4EXJA

Crystal structure of glutathione s-transferase like protein lelg_03239 (target efi-501752) from lodderomyces elongisporus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
221
Chain Sequence
VMAILYTGPTGNGRKPLVLGKLLNAPIKVHMFHPTKDIQEDWYLKLNPAGIVPTLVDDKGTPITESNNILLYIADTYDKEHKFFYSLKQDPKLYWEQNELLFYQATQFQSQTLTIANANYQNGHIDENIAQYVLSSFEKVFAFMETKLSGRDWFVGDKFTIVDIAFLVGEHRRRERLHNSPIWIDLKENFPNVEKWFQRAIAFENVEEILKEHAAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of glutathione s-transferase like protein lelg_03239 (target efi-501752) from lodderomyces elongisporus
rcsb
source organism Lodderomyces elongisporus nrrl yb-4239
total genus 73
structure length 221
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4exjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4exjA01
2MYGA 4K9ZA 3MWHA 1PL1A 3GURA 3LXTA 4WBJA 2VCVA 5CO3A 3H79A 5D73A 1WMJA 4GF0A 1RK4A 1GNWA 3ZL5A 1JZOA 1UC7A 1PKWA 5IIZA 4TR3A 1T7PB 1TI3A 3ERWA 1M7TA 3WD6A 4KDYA 2O8VB 4KX4A 1NSWA 3GHAA 3VWUA 1ILOA 5KN0A 2PGTA 1A24A 1AIUA 3ZMKA 4N0VA 4NAXA 4MCUA 1X5DA 1H4OA 5EY6A 4NWYA 2HSNB 1MDIA 3ZFLA 4PUFC 2PERA 2GGTA 3TDGA 6GSWA 4KB3A 5G31A 2GSQA 4JU5A 5B6MA 1N8JA 2LJAA 4G10A 2F8FA 2WULA 1O6JA 2H66A 4GSTA 3ZTLA 1F9MA 5DQSA 1M2AA 2H0IA 3DVWA 5IOWA 4NHZA 1OC3A 4IN0A 3GV1A 2L59A 5IO2A 5IOXA 3MSZA 3IA1A 1G7OA 4MZWA 3GYKA 4MP4A 1X5CA 6GSTA 4MMMA 5ECKB 2OE0A 2ES7A 2FA4A 2OJLA 5HFKA 2LNSA 1MD4A 3F3QA 4FYUA 3N9JA 4PURA 4JR6A 1K3LA 2HT9A 2O89A 1BEDA 4WR4A 2LJKA 1YEPA 2HE3A 5CNWA 5A4WA 5HQPA 3FW2A 4GSSA 3M8NA 2RLIA 5KN2A 3QPMA 1X9MB 1WP0A 2VL2C 4TR0A 2C80A 2LEGA 3VI5A 2J9HA 4ECJA 3UVTA 5IMZA 1A23A 2YWMA 1SKSB 4K0GA 1A0FA 2I1UA 4HZ4A 3UEMA 1M2BA 3BJ5A 1DBYA 2C3TA 2YN1A 3ERGA 1GSFA 2VO4A 4V2MA 2H73A 3GKKA 3PH9A 4X0XA 3US3A 3KXOA 4G0KA 4LA1A 2L6DA 3G7YA 2UZ8A 5JWRB 2H71A 3KMOA 2YPMA 3CRTA 2DC5A 1PGTA 4PTSA 3W6GA 3G7JA 4KA0A 1Z7RA 1RW1A 1EGRA 4HS1A 5DBQA 2K8SA 2H0GA 2FGXA 2H1AA 3HY2A 1T00A 1F3AA 3CSJA 1F37A 1OYJA 4V1Ap 2HRFA 1OE7A 3SWLA 2VOCA 4BWQA 4EDYA 5DVBA 5ECPB 1Z6NA 4WXTA 2TIRA 2XHFA 4ISDA 3IAS2 5ECQB 2PWJA 3O76A 3M1GA 5IMCA 2LQOA 4OO4A 2CT6A 2D2ZA 1GRXA 1XW5A 5DALB 4YQUA 2IJYA 3LYPA 2YWNA 5IM9A 1FVKA 2CX3A 4DSQA 3ERFA 4USSA 3H4KA 1ERVA 3GRXA 4QL9A 1YEXA 2M72A 3TRQA 2DSAA 1TK5B 6GSSA 2H70A 2VL2A 1KTEA 1YJ6A 2L4QA 4EC0A 5F06A 1HD2A 1XPVA 5D9VA 2R2JA 1GP1A 3LGCA 2FUG2 4ML1A 1AQXA 4KDXA 2A2RA 1U87A 1Q4JA 3Q19A 3BBYA 4LLRA 3IC8A 3GH9A 1WJKA 1GH2A 3HXSA 1JZWA 1QUWA 1O7UA 4GRFA 2L6CA 1YF0A 1EV4A 3RDWA 4JZQA 2LRCA 1DE2A 4HJ2A 1QGVA 5DDLA 2I9HA 3LFLA 4NPBA 2WCIA 4DSRA 4Q5QA 5F05A 4ZL8A 4MJBA 3HVXA 1PX7A 3A2WA 4O5RA 1XW9A 4ZB6A 4POMA 4BVYB 2RIIA 2CAIA 3C7MA 2MMAA 1ZCPA 2C0GA 1F3BA 5IMDA 5JWOB 2BTOT 2GQKA 1W4VA 4N10A 5F07A 3TKSC 1A8YA 4AGSA 2F9SA 2DJ1A 2FLSA 4K1FA 2VLTA 3QAWA 2HSMA 1THOA 1GSYA 3UMAA 4XCSA 3SBCA 1BG5A 3NOFA 4F82A 3L9UA 4LMVA 3GX8A 2C0FA 3IC4A 4MK3A 2B5EA 4IVFA 2VUPA 4RI7A 1JZRA 4MA9A 2E0QA 1AW9A 1OKTA 4G0LA 4ZILA 2DIZA 2IIYA 2JZTA 1M9AA 4GLTA 1G6WA 4LMWA 1XVWA 1XVQA 1O8WA 2C1YA 2H76A 2GSSA 2CZ2A 2RM5A 3VURA 1A0RP 1LJRA 2OA7A 3WYWA 4FH8A 3CMIA 4Q5NA 1K0CA 1PRXA 5CAXA 3GH6A 3HZ8A 2CA8A 2NDOA 3HDCA 2OADA 3L9SA 4GSNA 6GSVA 1GULA 2HZEA 3EU4A 4K7NA 5B6NA 3RHBA 1ERWA 2NTOA 3KGKA 5DJLA 