A 1T3BA 2H6ZA 3L78A 3DD3A 4X0XA 4I8BA 1TXXA 4ZBDA 1X5CA 5IPHA 2YANA 2RUFA 3BOAA 1ILOA 2FLSA 1UN2A 2X99A 1JHBA 2MBSA 4YQVA 1HQOA 2YV9A 5DJLA 2JZTA 1K0OA 3H4KA 2VL2A 3HHVA 5DQYA 5KN1A 2DJ1A 3Q19A 4OFMA 3IPZA 2AV4A 2YV7A 4GLTA 2PN8A 1GLQA 3KH7A 4BWSA 3VI5A 4MLYA 2X8CA 3G7YA 4ILFA 5CRHA 4ECBA 4IJ3A 2AB6A 1I9DA 3VPTA 1GTUA 1GSYA 4TRXA 2IMIA 1WMJA 4N11A 2EC4A 1EGRA 1MDJA 5ECKB 1X9MB 1M9AA 3TJFA 3KH9A 1U3IA 2UZ8A 4NXIA 3TJGA 1ZYQB 4HU9A 1KEBA 1FB0A 2GDRA 3KGKA 3LG6A 1ZZYA 4EC0A 4RI6A 1V9WA 2LRNA 4POLA 5LNKe 3M1GA 2GQMA 7GSSA 3MDKA 4BVYA 2C0GA 4MJBA 1EEMA 2HRKB 3LYKA 4GSNA 3TGZA 2FCHA 1XFLA 3R2QA 3A2XA 3EU3A 3TCOA 5CRWA 3J7Yb 5KN0A 3HZ4A 4LLRA 1ST9A 4JEDA 5IMCA 2LRTA 1N8JA 1XWAA 3FZAA 3A2WA 1PSQA 5ELGA 5LCZA 2HYXA 4LA1A 3DXBA 3QFAC 1YJ6A 1F3BA 3N9JA 2H73A 2YOIA 2IMFA 3GTUA 4N0ZA 3EINA 3UIWA 3BD2A 2OACA 2PMTA 2JU5A 2VM1A 4FQUA 1OYJA 2I3YA 2E2MA 3LXTA 4MPFA 1ZL9A 2PPTA 1URMA 3MAKA 2IPAA 2VOCA 3TRXA 3UEMA 4WF4A 4HZ2A 1HNBA 2E2GA 1U88A 2C4JA 5G1LA 2YJ7A 1EEJA 3EE2A 3UBLA 1AIUA 2WULA 4K0GA 3M0FA 4PNFA 1HYUA 2IIYA 1O6JA 1GSFA 1SJ6A 4KCEA 2VL3A 3IC8A 4K2DA 1YEXA 4JE1A 1TRSA 4MJCA 4IHUA 4PQHA 1XWBA 4XRDA 5IO0A 3M9KA 3TJBA 2I81A 5AIVA 1A23A 2OE0A 3D5JA 1FVJA 1WP0A 3F6FA 1GSUA 2K6VA 1EZKA 3C73A 2CA8A 4EXJA 3A2VA 5HR2A 2B6MA 1M2BA 4HI7A 4GRFA 4OCFA 4MPGA 3GIXA 1Q98A 3TUEA 2HRAA 3BJ5A 3ERFA 3C71A 1JZOA 2VM2A 3GX8A 1MDKA 2MZCA 4GCIA 4BWQA 1TRWA 2LNTA 3AY8A 3QR6A 3H1NA 6GSSA 1GTBA 5H5SA 1K0MA 2HI7A 2KHPA 3FW2A 2HQTA 4BL7A 3GURA 1SK0A 3TKRA 5DJMA 5IMAA 2I9HA 3WD6A 9GSSA 1EV9A 1SJIA 4KB3A 3L9UA 2XBQA 1PL2A 4MF5A 1PL1A 5D93A 2B7KA 3TRQA 1A0FA 1XVWA 2CAIA 3ZMKA 3LFLA 3FZ4A 4XTSA 3TB2A 2LJKA 2QSIA 2YZUA 2IMDA 4ACSA 5IMFA 2GZPA 2QGVA 3LORA 2DJ0A 1ERUA 2B3SA 1SL0B 3HD5A 5EY6A 2DJKA 3DKSA 4O92A 4N30A 2RLIA 2CZ2A 1AW9A 5CRGA 2CZ3A 2LNSA 17GSA 3HDCA 6GSTA 2LQQA 4ECJA 1ERWA 1THOA 5IIZA 2FUG2 5HR1A 2WDUA 1QGVA 2PU9C 13GSA 4WF5A 4PX1A 3LQ7A 2DLXA 4XRAA 4RQXA 1ON4A 3ZITA 1I5GA 5LD0A 2EIOA 2H72A 4TKYA 2LV3A 1DSBA 3MWHA 4PNGA 2HXKA 5JWQB 5C04A 3SBCA 4IP6A 1BYEA 4OFNA 3G7IA 2R37A 2H19A 4NAXA 1T1VA 4JRRA 4DSSA 2DSAA 2E7PA 3TOUA 2CX3A 2XPEA 3C1RA 1IYHA 4HJMA 2JZRA 3FEUA 5CREA 2H01A 3R3EA 4FYUA 1M2DA 4H86A 4IGJA 3H79A 3GH6A 2X8GA 3FZ9A 2CVBA 4I2TA 1ZGNA 5ECIB 3I69A 2EIQA 5ECOB 2RM6A 3JCML 4X1UA 4EL1A 3RHBA 2GT6A 3KMOA 2YN1A 1GSQA 3G7JA 4MCUA 1XW5A 1GNEA 5J4UA 4HUAA 1OKDA 2X8HA 2PWJA 3IC4A 3FRCA 1A2MA 4PXOA 3H93A 1TDIA 1YF0A 3VWXA 1CQGA 1V98A 4IKHA 2ES7A 4FO5A 1YZXA 2L6CA 3QDNA 1TKDB 4EKZA 4KH7A 2H0IA 3W6GA 3BCIA 5IPGA 3RPNA 1B8XA 2FHEA 4DSQA 4EO3A 1BEDA 4K7NA 2FA8A 4TR0A 4DVCA 1VF2A 1VRSD 1B4PA 4HU7A 4AJ6A 4K9ZA 4XS4A 3IV4A 2CVKA 1LBKA 3KTBA 3HYPA 3EMPA 2VLVA 1TK5B 1A2LA 2HSNB 4O7HA 3FYGA 2V32A 1XOAA 2AYTA 3DRNA 1EGOA 2VL2C 2H1DA 4PUFC 3FR6A 4KCAA 2B5EA 3L4NA 3A3TA 1K0CA 2DIYA 5CNWA 4TR4A 3V1WA 1TP9A 4TXOA 4PQ1A 3KTLA 1J9BA 5GSSA 4Q5RA 1ML6A 3GKMA 1OC3A 2DMMA 3DGQA 2BJXA 1NHOA 3UMAA 2L4QA 1PX6A 2XBIA 3E9JB 3ZYWA 1X9WB 5D9XA 1Z9HA 3NZNA 1U6TA 4OD7A 4ID0A 2OA7A 4IQAA 2C0DA 2HFDA 5CAXA 1BJXA 1JZDA 2GZYA 5DQSA 2N5AA 3PPUA 1OVNA 5DBQA 1G0TA 2N5BA 5DAKA 2L5OA 4LL1B 1M7TA 5IM9A 2C3TA 1FB6A 5IOXA 1PD21 3GKKA 3APSA 4PGTA 1WJKA 6GSWA 4XCSA 5J9CA 4LMWA 2YNXA 4NHZA 3Q18A 1ZOFA 2H1AA 1R5AA 4OMVA 5GSTA 1V40A 5D96A 4ULXA 4IVFA 1NM3A 5EVOA 4G2EA 1B9YC 1G7EA 1PN9A 1H4OA 2V6OA 2Z9SA 4YAVA 2HRFA 2FWGA 3Q74A 2IMEA 1BG5A 4GTUA 3VK9A 3IAS2 1Q4JA 2C1YA 2ZCTA 1SKSB 2C0FA 4KAEA 2IN3A 3ZVJA 2F3MA 1J0FA 5D8IA 5B8AA 2V2GA 1ERTA 2A2SA 4CW9A 4L8EA 3DMLA 1O85A 4HQZA 2AAWA 1R4WA 3VWVA 3W8SA 1PRXA 2EIRA 3PGTA 3CRUA 4D73A 3ERGA 3ME7A 3RAZA 1LU4A 2LRCA 3QAWA 1XVQA 4P3YB 3GHAA 2XC2A 3TDGA 4I5QA 2DC5A 3CYNA 3E3EA 1O81A 3WYWA 3GKXA 3QMXA 5CRDA 2FNOA 1IYIA 2IJYA 2NBSA 1NSWA 3IOSA 4G0IA 1TTZA 1T00A 5ECHB 3F63A 2M46A 2K18A 4JU5A 5DVBA 2GVPA 3IAM2 1UVZA 1GUHA 3HY2A 1PKZA 2LTKA 2GTUA 1WE0A 4HOJA 4ML6A 1SYXA 1SL2B 3ZRDA 4ZBBA 5FWGA 2DMLA 5HFGA 2WJUA 3ZFLA 4BVYB 2NDOA 1SKWB 1JLVA 1UC7A 2FGXA 5J3RA 4USSA 5FHIA 2H71A 1FAAA 4NPBA 4TXVA 5DALA 2KOKA 5F05A 4G19A 2GQLA 4WXTA 3TKPA 4EDZA 4KSOA 4EVMA 3HCZA 4GF0A 4CDOA 4PURA 3E0UA 2PGTA 4ZBAA 3EU4A 3VLNA 1FG4A 3IHQA 3GL3A 3WT2A 5KN2A 3WGXA 1WPIA 2LJRA 4IBPA 4RQRA 2OE3A 4Z7XA 1TW9A 4MF6A 1O8XA 1GWCA 4GSSA 1V57A 3GTUB 3GN3A 4GSTA 1F37A 3LGCA 3EURA 2HSYA 5G2ZA 3BBYA 2VIMA 18GSA 1J08A 5D73A 1SD9A 3OR5A 5HR0A 1V58A 4KF9A 1GH2A 1TU8A 5ID2B 1XWCA 4LMVA 2VAFA 3L9VA 1TJDA 2C80A 1ZYEA 3RHCA 1K0BA 2LUSA 4XS6A 4K8MA 2ON5A 1THXA 1YY7A 1ZMAA 1V2AA 2FWHA 5BMUA 1LJRA 3HZ8A 1H75A 4KNDA 3CRTA 2MBTA 3F9UA 1Z7PA 1DE1A 1YF1A 3CSJA 3F3RA 3QFBC 4HDEA 5ECSA 5IOWA 1VF4A 2OADA 1SJZA 2IFQA 3ZVJD 1K0DA 3EWLA 3KEBA 4MZWA 2DJ3A 2RM5A 3GRXA 3UAPA 4BA7A 1OC9B 4FIWA 1ERVA 3WT1A 3GX0A 1BQ7A 1SL1B 5H5RA 1AXDA 4K6XA 4O5RA 5J9BA 5JCGA 2XPDA 1BAYA 3F4RA 1TK8B 4TR1A 4MF7A 2GZZA 3UBKA 2ON7A 3TOTA 3D4MA 1PKWA 3IBHA 4GQCA 4AJ8A 1MTCA 5J41A 4FYCA 3F3QA 1U3AA 3ED3A 2TRXA 3FY7A 2G2QA 3F6DA 2HSMA 1HNAA 1AQXA 1Z5YE 3IRAA 1FHEA 2GGTA 2R2JA 2NPBA 2O89A 4EDYA 1OKTA 3EVIA 2WZ9A 3EYTA 4F0CA 2L4CA 4J2FA 4G10A 2DJJA 3KCMA 4JR6A 5KN3A 2RUEA 4MJEA 4O32A 4TVEA 11GSA 2B5YA 3UJ1A 4HQSA 4RI7A 2D2ZA 1HD2A 1AAZA 1QMVA 4NV2A 4NWYA 4XHMA 1Y6EA 1KNGA 2HZEA 2H75A 4WETA 4NV5A 1T4YA 3IK9A 2GT5A 2HE3A 2HNLA 1Z3EA 1USBA 3LEFA 1SU9A 4L5OA 4E8EA 1O8WA 3P2AA 1F3AA 2PVQA 2B5XA 1MEKA 2OE1A 4V2NA 4HJ2A 2GLRA 1ZCPA 4ISDA 4J57E 19GSA 3ZREA 3HVSA 4JR4A 4MJAA 4DEJA 2ZNMA 1GNWA 2PBJA 4IS0A 2JZSA 1T8EB 3UARA 1SD8A 1Z6NA 2FY6A 1R5PA 3EMXA 2F8FA 2WFCA 5A5KA 3D4TA 3P90A 5GAND 2MMZA 4ZL8A 2VCXA 3QOUA 1GUKA 4KUNA 2R5GA 4DSSB 2DBCA 5IMVA 4F9ZA 1XOBA 1HNCA 3HJPA 3DEXA 2VCZA 5FT3A 5IMZA 2A2RA 4MZBA 1K3OA 4YQUA 3H8QA 5HQPA 6GSXA 4N10A 3A5WA 1O73A 2CT6A 4OO4A 4OO5A 3VFIA 2OKAA 3APQA 1PA3A 3NIVA 3GYKA 2VD0A 4ZL9A 1DUGA 3LWAA 2H0HA 4IJIA 1M0UA 5ECNB 3C7MA 1ABAA 5F0GA 2YZHA 5IQYA 4Q5NA 5ECRB 2VCQA 2WS2A 1W89A 2N5FA 2A4VA 1XXUA 3IDVA 3HVVA 3BCKA 1K0NA 4F0BA 3TJJA 3HVXA 5G5FA 6GSVA 2X64A 5COHA 3MNGA 5CYYA 5F06A 4GQFA 1NHYA 2P5QA 3ZL5A 1SK1A 2O85A 2L57A 1B48A 5F8BA 2H66A 3GKNA 4G0LA
chains in the Genus database with same CATH superfamily
2LEGA 1N2AA 2F51A 1SVLA 2DKIA 2O3EA 3US3A 2O36A 5C00A 4WKWA 3MIXA 2WB9A 2QKEA 2V6KA 1K3YA 1F2EA 3ZTLA 1SKRB 3CTFA 3A5IA 4YQMA 3ZFBA 1F9MA 2K9FA 2HSHA 2K8SA 1WIKA 4FH8A 4L0UA 2FD3A 4MP4A 2WGRA 4AF2A 3RBTA 2WCIA 1MD4A 3G9BA 2FA4A 5KEJA 3Q6OA 3GA4A 5JCUA 3CMIA 3HKRA 3UVTA 1YEPA 4MABA 2WVXA 4IW9A 4BVXA 4ECIA 1C72A 3KIJA 4POMA 1ACVA 1CQHA 2VD1A 12GSA 5DAKB 3KJYA 3PR8A 4Q5FA 4QL7A 3WGEA 4V1Ag 3NOFA 4K1FA 3KD0A 3C1SA 4ZILA 1JFUA 2MMAA 5A4UA 3IXRA 3MSZA 1T4ZA 4MH2A 5G30A 2QA2A 2IMKA 2PUKC 4POBA 2DJ2A 1G6YA 3UVHA 3P8WA 5HR3A 3GSTA 1U87A 3I6AA 2WW1A 4ZL7A 2JSYA 3TKSE 1DE2A 2LS5A 2VUPA 1DBYA 1JZRA 2EFEA 2YWIA 3ISOA 2FWEA 1T7PB 2H6YA 1AQWA 1TI1A 4KGIA 1MDIA 4KDUA 5ABRA 2M72A 1YKAA 3DVXA 2C3QA 3FR9A 1A2JA 1X0RA 2VLTA 3FR3A 2B7JA 2AUVA 1XPVA 2YWMA 2HT9A 4EF0A 4MDCA 4EE0A 3I43A 1QXHA 1OE8A 2LQOA 1A8LA 1WWJA 4D73B 5INYA 5AIXA 4QL9A 4ML1A 3O3TA 3DYRA 3KM6A 2R4VA 1GSSA 2PERA 4JZQA 2P31A 5HFKA 4E8HA 1S3RA 3O6TA 4FYBA 1EOHA 1GSDA 5IMDA 3QAGA 3GL5A 4TN8A 1YDKA 3F4SA 4X43A 3F4TA 5A34A 3CXGA 4POKA 3GH9A 2H8LA 5H5QA 1F6MC 5B6NA 4CY6A 3QAVA 1X5EA 4DSRA 1Y25A 2KUCA 1XWKA 4IELA 5A1NB 3DWVA 2OBIA 4OCEA 5E4WA 4KE3A 3ZLPA 4ZB7A 2F9SA 3FKFA 2HRKA 3VPQA 1MD3A 1E6BA 1WOUA 4F82A 3RDWA 1QQ2A 5EPFA 4WR5A 2EFHA 1GLPA 3U5RE 5DALB 5D9VA 3LXZA 3EC3A 4O5UA 5JWOB 2K8VA 4OFTA 1TRUA 3CTGA 1XW9A 4G01A 5CO3A 4PQIA 4CHSA 1JZWA 1X5DA 2JADA 1X9SB 1YQ1A 2YWOA 3U6VA 2DIZA 4V2MA 2GSSA 5DDLA 4Z2UA 5J47A 2H1BA 2AJQB 1A24A 2LKUA 14GSA 3K8NA 2WRTA 1G6WA 4KW6A 2HRNA 4HZ4A 4TW5A 4BIKA 4ECCA 3D6IA 2BTOT 3I9V2 5ID2A 5DCHA 1QUWA 1TRVA 1Z6MA 16GSA 4TOPA 2JSZA 2GQKA 1TU7A 1B4QA 2L5LA 3TJKA 4TR3A 1AQVA 2MMOA 3N5OA 5BMUB 2YWNA 4I97A 3M9JA 1XBSA 3D0ZA 2V41A 1S3CA 2KP2A 4YH2A 2LJAA 3FHKA 1EP8A 3GFKA 1FVKA 5B7CA 3VWUA 2AHEA 4K0NA 3VURA 1A8YA 4G0KA 4L0WA 3M8NA 2C8UA 5ECMB 3KP8A 3TU3B 3L9SA 1S4BP 1Y1UA 2IFQB 1OC8A 2VLUA 4XIHA 20GSA 2E0QA 1OC9A 5A5HA 1QK8A 4KDYA 1GUMA 5JCWA 5ECQB 5G5EA 1M99A 1R7HA 5DCGA 1TK0B 1TI3A 4TR1B 5AN1A 2IL3A 1GL8A 2CVDA 1XW6A 3HXSA 5A4VA 3KXOA 4YAPA 4BL7B 2WW2A 3D21A 3FZ5A 2L59A 4AGSA 5GZZB 4L5LA 2HSMB 2VL9A 3CBUA 4MH3A 4I6XA 1RK4A 1OAZA 3LSZA 5GAPD 3IA1A 2ZUPA 2QC7A 3ERWA 3D22A 5HFIA 1FW1A 4Q5QA 3PINA 2FWFA 1FOVA 3LYPA 5G31A 4MK3A 1VGLA 3EPTA 4XS1A 1K0AA 4AJ7A 1XZOA 3TKSC 1AUCA 2HZEB 3CQFA 1RQMA 1YEWC 6GSYA 5ELAA 3KMNA 3ZZXA 2TRCP 2H74A 2P0GA 2I4AA 3J7Yk 2JL4A 4V2LA 3HVNA 8GSSA 1TOFA 2VCTA 5ENUA 1SK2A 3LJRA 2R6KA 2PVOC 2V1MA 3FK8A 1BG1A 3UOMA 3KZQA 4AKXB 3GNJA 2O7KA 2GSQA 4PI0C 1AC1A 1PQNA 3ZMLA 2OBKA 5BRTA 2CX4A 4OWYA 4WBJA 2P5RA 4V1Ap 4EUYA 3ME8A 3QPMA 1M9BA 4PTSA 2R3XA 2MYGA 1EOGA 3GV1A 3SWLA 4WBRD 22GSA 2DKHA 1K3LA 1JLWA 1YKCA 2KLXA 2O87A 5F07A 2VCVA 5A4WA 2R0CA 4NMUA 2H76A 2VCWA 1W4VA 5AISA 2JACA 2MMNA 2BMXA 2F8AA 3C8EA 5E59A 5CP1A 4HEA2 4PUAA 3HA9A 2H0GA 3PH9A 1KTEA 5D9WA 3TRPA 3GSSA 2H1GA 2KP1A 4IN0A 1BX9A 3F8UA 4ZB6A 4BPYA 3M3MA 5JWRB 1EV4A 4ZB8A 1O7UA 2NVLA 4WR4A 3O76A 10GSA 3S9FA 