4YQVA 2LNTA 1K3OA 3WT1A 4V2NA 1KNGA 3M3MA 3D21A 2YOIA 3WGDA 1V40A 1S3DA 3GFKA 3NZNA 2DJKA 5D96A 1TOFA 1UN2A 2MMNA 2IFQB 1XWKA 2IMEA 4HEA2 4BPYA 2H19A 2GZZA 1XW6A 2O87A 2WS2A 2CVKA 2O7KA 5H5QA 2RUFA 2MMZA 1SD9A 3TKSA 3HKRA 2I4AA 3DVXA 2M80A 4L5LA 5DCHA 1GTUA 1SU9A 3ZLPA 22GSA 4JE1A 2AUVA 2A2SA 1T4YA 3DEXA 1I5GA 2V32A 4I2TA 2LTKA 1S3AA 4BVYA 4POBA 3A5WA 1K0BA 2GZYA 2IN3A 1GTBA 3HD5A 3VPQA 1GWCA 3O6TA 1GTIA 2C0EA 4TXVA 3CYNA 1FG4A 4KSMA 2XBIA 4PQIA 5J4UA 2CZ3A 2YANA 1K0OA 3F4SA 2GDRA 3F9UA 5FWGA 2KP1A 3GL5A 2JU5A 2F8AA 3ZIJA 1X5EA 3GL3A 1JZDA 4F9ZA 1JHBA 4KF9A 3F63A 1M9BA 5FT3A 3EYTA 1X0RA 3J7Yk 4WR5A 3TOUA 4DSSA 1GUMA 1AUCA 3RAZA 4L0WA 1E2YA 3GMFA 3ZVJA 3QD9A 7GSSA 1BQ7A 2JADA 4EL1A 1PA3A 5CREA 2YV9A 3BCIA 5GSSA 1QXHA 1FO5A 3KP8A 4RQXA 2HI7A 5LCZA 1TRSA 4D73B 2R4VA 4TXOB 1SL2B 4XHMA 5CRDA 2N5FA 3D4MA 2EIQA 1ERTA 2GLRA 3GKMA 3TKRA 3DGQA 4I6XA 1HNAA 2EIRA 5H5RA 3V1WA 4N0ZA 3MAKA 3TJGA 1ZOFA 2GSRA 3UAPA 1YQ1A 4F2IA 2E2GA 4XTSA 5ECIB 3ZIVA 4ECCA 3KJYA 3C1SA 1EGOA 1AQVA 2GTUA 3CSIA 4ZIJA 3KCMA 3TKQA 2VM2A 2J23A 5GAPD 5CYYA 5D93A 3GKXA 1VF2A 3L0HA 4YAPA 2MBTA 5IMVA 1SL0B 4WEYA 2LJRA 2H1GA 2X8HA 3ZVJD 1EZKA 2IMKA 3TUEA 4F03A 4PNGA 3R2QA 1OC8A 3CSHA 2DJ3A 1PN9A 4BL7A 2PMTA 2JL4A 1ZL9A 3UOMA 3M0FA 1VF4A 3UBLA 3TCOA 1WRYA 5FHIA 2B7JA 3ZYWA 3QFBC 4O92A 3DXBA 1RQMA 2C8UA 4JEDA 5G30A 1XWBA 2IMIA 1HQOA 2H01A 2CVBA 4K7OA 2X64A 2B5XA 2V1MA 2HRKA 1K0DA 1A2LA 3ZMLA 4IP1A 3TGZA 3PINA 3F4TA 2YZHA 3FY7A 4ZB8A 1Q98A 1SKWB 1K3YA 5G1LA 1NW2A 6GSXA 5IQYA 4GQFA 1W89A 3FK8A 1AQWA 1O81A 2G2QA 2HLSA 5AIVA 3W8SA 1YDKA 2B1KA 2XC2A 1VRSD 3EE2A 3DIEA 3APOA 4J57E 4QQ7A 4KH7A 3TKSE 3KEBA 2YJHA 1UVZA 1ON4A 3N5OA 4YH2A 1GSUA 4JRRA 1NM3A 1GNEA 5ELGA 3M9JA 1FOVA 3EC3A 1SKRB 1R5AA 4KE3A 1B9YC 1Y25A 5LD0A 1Z6MA 3IV4A 3GTUB 2K9FA 5CP1A 3VWXA 4V2LA 3VPTA 1R7HA 3F0IA 1TK8B 3GKNA 5HFIA 2R3XA 1SYXA 5J9CA 2FNOA 3DYRA 3MDKA 5JWQB 1GSQA 4NMUA 1NHOA 5ENUA 2REMA 4KSOA 1MDJA 3QFAC 2X8CA 2DMMA 4HJMA 3C8EA 3KD0A 4IJIA 4CHSA 2JZRA 1ZMAA 4EDZA 3APSA 1TK0B 4E8HA 3FZ4A 4XRDA 1X9SB 4I97A 4FYBA 5D9TA 2F51A 2QSIA 3TJKA 2V2GA 4POLA 3QDNA 3H1NA 4GCIA 2P31A 5KN1A 3CBUA 1OC9B 3GX0A 4ECIA 3CTGA 5ID2B 1XIYA 2OE1A 4MH3A 3LG6A 3FEUA 5ELAA 2OBIA 5EVOA 2YZUA 3GIXA 1GSEA 4HDEA 4TN8A 1LU4A 2YNXA 3KP9A 1WOUA 1FAAA 5JCUA 1TRWA 1TRVA 4TR1B 4XS4B 3IXRA 2H6YA 4OFNA 2MBSA 4ZBDA 3DWVA 2X8GA 1U88A 2QGVA 1CQHA 1HNBA 4IKHA 1ABAA 4BVXB 4ZB9A 3EWLA 1ZYQB 2AJQB 3FR9A 6GSYA 3E9JB 3S9FA 2O85A 5G5EA 1THXA 1G0TA 5G2ZA 1B48A 3DRNA 19GSA 1JLVA 1FB0A 2LQQA 2XPEA 1URMA 3P8WA 1TP9A 4FYCA 5IMAA 2WDUA 3GNJA 2LRNA 2TRCP 1HYUA 3KMNA 2FY6A 3LQ7A 1Z3EA 4CW9A 1SK2A 2FD3A 2P5RA 4MLYA 3K8NA 4ZBBA 3R3EA 4PQHA 3GTUA 3Q74A 2CV4A 4MF7A 3QAGA 3O3TA 3H8QA 3IOSA 3KTBA 3AY8A 1O85A 3KH9A 3EMPA 1TXXA 4AF2A 4QL7A 4IGJA 3IDVA 11GSA 1GUHA 1K0MA 2PVQA 2YJ7A 2XBQA 1XWGA 4K0NA 1QK8A 3HZ4A 4TW5A 3FYGA 5EPFA 2GT6A 4O32A 2WJUA 5F0GA 1J0FA 5CRWA 4G19A 13GSA 1R5PA 2FA8A 3VI7A 3UJ1A 5D8IA 1T8EB 1PKZA 5HR2A 3IAM2 4DVCA 1AXDA 4HQSA 3VWVA 1PQNA 1J9BA 2F3MA 3J7Yb 2LUSA 4EF0A 1PL2A 1XZOA 3KM6A 5D9WA 2EC4A 4ACSA 5IO0A 4ZL7A 4ID0A 1B9XC 3UL3A 1J08A 2M46A 2C3NA 5DALA 3G9BA 1O73A 1GSSA 3UVHA 1TI1A 4PXOA 4K2DA 3VK9A 1DUGA 18GSA 2ALBA 3RPNA 2VCQA 2A4VA 2JACA 2CAQA 3JCML 3QCPA 2PUKC 3G7IA 2PVOC 4TOPA 3M9KA 4TR1A 4XS4A 4K8MA 2FWFA 1GLPA 5DCGA 3QR6A 1DE1A 3Q6OA 1MDKA 4KDUA 3QAVA 2TRXA 1ACVA 1S3CA 5HFGA 3QOUA 1U3IA 3C71A 3IBHA 2K8VA 2L4CA 5CRGA 4MPGA 3U6VA 1A2MA 2B1LA 3FRCA 4MH2A 4F0CA 1B8XA 1V57A 3W8JA 4AJ6A 1DSBA 3QMXA 1SJZA 4HOJA 2BMXA 1WWJA 4FIWA 2C4JA 1YKAA 2H72A 2OACA 3ZITA 4YQMA 3ISOA 2VD1A 1KEBA 3TOTA 3FKFA 4MF6A 3MNGA 2VD0A 4IW9A 1BX9A 3A3TA 3VFIA 3D4TA 3WGEA 1SJIA 5C04A 4IS0A 3VWWA 4HU7A 4HZ2A 2FCHA 5A5KA 2VCWA 4K6XA 1AAZA 4LL4B 2C0DA 4TKYA 2HNLA 3KIJA 2ZUPA 5G5FA 3UIWA 4KGIA 3IRAA 4Q5RA 4Z7XA 3CRUA 3HHVA 3EURA 3IK7A 3BOAA 3FZAA 1F6MC 2DBCA 2HFDA 2LS5A 2MZCA 1E6BA 3FZ9A 1TDIA 3C1RA 2RM6A 4MZCA 4MF5A 2OBKA 3BD2A 1O8XA 2GQMA 2I3YA 1ZGNA 2LV3A 5DAKB 1BJXA 4E8EA 1Z7PA 2VCZA 3GA4A 3ZZXA 4POKA 1F2EA 3C73A 3HYPA 2B6MA 4I5QA 1I9DA 2DJJA 1TU7A 3D5JA 2DJ2A 1FVJA 1PX6A 3F6DA 2IMFA 2IPAA 2VCTA 5G1KA 3GSSA 4TR4A 2AAWA 4TRXA 4OFTA 4LL1B 3U5RE 1T3BA 1XWAA 4PNFA 2R37A 2CVDA 3E3EA 2E2MA 1V2AA 3D22A 1OE8A 2Z9SA 2IFQA 5B7CA 2KHPA 2NPBA 4IELA 4WETA 3IPZA 1ML6A 1T1VA 1LBKA 4IHUA 1U3AA 4GTUA 4BWSA 3IR4A 1A8LA 2JSZA 5DQYA 1H75A 1XOBA 3WGXA 5ECMB 2KP2A 2AYTA 2P5QA 4J56E 4WKWA 5ECOB 5IPHA 1U6TA 3D0ZA 2HSHA 4MJAA 5AIXA 2ZCTA 1TTZA 3UARA 2BJXA 4AJ8A 2JSYA 1GL8A 1SENA 5BMUA 4RI6A 4XS6A 5ECHB 1K0AA 1EOHA 5HR3A 1Z5YE 4N11A 1ZZYA 1XBSA 4IP6A 2DIYA 5KN3A 3Q18A 4XS1A 4OO5A 3ME7A 1WIKA 4EXJA 5C00A 4EKZA 4FQUA 4PGTA 3ZFBA 4KCEA 1Z9HA 5EL8A 1PSQA 2WZ9A 1WE0A 4WF5A 1EWXA 1SJ6A 1G7EA 5ECRB 3F4RA 12GSA 4HUAA 4ML6A 3EU3A 2NVLA 4IQ1A 3BCKA 1JFUA 2GS3A 1NHYA 1MEKA 1QFNA 3GSTA 2GQLA 5DAKA 4IQAA 3TJBA 14GSA 5L71A 3PGTA 5ABRA 2FHEA 4EUYA 4D73A 3L9VA 2VLVA 5A4UA 5HR1A 4TXOA 3EMXA 3FZ5A 2PPTA 4BA7A 4L8EA 4PUAA 4HQZA 4ZL9A 5GZZB 1WPIA 3TRXA 1TRUA 1M0UA 5IPGA 4RQRA 2B3SA 2HRAA 1UA5A 5AN1A 2L57A 2YP6A 2LRTA 5JCGA 4CDOA 1VGLA 2K18A 1JLWA 3HJOA 2NBSA 2H30A 2JZSA 4FO5A 2QC7A 4HU9A 2YCDA 4WF4A 2OKAA 4OD7A 5INYA 2PBJA 4ILFA 5ECLB 1TU8A 3TB2A 2YV7A 2HSMB 2B5YA 3LSZA 2GVPA 3KTLA 2HSYA 1USBA 4NHWA 4MZBA 2XPDA 3VLNA 3APQA 2V6KA 3DD3A 2V6OA 3E0UA 3I69A 1XOAA 3KH7A 4K7IA 5J9BA 1XWCA 3UBKA 5AISA 1K0NA 2RUEA 2GSTA 2AB6A 5A4VA 3LYKA 2X99A 16GSA 3ED3A 2FWGA 2ZNMA 4P3YB 2N5AA 2HYXA 2GT5A 1GTAA 5JCWA 1FW1A 4KW6A 2YWOA 5J41A 3GN3A 1Y6EA 3LEFA 2WFCA 1V98A 2H6XA 2MMOA 4NXIA 4OFMA 1CQGA 4JR4A 5B8AA 5KEJA 2HZEB 1HNCA 2IWTA 1EP7A 1T4ZA 2FWEA 4MPFA 4PQ1A 1GSDA 1TW9A 3I9V2 3OR5A 1VF3A 1VF1A 4PX1A 4DEJA 4GXZA 1YF1A 4GQCA 1EP8A 3TKPA 5E59A 3EINA 2B7KA 1XXUA 4XIHA 2FWHA 3TJFA 4L5OA 3P7XA 3TRPA 1G6YA 2WRTA 2VAFA 1PD21 4JBBA 1XCCA 3TJJA 1M2DA 5IMFA 4KCAA 2PU9C 4KUNA 2KLXA 1FHEA 2HRNA 1XFLA 5AGYA 3PR8A 2R5GA 4HI7A 2DMLA 17GSA 3A2VA 4F0BA 10GSA 2IMDA 4TVEA 1ERUA 2H75A 3HVVA 4G0IA 3PPUA 5LNKe 4GWRA 1C72A 3F8UA 4J2FA 4OCEA 5H5SA 2L5OA 1BYEA 4MJEA 3ZREA 3DKSA 9GSSA 1BAYA 4KNDA 1OVNA 4G2EA 4H86A 1OAZA 3D6IA 5COHA 1B4QA 1YKCA 4I2UA 20GSA 1OC9A 3F6FA 5J3RA 3HCZA 1M99A 6GSUA 2C3QA 4NV2A 2PN8A 5ID2A 4G9HA 5ECSA 1SL1B 2VL3A 4KAEA 3I6AA 3RHCA 4YAVA 2H6ZA 4DSSB 4MJCA 2VIMA 1IYHA 5E4WA 4IBPA 2VCXA 2I81A 2AHEA 1EV9A 2N5BA 1TKDB 8GSSA 2ON5A 2CQ9A 2DLXA 4AJ7A 1MTCA 2KUCA 3EVIA 1EOGA 1SK0A 2AV4A 2VLUA 2WGRA 1IYIA 5DJMA 3P2AA 2V41A 1R4WA 2G0FA 1YY7A 4BVXA 4ECBA 2R6KA 3H93A 3LORA 4NV5A 2VM1A 3HJMA 