2H6XA 4K7OA 4GWRA 4LL4B 3W8JA 3TKSA 1G7OA 2NTOA 2LSTA 1E2YA 1S3AA 3DVWA 1PMTA 1EP7A 1GULA 3APOA 5B8BA 4KA0A 4MMMA 2J9HA 2GS3A 1BF5A 4KSMA 4ZXGA 3F0IA 4I2UA 3UL3A 1GTIA 2CQ9A 4XS4B 1NW2A 3QD9A 1SYRA 2L6DA 5ECLB 2J23A 2GSRA 1XCCA 2GSTA 4RUVA 1OE7A 2RIIA 2REMA 5ECPB 3VI7A 1VF1A 1GTAA 3GUSA 1KBNA 4MZCA 3IR4A 1VF3A 4JBBA 3HJOA 3WGDA 4KX4A 4F03A 2HLSA 6GSUA 1XWGA 2O8VB 2ALBA 1SENA 1M2AA 2M80A 2YPMA 2WVYA 4IQ1A 4TXOB 2XHFA 1WRYA 2B1LA 5IO2A 3IK7A 2G0FA 3VWWA 4QQ7A 2IWTA 5L71A 2CV4A 1PX7A 3CSHA 1XIYA 5B6MA 2TIRA 1Z7RA 1S3DA 1GRXA 1GP1A 3L0HA 1FO5A 2C3NA 1PGTA 5EL8A 2YCDA 2HZFA 4ZIJA 4ZB9A 1A0RP 3KP9A 2I1UA 2YJHA 1QFNA 1GSEA 4G9HA 4N0VA 4BVXB 5J5NA 4WEYA 4F2IA 3QCPA 4KDXA 3CSIA 4MA9A 3IHGA 2H70A 5G1KA 1UA5A 4FXYP 3ZIVA 4NHWA 2CAQA 1EWXA 2R0GA 4J56E 2YP6A 2VO4A 3IE3A 4GXZA 2C0EA 4HS1A 3ZIJA 3HJMA 3GMFA 5D9TA 2B1KA 5AGYA 3RPPA 3DIEA 1RW1A 3P7XA 1R26A 4K7IA 1B9XC 2OJLA 3TKQA 4IP1A 2H30A 1T3BA 2H6ZA 3L78A 3DD3A 4X0XA 1I1IP 4I8BA 1TXXA 4ZBDA 1X5CA 5IPHA 2YANA 2RUFA 3BOAA 4PI2C 1ILOA 2FLSA 1UN2A 4N3ZA 2X99A 1JHBA 2MBSA 4YQVA 1HQOA 2YV9A 5DJLA 2JZTA 1K0OA 3H4KA 2VL2A 3HHVA 4AKGA 5DQYA 5KN1A 2DJ1A 3Q19A 4OFMA 3IPZA 2AV4A 2YV7A 4GLTA 2PN8A 1GLQA 3KH7A 4BWSA 3VI5A 4MLYA 2X8CA 3G7YA 4ILFA 5CRHA 4ECBA 4IJ3A 2AB6A 1I9DA 3VPTA 1GTUA 1GSYA 4TRXA 2QA1A 2IMIA 1WMJA 4N11A 2EC4A 1EGRA 1MDJA 5ECKB 1X9MB 1M9AA 3TJFA 3KH9A 1U3IA 2UZ8A 4NXIA 3TJGA 1ZYQB 4HU9A 1KEBA 4E68A 1FB0A 2GDRA 3KGKA 5KOXA 3LG6A 1ZZYA 4EC0A 4RI6A 1V9WA 4MNNA 5A1NA 2LRNA 4POLA 5LNKe 3M1GA 2GQMA 7GSSA 3MDKA 4BVYA 2C0GA 4MJBA 1EEMA 2HRKB 3LYKA 4GSNA 3TGZA 2FCHA 1XFLA 3R2QA 3A2XA 3EU3A 3TCOA 5CRWA 3J7Yb 5KN0A 3HZ4A 4LLRA 1ST9A 4JEDA 5IMCA 2LRTA 1N8JA 1XWAA 3FZAA 3A2WA 1PSQA 5ELGA 5LCZA 2HYXA 4LA1A 3DXBA 3QFAC 1YJ6A 1F3BA 3N9JA 2H73A 2YOIA 2IMFA 3GTUA 4N0ZA 3EINA 3UIWA 3BD2A 2OACA 2PMTA 2JU5A 2VM1A 4FQUA 1OYJA 2I3YA 4A5PA 2E2MA 3LXTA 4MPFA 1ZL9A 2PPTA 1URMA 3MAKA 2IPAA 2VOCA 3TRXA 3UEMA 4WF4A 4HZ2A 1HNBA 2E2GA 1U88A 2C4JA 5G1LA 2YJ7A 1EEJA 3EE2A 3UBLA 1AIUA 2WULA 4K0GA 3M0FA 4PNFA 1HYUA 2IIYA 3MYDA 1O6JA 1GSFA 1SJ6A 4KCEA 2VL3A 3IC8A 4K2DA 1YEXA 4JE1A 1TRSA 4MJCA 4IHUA 4PQHA 1XWBA 4XRDA 5IO0A 3M9KA 3TJBA 2X49A 2I81A 5AIVA 1A23A 2OE0A 3D5JA 1FVJA 1WP0A 3F6FA 1GSUA 2K6VA 1EZKA 3C73A 2CA8A 4EXJA 3A2VA 5HR2A 2B6MA 1M2BA 4HI7A 5A5HB 4GRFA 4OCFA 4MPGA 3GIXA 1Q98A 3TUEA 2HRAA 3BJ5A 3ERFA 3C71A 1JZOA 2VM2A 3GX8A 1MDKA 2MZCA 4GCIA 4CY8A 4BWQA 1TRWA 2LNTA 3AY8A 3QR6A 3H1NA 6GSSA 1GTBA 5H5SA 1K0MA 2HI7A 2KHPA 3FW2A 2HQTA 4BL7A 3GURA 1SK0A 3TKRA 5DJMA 5IMAA 2I9HA 3LW9A 3WD6A 9GSSA 1EV9A 1SJIA 4KB3A 3L9UA 2XBQA 1PL2A 4MF5A 1PL1A 5D93A 2B7KA 3TRQA 1A0FA 1XVWA 2CAIA 3ZMKA 3LFLA 3FZ4A 4XTSA 3TB2A 2LJKA 2QSIA 2YZUA 2IMDA 4ACSA 5IMFA 2GZPA 2QGVA 3LORA 1PFOA 2DJ0A 1ERUA 2B3SA 1SL0B 3HD5A 5EY6A 2DJKA 3DKSA 4O92A 4N30A 2RLIA 2CZ2A 1AW9A 5CRGA 2CZ3A 2LNSA 17GSA 3HDCA 6GSTA 2LQQA 4ECJA 1ERWA 1THOA 5IIZA 2FUG2 5HR1A 2WDUA 1QGVA 2PU9C 13GSA 4WF5A 4PX1A 3LQ7A 2DLXA 4XRAA 4RQXA 4EIQA 1ON4A 1TXUA 1I5GA 1ZYPA 3ZITA 5LD0A 2EIOA 2H72A 4TKYA 2LV3A 1DSBA 3MWHA 4PNGA 2HXKA 5JWQB 5C04A 3SBCA 4IP6A 1BYEA 4OFNA 3G7IA 2R37A 2H19A 4NAXA 1T1VA 4JRRA 4DSSA 2DSAA 2E7PA 3TOUA 2CX3A 2XPEA 3C1RA 1IYHA 4HJMA 2JZRA 3FEUA 5CREA 2H01A 3R3EA 4K5RA 4FYUA 1M2DA 4H86A 4IGJA 3H79A 3GH6A 2X8GA 3FZ9A 2CVBA 4I2TA 1ZGNA 5ECIB 3I69A 2EIQA 5ECOB 2RM6A 3JCML 4X1UA 4EL1A 3RHBA 2GT6A 3KMOA 2YN1A 1GSQA 3G7JA 4MCUA 1XW5A 1GNEA 5J4UA 4HUAA 1OKDA 2X8HA 2PWJA 3IC4A 3FRCA 1A2MA 4PXOA 3H93A 1TDIA 1FOHA 1YF0A 3VWXA 1CQGA 1V98A 4IKHA 2ES7A 4FO5A 1YZXA 2L6CA 3QDNA 1TKDB 4EKZA 4KH7A 2H0IA 3W6GA 3BCIA 5IPGA 3RPNA 1B8XA 2FHEA 4DSQA 4EO3A 1BEDA 4K7NA 2FA8A 4TR0A 4DVCA 1VF2A 1VRSD 1B4PA 4HU7A 4AJ6A 1SVOA 4K9ZA 4XS4A 3IV4A 2CVKA 1LBKA 3KTBA 3HYPA 3EMPA 2VLVA 1TK5B 1A2LA 2HSNB 4EIPA 2H1LA 4O7HA 3FYGA 2V32A 1XOAA 2AYTA 3DRNA 1EGOA 2VL2C 2H1DA 4PUFC 4ICYA 3FR6A 4KCAA 2X4AA 2B5EA 3A3TA 3L4NA 1K0CA 2DIYA 5CNWA 4TR4A 3V1WA 1TP9A 4TXOA 4YKGA 4PQ1A 3KTLA 1J9BA 5GSSA 4Q5RA 1ML6A 3GKMA 1OC3A 2DMMA 2VKZG 3DGQA 2BJXA 1NHOA 3UMAA 2L4QA 1PX6A 2XBIA 3E9JB 3ZYWA 1X9WB 5D9XA 1Z9HA 3NZNA 1U6TA 4OD7A 4ID0A 2OA7A 4IQAA 2C0DA 2HFDA 5CAXA 1BJXA 1JZDA 2GZYA 2WVXB 5DQSA 2N5AA 3PPUA 1OVNA 5DBQA 1G0TA 2N5BA 5DAKA 2L5OA 4LL1B 1M7TA 5IM9A 2C3TA 1FB6A 5IOXA 1PD21 3GKKA 3APSA 4PGTA 1WJKA 6GSWA 4XCSA 5J9CA 4LMWA 2YNXA 2A4HA 4NHZA 3Q18A 1ZOFA 2H1AA 2R0PA 1R5AA 4OMVA 5GSTA 1V40A 2WW0A 5D96A 4ULXA 4IVFA 1NM3A 5EVOA 4G2EA 1B9YC 1G7EA 1PN9A 1H4OA 2V6OA 2Z9SA 4YAVA 2HRFA 2FWGA 3Q74A 2IMEA 1BG5A 4GTUA 3VK9A 3IAS2 1Q4JA 4O5QA 2C1YA 2ZCTA 1SKSB 2C0FA 4KAEA 2IN3A 3ZVJA 2F3MA 1J0FA 5D8IA 5B8AA 3RFRC 2V2GA 1ERTA 2A2SA 4CW9A 4L8EA 3DMLA 3CHXC 1YVLA 1O85A 4HQZA 2AAWA 1R4WA 3VWVA 3W8SA 1PRXA 2EIRA 4K2XA 3PGTA 3CRUA 4D73A 3ERGA 3ME7A 3RAZA 1LU4A 2LRCA 3QAWA 1XVQA 4P3YB 3GHAA 2XC2A 3TDGA 4PHZC 4I5QA 2DC5A 3CYNA 3E3EA 1O81A 3WYWA 3GKXA 3QMXA 5CRDA 2FNOA 1IYIA 2IJYA 2NBSA 5A34B 4W66A 1NSWA 3IOSA 4G0IA 1TTZA 1T00A 5ECHB 3F63A 2M46A 2K18A 4JU5A 5DVBA 2GVPA 3IAM2 1UVZA 1GUHA 3HY2A 1XG8A 1PKZA 2LTKA 2GTUA 1WE0A 4HOJA 4GDFA 4ML6A 1SYXA 1SL2B 3ZRDA 4ZBBA 5FWGA 2DMLA 5HFGA 2WJUA 3ZFLA 4BVYB 2NDOA 1SKWB 1JLVA 1UC7A 2FGXA 5J3RA 3FMWA 4USSA 5FHIA 4Z2RA 2H71A 1FAAA 4NPBA 4TXVA 5DALA 2KOKA 5F05A 4G19A 2GQLA 4WXTA 3TKPA 4EDZA 3CWGA 4KSOA 4EVMA 3HCZA 4GF0A 4CDOA 4PURA 3E0UA 2PGTA 1SVMA 4ZBAA 3EU4A 3VLNA 1FG4A 3IHQA 3GL3A 3WT2A 5KN2A 3WGXA 1WPIA 2LJRA 4IBPA 4RQRA 2OE3A 4Z7XA 1TW9A 4MF6A 1O8XA 1GWCA 4GSSA 1V57A 3GTUB 3GN3A 4GSTA 1F37A 3LGCA 1ZYNA 3EURA 2HSYA 5G2ZA 3BBYA 2VIMA 18GSA 1J08A 5D73A 1SD9A 3OR5A 5HR0A 1V58A 4KF9A 1GH2A 1TU8A 5ID2B 1XWCA 4LMVA 2VAFA 3L9VA 1TJDA 2C80A 1ZYEA 3RHCA 1K0BA 2LUSA 4XS6A 4K8MA 4YKFA 2ON5A 4QMKA 1THXA 1YY7A 1ZMAA 1V2AA 2FWHA 5BMUA 1LJRA 3HZ8A 1H75A 4KNDA 3CRTA 2MBTA 4HSCX 3F9UA 1Z7PA 1DE1A 1YF1A 3CSJA 5KOWA 3F3RA 3QFBC 4HDEA 5ECSA 5IOWA 2OT3A 1VF4A 2OADA 1SJZA 2IFQA 3ZVJD 1K0DA 3EWLA 3KEBA 4MZWA 2DJ3A 2RM5A 3GRXA 3UAPA 4BA7A 1OC9B 4FIWA 1ERVA 3WT1A 3GX0A 1BQ7A 1SL1B 4AI6A 1AXDA 2O5VA 5H5RA 4K6XA 4O5RA 5J9BA 5JCGA 1M3JA 2XPDA 5J4VA 1BAYA 3F4RA 1TK8B 4TR1A 4MF7A 2GZZA 3UBKA 2ON7A 3TOTA 3D4MA 1PKWA 3IBHA 4GQCA 4AJ8A 1MTCA 5J41A 4FYCA 3F3QA 1U3AA 3ED3A 2TRXA 3FY7A 2UV8G 2G2QA 3F6DA 2HSMA 1HNAA 1AQXA 1Z5YE 3IRAA 1FHEA 2GGTA 2R2JA 2NPBA 2O89A 4EDYA 1OKTA 3EVIA 2A2PA 2WZ9A 3EYTA 4F0CA 2L4CA 4J2FA 4G10A 2DJJA 3KCMA 4JR6A 5KN3A 2RUEA 4MJEA 4O32A 4TVEA 11GSA 2B5YA 3UJ1A 4HQSA 4RI7A 2D2ZA 1HD2A 1AAZA 1QMVA 4NV2A 4NWYA 4XHMA 1Y6EA 1KNGA 2HZEA 2H75A 4WETA 4NV5A 1T4YA 3IK9A 2GT5A 2HE3A 2HNLA 1Z3EA 1USBA 3LEFA 4Z2TA 5J4YA 1SU9A 4L5OA 4E8EA 1M3IA 1O8WA 3P2AA 1F3AA 2PVQA 2B5XA 1MEKA 4AKIA 3HMJG 2OE1A 4V2NA 4HJ2A 2GLRA 1ZCPA 1N25A 4ISDA 4J57E 19GSA 3ZREA 3HVSA 4JR4A 4MJAA 4DEJA 2ZNMA 1GNWA 2PBJA 4IS0A 2JZSA 1T8EB 3UARA 1SD8A 1Z6NA 2FY6A 1R5PA 3EMXA 2F8FA 2WFCA 5A5KA 3D4TA 3P90A 5GAND 2MMZA 4ZL8A 2VCXA 3QOUA 1GUKA 4KUNA 2R5GA 4DSSB 2DBCA 4AKHA 5IMVA 4F9ZA 1XOBA 1HNCA 3HJPA 3DEXA 2VCZA 5FT3A 5IMZA 2A2RA 4MZBA 3RGBC 1K3OA 4YQUA 3H8QA 5HQPA 6GSXA 4N10A 3A5WA 1O73A 2CT6A 4OO4A 4K5SA 4OO5A 3VFIA 2OKAA 3APQA 1PA3A 3NIVA 3GYKA 2VD0A 4ZL9A 1DUGA 3LWAA 2H0HA 4IJIA 2WZSA 1M0UA 5ECNB 3C7MA 1ABAA 5F0GA 2YZHA 5IQYA 4X4JA 2EFCA 4Q5NA 5ECRB 2VCQA 2WS2A 1W89A 2N5FA 2A4VA 1XXUA 3IDVA 3HVVA 3BCKA 1K0NA 2WW3A 4F0BA 2WVZA 3TJJA 3HVXA 5G5FA 6GSVA 5J40A 2X64A 5COHA 1PN0A 3MNGA 5CYYA 5F06A 4GQFA 1NHYA 2P5QA 3ZL5A 1SK1A 2O85A 2HSNA 2L57A 2EFDA 1B48A 5F8BA 2H66A 3GKNA 4G0LA
chains in the Genus database with same CATH topology
2LEGA 1N2AA 2F51A 1SVLA 2DKIA 3US3A 5C00A 4WKWA 3MIXA 2WB9A 2QKEA 2V6KA 1K3YA 1F2EA 3ZTLA 1SKRB 3CTFA 3A5IA 4YQMA 3ZFBA 1F9MA 2K9FA 2HSHA 2K8SA 1WIKA 4FH8A 4L0UA 2FD3A 4MP4A 2WGRA 4AF2A 3RBTA 2WCIA 1MD4A 3G9BA 2FA4A 5KEJA 3Q6OA 3GA4A 5JCUA 3CMIA 3HKRA 3UVTA 1YEPA 4MABA 4IW9A 3KIJA 4BVXA 4ECIA 1C72A 4POMA 1ACVA 1CQHA 2VD1A 12GSA 5DAKB 3KJYA 3PR8A 4Q5FA 4QL7A 3WGEA 4V1Ag 3NOFA 4K1FA 3KD0A 3C1SA 4ZILA 1JFUA 2MMAA 5A4UA 3IXRA 3MSZA 1T4ZA 4MH2A 5G30A 2QA2A 2IMKA 2PUKC 4POBA 2DJ2A 1G6YA 3UVHA 3P8WA 5HR3A 3GSTA 1U87A 3I6AA 4ZL7A 2JSYA 3TKSE 1DE2A 2LS5A 2VUPA 1DBYA 1JZRA 2EFEA 2YWIA 3ISOA 2FWEA 1T7PB 2H6YA 1AQWA 1TI1A 4KGIA 1MDIA 4KDUA 5ABRA 2M72A 1YKAA 3DVXA 2C3QA 3FR9A 1A2JA 1X0RA 2VLTA 3FR3A 2B7JA 2AUVA 1XPVA 2YWMA 2HT9A 4EF0A 4MDCA 4EE0A 3I43A 1QXHA 1OE8A 2LQOA 1A8LA 1WWJA 4D73B 5INYA 5AIXA 4QL9A 4ML1A 3O3TA 3DYRA 3KM6A 2R4VA 1GSSA 2PERA 4JZQA 2P31A 5HFKA 4E8HA 3O6TA 4FYBA 1EOHA 1GSDA 5IMDA 3QAGA 3GL5A 4TN8A 1YDKA 3F4SA 4X43A 3F4TA 5A34A 3CXGA 4POKA 3GH9A 2H8LA 5H5QA 1F6MC 5B6NA 4CY6A 3QAVA 1X5EA 4DSRA 1Y25A 2KUCA 1XWKA 4IELA 5A1NB 3DWVA 2OBIA 4OCEA 5E4WA 4KE3A 3ZLPA 4ZB7A 2F9SA 3FKFA 2HRKA 3VPQA 1MD3A 1E6BA 1WOUA 4F82A 3RDWA 1QQ2A 5EPFA 4WR5A 2EFHA 1GLPA 3U5RE 5DALB 5D9VA 3LXZA 3EC3A 4O5UA 5JWOB 2K8VA 4OFTA 1TRUA 3CTGA 1XW9A 4G01A 5CO3A 4PQIA 4CHSA 1JZWA 1X5DA 2JADA 1X9SB 1YQ1A 2YWOA 3U6VA 2DIZA 4V2MA 2GSSA 5DDLA 4Z2UA 5J47A 2H1BA 2AJQB 1A24A 2LKUA 14GSA 3K8NA 2WRTA 1G6WA 4KW6A 2HRNA 4HZ4A 4TW5A 4ECCA 3D6IA 2BTOT 3I9V2 5ID2A 5DCHA 1QUWA 