3GUSA 3HA9A 5GSTA 4OCFA 5GAND 5J5NA 3FR6A 3CXGA 4X43A 4EO3A 2H8LA 1V9WA 2YWIA 1MD3A 3HJPA 5F8BA 2HQTA 3A2XA 1ZYEA 1X9WB 4WBRD 2EIOA 3RPPA 1SYRA 1GUKA 2H1BA 4O7HA 3FR3A 2HZFA 3P90A 1QQ2A 1EEJA 2DJ0A 4X1UA 4Q5FA 2E7PA 3CTFA 4BL7B 3I43A 2ON7A 4MDCA 2CX4A 4OWYA 4EE0A 3LJRA 2HXKA 4RUVA 3L4NA 1EEMA 5B8BA 4EVMA 5CRHA 2QKEA 1QMVA 2GZPA 2H0HA 3ZRDA 1PMTA 5HR0A 2LSTA 2L5LA 1SK1A 1TJDA 2K6VA 3LXZA 2HRKB 3NIVA 4IJ3A 4N30A 5D9XA 3DMLA 2OE3A 4MABA 3F3RA 2P0GA 2VL9A 3ME8A 3HVSA 3RBTA 1SD8A 1V58A 1YZXA 3IHQA 1GLQA 1ST9A 1AC1A 1FB6A 2WB9A 3WT2A 2H1DA 1N2AA 4ZBAA 4L0UA 1A2JA 5ECNB 2KOKA 3KZQA 1OKDA 1B4PA 2LKUA 4I8BA 4ZXGA 2H74A 1KBNA 3IK9A 3L78A 3IE3A 4OMVA 3FHKA 1R26A 2IL3A 4ULXA 3LWAA 4XRAA 4V1Ag
chains in the Genus database with same CATH superfamily
2MYGA 4K9ZA 3MWHA 1PL1A 3GURA 3LXTA 4WBJA 2VCVA 5CO3A 3H79A 5D73A 1WMJA 4GF0A 1RK4A 1GNWA 3ZL5A 1JZOA 1UC7A 1PKWA 5IIZA 4TR3A 1T7PB 1TI3A 3ERWA 1M7TA 3WD6A 4KDYA 2O8VB 4KX4A 1NSWA 3GHAA 3VWUA 1ILOA 5KN0A 2PGTA 1A24A 1AIUA 3ZMKA 4N0VA 4NAXA 4MCUA 1X5DA 1H4OA 5EY6A 4NWYA 2HSNB 1MDIA 3ZFLA 4PUFC 2PERA 2GGTA 3TDGA 6GSWA 4KB3A 5G31A 2GSQA 4JU5A 5B6MA 1N8JA 2LJAA 4G10A 2F8FA 2WULA 1O6JA 2H66A 4GSTA 2X49A 3ZTLA 1F9MA 5DQSA 1M2AA 2H0IA 3DVWA 5IOWA 4NHZA 1OC3A 4IN0A 3GV1A 2L59A 5IO2A 5IOXA 3MSZA 2DKHA 3IA1A 1G7OA 4MZWA 3GYKA 4MP4A 1X5CA 2R0CA 6GSTA 4MMMA 5ECKB 2OE0A 2ES7A 2FA4A 2WVZA 4G01A 2OJLA 5HFKA 1ZYNA 5J40A 2LNSA 1MD4A 3F3QA 4FYUA 3N9JA 4PURA 4JR6A 1K3LA 2HT9A 2O89A 1BEDA 1I1IP 4WR4A 2LJKA 1YEPA 2HE3A 2A4HA 5CNWA 4AKGA 5A4WA 5HQPA 4K5RA 3FW2A 4GSSA 3M8NA 2RLIA 5KN2A 3QPMA 1X9MB 1WP0A 2VL2C 4Z2TA 4TR0A 2C80A 2LEGA 3VI5A 2J9HA 4ECJA 3UVTA 5IMZA 1A23A 2YWMA 1SKSB 4K0GA 1A0FA 2I1UA 4HZ4A 3UEMA 1M2BA 3BJ5A 1DBYA 2C3TA 2YN1A 3ERGA 1GSFA 2VO4A 4V2MA 2H73A 3GKKA 3PH9A 4X0XA 3US3A 3KXOA 4G0KA 4LA1A 2L6DA 3G7YA 2UZ8A 5JWRB 3FMWA 2H71A 4AKHA 4CY6A 3KMOA 2YPMA 3CRTA 2DC5A 3RFRC 1PGTA 4PTSA 3W6GA 3G7JA 3TU3B 4KA0A 1Z7RA 1RW1A 1EGRA 4HS1A 5DBQA 2K8SA 2H0GA 5A1NA 2FGXA 2H1AA 3HY2A 1T00A 1F3AA 3CSJA 1F37A 1OYJA 4V1Ap 2HRFA 1OE7A 3SWLA 2VOCA 4BWQA 4EDYA 5DVBA 5ECPB 1Z6NA 4WXTA 2TIRA 2XHFA 4ISDA 3IAS2 5ECQB 2PWJA 3O76A 3M1GA 5IMCA 2LQOA 4OO4A 2CT6A 2D2ZA 1GRXA 1XW5A 5DALB 4YQUA 2IJYA 2EFCA 3LYPA 2YWNA 5IM9A 1FVKA 4AI6A 2CX3A 4DSQA 3ERFA 4USSA 3H4KA 1ERVA 3GRXA 4QL9A 1YEXA 2M72A 3TRQA 2DSAA 1TK5B 6GSSA 2H70A 2VL2A 1KTEA 1YJ6A 2L4QA 4EC0A 5F06A 1HD2A 1XPVA 5D9VA 2R2JA 4A5PA 1GP1A 3LGCA 2FUG2 4ML1A 1AQXA 4KDXA 2A2RA 1U87A 1Q4JA 3Q19A 1PFOA 3BBYA 4LLRA 3IC8A 3GH9A 1WJKA 1GH2A 3HXSA 1JZWA 5KOXA 1QUWA 1O7UA 4GRFA 2L6CA 1YF0A 1EV4A 3RDWA 4JZQA 2LRCA 1DE2A 4HJ2A 1QGVA 5DDLA 2I9HA 3LFLA 4NPBA 2WCIA 4DSRA 4Q5QA 5F05A 4ZL8A 4MJBA 4AKIA 3HVXA 1PX7A 3A2WA 4O5RA 1XW9A 4ZB6A 4POMA 4BVYB 2RIIA 2CAIA 3C7MA 2MMAA 5A5HA 1ZCPA 2C0GA 1F3BA 5IMDA 5JWOB 2BTOT 2GQKA 1W4VA 4N10A 5F07A 3TKSC 1A8YA 4AGSA 2F9SA 2DJ1A 2FLSA 4K1FA 2VLTA 3QAWA 2HSMA 1THOA 1GSYA 3UMAA 4XCSA 3SBCA 1BG5A 3NOFA 4F82A 3L9UA 2WVXB 4LMVA 3GX8A 2C0FA 3IC4A 4MK3A 2B5EA 4IVFA 2VUPA 4RI7A 1JZRA 4MA9A 2E0QA 1AW9A 1OKTA 4G0LA 4ZILA 2DIZA 2IIYA 2JZTA 1M9AA 4GLTA 1G6WA 4LMWA 1XVWA 1XVQA 1O8WA 2C1YA 2H76A 4AKXB 2GSSA 2CZ2A 2RM5A 3VURA 1A0RP 1LJRA 2OA7A 3WYWA 4FH8A 3CMIA 4Q5NA 1K0CA 1PRXA 5CAXA 1ZYPA 3GH6A 3HZ8A 2CA8A 2NDOA 3HDCA 2OADA 3L9SA 4GSNA 6GSVA 1GULA 2HZEA 3EU4A 4K7NA 5B6NA 3RHBA 1ERWA 2NTOA 3KGKA 5DJLA 4YQVA 2LNTA 1K3OA 3WT1A 4V2NA 1KNGA 3M3MA 3D21A 2YOIA 3WGDA 1V40A 1S3DA 3GFKA 4BIKA 3NZNA 4ICYA 2DJKA 5D96A 1TOFA 1UN2A 2MMNA 2IFQB 1XWKA 2IMEA 4HEA2 4BPYA 2H19A 2GZZA 1XW6A 2O87A 2WS2A 2CVKA 2O7KA 5H5QA 2RUFA 2MMZA 1SD9A 3TKSA 1SVLA 3HKRA 2I4AA 3DVXA 2M80A 2H1LA 4L5LA 3HVNA 5DCHA 1GTUA 1SU9A 3ZLPA 22GSA 4JE1A 2AUVA 2A2SA 1T4YA 3DEXA 1I5GA 2V32A 4I2TA 2LTKA 1S3AA 3HMJG 4BVYA 4POBA 3A5WA 1K0BA 2GZYA 2IN3A 1GTBA 3CQFA 3HD5A 3VPQA 1GWCA 3O6TA 1GTIA 2C0EA 4TXVA 3CYNA 1FG4A 4KSMA 5BMUB 2XBIA 4PQIA 5J4UA 2CZ3A 2YANA 1K0OA 3F4SA 2GDRA 3F9UA 5FWGA 2KP1A 3GL5A 2JU5A 2F8AA 3ZIJA 1SVMA 1X5EA 3GL3A 1JZDA 4F9ZA 1JHBA 4KF9A 3F63A 4K2XA 1M9BA 5FT3A 3EYTA 1X0RA 3J7Yk 4WR5A 3TOUA 4DSSA 1GUMA 1AUCA 3RAZA 4L0WA 1E2YA 3GMFA 3ZVJA 3QD9A 7GSSA 1BQ7A 2JADA 4EL1A 1PA3A 5CREA 2YV9A 3BCIA 5GSSA 2O5VA 1QXHA 1FO5A 3KP8A 4RQXA 2HI7A 5LCZA 1TRSA 4D73B 2R4VA 4TXOB 1SL2B 4XHMA 5CRDA 2N5FA 3D4MA 2EIQA 1ERTA 2GLRA 3GKMA 3IHGA 3TKRA 3DGQA 4I6XA 1HNAA 2EIRA 5H5RA 3V1WA 4N0ZA 3MAKA 3TJGA 1ZOFA 2GSRA 3UAPA 1YQ1A 4F2IA 2E2GA 1XG8A 4XTSA 5ECIB 2EFDA 3ZIVA 4ECCA 3KJYA 3C1SA 1EGOA 1AQVA 2GTUA 3CSIA 4ZIJA 3KCMA 3TKQA 2VM2A 2J23A 5GAPD 5CYYA 5D93A 3GKXA 1VF2A 3L0HA 4YAPA 2MBTA 5IMVA 1SL0B 4WEYA 2LJRA 2H1GA 2X8HA 3ZVJD 1EZKA 1M3JA 2IMKA 3TUEA 4F03A 4PNGA 3R2QA 1OC8A 3CSHA 2DJ3A 1PN9A 4BL7A 2PMTA 2JL4A 1ZL9A 3UOMA 3M0FA 1VF4A 3UBLA 3TCOA 1WRYA 5FHIA 2B7JA 3ZYWA 3QFBC 4O92A 3DXBA 1RQMA 2C8UA 2EFEA 4JEDA 5G30A 1XWBA 2IMIA 1HQOA 2H01A 2CVBA 4K7OA 2X64A 3RGBC 2V1MA 2B5XA 1PN0A 2HRKA 1K0DA 1A2LA 3ZMLA 4IP1A 3TGZA 3PINA 2DKIA 4QMKA 3F4TA 2YZHA 2R0GA 3FY7A 4ZB8A 1Q98A 1SKWB 1K3YA 5G1LA 1NW2A 4CY8A 6GSXA 5IQYA 4GQFA 1W89A 3FK8A 1AQWA 1O81A 2G2QA 2HLSA 4GDFA 5AIVA 3W8SA 1YDKA 4X4JA 2B1KA 2XC2A 1VRSD 3EE2A 3DIEA 4PHZC 3APOA 4J57E 2WZSA 4QQ7A 4YKGA 4KH7A 3TKSE 3KEBA 2YJHA 1UVZA 1ON4A 3N5OA 4YH2A 1GSUA 4JRRA 1NM3A 2EFHA 1FOHA 1GNEA 5ELGA 3M9JA 2R0PA 1FOVA 3EC3A 1SKRB 1R5AA 4KE3A 1B9YC 1Y25A 5LD0A 1Z6MA 3IV4A 3GTUB 2K9FA 5CP1A 3VWXA 4V2LA 3VPTA 1R7HA 3F0IA 1TK8B 3GKNA 5HFIA 2R3XA 1SYXA 5J9CA 2FNOA 3DYRA 3MDKA 5JWQB 1GSQA 4NMUA 1NHOA 5ENUA 2REMA 4KSOA 1MDJA 3QFAC 2X4AA 2HSNA 5A34B 2X8CA 2DMMA 4HJMA 3C8EA 3KD0A 4IJIA 4CHSA 2JZRA 1ZMAA 4EDZA 3APSA 1TK0B 4E8HA 3FZ4A 4XRDA 1X9SB 4I97A 4FYBA 5D9TA 2F51A 2QSIA 3TJKA 2V2GA 4POLA 3QDNA 3H1NA 4GCIA 2P31A 5KN1A 3CBUA 1OC9B 3GX0A 4ECIA 3CTGA 5ID2B 1XIYA 2OE1A 4MH3A 3LG6A 3FEUA 5ELAA 2OBIA 5EVOA 2YZUA 3GIXA 1GSEA 4HDEA 4TN8A 1LU4A 2YNXA 3KP9A 1WOUA 1FAAA 5JCUA 1TRWA 1TRVA 4TR1B 4XS4B 3IXRA 2H6YA 4OFNA 2MBSA 4ZBDA 3DWVA 2X8GA 1U88A 2QGVA 4Z2UA 1CQHA 1HNBA 4IKHA 1ABAA 4BVXB 4ZB9A 3EWLA 1ZYQB 2AJQB 3FR9A 6GSYA 3E9JB 3S9FA 2O85A 5G5EA 1THXA 1G0TA 5G2ZA 1B48A 3DRNA 19GSA 1JLVA 1FB0A 2LQQA 4EIPA 2XPEA 1URMA 3P8WA 1TP9A 4FYCA 5IMAA 2WDUA 3GNJA 2WW1A 2LRNA 2TRCP 1HYUA 3KMNA 2FY6A 3LQ7A 1Z3EA 4CW9A 1SK2A 2FD3A 2P5RA 4MLYA 3K8NA 4ZBBA 3R3EA 4PQHA 3GTUA 3Q74A 2CV4A 4MF7A 3QAGA 3O3TA 3H8QA 3IOSA 3KTBA 3AY8A 1O85A 3KH9A 3EMPA 1TXXA 4AF2A 4QL7A 4IGJA 3IDVA 11GSA 1GUHA 1K0MA 2PVQA 2YJ7A 2XBQA 1XWGA 4K0NA 1QK8A 3HZ4A 4TW5A 1N25A 3FYGA 5EPFA 2GT6A 