1TRVA 1Z6MA 16GSA 4TOPA 2JSZA 2GQKA 1TU7A 1B4QA 2L5LA 3TJKA 4TR3A 1AQVA 2MMOA 3N5OA 5BMUB 2YWNA 4I97A 3M9JA 1XBSA 3D0ZA 2V41A 1S3CA 2KP2A 4YH2A 2LJAA 3FHKA 1EP8A 3GFKA 1FVKA 5B7CA 3VWUA 2AHEA 4K0NA 3VURA 1A8YA 4G0KA 4L0WA 3M8NA 2C8UA 5ECMB 3KP8A 3TU3B 3L9SA 1Y1UA 2IFQB 1OC8A 2VLUA 4XIHA 20GSA 2E0QA 1OC9A 5A5HA 1QK8A 4KDYA 1GUMA 5JCWA 5ECQB 5G5EA 1M99A 1R7HA 5DCGA 1TK0B 1TI3A 4TR1B 5AN1A 2IL3A 1GL8A 2CVDA 1XW6A 3HXSA 5A4VA 3KXOA 4YAPA 4BL7B 3D21A 3FZ5A 2L59A 4AGSA 5GZZB 4L5LA 2HSMB 2VL9A 3CBUA 4MH3A 4I6XA 1RK4A 1OAZA 3LSZA 5GAPD 3IA1A 2ZUPA 2QC7A 3ERWA 3D22A 5HFIA 1FW1A 4Q5QA 3PINA 2FWFA 1FOVA 3LYPA 5G31A 4MK3A 1VGLA 3EPTA 4XS1A 1K0AA 4AJ7A 1XZOA 3TKSC 1AUCA 2HZEB 1RQMA 6GSYA 5ELAA 3KMNA 3ZZXA 2TRCP 2H74A 2P0GA 2I4AA 3J7Yk 2JL4A 4V2LA 8GSSA 1TOFA 2VCTA 5ENUA 1SK2A 3LJRA 2R6KA 2PVOC 2V1MA 3FK8A 1BG1A 3UOMA 3KZQA 4AKXB 3GNJA 2O7KA 2GSQA 1AC1A 1PQNA 3ZMLA 2OBKA 5BRTA 2CX4A 4OWYA 4WBJA 2P5RA 4V1Ap 4EUYA 3ME8A 3QPMA 1M9BA 4PTSA 2R3XA 2MYGA 1EOGA 3GV1A 3SWLA 4WBRD 22GSA 2DKHA 1K3LA 1JLWA 1YKCA 2KLXA 2O87A 5F07A 2VCVA 5A4WA 2R0CA 4NMUA 2H76A 2VCWA 1W4VA 5AISA 2JACA 2MMNA 2BMXA 2F8AA 3C8EA 5E59A 5CP1A 4HEA2 4PUAA 3HA9A 2H0GA 3PH9A 1KTEA 5D9WA 3TRPA 3GSSA 2H1GA 2KP1A 4IN0A 1BX9A 3F8UA 4ZB6A 4BPYA 3M3MA 5JWRB 1EV4A 4ZB8A 1O7UA 2NVLA 4WR4A 3O76A 10GSA 3S9FA 2H6XA 4K7OA 4GWRA 4LL4B 3W8JA 3TKSA 1G7OA 2NTOA 2LSTA 1E2YA 1S3AA 3DVWA 1PMTA 1EP7A 1GULA 3APOA 5B8BA 4KA0A 4MMMA 2J9HA 2GS3A 1BF5A 4KSMA 4ZXGA 3F0IA 4I2UA 3UL3A 1GTIA 2CQ9A 4XS4B 1NW2A 3QD9A 1SYRA 2L6DA 5ECLB 2J23A 2GSRA 1XCCA 2GSTA 4RUVA 1OE7A 2RIIA 2REMA 5ECPB 3VI7A 1VF1A 1GTAA 3GUSA 1KBNA 4MZCA 3IR4A 1VF3A 4JBBA 3HJOA 3WGDA 4KX4A 4F03A 2HLSA 6GSUA 1XWGA 2O8VB 2ALBA 1SENA 1M2AA 2M80A 2YPMA 4IQ1A 4TXOB 2XHFA 1WRYA 2B1LA 5IO2A 3IK7A 2G0FA 3VWWA 4QQ7A 2IWTA 5L71A 2CV4A 1PX7A 3CSHA 1XIYA 5B6MA 2TIRA 1Z7RA 1S3DA 1GRXA 1GP1A 3L0HA 1FO5A 2C3NA 1PGTA 5EL8A 2YCDA 2HZFA 4ZIJA 4ZB9A 1A0RP 3KP9A 2I1UA 2YJHA 1QFNA 1GSEA 4G9HA 4N0VA 4BVXB 5J5NA 4WEYA 4F2IA 3QCPA 4KDXA 3CSIA 4MA9A 3IHGA 2H70A 5G1KA 1UA5A 3ZIVA 4NHWA 2CAQA 1EWXA 2R0GA 4J56E 2YP6A 2VO4A 3IE3A 4GXZA 2C0EA 4HS1A 3ZIJA 3HJMA 3GMFA 5D9TA 2B1KA 5AGYA 3RPPA 3DIEA 1RW1A 3P7XA 1R26A 4K7IA 1B9XC 2OJLA 3TKQA 4IP1A 2H30A 1T3BA 2H6ZA 3L78A 3DD3A 4X0XA 4I8BA 1TXXA 4ZBDA 1X5CA 5IPHA 2YANA 2RUFA 3BOAA 1ILOA 2FLSA 1UN2A 4N3ZA 2X99A 1JHBA 2MBSA 4YQVA 1HQOA 2YV9A 5DJLA 2JZTA 1K0OA 3H4KA 2VL2A 3HHVA 4AKGA 5DQYA 5KN1A 2DJ1A 3Q19A 4OFMA 3IPZA 2AV4A 2YV7A 4GLTA 2PN8A 1GLQA 3KH7A 4BWSA 3VI5A 4MLYA 2X8CA 3G7YA 4ILFA 5CRHA 4ECBA 4IJ3A 2AB6A 1I9DA 3VPTA 1GTUA 1GSYA 4TRXA 2QA1A 2IMIA 1WMJA 4N11A 2EC4A 1EGRA 1MDJA 5ECKB 1X9MB 1M9AA 3TJFA 3KH9A 1U3IA 2UZ8A 4NXIA 3TJGA 1ZYQB 4HU9A 1KEBA 4E68A 1FB0A 2GDRA 3KGKA 5KOXA 3LG6A 1ZZYA 4EC0A 4RI6A 1V9WA 4MNNA 5A1NA 2LRNA 4POLA 5LNKe 3M1GA 2GQMA 7GSSA 3MDKA 4BVYA 2C0GA 4MJBA 1EEMA 2HRKB 3LYKA 4GSNA 3TGZA 2FCHA 1XFLA 3R2QA 3A2XA 3EU3A 3TCOA 5CRWA 3J7Yb 5KN0A 3HZ4A 4LLRA 1ST9A 4JEDA 5IMCA 2LRTA 1N8JA 1XWAA 3FZAA 3A2WA 1PSQA 5ELGA 5LCZA 2HYXA 4LA1A 3DXBA 3QFAC 1YJ6A 1F3BA 3N9JA 2H73A 2YOIA 2IMFA 3GTUA 4N0ZA 3EINA 3UIWA 3BD2A 2OACA 2PMTA 2JU5A 2VM1A 4FQUA 1OYJA 2I3YA 4A5PA 2E2MA 3LXTA 4MPFA 1ZL9A 2PPTA 1URMA 3MAKA 2IPAA 2VOCA 3TRXA 3UEMA 4WF4A 4HZ2A 1HNBA 2E2GA 1U88A 2C4JA 5G1LA 2YJ7A 1EEJA 3EE2A 3UBLA 1AIUA 2WULA 4K0GA 3M0FA 4PNFA 1HYUA 2IIYA 3MYDA 1O6JA 1GSFA 1SJ6A 4KCEA 2VL3A 3IC8A 4K2DA 1YEXA 4JE1A 1TRSA 4MJCA 4IHUA 4PQHA 1XWBA 4XRDA 5IO0A 3M9KA 3TJBA 2X49A 2I81A 5AIVA 1A23A 2OE0A 3D5JA 1FVJA 1WP0A 3F6FA 1GSUA 2K6VA 1EZKA 3C73A 2CA8A 4EXJA 3A2VA 5HR2A 2B6MA 1M2BA 4HI7A 5A5HB 4GRFA 4OCFA 4MPGA 3GIXA 1Q98A 3TUEA 2HRAA 3BJ5A 3ERFA 3C71A 1JZOA 2VM2A 3GX8A 1MDKA 2MZCA 4GCIA 4CY8A 4BWQA 1TRWA 2LNTA 3AY8A 3QR6A 3H1NA 6GSSA 1GTBA 5H5SA 1K0MA 2HI7A 2KHPA 3FW2A 2HQTA 4BL7A 3GURA 1SK0A 3TKRA 5DJMA 5IMAA 2I9HA 3LW9A 3WD6A 9GSSA 1EV9A 1SJIA 4KB3A 3L9UA 2XBQA 1PL2A 4MF5A 1PL1A 5D93A 2B7KA 3TRQA 1A0FA 1XVWA 2CAIA 3ZMKA 3LFLA 3FZ4A 4XTSA 3TB2A 2LJKA 2QSIA 2YZUA 2IMDA 4ACSA 5IMFA 2GZPA 2QGVA 3LORA 2DJ0A 1ERUA 2B3SA 1SL0B 3HD5A 5EY6A 2DJKA 3DKSA 4O92A 4N30A 2RLIA 2CZ2A 1AW9A 5CRGA 2CZ3A 2LNSA 17GSA 3HDCA 6GSTA 2LQQA 4ECJA 1ERWA 1THOA 5IIZA 2FUG2 5HR1A 2WDUA 1QGVA 2PU9C 13GSA 4WF5A 4PX1A 3LQ7A 2DLXA 4XRAA 4RQXA 4EIQA 1ON4A 1TXUA 1I5GA 1ZYPA 3ZITA 5LD0A 2EIOA 2H72A 4TKYA 2LV3A 1DSBA 3MWHA 4PNGA 2HXKA 5JWQB 5C04A 3SBCA 4IP6A 1BYEA 4OFNA 3G7IA 2R37A 2H19A 4NAXA 1T1VA 4JRRA 4DSSA 2DSAA 2E7PA 3TOUA 2CX3A 2XPEA 3C1RA 1IYHA 4HJMA 2JZRA 3FEUA 5CREA 2H01A 3R3EA 4K5RA 4FYUA 1M2DA 4H86A 4IGJA 3H79A 3GH6A 2X8GA 3FZ9A 2CVBA 4I2TA 1ZGNA 5ECIB 3I69A 2EIQA 5ECOB 2RM6A 3JCML 4X1UA 4EL1A 3RHBA 2GT6A 3KMOA 2YN1A 1GSQA 3G7JA 4MCUA 1XW5A 1GNEA 5J4UA 4HUAA 1OKDA 2X8HA 2PWJA 3IC4A 3FRCA 1A2MA 4PXOA 3H93A 1TDIA 1FOHA 1YF0A 3VWXA 1CQGA 1V98A 4IKHA 2ES7A 4FO5A 1YZXA 2L6CA 3QDNA 1TKDB 4EKZA 4KH7A 2H0IA 3W6GA 3BCIA 5IPGA 3RPNA 1B8XA 2FHEA 4DSQA 4EO3A 1BEDA 4K7NA 2FA8A 4TR0A 4DVCA 1VF2A 1VRSD 1B4PA 4HU7A 4AJ6A 1SVOA 4K9ZA 4XS4A 3IV4A 2CVKA 1LBKA 3KTBA 3HYPA 3EMPA 2VLVA 1TK5B 1A2LA 2HSNB 4EIPA 2H1LA 4O7HA 3FYGA 2V32A 1XOAA 2AYTA 3DRNA 1EGOA 2VL2C 2H1DA 4PUFC 4ICYA 3FR6A 4KCAA 2X4AA 2B5EA 3L4NA 3A3TA 1K0CA 2DIYA 5CNWA 4TR4A 3V1WA 1TP9A 4TXOA 4YKGA 4PQ1A 3KTLA 1J9BA 5GSSA 4Q5RA 1ML6A 3GKMA 1OC3A 2DMMA 2VKZG 3DGQA 2BJXA 1NHOA 3UMAA 2L4QA 1PX6A 2XBIA 3E9JB 3ZYWA 1X9WB 5D9XA 1Z9HA 3NZNA 1U6TA 4OD7A 4ID0A 2OA7A 4IQAA 2C0DA 2HFDA 5CAXA 1BJXA 1JZDA 2GZYA 5DQSA 2N5AA 3PPUA 1OVNA 5DBQA 1G0TA 2N5BA 5DAKA 2L5OA 4LL1B 1M7TA 5IM9A 2C3TA 1FB6A 5IOXA 1PD21 3GKKA 3APSA 4PGTA 1WJKA 6GSWA 4XCSA 5J9CA 4LMWA 2YNXA 2A4HA 4NHZA 3Q18A 1ZOFA 2H1AA 2R0PA 1R5AA 4OMVA 5GSTA 1V40A 5D96A 4ULXA 4IVFA 1NM3A 5EVOA 4G2EA 1B9YC 1G7EA 1PN9A 1H4OA 2V6OA 2Z9SA 4YAVA 2HRFA 2FWGA 3Q74A 2IMEA 1BG5A 4GTUA 3VK9A 3IAS2 1Q4JA 4O5QA 2C1YA 2ZCTA 1SKSB 2C0FA 4KAEA 2IN3A 3ZVJA 2F3MA 1J0FA 5D8IA 5B8AA 2V2GA 1ERTA 2A2SA 4CW9A 4L8EA 3DMLA 1YVLA 1O85A 4HQZA 2AAWA 1R4WA 3VWVA 3W8SA 1PRXA 2EIRA 4K2XA 3PGTA 3CRUA 4D73A 3ERGA 3ME7A 3RAZA 1LU4A 2LRCA 3QAWA 1XVQA 4P3YB 3GHAA 2XC2A 3TDGA 4I5QA 2DC5A 3CYNA 3E3EA 1O81A 3WYWA 3GKXA 3QMXA 5CRDA 2FNOA 1IYIA 2IJYA 2NBSA 5A34B 4W66A 1NSWA 3IOSA 4G0IA 1TTZA 1T00A 5ECHB 3F63A 2M46A 2K18A 4JU5A 5DVBA 2GVPA 3IAM2 1UVZA 1GUHA 3HY2A 1PKZA 2LTKA 2GTUA 1WE0A 4HOJA 4GDFA 4ML6A 1SYXA 1SL2B 3ZRDA 4ZBBA 5FWGA 2DMLA 5HFGA 2WJUA 3ZFLA 4BVYB 2NDOA 1SKWB 1JLVA 1UC7A 2FGXA 5J3RA 3FMWA 4USSA 5FHIA 4Z2RA 2H71A 1FAAA 4NPBA 4TXVA 5DALA 2KOKA 5F05A 4G19A 2GQLA 4WXTA 3TKPA 4EDZA 3CWGA 4KSOA 4EVMA 3HCZA 4GF0A 4CDOA 4PURA 3E0UA 2PGTA 1SVMA 4ZBAA 3EU4A 3VLNA 1FG4A 3IHQA 3GL3A 3WT2A 5KN2A 3WGXA 1WPIA 2LJRA 4IBPA 4RQRA 2OE3A 4Z7XA 1TW9A 4MF6A 1O8XA 1GWCA 4GSSA 1V57A 3GTUB 3GN3A 4GSTA 1F37A 3LGCA 1ZYNA 3EURA 2HSYA 5G2ZA 3BBYA 2VIMA 18GSA 1J08A 5D73A 1SD9A 3OR5A 5HR0A 1V58A 4KF9A 1GH2A 1TU8A 5ID2B 1XWCA 4LMVA 2VAFA 3L9VA 1TJDA 2C80A 1ZYEA 3RHCA 1K0BA 2LUSA 4XS6A 4K8MA 4YKFA 2ON5A 4QMKA 1THXA 1YY7A 1ZMAA 1V2AA 2FWHA 5BMUA 1LJRA 3HZ8A 1H75A 4KNDA 3CRTA 2MBTA 3F9UA 1Z7PA 1DE1A 1YF1A 3CSJA 5KOWA 3F3RA 3QFBC 4HDEA 5ECSA 5IOWA 2OT3A 1VF4A 2OADA 1SJZA 2IFQA 3ZVJD 1K0DA 3EWLA 3KEBA 4MZWA 2DJ3A 2RM5A 3GRXA 3UAPA 4BA7A 1OC9B 4FIWA 1ERVA 3WT1A 3GX0A 1BQ7A 1SL1B 4AI6A 1AXDA 2O5VA 5H5RA 4K6XA 4O5RA 5J9BA 5JCGA 2XPDA 5J4VA 1BAYA 3F4RA 1TK8B 4TR1A 4MF7A 2GZZA 3UBKA 2ON7A 3TOTA 3D4MA 1PKWA 3IBHA 4GQCA 4AJ8A 1MTCA 5J41A 4FYCA 3F3QA 1U3AA 3ED3A 2TRXA 3FY7A 2UV8G 2G2QA 3F6DA 2HSMA 1HNAA 1AQXA 1Z5YE 3IRAA 1FHEA 2GGTA 2R2JA 2NPBA 2O89A 4EDYA 1OKTA 3EVIA 2A2PA 2WZ9A 3EYTA 4F0CA 2L4CA 4J2FA 4G10A 2DJJA 3KCMA 4JR6A 5KN3A 2RUEA 4MJEA 4O32A 4TVEA 11GSA 2B5YA 3UJ1A 4HQSA 4RI7A 2D2ZA 1HD2A 1AAZA 1QMVA 4NV2A 4NWYA 4XHMA 1Y6EA 1KNGA 2HZEA 2H75A 4WETA 4NV5A 1T4YA 3IK9A 2GT5A 2HE3A 2HNLA 1Z3EA 1USBA 3LEFA 4Z2TA 5J4YA 1SU9A 4L5OA 4E8EA 1O8WA 3P2AA 1F3AA 2PVQA 2B5XA 1MEKA 4AKIA 3HMJG 2OE1A 4V2NA 4HJ2A 2GLRA 1ZCPA 1N25A 4ISDA 4J57E 19GSA 3ZREA 3HVSA 4JR4A 4MJAA 4DEJA 2ZNMA 1GNWA 2PBJA 4IS0A 2JZSA 1T8EB 3UARA 1SD8A 1Z6NA 2FY6A 1R5PA 3EMXA 2F8FA 2WFCA 5A5KA 3D4TA 3P90A 5GAND 2MMZA 4ZL8A 2VCXA 3QOUA 1GUKA 4KUNA 2R5GA 4DSSB 2DBCA 4AKHA 5IMVA 4F9ZA 1XOBA 1HNCA 3HJPA 3DEXA 2VCZA 5FT3A 5IMZA 2A2RA 4MZBA 1K3OA 4YQUA 3H8QA 5HQPA 6GSXA 4N10A 3A5WA 1O73A 2CT6A 4OO4A 4K5SA 4OO5A 3VFIA 2OKAA 3APQA 1PA3A 3NIVA 3GYKA 2VD0A 4ZL9A 1DUGA 3LWAA 2H0HA 4IJIA 1M0UA 5ECNB 3C7MA 1ABAA 5F0GA 2YZHA 5IQYA 4X4JA 2EFCA 4Q5NA 5ECRB 2VCQA 2WS2A 1W89A 2N5FA 2A4VA 1XXUA 3IDVA 3HVVA 3BCKA 1K0NA 4F0BA 3TJJA 3HVXA 5G5FA 6GSVA 5J40A 2X64A 5COHA 1PN0A 3MNGA 5CYYA 5F06A 4GQFA 1NHYA 2P5QA 3ZL5A 1SK1A 2O85A 2HSNA 2L57A 2EFDA 1B48A 5F8BA 2H66A 3GKNA 4G0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEG A;  1N2A A;  2F51 A;  3US3 A;  5C00 A;  4WKW A;  2WB9 A;  2QKE A;  2V6K A;  1K3Y A;  1F2E A;  3ZTL A;  1SKR B;  3CTF A;  4YQM A;  3ZFB A;  1F9M A;  2K9F A;  2HSH A;  2K8S A;  1WIK A;  4FH8 A;  4L0U A;  2FD3 A;  4MP4 A;  2WGR A;  4AF2 A;  3RBT A;  2WCI A;  1MD4 A;  3G9B A;  2FA4 A;  5KEJ A;  3Q6O A;  