4O32A 2WJUA 5F0GA 1J0FA 2WVYA 5CRWA 4G19A 13GSA 1R5PA 2FA8A 3VI7A 3UJ1A 5D8IA 2VKZG 1T8EB 1PKZA 5HR2A 3IAM2 4DVCA 1AXDA 4HQSA 3VWVA 1PQNA 1J9BA 2F3MA 3J7Yb 2LUSA 4EF0A 1PL2A 1XZOA 3KM6A 5D9WA 2EC4A 4ACSA 5IO0A 4ZL7A 4ID0A 1B9XC 3UL3A 1J08A 2M46A 2C3NA 5DALA 3G9BA 1O73A 1GSSA 3UVHA 1TI1A 4PXOA 4K2DA 3VK9A 1DUGA 3LW9A 18GSA 2ALBA 3RPNA 2VCQA 2A4VA 2JACA 2CAQA 3JCML 3QCPA 1SVOA 2PUKC 3G7IA 2PVOC 4TOPA 3M9KA 4TR1A 1YVLA 4XS4A 4K8MA 2FWFA 1GLPA 5DCGA 3QR6A 1BG1A 1DE1A 3Q6OA 1MDKA 4KDUA 3QAVA 2TRXA 1ACVA 1S3CA 5HFGA 4ZB7A 3QOUA 1U3IA 3C71A 3IBHA 2K8VA 2L4CA 5CRGA 1S3RA 4MPGA 3U6VA 1A2MA 2B1LA 3FRCA 4MH2A 4F0CA 1B8XA 1V57A 3W8JA 4AJ6A 2WW2A 1DSBA 3QMXA 1SJZA 4HOJA 2BMXA 1WWJA 4FIWA 2C4JA 1YKAA 2H72A 2OACA 3ZITA 4YQMA 3ISOA 2VD1A 1KEBA 3TOTA 3FKFA 4MF6A 3MNGA 2VD0A 4IW9A 3CWGA 1BX9A 3A3TA 3VFIA 3D4TA 2QA2A 3WGEA 1SJIA 5C04A 4IS0A 3VWWA 4HU7A 4HZ2A 2FCHA 5A5KA 2VCWA 4K6XA 1AAZA 4LL4B 2C0DA 4TKYA 2HNLA 3KIJA 4PI2C 2ZUPA 5G5FA 3UIWA 4KGIA 3IRAA 4Q5RA 2WVXA 4Z7XA 3CRUA 3HHVA 3EURA 3IK7A 1BF5A 3BOAA 3FZAA 2QA1A 1F6MC 2DBCA 2HFDA 2LS5A 2MZCA 1E6BA 3MYDA 3FZ9A 1TDIA 2O36A 3C1RA 2RM6A 4MZCA 4PI0C 4MF5A 2OBKA 3BD2A 1O8XA 2OT3A 2GQMA 2I3YA 1ZGNA 2LV3A 5DAKB 1BJXA 4E8EA 1Z7PA 2VCZA 3GA4A 3ZZXA 4POKA 1F2EA 3C73A 3HYPA 2B6MA 4I5QA 1I9DA 2DJJA 1TU7A 3D5JA 2DJ2A 1FVJA 1PX6A 3F6DA 4Z2RA 2IMFA 2IPAA 2VCTA 5G1KA 3GSSA 4TR4A 2AAWA 4TRXA 4OFTA 4LL1B 3U5RE 1T3BA 1XWAA 4PNFA 2R37A 2CVDA 5J4YA 3E3EA 2E2MA 1V2AA 3D22A 1OE8A 2Z9SA 2IFQA 5B7CA 2KHPA 2NPBA 4IELA 4WETA 3IPZA 1ML6A 1T1VA 1LBKA 4IHUA 1U3AA 4GTUA 4BWSA 3IR4A 1A8LA 2JSZA 5DQYA 1H75A 4O5QA 1XOBA 3WGXA 5ECMB 5A1NB 2KP2A 2AYTA 4FXYP 2P5QA 4J56E 4WKWA 5ECOB 5IPHA 1U6TA 3D0ZA 2HSHA 4MJAA 5AIXA 2ZCTA 1TTZA 4W66A 3UARA 2BJXA 4AJ8A 2JSYA 1GL8A 1SENA 5BMUA 4RI6A 4XS6A 5ECHB 1K0AA 1EOHA 5HR3A 1Z5YE 4N11A 2WW3A 1ZZYA 1XBSA 4IP6A 2DIYA 5KN3A 3Q18A 4XS1A 4OO5A 3ME7A 1WIKA 4EXJA 5C00A 4EKZA 4FQUA 4PGTA 3ZFBA 4KCEA 1Z9HA 5EL8A 1TXUA 1PSQA 2WZ9A 4YKFA 1WE0A 4WF5A 1EWXA 1SJ6A 5KOWA 5ECRB 3F4RA 1G7EA 12GSA 4HUAA 4ML6A 3EU3A 2NVLA 4IQ1A 3BCKA 1JFUA 2GS3A 1NHYA 1MEKA 1QFNA 3GSTA 2GQLA 5DAKA 4IQAA 1Y1UA 4O5UA 3TJBA 14GSA 5L71A 4HSCX 3PGTA 5ABRA 2FHEA 4EUYA 4D73A 3L9VA 2VLVA 5A4UA 5HR1A 4TXOA 3EMXA 3FZ5A 2PPTA 4BA7A 4L8EA 4PUAA 4HQZA 4ZL9A 5GZZB 1WPIA 3TRXA 1TRUA 1M0UA 5IPGA 4RQRA 2B3SA 2HRAA 1UA5A 5AN1A 2L57A 2YP6A 2LRTA 5JCGA 4CDOA 1VGLA 5A5HB 2K18A 1JLWA 3HJOA 2NBSA 2H30A 2JZSA 4FO5A 2QC7A 4HU9A 2YCDA 4WF4A 2OKAA 4OD7A 5INYA 2PBJA 4ILFA 5ECLB 1TU8A 3TB2A 2YV7A 2HSMB 5BRTA 2B5YA 3LSZA 2GVPA 3KTLA 2HSYA 1USBA 4NHWA 4MZBA 2XPDA 3VLNA 3APQA 2V6KA 3DD3A 2V6OA 3E0UA 3I69A 1XOAA 3KH7A 4K7IA 5J9BA 1XWCA 3UBKA 5AISA 1K0NA 2RUEA 2GSTA 2AB6A 5A4VA 3LYKA 2X99A 16GSA 3ED3A 2FWGA 2ZNMA 4P3YB 2N5AA 2HYXA 2GT5A 1GTAA 5JCWA 1FW1A 4KW6A 2YWOA 5J41A 3GN3A 1Y6EA 3LEFA 2WFCA 1V98A 2H6XA 2MMOA 4NXIA 4OFMA 1CQGA 4JR4A 5B8AA 3EPTA 5KEJA 2HZEB 1HNCA 2IWTA 1EP7A 1T4ZA 2FWEA 4MPFA 4PQ1A 1GSDA 1TW9A 3I9V2 3OR5A 1VF3A 1VF1A 4PX1A 4DEJA 4GXZA 1YF1A 4GQCA 1EP8A 3TKPA 5E59A 3EINA 2B7KA 1XXUA 4XIHA 2FWHA 3TJFA 4L5OA 3P7XA 3TRPA 1G6YA 2WRTA 2VAFA 1PD21 4JBBA 1XCCA 3TJJA 1M2DA 5IMFA 4KCAA 2PU9C 4KUNA 2KLXA 1FHEA 2HRNA 2WW0A 1XFLA 5AGYA 3PR8A 2R5GA 4HI7A 2DMLA 17GSA 3A2VA 4K5SA 4F0BA 10GSA 2IMDA 4TVEA 1ERUA 2H75A 3HVVA 4G0IA 3PPUA 5LNKe 4GWRA 1C72A 3F8UA 5A34A 4J2FA 4OCEA 5H5SA 2L5OA 1BYEA 4MJEA 3ZREA 3DKSA 9GSSA 1BAYA 4KNDA 1OVNA 4G2EA 4H86A 1S4BP 1OAZA 3D6IA 5COHA 1B4QA 1YKCA 4I2UA 20GSA 1OC9A 3MIXA 3F6FA 5J3RA 3HCZA 1M99A 6GSUA 4N3ZA 2C3QA 4NV2A 2PN8A 5ID2A 5J47A 4G9HA 5ECSA 1SL1B 2VL3A 4KAEA 3I6AA 3RHCA 4YAVA 2H6ZA 4DSSB 4MJCA 2VIMA 1IYHA 1YEWC 5E4WA 4IBPA 2VCXA 2I81A 2AHEA 1EV9A 2N5BA 1TKDB 8GSSA 2ON5A 2CQ9A 2DLXA 4AJ7A 1MTCA 2KUCA 3EVIA 1EOGA 1SK0A 2AV4A 2VLUA 2WGRA 1IYIA 5DJMA 3P2AA 2V41A 1R4WA 3A5IA 2G0FA 1YY7A 4BVXA 4ECBA 2R6KA 3H93A 3LORA 4NV5A 2VM1A 3HJMA 3GUSA 3HA9A 5GSTA 4OCFA 5GAND 5J5NA 3FR6A 3CXGA 4X43A 4EO3A 2H8LA 1V9WA 2YWIA 1MD3A 3HJPA 5F8BA 2HQTA 3A2XA 1M3IA 1ZYEA 1X9WB 4WBRD 4EIQA 2EIOA 3RPPA 1SYRA 1GUKA 2H1BA 4O7HA 2O3EA 3FR3A 2HZFA 4E68A 3P90A 1QQ2A 1EEJA 2DJ0A 4X1UA 4Q5FA 2E7PA 3CTFA 4BL7B 3I43A 2ON7A 4MDCA 2CX4A 4OWYA 4EE0A 3LJRA 2HXKA 4RUVA 1EEMA 3L4NA 5B8BA 4EVMA 5CRHA 2QKEA 1QMVA 5J4VA 2UV8G 2GZPA 2H0HA 3ZRDA 1PMTA 5HR0A 2LSTA 2L5LA 1SK1A 1TJDA 2K6VA 3LXZA 2HRKB 3NIVA 4IJ3A 4N30A 5D9XA 3DMLA 2OE3A 4MABA 3F3RA 2P0GA 2VL9A 3ME8A 3HVSA 3RBTA 1SD8A 1V58A 1YZXA 3IHQA 1GLQA 1ST9A 1AC1A 1FB6A 2WB9A 3WT2A 2H1DA 1N2AA 4ZBAA 4L0UA 1A2JA 2A2PA 5ECNB 2KOKA 3KZQA 4MNNA 1OKDA 1B4PA 2LKUA 3CHXC 4I8BA 4ZXGA 2H74A 1KBNA 3IK9A 3L78A 3IE3A 4OMVA 3FHKA 1R26A 2IL3A 4ULXA 3LWAA 4XRAA 4V1Ag
chains in the Genus database with same CATH topology
2MYGA 4K9ZA 3MWHA 1PL1A 3GURA 3LXTA 4WBJA 2VCVA 5CO3A 3H79A 5D73A 1WMJA 4GF0A 1RK4A 1GNWA 3ZL5A 1JZOA 1UC7A 1PKWA 5IIZA 4TR3A 1T7PB 1TI3A 3ERWA 1M7TA 3WD6A 4KDYA 2O8VB 4KX4A 1NSWA 3GHAA 3VWUA 1ILOA 5KN0A 2PGTA 1A24A 1AIUA 3ZMKA 4N0VA 4NAXA 4MCUA 1X5DA 1H4OA 5EY6A 4NWYA 2HSNB 1MDIA 3ZFLA 4PUFC 2PERA 2GGTA 3TDGA 6GSWA 4KB3A 5G31A 2GSQA 4JU5A 5B6MA 1N8JA 2LJAA 4G10A 2F8FA 2WULA 1O6JA 2H66A 4GSTA 2X49A 3ZTLA 1F9MA 5DQSA 1M2AA 2H0IA 3DVWA 5IOWA 4NHZA 1OC3A 4IN0A 3GV1A 2L59A 5IO2A 5IOXA 3MSZA 2DKHA 3IA1A 1G7OA 4MZWA 3GYKA 4MP4A 1X5CA 2R0CA 6GSTA 4MMMA 5ECKB 2OE0A 2ES7A 2FA4A 4G01A 2OJLA 5HFKA 1ZYNA 5J40A 2LNSA 1MD4A 3F3QA 4FYUA 3N9JA 4PURA 4JR6A 1K3LA 2HT9A 2O89A 1BEDA 4WR4A 2LJKA 1YEPA 2HE3A 2A4HA 5CNWA 4AKGA 5A4WA 5HQPA 4K5RA 3FW2A 4GSSA 3M8NA 2RLIA 5KN2A 3QPMA 1X9MB 1WP0A 2VL2C 4Z2TA 4TR0A 2C80A 2LEGA 3VI5A 2J9HA 4ECJA 3UVTA 5IMZA 1A23A 2YWMA 1SKSB 4K0GA 1A0FA 2I1UA 4HZ4A 3UEMA 1M2BA 3BJ5A 1DBYA 2C3TA 2YN1A 3ERGA 1GSFA 2VO4A 4V2MA 2H73A 3GKKA 3PH9A 4X0XA 3US3A 3KXOA 4G0KA 4LA1A 2L6DA 3G7YA 2UZ8A 5JWRB 3FMWA 2H71A 4AKHA 4CY6A 3KMOA 2YPMA 3CRTA 2DC5A 1PGTA 4PTSA 3W6GA 3G7JA 3TU3B 4KA0A 1Z7RA 1RW1A 1EGRA 4HS1A 5DBQA 2K8SA 2H0GA 5A1NA 2FGXA 2H1AA 3HY2A 1T00A 1F3AA 3CSJA 1F37A 1OYJA 4V1Ap 2HRFA 1OE7A 3SWLA 2VOCA 4BWQA 4EDYA 5DVBA 5ECPB 1Z6NA 4WXTA 2TIRA 2XHFA 4ISDA 3IAS2 5ECQB 2PWJA 3O76A 3M1GA 5IMCA 2LQOA 4OO4A 2CT6A 2D2ZA 1GRXA 1XW5A 5DALB 4YQUA 2IJYA 2EFCA 3LYPA 2YWNA 5IM9A 1FVKA 4AI6A 2CX3A 4DSQA 3ERFA 4USSA 3H4KA 1ERVA 3GRXA 4QL9A 1YEXA 2M72A 3TRQA 2DSAA 1TK5B 6GSSA 2H70A 2VL2A 1KTEA 1YJ6A 2L4QA 4EC0A 5F06A 1HD2A 1XPVA 5D9VA 2R2JA 4A5PA 1GP1A 3LGCA 2FUG2 4ML1A 1AQXA 4KDXA 2A2RA 1U87A 1Q4JA 3Q19A 3BBYA 4LLRA 3IC8A 3GH9A 1WJKA 1GH2A 3HXSA 1JZWA 5KOXA 