3GA4 A;  5JCU A;  3CMI A;  3HKR A;  3UVT A;  1YEP A;  4MAB A;  4IW9 A;  3KIJ A;  4BVX A;  4ECI A;  1C72 A;  4POM A;  1ACV A;  1CQH A;  2VD1 A;  12GS A;  5DAK B;  3KJY A;  3PR8 A;  4Q5F A;  4QL7 A;  3WGE A;  4V1A g;  3NOF A;  4K1F A;  3KD0 A;  3C1S A;  4ZIL A;  1JFU A;  2MMA A;  5A4U A;  3IXR A;  3MSZ A;  1T4Z A;  4MH2 A;  5G30 A;  2IMK A;  2PUK C;  4POB A;  2DJ2 A;  1G6Y A;  3UVH A;  3P8W A;  5HR3 A;  3GST A;  1U87 A;  3I6A A;  4ZL7 A;  2JSY A;  3TKS E;  1DE2 A;  2LS5 A;  2VUP A;  1DBY A;  1JZR A;  2YWI A;  3ISO A;  2FWE A;  1T7P B;  2H6Y A;  1AQW A;  1TI1 A;  4KGI A;  1MDI A;  4KDU A;  5ABR A;  2M72 A;  1YKA A;  3DVX A;  2C3Q A;  3FR9 A;  1A2J A;  1X0R A;  2VLT A;  3FR3 A;  2B7J A;  2AUV A;  1XPV A;  2YWM A;  2HT9 A;  4EF0 A;  4MDC A;  4EE0 A;  3I43 A;  1QXH A;  1OE8 A;  2LQO A;  1A8L A;  1WWJ A;  4D73 B;  5INY A;  5AIX A;  4QL9 A;  4ML1 A;  3O3T A;  3DYR A;  3KM6 A;  2R4V A;  1GSS A;  2PER A;  4JZQ A;  2P31 A;  5HFK A;  4E8H A;  3O6T A;  4FYB A;  1EOH A;  1GSD A;  5IMD A;  3QAG A;  3GL5 A;  4TN8 A;  1YDK A;  3F4S A;  4X43 A;  3F4T A;  3CXG A;  4POK A;  3GH9 A;  2H8L A;  5H5Q A;  1F6M C;  5B6N A;  3QAV A;  1X5E A;  4DSR A;  1Y25 A;  2KUC A;  1XWK A;  4IEL A;  3DWV A;  2OBI A;  4OCE A;  5E4W A;  4KE3 A;  3ZLP A;  2F9S A;  3FKF A;  2HRK A;  3VPQ A;  1MD3 A;  1E6B A;  1WOU A;  4F82 A;  3RDW A;  1QQ2 A;  5EPF A;  4WR5 A;  1GLP A;  3U5R E;  5DAL B;  5D9V A;  3LXZ A;  3EC3 A;  5JWO B;  2K8V A;  4OFT A;  1TRU A;  3CTG A;  1XW9 A;  5CO3 A;  4PQI A;  4CHS A;  1JZW A;  1X5D A;  2JAD A;  1X9S B;  1YQ1 A;  2YWO A;  3U6V A;  2DIZ A;  4V2M A;  2GSS A;  5DDL A;  1A24 A;  2H1B A;  2AJQ B;  2LKU A;  14GS A;  3K8N A;  2WRT A;  1G6W A;  4KW6 A;  2HRN A;  4HZ4 A;  4TW5 A;  4ECC A;  3D6I A;  2BTO T;  3I9V 2;  5ID2 A;  5DCH A;  1QUW A;  1TRV A;  1Z6M A;  16GS A;  4TOP A;  2JSZ A;  2GQK A;  1TU7 A;  1B4Q A;  2L5L A;  3TJK A;  4TR3 A;  1AQV A;  2MMO A;  3N5O A;  2YWN A;  4I97 A;  3M9J A;  1XBS A;  3D0Z A;  2V41 A;  1S3C A;  2KP2 A;  4YH2 A;  2LJA A;  3FHK A;  1EP8 A;  3GFK A;  1FVK A;  5B7C A;  3VWU A;  2AHE A;  4K0N A;  3VUR A;  1A8Y A;  4G0K A;  4L0W A;  3M8N A;  2C8U A;  5ECM B;  3KP8 A;  3L9S A;  2IFQ B;  1OC8 A;  2VLU A;  4XIH A;  20GS A;  2E0Q A;  1OC9 A;  1QK8 A;  4KDY A;  1GUM A;  5JCW A;  5ECQ B;  5G5E A;  1M99 A;  1R7H A;  5DCG A;  1TK0 B;  1TI3 A;  4TR1 B;  5AN1 A;  2IL3 A;  1GL8 A;  2CVD A;  1XW6 A;  3HXS A;  5A4V A;  3KXO A;  4YAP A;  4BL7 B;  3D21 A;  3FZ5 A;  2L59 A;  4AGS A;  5GZZ B;  4L5L A;  2HSM B;  2VL9 A;  3CBU A;  4MH3 A;  4I6X A;  1RK4 A;  1OAZ A;  3LSZ A;  5GAP D;  3IA1 A;  2ZUP A;  2QC7 A;  3ERW A;  3D22 A;  5HFI A;  1FW1 A;  4Q5Q A;  3PIN A;  2FWF A;  1FOV A;  3LYP A;  5G31 A;  4MK3 A;  1VGL A;  4XS1 A;  1K0A A;  4AJ7 A;  1XZO A;  3TKS C;  1AUC A;  2HZE B;  1RQM A;  6GSY A;  5ELA A;  3KMN A;  3ZZX A;  2TRC P;  2H74 A;  2P0G A;  2I4A A;  3J7Y k;  2JL4 A;  4V2L A;  8GSS A;  1TOF A;  2VCT A;  5ENU A;  1SK2 A;  3LJR A;  2R6K A;  2PVO C;  2V1M A;  3FK8 A;  3UOM A;  3KZQ A;  3GNJ A;  2O7K A;  2GSQ A;  1AC1 A;  1PQN A;  3ZML A;  2OBK A;  2CX4 A;  4OWY A;  4WBJ A;  2P5R A;  4V1A p;  4EUY A;  3ME8 A;  3QPM A;  1M9B A;  4PTS A;  2R3X A;  2MYG A;  1EOG A;  3GV1 A;  3SWL A;  4WBR D;  22GS A;  1K3L A;  1JLW A;  1YKC A;  2KLX A;  2O87 A;  5F07 A;  2VCV A;  5A4W A;  4NMU A;  2H76 A;  2VCW A;  1W4V A;  5AIS A;  2JAC A;  2MMN A;  2BMX A;  2F8A A;  3C8E A;  5E59 A;  5CP1 A;  4HEA 2;  4PUA A;  3HA9 A;  2H0G A;  3PH9 A;  1KTE A;  5D9W A;  3TRP A;  3GSS A;  2H1G A;  2KP1 A;  4IN0 A;  1BX9 A;  3F8U A;  4ZB6 A;  4BPY A;  3M3M A;  5JWR B;  1EV4 A;  4ZB8 A;  1O7U A;  2NVL A;  4WR4 A;  3O76 A;  10GS A;  3S9F A;  2H6X A;  4K7O A;  4GWR A;  4LL4 B;  3W8J A;  3TKS A;  1G7O A;  2NTO A;  2LST A;  1E2Y A;  1S3A A;  3DVW A;  1PMT A;  1EP7 A;  1GUL A;  3APO A;  5B8B A;  4KA0 A;  4MMM A;  2J9H A;  2GS3 A;  4KSM A;  4ZXG A;  3F0I A;  4I2U A;  3UL3 A;  1GTI A;  2CQ9 A;  4XS4 B;  1NW2 A;  3QD9 A;  1SYR A;  2L6D A;  5ECL B;  2J23 A;  2GSR A;  1XCC A;  2GST A;  4RUV A;  1OE7 A;  2RII A;  2REM A;  5ECP B;  3VI7 A;  1VF1 A;  1GTA A;  3GUS A;  1KBN A;  4MZC A;  3IR4 A;  1VF3 A;  4JBB A;  3HJO A;  3WGD A;  4KX4 A;  4F03 A;  2HLS A;  6GSU A;  1XWG A;  2O8V B;  2ALB A;  1SEN A;  1M2A A;  2M80 A;  2YPM A;  4IQ1 A;  4TXO B;  2XHF A;  1WRY A;  2B1L A;  5IO2 A;  3IK7 A;  2G0F A;  3VWW A;  4QQ7 A;  2IWT A;  5L71 A;  2CV4 A;  1PX7 A;  3CSH A;  1XIY A;  5B6M A;  2TIR A;  1Z7R A;  1S3D A;  1GRX A;  1GP1 A;  3L0H A;  1FO5 A;  2C3N A;  1PGT A;  5EL8 A;  2YCD A;  2HZF A;  4ZIJ A;  4ZB9 A;  1A0R P;  3KP9 A;  2I1U A;  2YJH A;  1QFN A;  1GSE A;  4G9H A;  4N0V A;  4BVX B;  5J5N A;  4WEY A;  4F2I A;  3QCP A;  4KDX A;  3CSI A;  4MA9 A;  2H70 A;  5G1K A;  1UA5 A;  3ZIV A;  4NHW A;  2CAQ A;  1EWX A;  4J56 E;  2YP6 A;  2VO4 A;  3IE3 A;  4GXZ A;  2C0E A;  4HS1 A;  3ZIJ A;  3HJM A;  3GMF A;  5D9T A;  2B1K A;  5AGY A;  3RPP A;  3DIE A;  1RW1 A;  3P7X A;  1R26 A;  4K7I A;  1B9X C;  2OJL A;  3TKQ A;  4IP1 A;  2H30 A;  1T3B A;  2H6Z A;  3L78 A;  3DD3 A;  4X0X A;  4I8B A;  1TXX A;  4ZBD A;  1X5C A;  5IPH A;  2YAN A;  2RUF A;  3BOA A;  1ILO A;  2FLS A;  1UN2 A;  2X99 A;  1JHB A;  2MBS A;  4YQV A;  1HQO A;  2YV9 A;  5DJL A;  2JZT A;  1K0O A;  3H4K A;  2VL2 A;  3HHV A;  5DQY A;  5KN1 A;  2DJ1 A;  3Q19 A;  4OFM A;  3IPZ A;  2AV4 A;  2YV7 A;  4GLT A;  2PN8 A;  1GLQ A;  3KH7 A;  4BWS A;  3VI5 A;  4MLY A;  2X8C A;  3G7Y A;  4ILF A;  5CRH A;  4ECB A;  4IJ3 A;  2AB6 A;  1I9D A;  3VPT A;  1GTU A;  1GSY A;  4TRX A;  2IMI A;  1WMJ A;  4N11 A;  2EC4 A;  1EGR A;  1MDJ A;  5ECK B;  1X9M B;  1M9A A;  3TJF A;  3KH9 A;  1U3I A;  2UZ8 A;  4NXI A;  3TJG A;  1ZYQ B;  4HU9 A;  1KEB A;  1FB0 A;  2GDR A;  3KGK A;  3LG6 A;  1ZZY A;  4EC0 A;  4RI6 A;  1V9W A;  2LRN A;  4POL A;  5LNK e;  3M1G A;  2GQM A;  7GSS A;  3MDK A;  4BVY A;  2C0G A;  4MJB A;  1EEM A;  2HRK B;  3LYK A;  4GSN A;  3TGZ A;  2FCH A;  1XFL A;  3R2Q A;  3A2X A;  3EU3 A;  3TCO A;  5CRW A;  3J7Y b;  5KN0 A;  3HZ4 A;  4LLR A;  1ST9 A;  4JED A;  5IMC A;  2LRT A;  1N8J A;  1XWA A;  3FZA A;  3A2W A;  1PSQ A;  5ELG A;  5LCZ A;  2HYX A;  4LA1 A;  3DXB A;  3QFA C;  1YJ6 A;  1F3B A;  3N9J A;  2H73 A;  2YOI A;  2IMF A;  3GTU A;  4N0Z A;  3EIN A;  3UIW A;  3BD2 A;  2OAC A;  2PMT A;  2JU5 A;  2VM1 A;  4FQU A;  1OYJ A;  2I3Y A;  2E2M A;  3LXT A;  4MPF A;  1ZL9 A;  2PPT A;  1URM A;  3MAK A;  2IPA A;  2VOC A;  3TRX A;  3UEM A;  4WF4 A;  4HZ2 A;  1HNB A;  2E2G A;  1U88 A;  2C4J A;  5G1L A;  2YJ7 A;  1EEJ A;  3EE2 A;  3UBL A;  1AIU A;  2WUL A;  4K0G A;  3M0F A;  4PNF A;  1HYU A;  2IIY A;  1O6J A;  1GSF A;  1SJ6 A;  4KCE A;  2VL3 A;  3IC8 A;  4K2D A;  1YEX A;  4JE1 A;  1TRS A;  4MJC A;  4IHU A;  4PQH A;  1XWB A;  4XRD A;  5IO0 A;  3M9K A;  3TJB A;  2I81 A;  5AIV A;  1A23 A;  2OE0 A;  3D5J A;  1FVJ A;  1WP0 A;  3F6F A;  1GSU A;  2K6V A;  1EZK A;  3C73 A;  2CA8 A;  4EXJ A;  3A2V A;  5HR2 A;  2B6M A;  1M2B A;  4HI7 A;  4GRF A;  4OCF A;  4MPG A;  3GIX A;  1Q98 A;  3TUE A;  2HRA A;  3BJ5 A;  3ERF A;  3C71 A;  1JZO A;  2VM2 A;  3GX8 A;  1MDK A;  2MZC A;  4GCI A;  4BWQ A;  1TRW A;  2LNT A;  3AY8 A;  3QR6 A;  3H1N A;  6GSS A;  1GTB A;  5H5S A;  1K0M A;  2HI7 A;  2KHP A;  3FW2 A;  2HQT A;  4BL7 A;  3GUR A;  1SK0 A;  3TKR A;  5DJM A;  5IMA A;  2I9H A;  3WD6 A;  9GSS A;  1EV9 A;  1SJI A;  4KB3 A;  3L9U A;  2XBQ A;  1PL2 A;  4MF5 A;  1PL1 A;  5D93 A;  2B7K A;  3TRQ A;  1A0F A;  1XVW A;  2CAI A;  3ZMK A;  3LFL A;  3FZ4 A;  4XTS A;  3TB2 A;  2LJK A;  2QSI A;  2YZU A;  2IMD A;  4ACS A;  5IMF A;  2GZP A;  2QGV A;  3LOR A;  2DJ0 A;  1ERU A;  2B3S A;  1SL0 B;  3HD5 A;  5EY6 A;  2DJK A;  3DKS A;  4O92 A;  4N30 A;  2RLI A;  2CZ2 A;  1AW9 A;  5CRG A;  2CZ3 A;  2LNS A;  17GS A;  3HDC A;  6GST A;  2LQQ A;  4ECJ A;  1ERW A;  1THO A;  5IIZ A;  2FUG 2;  5HR1 A;  2WDU A;  1QGV A;  2PU9 C;  13GS A;  4WF5 A;  4PX1 A;  3LQ7 A;  2DLX A;  4XRA A;  4RQX A;  1ON4 A;  3ZIT A;  1I5G A;  5LD0 A;  2EIO A;  2H72 A;  4TKY A;  2LV3 A;  1DSB A;  3MWH A;  4PNG A;  2HXK A;  5JWQ B;  5C04 A;  3SBC A;  4IP6 A;  1BYE A;  4OFN A;  3G7I A;  2R37 A;  2H19 A;  4NAX A;  1T1V A;  4JRR A;  4DSS A;  2DSA A;  2E7P A;  3TOU A;  2CX3 A;  2XPE A;  3C1R A;  1IYH A;  4HJM A;  2JZR A;  3FEU A;  5CRE A;  2H01 A;  3R3E A;  4FYU A;  1M2D A;  4H86 A;  4IGJ A;  3H79 A;  3GH6 A;  2X8G A;  3FZ9 A;  2CVB A;  4I2T A;  1ZGN A;  5ECI B;  3I69 A;  2EIQ A;  5ECO B;  2RM6 A;  3JCM L;  4X1U A;  4EL1 A;  3RHB A;  2GT6 A;  3KMO A;  2YN1 A;  1GSQ A;  3G7J A;  4MCU A;  1XW5 A;  1GNE A;  5J4U A;  4HUA A;  1OKD A;  2X8H A;  2PWJ A;  3IC4 A;  3FRC A;  1A2M A;  4PXO A;  3H93 A;  1TDI A;  1YF0 A;  3VWX A;  1CQG A;  1V98 A;  4IKH A;  2ES7 A;  4FO5 A;  1YZX A;  2L6C A;  3QDN A;  1TKD B;  4EKZ A;  4KH7 A;  2H0I A;  3W6G A;  3BCI A;  5IPG A;  3RPN A;  1B8X A;  2FHE A;  4DSQ A;  4EO3 A;  1BED A;  4K7N A;  2FA8 A;  4TR0 A;  4DVC A;  1VF2 A;  1VRS D;  1B4P A;  4HU7 A;  4AJ6 A;  4K9Z A;  4XS4 A;  3IV4 A;  2CVK A;  1LBK A;  3KTB A;  3HYP A;  3EMP A;  2VLV A;  1TK5 B;  1A2L A;  2HSN B;  4O7H A;  3FYG A;  2V32 A;  1XOA A;  2AYT A;  3DRN A;  1EGO A;  2VL2 C;  2H1D A;  4PUF C;  3FR6 A;  4KCA A;  2B5E A;  3L4N A;  3A3T A;  1K0C A;  2DIY A;  5CNW A;  4TR4 A;  3V1W A;  1TP9 A;  4TXO A;  4PQ1 A;  3KTL A;  1J9B A;  5GSS A;  4Q5R A;  1ML6 A;  3GKM A;  1OC3 A;  2DMM A;  3DGQ A;  2BJX A;  1NHO A;  3UMA A;  2L4Q A;  1PX6 A;  2XBI A;  3E9J B;  3ZYW A;  1X9W B;  5D9X A;  1Z9H A;  3NZN A;  1U6T A;  4OD7 A;  4ID0 A;  2OA7 A;  4IQA A;  2C0D A;  2HFD A;  5CAX A;  1BJX A;  1JZD A;  2GZY A;  5DQS A;  2N5A A;  3PPU A;  1OVN A;  5DBQ A;  1G0T A;  2N5B A;  5DAK A;  2L5O A;  4LL1 B;  1M7T A;  5IM9 A;  2C3T A;  1FB6 A;  5IOX A;  1PD2 1;  3GKK A;  3APS A;  4PGT A;  1WJK A;  6GSW A;  4XCS A;  5J9C A;  4LMW A;  2YNX A;  4NHZ A;  3Q18 A;  1ZOF A;  2H1A A;  1R5A A;  4OMV A;  5GST A;  1V40 A;  5D96 A;  4ULX A;  4IVF A;  1NM3 A;  5EVO A;  4G2E A;  1B9Y C;  1G7E A;  1PN9 A;  1H4O A;  2V6O A;  2Z9S A;  4YAV A;  2HRF A;  2FWG A;  3Q74 A;  2IME A;  1BG5 A;  4GTU A;  3VK9 A;  3IAS 2;  1Q4J A;  2C1Y A;  2ZCT A;  1SKS B;  2C0F A;  4KAE A;  2IN3 A;  3ZVJ A;  2F3M A;  1J0F A;  5D8I A;  5B8A A;  2V2G A;  1ERT A;  2A2S A;  4CW9 A;  4L8E A;  3DML A;  1O85 A;  4HQZ A;  2AAW A;  1R4W A;  3VWV A;  3W8S A;  1PRX A;  2EIR A;  3PGT A;  3CRU A;  4D73 A;  3ERG A;  3ME7 A;  3RAZ A;  1LU4 A;  2LRC A;  3QAW A;  1XVQ A;  4P3Y B;  3GHA A;  2XC2 A;  3TDG A;  4I5Q A;  2DC5 A;  3CYN A;  3E3E A;  1O81 A;  3WYW A;  3GKX A;  3QMX A;  5CRD A;  2FNO A;  1IYI A;  2IJY A;  2NBS A;  1NSW A;  3IOS A;  4G0I A;  1TTZ A;  1T00 A;  5ECH B;  3F63 A;  2M46 A;  2K18 A;  4JU5 A;  5DVB A;  2GVP A;  3IAM 2;  1UVZ A;  1GUH A;  3HY2 A;  1PKZ A;  2LTK A;  2GTU A;  1WE0 A;  4HOJ A;  4ML6 A;  1SYX A;  1SL2 B;  3ZRD A;  4ZBB A;  5FWG A;  2DML A;  5HFG A;  2WJU A;  3ZFL A;  4BVY B;  2NDO A;  1SKW B;  1JLV A;  1UC7 A;  2FGX A;  5J3R A;  4USS A;  5FHI A;  2H71 A;  1FAA A;  4NPB A;  4TXV A;  5DAL A;  2KOK A;  5F05 A;  4G19 A;  2GQL A;  4WXT A;  3TKP A;  4EDZ A;  4KSO A;  4EVM A;  3HCZ A;  4GF0 A;  4CDO A;  4PUR A;  3E0U A;  2PGT A;  4ZBA A;  3EU4 A;  3VLN A;  1FG4 A;  3IHQ A;  3GL3 A;  3WT2 A;  5KN2 A;  3WGX A;  1WPI A;  2LJR A;  4IBP A;  4RQR A;  2OE3 A;  4Z7X A;  1TW9 A;  4MF6 A;  1O8X A;  1GWC A;  4GSS A;  1V57 A;  3GTU B;  3GN3 A;  4GST A;  1F37 A;  3LGC A;  3EUR A;  2HSY A;  5G2Z A;  3BBY A;  2VIM A;  18GS A;  1J08 A;  5D73 A;  1SD9 A;  3OR5 A;  5HR0 A;  1V58 A;  4KF9 A;  1GH2 A;  1TU8 A;  5ID2 B;  1XWC A;  4LMV A;  2VAF A;  3L9V A;  1TJD A;  2C80 A;  1ZYE A;  3RHC A;  1K0B A;  2LUS A;  4XS6 A;  4K8M A;  2ON5 A;  1THX A;  1YY7 A;  1ZMA A;  1V2A A;  2FWH A;  5BMU A;  1LJR A;  3HZ8 A;  1H75 A;  4KND A;  3CRT A;  2MBT A;  3F9U A;  1Z7P A;  1DE1 A;  1YF1 A;  3CSJ A;  3F3R A;  3QFB C;  4HDE A;  5ECS A;  5IOW A;  1VF4 A;  2OAD A;  1SJZ A;  2IFQ A;  3ZVJ D;  1K0D A;  3EWL A;  3KEB A;  4MZW A;  2DJ3 A;  2RM5 A;  3GRX A;  3UAP A;  4BA7 A;  1OC9 B;  4FIW A;  1ERV A;  3WT1 A;  3GX0 A;  1BQ7 A;  1SL1 B;  5H5R A;  1AXD A;  4K6X A;  4O5R A;  5J9B A;  5JCG A;  2XPD A;  1BAY A;  3F4R A;  1TK8 B;  4TR1 A;  4MF7 A;  2GZZ A;  3UBK A;  2ON7 A;  3TOT A;  3D4M A;  1PKW A;  3IBH A;  4GQC A;  4AJ8 A;  1MTC A;  5J41 A;  4FYC A;  3F3Q A;  1U3A A;  3ED3 A;  2TRX A;  3FY7 A;  2G2Q A;  3F6D A;  2HSM A;  1HNA A;  1AQX A;  1Z5Y E;  3IRA A;  1FHE A;  2GGT A;  2R2J A;  2NPB A;  2O89 A;  4EDY A;  1OKT A;  3EVI A;  2WZ9 A;  3EYT A;  4F0C A;  2L4C A;  4J2F A;  4G10 A;  2DJJ A;  3KCM A;  4JR6 A;  5KN3 A;  2RUE A;  4MJE A;  4O32 A;  4TVE A;  11GS A;  2B5Y A;  3UJ1 A;  4HQS A;  4RI7 A;  2D2Z A;  1HD2 A;  1AAZ A;  1QMV A;  4NV2 A;  4NWY A;  4XHM A;  1Y6E A;  1KNG A;  2HZE A;  2H75 A;  4WET A;  4NV5 A;  1T4Y A;  3IK9 A;  2GT5 A;  2HE3 A;  2HNL A;  1Z3E A;  1USB A;  3LEF A;  1SU9 A;  4L5O A;  4E8E A;  1O8W A;  3P2A A;  1F3A A;  2PVQ A;  2B5X A;  1MEK A;  2OE1 A;  4V2N A;  4HJ2 A;  2GLR A;  1ZCP A;  4ISD A;  4J57 E;  19GS A;  3ZRE A;  3HVS A;  4JR4 A;  4MJA A;  4DEJ A;  2ZNM A;  1GNW A;  2PBJ A;  4IS0 A;  2JZS A;  1T8E B;  3UAR A;  1SD8 A;  1Z6N A;  2FY6 A;  1R5P A;  3EMX A;  2F8F A;  2WFC A;  5A5K A;  3D4T A;  3P90 A;  5GAN D;  2MMZ A;  4ZL8 A;  2VCX A;  3QOU A;  1GUK A;  4KUN A;  2R5G A;  4DSS B;  2DBC A;  5IMV A;  4F9Z A;  1XOB A;  1HNC A;  3HJP A;  3DEX A;  2VCZ A;  5FT3 A;  5IMZ A;  2A2R A;  4MZB A;  1K3O A;  4YQU A;  3H8Q A;  5HQP A;  6GSX A;  4N10 A;  3A5W A;  1O73 A;  2CT6 A;  4OO4 A;  4OO5 A;  3VFI A;  2OKA A;  3APQ A;  1PA3 A;  3NIV A;  3GYK A;  2VD0 A;  4ZL9 A;  1DUG A;  3LWA A;  2H0H A;  4IJI A;  1M0U A;  5ECN B;  3C7M A;  1ABA A;  5F0G A;  2YZH A;  5IQY A;  4Q5N A;  5ECR B;  2VCQ A;  2WS2 A;  1W89 A;  2N5F A;  2A4V A;  1XXU A;  3IDV A;  3HVV A;  3BCK A;  1K0N A;  4F0B A;  3TJJ A;  3HVX A;  5G5F A;  6GSV A;  2X64 A;  5COH A;  3MNG A;  5CYY A;  5F06 A;  4GQF A;  1NHY A;  2P5Q A;  3ZL5 A;  1SK1 A;  2O85 A;  2L57 A;  1B48 A;  5F8B A;  2H66 A;  3GKN A;  4G0L A; 
#chains in the Genus database with same CATH topology
 2LEG A;  1N2A A;  2F51 A;  1SVL A;  2DKI A;  2O3E A;  3US3 A;  2O36 A;  5C00 A;  4WKW A;  3MIX A;  2WB9 A;  2QKE A;  2V6K A;  1K3Y A;  1F2E A;  3ZTL A;  1SKR B;  3CTF A;  3A5I A;  4YQM A;  3ZFB A;  1F9M A;  2K9F A;  2HSH A;  2K8S A;  1WIK A;  4FH8 A;  4L0U A;  2FD3 A;  4MP4 A;  2WGR A;  4AF2 A;  3RBT A;  2WCI A;  1MD4 A;  3G9B A;  2FA4 A;  5KEJ A;  3Q6O A;  3GA4 A;  5JCU A;  3CMI A;  3HKR A;  3UVT A;  1YEP A;  4MAB A;  2WVX A;  4IW9 A;  4BVX A;  4ECI A;  1C72 A;  3KIJ A;  4POM A;  1ACV A;  1CQH A;  2VD1 A;  12GS A;  5DAK B;  3KJY A;  3PR8 A;  4Q5F A;  4QL7 A;  3WGE A;  4V1A g;  3NOF A;  4K1F A;  3KD0 A;  3C1S A;  4ZIL A;  1JFU A;  2MMA A;  5A4U A;  3IXR A;  3MSZ A;  1T4Z A;  4MH2 A;  5G30 A;  2QA2 A;  2IMK A;  2PUK C;  4POB A;  2DJ2 A;  1G6Y A;  3UVH A;  3P8W A;  5HR3 A;  3GST A;  1U87 A;  3I6A A;  2WW1 A;  4ZL7 A;  2JSY A;  3TKS E;  1DE2 A;  2LS5 A;  2VUP A;  1DBY A;  1JZR A;  2EFE A;  2YWI A;  3ISO A;  2FWE A;  1T7P B;  2H6Y A;  1AQW A;  1TI1 A;  4KGI A;  1MDI A;  4KDU A;  5ABR A;  2M72 A;  1YKA A;  3DVX A;  2C3Q A;  3FR9 A;  1A2J A;  1X0R A;  2VLT A;  3FR3 A;  2B7J A;  2AUV A;  1XPV A;  2YWM A;  2HT9 A;  4EF0 A;  4MDC A;  4EE0 A;  3I43 A;  1QXH A;  1OE8 A;  2LQO A;  1A8L A;  1WWJ A;  4D73 B;  5INY A;  5AIX A;  4QL9 A;  4ML1 A;  3O3T A;  3DYR A;  3KM6 A;  2R4V A;  1GSS A;  2PER A;  4JZQ A;  2P31 A;  5HFK A;  4E8H A;  1S3R A;  3O6T A;  4FYB A;  1EOH A;  1GSD A;  5IMD A;  3QAG A;  3GL5 A;  4TN8 A;  1YDK A;  3F4S A;  4X43 A;  3F4T A;  5A34 A;  3CXG A;  4POK A;  3GH9 A;  2H8L A;  5H5Q A;  1F6M C;  5B6N A;  4CY6 A;  3QAV A;  1X5E A;  4DSR A;  1Y25 A;  2KUC A;  1XWK A;  4IEL A;  5A1N B;  3DWV A;  2OBI A;  4OCE A;  5E4W A;  4KE3 A;  3ZLP A;  4ZB7 A;  2F9S A;  3FKF A;  2HRK A;  3VPQ A;  1MD3 A;  1E6B A;  1WOU A;  4F82 A;  3RDW A;  1QQ2 A;  5EPF A;  4WR5 A;  2EFH A;  1GLP A;  3U5R E;  5DAL B;  5D9V A;  3LXZ A;  3EC3 A;  4O5U A;  5JWO B;  2K8V A;  4OFT A;  1TRU A;  3CTG A;  1XW9 A;  4G01 A;  5CO3 A;  4PQI A;  4CHS A;  1JZW A;  1X5D A;  2JAD A;  1X9S B;  1YQ1 A;  2YWO A;  3U6V A;  2DIZ A;  4V2M A;  2GSS A;  5DDL A;  4Z2U A;  5J47 A;  2H1B A;  2AJQ B;  1A24 A;  2LKU A;  14GS A;  3K8N A;  2WRT A;  1G6W A;  4KW6 A;  2HRN A;  4HZ4 A;  4TW5 A;  4BIK A;  4ECC A;  3D6I A;  2BTO T;  3I9V 2;  5ID2 A;  5DCH A;  1QUW A;  1TRV A;  1Z6M A;  16GS A;  4TOP A;  2JSZ A;  2GQK A;  1TU7 A;  1B4Q A;  2L5L A;  3TJK A;  4TR3 A;  1AQV A;  2MMO A;  3N5O A;  5BMU B;  2YWN A;  4I97 A;  3M9J A;  1XBS A;  3D0Z A;  2V41 A;  1S3C A;  2KP2 A;  4YH2 A;  2LJA A;  3FHK A;  1EP8 A;  3GFK A;  1FVK A;  5B7C A;  3VWU A;  2AHE A;  4K0N A;  3VUR A;  1A8Y A;  4G0K A;  4L0W A;  3M8N A;  2C8U A;  5ECM B;  3KP8 A;  3TU3 B;  3L9S A;  1S4B P;  1Y1U A;  2IFQ B;  1OC8 A;  2VLU A;  4XIH A;  20GS A;  2E0Q A;  1OC9 A;  5A5H A;  1QK8 A;  4KDY A;  1GUM A;  5JCW A;  5ECQ B;  5G5E A;  1M99 A;  1R7H A;  5DCG A;  1TK0 B;  1TI3 A;  4TR1 B;  5AN1 A;  2IL3 A;  1GL8 A;  2CVD A;  1XW6 A;  3HXS A;  5A4V A;  3KXO A;  4YAP A;  4BL7 B;  2WW2 A;  3D21 A;  3FZ5 A;  2L59 A;  4AGS A;  5GZZ B;  4L5L A;  2HSM B;  2VL9 A;  3CBU A;  4MH3 A;  4I6X A;  1RK4 A;  1OAZ A;  3LSZ A;  5GAP D;  3IA1 A;  2ZUP A;  2QC7 A;  3ERW A;  3D22 A;  5HFI A;  1FW1 A;  4Q5Q A;  3PIN A;  2FWF A;  1FOV A;  3LYP A;  5G31 A;  4MK3 A;  1VGL A;  3EPT A;  4XS1 A;  1K0A A;  4AJ7 A;  1XZO A;  3TKS C;  1AUC A;  2HZE B;  3CQF A;  1RQM A;  1YEW C;  6GSY A;  5ELA A;  3KMN A;  3ZZX A;  2TRC P;  2H74 A;  2P0G A;  2I4A A;  3J7Y k;  2JL4 A;  4V2L A;  3HVN A;  8GSS A;  1TOF A;  2VCT A;  5ENU A;  1SK2 A;  3LJR A;  2R6K A;  2PVO C;  2V1M A;  3FK8 A;  1BG1 A;  3UOM A;  3KZQ A;  4AKX B;  3GNJ A;  2O7K A;  2GSQ A;  4PI0 C;  1AC1 A;  1PQN A;  3ZML A;  2OBK A;  5BRT A;  2CX4 A;  4OWY A;  4WBJ A;  2P5R A;  4V1A p;  4EUY A;  3ME8 A;  3QPM A;  1M9B A;  4PTS A;  2R3X A;  2MYG A;  1EOG A;  3GV1 A;  3SWL A;  4WBR D;  22GS A;  2DKH A;  1K3L A;  1JLW A;  1YKC A;  2KLX A;  2O87 A;  5F07 A;  2VCV A;  5A4W A;  2R0C A;  4NMU A;  2H76 A;  2VCW A;  1W4V A;  5AIS A;  2JAC A;  2MMN A;  2BMX A;  2F8A A;  3C8E A;  5E59 A;  5CP1 A;  4HEA 2;  4PUA A;  3HA9 A;  2H0G A;  3PH9 A;  1KTE A;  5D9W A;  3TRP A;  3GSS A;  2H1G A;  2KP1 A;  4IN0 A;  1BX9 A;  3F8U A;  4ZB6 A;  4BPY A;  3M3M A;  5JWR B;  1EV4 A;  4ZB8 A;  1O7U A;  2NVL A;  4WR4 A;  3O76 A;  10GS A;  3S9F A;  2H6X A;  4K7O A;  4GWR A;  4LL4 B;  3W8J A;  3TKS A;  1G7O A;  2NTO A;  2LST A;  1E2Y A;  1S3A A;  3DVW A;  1PMT A;  1EP7 A;  1GUL A;  3APO A;  5B8B A;  4KA0 A;  4MMM A;  2J9H A;  2GS3 A;  1BF5 A;  4KSM A;  4ZXG A;  3F0I A;  4I2U A;  3UL3 A;  1GTI A;  2CQ9 A;  4XS4 B;  1NW2 A;  3QD9 A;  1SYR A;  2L6D A;  5ECL B;  2J23 A;  2GSR A;  1XCC A;  2GST A;  4RUV A;  1OE7 A;  2RII A;  2REM A;  5ECP B;  3VI7 A;  1VF1 A;  1GTA A;  3GUS A;  1KBN A;  4MZC A;  3IR4 A;  1VF3 A;  4JBB A;  3HJO A;  3WGD A;  4KX4 A;  4F03 A;  2HLS A;  6GSU A;  1XWG A;  2O8V B;  2ALB A;  1SEN A;  1M2A A;  2M80 A;  2YPM A;  2WVY A;  4IQ1 A;  4TXO B;  2XHF A;  1WRY A;  2B1L A;  5IO2 A;  3IK7 A;  2G0F A;  3VWW A;  4QQ7 A;  2IWT A;  5L71 A;  2CV4 A;  1PX7 A;  3CSH A;  1XIY A;  5B6M A;  2TIR A;  1Z7R A;  1S3D A;  1GRX A;  1GP1 A;  3L0H A;  1FO5 A;  2C3N A;  1PGT A;  5EL8 A;  2YCD A;  2HZF A;  4ZIJ A;  4ZB9 A;  1A0R P;  3KP9 A;  2I1U A;  2YJH A;  1QFN A;  1GSE A;  4G9H A;  4N0V A;  4BVX B;  5J5N A;  4WEY A;  4F2I A;  3QCP A;  4KDX A;  3CSI A;  4MA9 A;  3IHG A;  2H70 A;  5G1K A;  1UA5 A;  4FXY P;  3ZIV A;  4NHW A;  2CAQ A;  1EWX A;  2R0G A;  4J56 E;  2YP6 A;  2VO4 A;  3IE3 A;  4GXZ A;  2C0E A;  4HS1 A;  3ZIJ A;  3HJM A;  3GMF A;  5D9T A;  2B1K A;  5AGY A;  3RPP A;  3DIE A;  1RW1 A;  3P7X A;  1R26 A;  4K7I A;  1B9X C;  2OJL A;  3TKQ A;  4IP1 A;  2H30 A;  1T3B A;  2H6Z A;  3L78 A;  3DD3 A;  4X0X A;  1I1I P;  4I8B A;  1TXX A;  4ZBD A;  1X5C A;  5IPH A;  2YAN A;  2RUF A;  3BOA A;  4PI2 C;  1ILO A;  2FLS A;  1UN2 A;  4N3Z A;  2X99 A;  1JHB A;  2MBS A;  4YQV A;  1HQO A;  2YV9 A;  5DJL A;  2JZT A;  1K0O A;  3H4K A;  2VL2 A;  3HHV A;  4AKG A;  5DQY A;  5KN1 A;  2DJ1 A;  3Q19 A;  4OFM A;  3IPZ A;  2AV4 A;  2YV7 A;  4GLT A;  2PN8 A;  1GLQ A;  3KH7 A;  4BWS A;  3VI5 A;  4MLY A;  2X8C A;  3G7Y A;  4ILF A;  5CRH A;  4ECB A;  4IJ3 A;  2AB6 A;  1I9D A;  3VPT A;  1GTU A;  1GSY A;  4TRX A;  2QA1 A;  2IMI A;  1WMJ A;  4N11 A;  2EC4 A;  1EGR A;  1MDJ A;  5ECK B;  1X9M B;  1M9A A;  3TJF A;  3KH9 A;  1U3I A;  2UZ8 A;  4NXI A;  3TJG A;  1ZYQ B;  4HU9 A;  1KEB A;  4E68 A;  1FB0 A;  2GDR A;  3KGK A;  5KOX A;  3LG6 A;  1ZZY A;  4EC0 A;  4RI6 A;  1V9W A;  4MNN A;  5A1N A;  2LRN A;  4POL A;  5LNK e;  3M1G A;  2GQM A;  7GSS A;  3MDK A;  4BVY A;  2C0G A;  4MJB A;  1EEM A;  2HRK B;  3LYK A;  4GSN A;  3TGZ A;  2FCH A;  1XFL A;  3R2Q A;  3A2X A;  3EU3 A;  3TCO A;  5CRW A;  3J7Y b;  5KN0 A;  3HZ4 A;  4LLR A;  1ST9 A;  4JED A;  5IMC A;  2LRT A;  1N8J A;  1XWA A;  3FZA A;  3A2W A;  1PSQ A;  5ELG A;  5LCZ A;  2HYX A;  4LA1 A;  3DXB A;  3QFA C;  1YJ6 A;  1F3B A;  3N9J A;  2H73 A;  2YOI A;  2IMF A;  3GTU A;  4N0Z A;  3EIN A;  3UIW A;  3BD2 A;  2OAC A;  2PMT A;  2JU5 A;  2VM1 A;  4FQU A;  1OYJ A;  2I3Y A;  4A5P A;  2E2M A;  3LXT A;  4MPF A;  1ZL9 A;  2PPT A;  1URM A;  3MAK A;  2IPA A;  2VOC A;  3TRX A;  3UEM A;  4WF4 A;  4HZ2 A;  1HNB A;  2E2G A;  1U88 A;  2C4J A;  5G1L A;  2YJ7 A;  1EEJ A;  3EE2 A;  3UBL A;  1AIU A;  2WUL A;  4K0G A;  3M0F A;  4PNF A;  1HYU A;  2IIY A;  3MYD A;  1O6J A;  1GSF A;  1SJ6 A;  4KCE A;  2VL3 A;  3IC8 A;  4K2D A;  1YEX A;  4JE1 A;  1TRS A;  4MJC A;  4IHU A;  4PQH A;  1XWB A;  4XRD A;  5IO0 A;  3M9K A;  3TJB A;  2X49 A;  2I81 A;  5AIV A;  1A23 A;  2OE0 A;  3D5J A;  1FVJ A;  1WP0 A;  3F6F A;  1GSU A;  2K6V A;  1EZK A;  3C73 A;  2CA8 A;  4EXJ A;  3A2V A;  5HR2 A;  2B6M A;  1M2B A;  4HI7 A;  5A5H B;  4GRF A;  4OCF A;  4MPG A;  3GIX A;  1Q98 A;  3TUE A;  2HRA A;  3BJ5 A;  3ERF A;  3C71 A;  1JZO A;  2VM2 A;  3GX8 A;  1MDK A;  2MZC A;  4GCI A;  4CY8 A;  4BWQ A;  1TRW A;  2LNT A;  3AY8 A;  3QR6 A;  3H1N A;  6GSS A;  1GTB A;  5H5S A;  1K0M A;  2HI7 A;  2KHP A;  3FW2 A;  2HQT A;  4BL7 A;  3GUR A;  1SK0 A;  3TKR A;  5DJM A;  5IMA A;  2I9H A;  3LW9 A;  3WD6 A;  9GSS A;  1EV9 A;  1SJI A;  4KB3 A;  3L9U A;  2XBQ A;  1PL2 A;  4MF5 A;  1PL1 A;  5D93 A;  2B7K A;  3TRQ A;  1A0F A;  1XVW A;  2CAI A;  3ZMK A;  3LFL A;  3FZ4 A;  4XTS A;  3TB2 A;  2LJK A;  2QSI A;  2YZU A;  2IMD A;  4ACS A;  5IMF A;  2GZP A;  2QGV A;  3LOR A;  1PFO A;  2DJ0 A;  1ERU A;  2B3S A;  1SL0 B;  3HD5 A;  5EY6 A;  2DJK A;  3DKS A;  4O92 A;  4N30 A;  2RLI A;  2CZ2 A;  1AW9 A;  5CRG A;  2CZ3 A;  2LNS A;  17GS A;  3HDC A;  6GST A;  2LQQ A;  4ECJ A;  1ERW A;  1THO A;  5IIZ A;  2FUG 2;  5HR1 A;  2WDU A;  1QGV A;  2PU9 C;  13GS A;  4WF5 A;  4PX1 A;  3LQ7 A;  2DLX A;  4XRA A;  4RQX A;  4EIQ A;  1ON4 A;  1TXU A;  1I5G A;  1ZYP A;  3ZIT A;  5LD0 A;  2EIO A;  2H72 A;  4TKY A;  2LV3 A;  1DSB A;  3MWH A;  4PNG A;  2HXK A;  5JWQ B;  5C04 A;  3SBC A;  4IP6 A;  1BYE A;  4OFN A;  3G7I A;  2R37 A;  2H19 A;  4NAX A;  1T1V A;  4JRR A;  4DSS A;  2DSA A;  2E7P A;  3TOU A;  2CX3 A;  2XPE A;  3C1R A;  1IYH A;  4HJM A;  2JZR A;  3FEU A;  5CRE A;  2H01 A;  3R3E A;  4K5R A;  4FYU A;  1M2D A;  4H86 A;  4IGJ A;  3H79 A;  3GH6 A;  2X8G A;  3FZ9 A;  2CVB A;  4I2T A;  1ZGN A;  5ECI B;  3I69 A;  2EIQ A;  5ECO B;  2RM6 A;  3JCM L;  4X1U A;  4EL1 A;  3RHB A;  2GT6 A;  3KMO A;  2YN1 A;  1GSQ A;  3G7J A;  4MCU A;  1XW5 A;  1GNE A;  5J4U A;  4HUA A;  1OKD A;  2X8H A;  2PWJ A;  3IC4 A;  3FRC A;  1A2M A;  4PXO A;  3H93 A;  1TDI A;  1FOH A;  1YF0 A;  3VWX A;  1CQG A;  1V98 A;  4IKH A;  2ES7 A;  4FO5 A;  1YZX A;  2L6C A;  3QDN A;  1TKD B;  4EKZ A;  4KH7 A;  2H0I A;  3W6G A;  3BCI A;  5IPG A;  3RPN A;  1B8X A;  2FHE A;  4DSQ A;  4EO3 A;  1BED A;  4K7N A;  2FA8 A;  4TR0 A;  4DVC A;  1VF2 A;  1VRS D;  1B4P A;  4HU7 A;  4AJ6 A;  1SVO A;  4K9Z A;  4XS4 A;  3IV4 A;  2CVK A;  1LBK A;  3KTB A;  3HYP A;  3EMP A;  2VLV A;  1TK5 B;  1A2L A;  2HSN B;  4EIP A;  2H1L A;  4O7H A;  3FYG A;  2V32 A;  1XOA A;  2AYT A;  3DRN A;  1EGO A;  2VL2 C;  2H1D A;  4PUF C;  4ICY A;  3FR6 A;  4KCA A;  2X4A A;  2B5E A;  3A3T A;  3L4N A;  1K0C A;  2DIY A;  5CNW A;  4TR4 A;  3V1W A;  1TP9 A;  4TXO A;  4YKG A;  4PQ1 A;  3KTL A;  1J9B A;  5GSS A;  4Q5R A;  1ML6 A;  3GKM A;  1OC3 A;  2DMM A;  2VKZ G;  3DGQ A;  2BJX A;  1NHO A;  3UMA A;  2L4Q A;  1PX6 A;  2XBI A;  3E9J B;  3ZYW A;  1X9W B;  5D9X A;  1Z9H A;  3NZN A;  1U6T A;  4OD7 A;  4ID0 A;  2OA7 A;  4IQA A;  2C0D A;  2HFD A;  5CAX A;  1BJX A;  1JZD A;  2GZY A;  2WVX B;  5DQS A;  2N5A A;  3PPU A;  1OVN A;  5DBQ A;  1G0T A;  2N5B A;  5DAK A;  2L5O A;  4LL1 B;  1M7T A;  5IM9 A;  2C3T A;  1FB6 A;  5IOX A;  1PD2 1;  3GKK A;  3APS A;  4PGT A;  1WJK A;  6GSW A;  4XCS A;  5J9C A;  4LMW A;  2YNX A;  2A4H A;  4NHZ A;  3Q18 A;  1ZOF A;  2H1A A;  2R0P A;  1R5A A;  4OMV A;  5GST A;  1V40 A;  2WW0 A;  5D96 A;  4ULX A;  4IVF A;  1NM3 A;  5EVO A;  4G2E A;  1B9Y C;  1G7E A;  1PN9 A;  1H4O A;  2V6O A;  2Z9S A;  4YAV A;  2HRF A;  2FWG A;  3Q74 A;  2IME A;  1BG5 A;  4GTU A;  3VK9 A;  3IAS 2;  1Q4J A;  4O5Q A;  2C1Y A;  2ZCT A;  1SKS B;  2C0F A;  4KAE A;  2IN3 A;  3ZVJ A;  2F3M A;  1J0F A;  5D8I A;  5B8A A;  3RFR C;  2V2G A;  1ERT A;  2A2S A;  4CW9 A;  4L8E A;  3DML A;  3CHX C;  1YVL A;  1O85 A;  4HQZ A;  2AAW A;  1R4W A;  3VWV A;  3W8S A;  1PRX A;  2EIR A;  4K2X A;  3PGT A;  3CRU A;  4D73 A;  3ERG A;  3ME7 A;  3RAZ A;  1LU4 A;  2LRC A;  3QAW A;  1XVQ A;  4P3Y B;  3GHA A;  2XC2 A;  3TDG A;  4PHZ C;  4I5Q A;  2DC5 A;  3CYN A;  3E3E A;  1O81 A;  3WYW A;  3GKX A;  3QMX A;  5CRD A;  2FNO A;  1IYI A;  2IJY A;  2NBS A;  5A34 B;  4W66 A;  1NSW A;  3IOS A;  4G0I A;  1TTZ A;  1T00 A;  5ECH B;  3F63 A;  2M46 A;  2K18 A;  4JU5 A;  5DVB A;  2GVP A;  3IAM 2;  1UVZ A;  1GUH A;  3HY2 A;  1XG8 A;  1PKZ A;  2LTK A;  2GTU A;  1WE0 A;  4HOJ A;  4GDF A;  4ML6 A;  1SYX A;  1SL2 B;  3ZRD A;  4ZBB A;  5FWG A;  2DML A;  5HFG A;  2WJU A;  3ZFL A;  4BVY B;  2NDO A;  1SKW B;  1JLV A;  1UC7 A;  2FGX A;  5J3R A;  3FMW A;  4USS A;  5FHI A;  4Z2R A;  2H71 A;  1FAA A;  4NPB A;  4TXV A;  5DAL A;  2KOK A;  5F05 A;  4G19 A;  2GQL A;  4WXT A;  3TKP A;  4EDZ A;  3CWG A;  4KSO A;  4EVM A;  3HCZ A;  4GF0 A;  4CDO A;  4PUR A;  3E0U A;  2PGT A;  1SVM A;  4ZBA A;  3EU4 A;  3VLN A;  1FG4 A;  3IHQ A;  3GL3 A;  3WT2 A;  5KN2 A;  3WGX A;  1WPI A;  2LJR A;  4IBP A;  4RQR A;  2OE3 A;  4Z7X A;  1TW9 A;  4MF6 A;  1O8X A;  1GWC A;  4GSS A;  1V57 A;  3GTU B;  3GN3 A;  4GST A;  1F37 A;  3LGC A;  1ZYN A;  3EUR A;  2HSY A;  5G2Z A;  3BBY A;  2VIM A;  18GS A;  1J08 A;  5D73 A;  1SD9 A;  3OR5 A;  5HR0 A;  1V58 A;  4KF9 A;  1GH2 A;  1TU8 A;  5ID2 B;  1XWC A;  4LMV A;  2VAF A;  3L9V A;  1TJD A;  2C80 A;  1ZYE A;  3RHC A;  1K0B A;  2LUS A;  4XS6 A;  4K8M A;  4YKF A;  2ON5 A;  4QMK A;  1THX A;  1YY7 A;  1ZMA A;  1V2A A;  2FWH A;  5BMU A;  1LJR A;  3HZ8 A;  1H75 A;  4KND A;  3CRT A;  2MBT A;  4HSC X;  3F9U A;  1Z7P A;  1DE1 A;  1YF1 A;  3CSJ A;  5KOW A;  3F3R A;  3QFB C;  4HDE A;  5ECS A;  5IOW A;  2OT3 A;  1VF4 A;  2OAD A;  1SJZ A;  2IFQ A;  3ZVJ D;  1K0D A;  3EWL A;  3KEB A;  4MZW A;  2DJ3 A;  2RM5 A;  3GRX A;  3UAP A;  4BA7 A;  1OC9 B;  4FIW A;  1ERV A;  3WT1 A;  3GX0 A;  1BQ7 A;  1SL1 B;  4AI6 A;  1AXD A;  2O5V A;  5H5R A;  4K6X A;  4O5R A;  5J9B A;  5JCG A;  1M3J A;  2XPD A;  5J4V A;  1BAY A;  3F4R A;  1TK8 B;  4TR1 A;  4MF7 A;  2GZZ A;  3UBK A;  2ON7 A;  3TOT A;  3D4M A;  1PKW A;  3IBH A;  4GQC A;  4AJ8 A;  1MTC A;  5J41 A;  4FYC A;  3F3Q A;  1U3A A;  3ED3 A;  2TRX A;  3FY7 A;  2UV8 G;  2G2Q A;  3F6D A;  2HSM A;  1HNA A;  1AQX A;  1Z5Y E;  3IRA A;  1FHE A;  2GGT A;  2R2J A;  2NPB A;  2O89 A;  4EDY A;  1OKT A;  3EVI A;  2A2P A;  2WZ9 A;  3EYT A;  4F0C A;  2L4C A;  4J2F A;  4G10 A;  2DJJ A;  3KCM A;  4JR6 A;  5KN3 A;  2RUE A;  4MJE A;  4O32 A;  4TVE A;  11GS A;  2B5Y A;  3UJ1 A;  4HQS A;  4RI7 A;  2D2Z A;  1HD2 A;  1AAZ A;  1QMV A;  4NV2 A;  4NWY A;  4XHM A;  1Y6E A;  1KNG A;  2HZE A;  2H75 A;  4WET A;  4NV5 A;  1T4Y A;  3IK9 A;  2GT5 A;  2HE3 A;  2HNL A;  1Z3E A;  1USB A;  3LEF A;  4Z2T A;  5J4Y A;  1SU9 A;  4L5O A;  4E8E A;  1M3I A;  1O8W A;  3P2A A;  1F3A A;  2PVQ A;  2B5X A;  1MEK A;  4AKI A;  3HMJ G;  2OE1 A;  4V2N A;  4HJ2 A;  2GLR A;  1ZCP A;  1N25 A;  4ISD A;  4J57 E;  19GS A;  3ZRE A;  3HVS A;  4JR4 A;  4MJA A;  4DEJ A;  2ZNM A;  1GNW A;  2PBJ A;  4IS0 A;  2JZS A;  1T8E B;  3UAR A;  1SD8 A;  1Z6N A;  2FY6 A;  1R5P A;  3EMX A;  2F8F A;  2WFC A;  5A5K A;  3D4T A;  3P90 A;  5GAN D;  2MMZ A;  4ZL8 A;  2VCX A;  3QOU A;  1GUK A;  4KUN A;  2R5G A;  4DSS B;  2DBC A;  4AKH A;  5IMV A;  4F9Z A;  1XOB A;  1HNC A;  3HJP A;  3DEX A;  2VCZ A;  5FT3 A;  5IMZ A;  2A2R A;  4MZB A;  3RGB C;  1K3O A;  4YQU A;  3H8Q A;  5HQP A;  6GSX A;  4N10 A;  3A5W A;  1O73 A;  2CT6 A;  4OO4 A;  4K5S A;  4OO5 A;  3VFI A;  2OKA A;  3APQ A;  1PA3 A;  3NIV A;  3GYK A;  2VD0 A;  4ZL9 A;  1DUG A;  3LWA A;  2H0H A;  4IJI A;  2WZS A;  1M0U A;  5ECN B;  3C7M A;  1ABA A;  5F0G A;  2YZH A;  5IQY A;  4X4J A;  2EFC A;  4Q5N A;  5ECR B;  2VCQ A;  2WS2 A;  1W89 A;  2N5F A;  2A4V A;  1XXU A;  3IDV A;  3HVV A;  3BCK A;  1K0N A;  2WW3 A;  4F0B A;  2WVZ A;  3TJJ A;  3HVX A;  5G5F A;  6GSV A;  5J40 A;  2X64 A;  5COH A;  1PN0 A;  3MNG A;  5CYY A;  5F06 A;  4GQF A;  1NHY A;  2P5Q A;  3ZL5 A;  1SK1 A;  2O85 A;  2HSN A;  2L57 A;  2EFD A;  1B48 A;  5F8B A;  2H66 A;  3GKN A;  4G0L A; 
#chains in the Genus database with same CATH homology
 2LEG A;  1N2A A;  2F51 A;  1SVL A;  2DKI A;  3US3 A;  5C00 A;  4WKW A;  3MIX A;  2WB9 A;  2QKE A;  2V6K A;  1K3Y A;  1F2E A;  3ZTL A;  1SKR B;  3CTF A;  3A5I A;  4YQM A;  3ZFB A;  1F9M A;  2K9F A;  2HSH A;  2K8S A;  1WIK A;  4FH8 A;  4L0U A;  2FD3 A;  4MP4 A;  2WGR A;  4AF2 A;  3RBT A;  2WCI A;  1MD4 A;  3G9B A;  2FA4 A;  5KEJ A;  3Q6O A;  3GA4 A;  5JCU A;  3CMI A;  3HKR A;  3UVT A;  1YEP A;  4MAB A;  4IW9 A;  3KIJ A;  4BVX A;  4ECI A;  1C72 A;  4POM A;  1ACV A;  1CQH A;  2VD1 A;  12GS A;  5DAK B;  3KJY A;  3PR8 A;  4Q5F A;  4QL7 A;  3WGE A;  4V1A g;  3NOF A;  4K1F A;  3KD0 A;  3C1S A;  4ZIL A;  1JFU A;  2MMA A;  5A4U A;  3IXR A;  3MSZ A;  1T4Z A;  4MH2 A;  5G30 A;  2QA2 A;  2IMK A;  2PUK C;  4POB A;  2DJ2 A;  1G6Y A;  3UVH A;  3P8W A;  5HR3 A;  3GST A;  1U87 A;  3I6A A;  4ZL7 A;  2JSY A;  3TKS E;  1DE2 A;  2LS5 A;  2VUP A;  1DBY A;  1JZR A;  2EFE A;  2YWI A;  3ISO A;  2FWE A;  1T7P B;  2H6Y A;  1AQW A;  1TI1 A;  4KGI A;  1MDI A;  4KDU A;  5ABR A;  2M72 A;  1YKA A;  3DVX A;  2C3Q A;  3FR9 A;  1A2J A;  1X0R A;  2VLT A;  3FR3 A;  2B7J A;  2AUV A;  1XPV A;  2YWM A;  2HT9 A;  4EF0 A;  4MDC A;  4EE0 A;  3I43 A;  1QXH A;  1OE8 A;  2LQO A;  1A8L A;  1WWJ A;  4D73 B;  5INY A;  5AIX A;  4QL9 A;  4ML1 A;  3O3T A;  3DYR A;  3KM6 A;  2R4V A;  1GSS A;  2PER A;  4JZQ A;  2P31 A;  5HFK A;  4E8H A;  3O6T A;  4FYB A;  1EOH A;  1GSD A;  5IMD A;  3QAG A;  3GL5 A;  4TN8 A;  1YDK A;  3F4S A;  4X43 A;  3F4T A;  5A34 A;  3CXG A;  4POK A;  3GH9 A;  2H8L A;  5H5Q A;  1F6M C;  5B6N A;  4CY6 A;  3QAV A;  1X5E A;  4DSR A;  1Y25 A;  2KUC A;  1XWK A;  4IEL A;  5A1N B;  3DWV A;  2OBI A;  4OCE A;  5E4W A;  4KE3 A;  3ZLP A;  4ZB7 A;  2F9S A;  3FKF A;  2HRK A;  3VPQ A;  1MD3 A;  1E6B A;  1WOU A;  4F82 A;  3RDW A;  1QQ2 A;  5EPF A;  4WR5 A;  2EFH A;  1GLP A;  3U5R E;  5DAL B;  5D9V A;  3LXZ A;  3EC3 A;  4O5U A;  5JWO B;  2K8V A;  4OFT A;  1TRU A;  3CTG A;  1XW9 A;  4G01 A;  5CO3 A;  4PQI A;  4CHS A;  1JZW A;  1X5D A;  2JAD A;  1X9S B;  1YQ1 A;  2YWO A;  3U6V A;  2DIZ A;  4V2M A;  2GSS A;  5DDL A;  4Z2U A;  5J47 A;  2H1B A;  2AJQ B;  1A24 A;  2LKU A;  14GS A;  3K8N A;  2WRT A;  1G6W A;  4KW6 A;  2HRN A;  4HZ4 A;  4TW5 A;  4ECC A;  3D6I A;  2BTO T;  3I9V 2;  5ID2 A;  5DCH A;  1QUW A;  1TRV A;  1Z6M A;  16GS A;  4TOP A;  2JSZ A;  2GQK A;  1TU7 A;  1B4Q A;  2L5L A;  3TJK A;  4TR3 A;  1AQV A;  2MMO A;  3N5O A;  5BMU B;  2YWN A;  4I97 A;  3M9J A;  1XBS A;  3D0Z A;  2V41 A;  1S3C A;  2KP2 A;  4YH2 A;  2LJA A;  3FHK A;  1EP8 A;  3GFK A;  1FVK A;  5B7C A;  3VWU A;  2AHE A;  4K0N A;  3VUR A;  1A8Y A;  4G0K A;  4L0W A;  3M8N A;  2C8U A;  5ECM B;  3KP8 A;  3TU3 B;  3L9S A;  1Y1U A;  2IFQ B;  1OC8 A;  2VLU A;  4XIH A;  20GS A;  2E0Q A;  1OC9 A;  5A5H A;  1QK8 A;  4KDY A;  1GUM A;  5JCW A;  5ECQ B;  5G5E A;  1M99 A;  1R7H A;  5DCG A;  1TK0 B;  1TI3 A;  4TR1 B;  5AN1 A;  2IL3 A;  1GL8 A;  2CVD A;  1XW6 A;  3HXS A;  5A4V A;  3KXO A;  4YAP A;  4BL7 B;  3D21 A;  3FZ5 A;  2L59 A;  4AGS A;  5GZZ B;  4L5L A;  2HSM B;  2VL9 A;  3CBU A;  4MH3 A;  4I6X A;  1RK4 A;  1OAZ A;  3LSZ A;  5GAP D;  3IA1 A;  2ZUP A;  2QC7 A;  3ERW A;  3D22 A;  5HFI A;  1FW1 A;  4Q5Q A;  3PIN A;  2FWF A;  1FOV A;  3LYP A;  5G31 A;  4MK3 A;  1VGL A;  3EPT A;  4XS1 A;  1K0A A;  4AJ7 A;  1XZO A;  3TKS C;  1AUC A;  2HZE B;  1RQM A;  6GSY A;  5ELA A;  3KMN A;  3ZZX A;  2TRC P;  2H74 A;  2P0G A;  2I4A A;  3J7Y k;  2JL4 A;  4V2L A;  8GSS A;  1TOF A;  2VCT A;  5ENU A;  1SK2 A;  3LJR A;  2R6K A;  2PVO C;  2V1M A;  3FK8 A;  1BG1 A;  3UOM A;  3KZQ A;  4AKX B;  3GNJ A;  2O7K A;  2GSQ A;  1AC1 A;  1PQN A;  3ZML A;  2OBK A;  5BRT A;  2CX4 A;  4OWY A;  4WBJ A;  2P5R A;  4V1A p;  4EUY A;  3ME8 A;  3QPM A;  1M9B A;  4PTS A;  2R3X A;  2MYG A;  1EOG A;  3GV1 A;  3SWL A;  4WBR D;  22GS A;  2DKH A;  1K3L A;  1JLW A;  1YKC A;  2KLX A;  2O87 A;  5F07 A;  2VCV A;  5A4W A;  2R0C A;  4NMU A;  2H76 A;  2VCW A;  1W4V A;  5AIS A;  2JAC A;  2MMN A;  2BMX A;  2F8A A;  3C8E A;  5E59 A;  5CP1 A;  4HEA 2;  4PUA A;  3HA9 A;  2H0G A;  3PH9 A;  1KTE A;  5D9W A;  3TRP A;  3GSS A;  2H1G A;  2KP1 A;  4IN0 A;  1BX9 A;  3F8U A;  4ZB6 A;  4BPY A;  3M3M A;  5JWR B;  1EV4 A;  4ZB8 A;  1O7U A;  2NVL A;  4WR4 A;  3O76 A;  10GS A;  3S9F A;  2H6X A;  4K7O A;  4GWR A;  4LL4 B;  3W8J A;  3TKS A;  1G7O A;  2NTO A;  2LST A;  1E2Y A;  1S3A A;  3DVW A;  1PMT A;  1EP7 A;  1GUL A;  3APO A;  5B8B A;  4KA0 A;  4MMM A;  2J9H A;  2GS3 A;  1BF5 A;  4KSM A;  4ZXG A;  3F0I A;  4I2U A;  3UL3 A;  1GTI A;  2CQ9 A;  4XS4 B;  1NW2 A;  3QD9 A;  1SYR A;  2L6D A;  5ECL B;  2J23 A;  2GSR A;  1XCC A;  2GST A;  4RUV A;  1OE7 A;  2RII A;  2REM A;  5ECP B;  3VI7 A;  1VF1 A;  1GTA A;  3GUS A;  1KBN A;  4MZC A;  3IR4 A;  1VF3 A;  4JBB A;  3HJO A;  3WGD A;  4KX4 A;  4F03 A;  2HLS A;  6GSU A;  1XWG A;  2O8V B;  2ALB A;  1SEN A;  1M2A A;  2M80 A;  2YPM A;  4IQ1 A;  4TXO B;  2XHF A;  1WRY A;  2B1L A;  5IO2 A;  3IK7 A;  2G0F A;  3VWW A;  4QQ7 A;  2IWT A;  5L71 A;  2CV4 A;  1PX7 A;  3CSH A;  1XIY A;  5B6M A;  2TIR A;  1Z7R A;  1S3D A;  1GRX A;  1GP1 A;  3L0H A;  1FO5 A;  2C3N A;  1PGT A;  5EL8 A;  2YCD A;  2HZF A;  4ZIJ A;  4ZB9 A;  1A0R P;  3KP9 A;  2I1U A;  2YJH A;  1QFN A;  1GSE A;  4G9H A;  4N0V A;  4BVX B;  5J5N A;  4WEY A;  4F2I A;  3QCP A;  4KDX A;  3CSI A;  4MA9 A;  3IHG A;  2H70 A;  5G1K A;  1UA5 A;  3ZIV A;  4NHW A;  2CAQ A;  1EWX A;  2R0G A;  4J56 E;  2YP6 A;  2VO4 A;  3IE3 A;  4GXZ A;  2C0E A;  4HS1 A;  3ZIJ A;  3HJM A;  3GMF A;  5D9T A;  2B1K A;  5AGY A;  3RPP A;  3DIE A;  1RW1 A;  3P7X A;  1R26 A;  4K7I A;  1B9X C;  2OJL A;  3TKQ A;  4IP1 A;  2H30 A;  1T3B A;  2H6Z A;  3L78 A;  3DD3 A;  4X0X A;  4I8B A;  1TXX A;  4ZBD A;  1X5C A;  5IPH A;  2YAN A;  2RUF A;  3BOA A;  1ILO A;  2FLS A;  1UN2 A;  4N3Z A;  2X99 A;  1JHB A;  2MBS A;  4YQV A;  1HQO A;  2YV9 A;  5DJL A;  2JZT A;  1K0O A;  3H4K A;  2VL2 A;  3HHV A;  4AKG A;  5DQY A;  5KN1 A;  2DJ1 A;  3Q19 A;  4OFM A;  3IPZ A;  2AV4 A;  2YV7 A;  4GLT A;  2PN8 A;  1GLQ A;  3KH7 A;  4BWS A;  3VI5 A;  4MLY A;  2X8C A;  3G7Y A;  4ILF A;  5CRH A;  4ECB A;  4IJ3 A;  2AB6 A;  1I9D A;  3VPT A;  1GTU A;  1GSY A;  4TRX A;  2QA1 A;  2IMI A;  1WMJ A;  4N11 A;  2EC4 A;  1EGR A;  1MDJ A;  5ECK B;  1X9M B;  1M9A A;  3TJF A;  3KH9 A;  1U3I A;  2UZ8 A;  4NXI A;  3TJG A;  1ZYQ B;  4HU9 A;  1KEB A;  4E68 A;  1FB0 A;  2GDR A;  3KGK A;  5KOX A;  3LG6 A;  1ZZY A;  4EC0 A;  4RI6 A;  1V9W A;  4MNN A;  5A1N A;  2LRN A;  4POL A;  5LNK e;  3M1G A;  2GQM A;  7GSS A;  3MDK A;  4BVY A;  2C0G A;  4MJB A;  1EEM A;  2HRK B;  3LYK A;  4GSN A;  3TGZ A;  2FCH A;  1XFL A;  3R2Q A;  3A2X A;  3EU3 A;  3TCO A;  5CRW A;  3J7Y b;  5KN0 A;  3HZ4 A;  4LLR A;  1ST9 A;  4JED A;  5IMC A;  2LRT A;  1N8J A;  1XWA A;  3FZA A;  3A2W A;  1PSQ A;  5ELG A;  5LCZ A;  2HYX A;  4LA1 A;  3DXB A;  3QFA C;  1YJ6 A;  1F3B A;  3N9J A;  2H73 A;  2YOI A;  2IMF A;  3GTU A;  4N0Z A;  3EIN A;  3UIW A;  3BD2 A;  2OAC A;  2PMT A;  2JU5 A;  2VM1 A;  4FQU A;  1OYJ A;  2I3Y A;  4A5P A;  2E2M A;  3LXT A;  4MPF A;  1ZL9 A;  2PPT A;  1URM A;  3MAK A;  2IPA A;  2VOC A;  3TRX A;  3UEM A;  4WF4 A;  4HZ2 A;  1HNB A;  2E2G A;  1U88 A;  2C4J A;  5G1L A;  2YJ7 A;  1EEJ A;  3EE2 A;  3UBL A;  1AIU A;  2WUL A;  4K0G A;  3M0F A;  4PNF A;  1HYU A;  2IIY A;  3MYD A;  1O6J A;  1GSF A;  1SJ6 A;  4KCE A;  2VL3 A;  3IC8 A;  4K2D A;  1YEX A;  4JE1 A;  1TRS A;  4MJC A;  4IHU A;  4PQH A;  1XWB A;  4XRD A;  5IO0 A;  3M9K A;  3TJB A;  2X49 A;  2I81 A;  5AIV A;  1A23 A;  2OE0 A;  3D5J A;  1FVJ A;  1WP0 A;  3F6F A;  1GSU A;  2K6V A;  1EZK A;  3C73 A;  2CA8 A;  4EXJ A;  3A2V A;  5HR2 A;  2B6M A;  1M2B A;  4HI7 A;  5A5H B;  4GRF A;  4OCF A;  4MPG A;  3GIX A;  1Q98 A;  3TUE A;  2HRA A;  3BJ5 A;  3ERF A;  3C71 A;  1JZO A;  2VM2 A;  3GX8 A;  1MDK A;  2MZC A;  4GCI A;  4CY8 A;  4BWQ A;  1TRW A;  2LNT A;  3AY8 A;  3QR6 A;  3H1N A;  6GSS A;  1GTB A;  5H5S A;  1K0M A;  2HI7 A;  2KHP A;  3FW2 A;  2HQT A;  4BL7 A;  3GUR A;  1SK0 A;  3TKR A;  5DJM A;  5IMA A;  2I9H A;  3LW9 A;  3WD6 A;  9GSS A;  1EV9 A;  1SJI A;  4KB3 A;  3L9U A;  2XBQ A;  1PL2 A;  4MF5 A;  1PL1 A;  5D93 A;  2B7K A;  3TRQ A;  1A0F A;  1XVW A;  2CAI A;  3ZMK A;  3LFL A;  3FZ4 A;  4XTS A;  3TB2 A;  2LJK A;  2QSI A;  2YZU A;  2IMD A;  4ACS A;  5IMF A;  2GZP A;  2QGV A;  3LOR A;  2DJ0 A;  1ERU A;  2B3S A;  1SL0 B;  3HD5 A;  5EY6 A;  2DJK A;  3DKS A;  4O92 A;  4N30 A;  2RLI A;  2CZ2 A;  1AW9 A;  5CRG A;  2CZ3 A;  2LNS A;  17GS A;  3HDC A;  6GST A;  2LQQ A;  4ECJ A;  1ERW A;  1THO A;  5IIZ A;  2FUG 2;  5HR1 A;  2WDU A;  1QGV A;  2PU9 C;  13GS A;  4WF5 A;  4PX1 A;  3LQ7 A;  2DLX A;  4XRA A;  4RQX A;  4EIQ A;  1ON4 A;  1TXU A;  1I5G A;  1ZYP A;  3ZIT A;  5LD0 A;  2EIO A;  2H72 A;  4TKY A;  2LV3 A;  1DSB A;  3MWH A;  4PNG A;  2HXK A;  5JWQ B;  5C04 A;  3SBC A;  4IP6 A;  1BYE A;  4OFN A;  3G7I A;  2R37 A;  2H19 A;  4NAX A;  1T1V A;  4JRR A;  4DSS A;  2DSA A;  2E7P A;  3TOU A;  2CX3 A;  2XPE A;  3C1R A;  1IYH A;  4HJM A;  2JZR A;  3FEU A;  5CRE A;  2H01 A;  3R3E A;  4K5R A;  4FYU A;  1M2D A;  4H86 A;  4IGJ A;  3H79 A;  3GH6 A;  2X8G A;  3FZ9 A;  2CVB A;  4I2T A;  1ZGN A;  5ECI B;  3I69 A;  2EIQ A;  5ECO B;  2RM6 A;  3JCM L;  4X1U A;  4EL1 A;  3RHB A;  2GT6 A;  3KMO A;  2YN1 A;  1GSQ A;  3G7J A;  4MCU A;  1XW5 A;  1GNE A;  5J4U A;  4HUA A;  1OKD A;  2X8H A;  2PWJ A;  3IC4 A;  3FRC A;  1A2M A;  4PXO A;  3H93 A;  1TDI A;  1FOH A;  1YF0 A;  3VWX A;  1CQG A;  1V98 A;  4IKH A;  2ES7 A;  4FO5 A;  1YZX A;  2L6C A;  3QDN A;  1TKD B;  4EKZ A;  4KH7 A;  2H0I A;  3W6G A;  3BCI A;  5IPG A;  3RPN A;  1B8X A;  2FHE A;  4DSQ A;  4EO3 A;  1BED A;  4K7N A;  2FA8 A;  4TR0 A;  4DVC A;  1VF2 A;  1VRS D;  1B4P A;  4HU7 A;  4AJ6 A;  1SVO A;  4K9Z A;  4XS4 A;  3IV4 A;  2CVK A;  1LBK A;  3KTB A;  3HYP A;  3EMP A;  2VLV A;  1TK5 B;  1A2L A;  2HSN B;  4EIP A;  2H1L A;  4O7H A;  3FYG A;  2V32 A;  1XOA A;  2AYT A;  3DRN A;  1EGO A;  2VL2 C;  2H1D A;  4PUF C;  4ICY A;  3FR6 A;  4KCA A;  2X4A A;  2B5E A;  3L4N A;  3A3T A;  1K0C A;  2DIY A;  5CNW A;  4TR4 A;  3V1W A;  1TP9 A;  4TXO A;  4YKG A;  4PQ1 A;  3KTL A;  1J9B A;  5GSS A;  4Q5R A;  1ML6 A;  3GKM A;  1OC3 A;  2DMM A;  2VKZ G;  3DGQ A;  2BJX A;  1NHO A;  3UMA A;  2L4Q A;  1PX6 A;  2XBI A;  3E9J B;  3ZYW A;  1X9W B;  5D9X A;  1Z9H A;  3NZN A;  1U6T A;  4OD7 A;  4ID0 A;  2OA7 A;  4IQA A;  2C0D A;  2HFD A;  5CAX A;  1BJX A;  1JZD A;  2GZY A;  5DQS A;  2N5A A;  3PPU A;  1OVN A;  5DBQ A;  1G0T A;  2N5B A;  5DAK A;  2L5O A;  4LL1 B;  1M7T A;  5IM9 A;  2C3T A;  1FB6 A;  5IOX A;  1PD2 1;  3GKK A;  3APS A;  4PGT A;  1WJK A;  6GSW A;  4XCS A;  5J9C A;  4LMW A;  2YNX A;  2A4H A;  4NHZ A;  3Q18 A;  1ZOF A;  2H1A A;  2R0P A;  1R5A A;  4OMV A;  5GST A;  1V40 A;  5D96 A;  4ULX A;  4IVF A;  1NM3 A;  5EVO A;  4G2E A;  1B9Y C;  1G7E A;  1PN9 A;  1H4O A;  2V6O A;  2Z9S A;  4YAV A;  2HRF A;  2FWG A;  3Q74 A;  2IME A;  1BG5 A;  4GTU A;  3VK9 A;  3IAS 2;  1Q4J A;  4O5Q A;  2C1Y A;  2ZCT A;  1SKS B;  2C0F A;  4KAE A;  2IN3 A;  3ZVJ A;  2F3M A;  1J0F A;  5D8I A;  5B8A A;  2V2G A;  1ERT A;  2A2S A;  4CW9 A;  4L8E A;  3DML A;  1YVL A;  1O85 A;  4HQZ A;  2AAW A;  1R4W A;  3VWV A;  3W8S A;  1PRX A;  2EIR A;  4K2X A;  3PGT A;  3CRU A;  4D73 A;  3ERG A;  3ME7 A;  3RAZ A;  1LU4 A;  2LRC A;  3QAW A;  1XVQ A;  4P3Y B;  3GHA A;  2XC2 A;  3TDG A;  4I5Q A;  2DC5 A;  3CYN A;  3E3E A;  1O81 A;  3WYW A;  3GKX A;  3QMX A;  5CRD A;  2FNO A;  1IYI A;  2IJY A;  2NBS A;  5A34 B;  4W66 A;  1NSW A;  3IOS A;  4G0I A;  1TTZ A;  1T00 A;  5ECH B;  3F63 A;  2M46 A;  2K18 A;  4JU5 A;  5DVB A;  2GVP A;  3IAM 2;  1UVZ A;  1GUH A;  3HY2 A;  1PKZ A;  2LTK A;  2GTU A;  1WE0 A;  4HOJ A;  4GDF A;  4ML6 A;  1SYX A;  1SL2 B;  3ZRD A;  4ZBB A;  5FWG A;  2DML A;  5HFG A;  2WJU A;  3ZFL A;  4BVY B;  2NDO A;  1SKW B;  1JLV A;  1UC7 A;  2FGX A;  5J3R A;  3FMW A;  4USS A;  5FHI A;  4Z2R A;  2H71 A;  1FAA A;  4NPB A;  4TXV A;  5DAL A;  2KOK A;  5F05 A;  4G19 A;  2GQL A;  4WXT A;  3TKP A;  4EDZ A;  3CWG A;  4KSO A;  4EVM A;  3HCZ A;  4GF0 A;  4CDO A;  4PUR A;  3E0U A;  2PGT A;  1SVM A;  4ZBA A;  3EU4 A;  3VLN A;  1FG4 A;  3IHQ A;  3GL3 A;  3WT2 A;  5KN2 A;  3WGX A;  1WPI A;  2LJR A;  4IBP A;  4RQR A;  2OE3 A;  4Z7X A;  1TW9 A;  4MF6 A;  1O8X A;  1GWC A;  4GSS A;  1V57 A;  3GTU B;  3GN3 A;  4GST A;  1F37 A;  3LGC A;  1ZYN A;  3EUR A;  2HSY A;  5G2Z A;  3BBY A;  2VIM A;  18GS A;  1J08 A;  5D73 A;  1SD9 A;  3OR5 A;  5HR0 A;  1V58 A;  4KF9 A;  1GH2 A;  1TU8 A;  5ID2 B;  1XWC A;  4LMV A;  2VAF A;  3L9V A;  1TJD A;  2C80 A;  1ZYE A;  3RHC A;  1K0B A;  2LUS A;  4XS6 A;  4K8M A;  4YKF A;  2ON5 A;  4QMK A;  1THX A;  1YY7 A;  1ZMA A;  1V2A A;  2FWH A;  5BMU A;  1LJR A;  3HZ8 A;  1H75 A;  4KND A;  3CRT A;  2MBT A;  3F9U A;  1Z7P A;  1DE1 A;  1YF1 A;  3CSJ A;  5KOW A;  3F3R A;  3QFB C;  4HDE A;  5ECS A;  5IOW A;  2OT3 A;  1VF4 A;  2OAD A;  1SJZ A;  2IFQ A;  3ZVJ D;  1K0D A;  3EWL A;  3KEB A;  4MZW A;  2DJ3 A;  2RM5 A;  3GRX A;  3UAP A;  4BA7 A;  1OC9 B;  4FIW A;  1ERV A;  3WT1 A;  3GX0 A;  1BQ7 A;  1SL1 B;  4AI6 A;  1AXD A;  2O5V A;  5H5R A;  4K6X A;  4O5R A;  5J9B A;  5JCG A;  2XPD A;  5J4V A;  1BAY A;  3F4R A;  1TK8 B;  4TR1 A;  4MF7 A;  2GZZ A;  3UBK A;  2ON7 A;  3TOT A;  3D4M A;  1PKW A;  3IBH A;  4GQC A;  4AJ8 A;  1MTC A;  5J41 A;  4FYC A;  3F3Q A;  1U3A A;  3ED3 A;  2TRX A;  3FY7 A;  2UV8 G;  2G2Q A;  3F6D A;  2HSM A;  1HNA A;  1AQX A;  1Z5Y E;  3IRA A;  1FHE A;  2GGT A;  2R2J A;  2NPB A;  2O89 A;  4EDY A;  1OKT A;  3EVI A;  2A2P A;  2WZ9 A;  3EYT A;  4F0C A;  2L4C A;  4J2F A;  4G10 A;  2DJJ A;  3KCM A;  4JR6 A;  5KN3 A;  2RUE A;  4MJE A;  4O32 A;  4TVE A;  11GS A;  2B5Y A;  3UJ1 A;  4HQS A;  4RI7 A;  2D2Z A;  1HD2 A;  1AAZ A;  1QMV A;  4NV2 A;  4NWY A;  4XHM A;  1Y6E A;  1KNG A;  2HZE A;  2H75 A;  4WET A;  4NV5 A;  1T4Y A;  3IK9 A;  2GT5 A;  2HE3 A;  2HNL A;  1Z3E A;  1USB A;  3LEF A;  4Z2T A;  5J4Y A;  1SU9 A;  4L5O A;  4E8E A;  1O8W A;  3P2A A;  1F3A A;  2PVQ A;  2B5X A;  1MEK A;  4AKI A;  3HMJ G;  2OE1 A;  4V2N A;  4HJ2 A;  2GLR A;  1ZCP A;  1N25 A;  4ISD A;  4J57 E;  19GS A;  3ZRE A;  3HVS A;  4JR4 A;  4MJA A;  4DEJ A;  2ZNM A;  1GNW A;  2PBJ A;  4IS0 A;  2JZS A;  1T8E B;  3UAR A;  1SD8 A;  1Z6N A;  2FY6 A;  1R5P A;  3EMX A;  2F8F A;  2WFC A;  5A5K A;  3D4T A;  3P90 A;  5GAN D;  2MMZ A;  4ZL8 A;  2VCX A;  3QOU A;  1GUK A;  4KUN A;  2R5G A;  4DSS B;  2DBC A;  4AKH A;  5IMV A;  4F9Z A;  1XOB A;  1HNC A;  3HJP A;  3DEX A;  2VCZ A;  5FT3 A;  5IMZ A;  2A2R A;  4MZB A;  1K3O A;  4YQU A;  3H8Q A;  5HQP A;  6GSX A;  4N10 A;  3A5W A;  1O73 A;  2CT6 A;  4OO4 A;  4K5S A;  4OO5 A;  3VFI A;  2OKA A;  3APQ A;  1PA3 A;  3NIV A;  3GYK A;  2VD0 A;  4ZL9 A;  1DUG A;  3LWA A;  2H0H A;  4IJI A;  1M0U A;  5ECN B;  3C7M A;  1ABA A;  5F0G A;  2YZH A;  5IQY A;  4X4J A;  2EFC A;  4Q5N A;  5ECR B;  2VCQ A;  2WS2 A;  1W89 A;  2N5F A;  2A4V A;  1XXU A;  3IDV A;  3HVV A;  3BCK A;  1K0N A;  4F0B A;  3TJJ A;  3HVX A;  5G5F A;  6GSV A;  5J40 A;  2X64 A;  5COH A;  1PN0 A;  3MNG A;  5CYY A;  5F06 A;  4GQF A;  1NHY A;  2P5Q A;  3ZL5 A;  1SK1 A;  2O85 A;  2HSN A;  2L57 A;  2EFD A;  1B48 A;  5F8B A;  2H66 A;  3GKN A;  4G0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...