1QUWA 1O7UA 4GRFA 2L6CA 1YF0A 1EV4A 3RDWA 4JZQA 2LRCA 1DE2A 4HJ2A 1QGVA 5DDLA 2I9HA 3LFLA 4NPBA 2WCIA 4DSRA 4Q5QA 5F05A 4ZL8A 4MJBA 4AKIA 3HVXA 1PX7A 3A2WA 4O5RA 1XW9A 4ZB6A 4POMA 4BVYB 2RIIA 2CAIA 3C7MA 2MMAA 5A5HA 1ZCPA 2C0GA 1F3BA 5IMDA 5JWOB 2BTOT 2GQKA 1W4VA 4N10A 5F07A 3TKSC 1A8YA 4AGSA 2F9SA 2DJ1A 2FLSA 4K1FA 2VLTA 3QAWA 2HSMA 1THOA 1GSYA 3UMAA 4XCSA 3SBCA 1BG5A 3NOFA 4F82A 3L9UA 4LMVA 3GX8A 2C0FA 3IC4A 4MK3A 2B5EA 4IVFA 2VUPA 4RI7A 1JZRA 4MA9A 2E0QA 1AW9A 1OKTA 4G0LA 4ZILA 2DIZA 2IIYA 2JZTA 1M9AA 4GLTA 1G6WA 4LMWA 1XVWA 1XVQA 1O8WA 2C1YA 2H76A 4AKXB 2GSSA 2CZ2A 2RM5A 3VURA 1A0RP 1LJRA 2OA7A 3WYWA 4FH8A 3CMIA 4Q5NA 1K0CA 1PRXA 5CAXA 1ZYPA 3GH6A 3HZ8A 2CA8A 2NDOA 3HDCA 2OADA 3L9SA 4GSNA 6GSVA 1GULA 2HZEA 3EU4A 4K7NA 5B6NA 3RHBA 1ERWA 2NTOA 3KGKA 5DJLA 4YQVA 2LNTA 1K3OA 3WT1A 4V2NA 1KNGA 3M3MA 3D21A 2YOIA 3WGDA 1V40A 1S3DA 3GFKA 3NZNA 4ICYA 2DJKA 5D96A 1TOFA 1UN2A 2MMNA 2IFQB 1XWKA 2IMEA 4HEA2 4BPYA 2H19A 2GZZA 1XW6A 2O87A 2WS2A 2CVKA 2O7KA 5H5QA 2RUFA 2MMZA 1SD9A 3TKSA 1SVLA 3HKRA 2I4AA 3DVXA 2M80A 2H1LA 4L5LA 5DCHA 1GTUA 1SU9A 3ZLPA 22GSA 4JE1A 2AUVA 2A2SA 1T4YA 3DEXA 1I5GA 2V32A 4I2TA 2LTKA 1S3AA 3HMJG 4BVYA 4POBA 3A5WA 1K0BA 2GZYA 2IN3A 1GTBA 3HD5A 3VPQA 1GWCA 3O6TA 1GTIA 2C0EA 4TXVA 3CYNA 1FG4A 4KSMA 5BMUB 2XBIA 4PQIA 5J4UA 2CZ3A 2YANA 1K0OA 3F4SA 2GDRA 3F9UA 5FWGA 2KP1A 3GL5A 2JU5A 2F8AA 3ZIJA 1SVMA 1X5EA 3GL3A 1JZDA 4F9ZA 1JHBA 4KF9A 3F63A 4K2XA 1M9BA 5FT3A 3EYTA 1X0RA 3J7Yk 4WR5A 3TOUA 4DSSA 1GUMA 1AUCA 3RAZA 4L0WA 1E2YA 3GMFA 3ZVJA 3QD9A 7GSSA 1BQ7A 2JADA 4EL1A 1PA3A 5CREA 2YV9A 3BCIA 5GSSA 2O5VA 1QXHA 1FO5A 3KP8A 4RQXA 2HI7A 5LCZA 1TRSA 4D73B 2R4VA 4TXOB 1SL2B 4XHMA 5CRDA 2N5FA 3D4MA 2EIQA 1ERTA 2GLRA 3GKMA 3IHGA 3TKRA 3DGQA 4I6XA 1HNAA 2EIRA 5H5RA 3V1WA 4N0ZA 3MAKA 3TJGA 1ZOFA 2GSRA 3UAPA 1YQ1A 4F2IA 2E2GA 4XTSA 5ECIB 2EFDA 3ZIVA 4ECCA 3KJYA 3C1SA 1EGOA 1AQVA 2GTUA 3CSIA 4ZIJA 3KCMA 3TKQA 2VM2A 2J23A 5GAPD 5CYYA 5D93A 3GKXA 1VF2A 3L0HA 4YAPA 2MBTA 5IMVA 1SL0B 4WEYA 2LJRA 2H1GA 2X8HA 3ZVJD 1EZKA 2IMKA 3TUEA 4F03A 4PNGA 3R2QA 1OC8A 3CSHA 2DJ3A 1PN9A 4BL7A 2PMTA 2JL4A 1ZL9A 3UOMA 3M0FA 1VF4A 3UBLA 3TCOA 1WRYA 5FHIA 2B7JA 3ZYWA 3QFBC 4O92A 3DXBA 1RQMA 2C8UA 2EFEA 4JEDA 5G30A 1XWBA 2IMIA 1HQOA 2H01A 2CVBA 4K7OA 2X64A 2B5XA 2V1MA 1PN0A 2HRKA 1K0DA 1A2LA 3ZMLA 4IP1A 3TGZA 3PINA 2DKIA 4QMKA 3F4TA 2YZHA 2R0GA 3FY7A 4ZB8A 1Q98A 1SKWB 1K3YA 5G1LA 1NW2A 4CY8A 6GSXA 5IQYA 4GQFA 1W89A 3FK8A 1AQWA 1O81A 2G2QA 2HLSA 4GDFA 5AIVA 3W8SA 1YDKA 4X4JA 2B1KA 2XC2A 1VRSD 3EE2A 3DIEA 3APOA 4J57E 4QQ7A 4YKGA 4KH7A 3TKSE 3KEBA 2YJHA 1UVZA 1ON4A 3N5OA 4YH2A 1GSUA 4JRRA 1NM3A 2EFHA 1FOHA 1GNEA 5ELGA 3M9JA 2R0PA 1FOVA 3EC3A 1SKRB 1R5AA 4KE3A 1B9YC 1Y25A 5LD0A 1Z6MA 3IV4A 3GTUB 2K9FA 5CP1A 3VWXA 4V2LA 3VPTA 1R7HA 3F0IA 1TK8B 3GKNA 5HFIA 2R3XA 1SYXA 5J9CA 2FNOA 3DYRA 3MDKA 5JWQB 1GSQA 4NMUA 1NHOA 5ENUA 2REMA 4KSOA 1MDJA 3QFAC 2X4AA 2HSNA 5A34B 2X8CA 2DMMA 4HJMA 3C8EA 3KD0A 4IJIA 4CHSA 2JZRA 1ZMAA 4EDZA 3APSA 1TK0B 4E8HA 3FZ4A 4XRDA 1X9SB 4I97A 4FYBA 5D9TA 2F51A 2QSIA 3TJKA 2V2GA 4POLA 3QDNA 3H1NA 4GCIA 2P31A 5KN1A 3CBUA 1OC9B 3GX0A 4ECIA 3CTGA 5ID2B 1XIYA 2OE1A 4MH3A 3LG6A 3FEUA 5ELAA 2OBIA 5EVOA 2YZUA 3GIXA 1GSEA 4HDEA 4TN8A 1LU4A 2YNXA 3KP9A 1WOUA 1FAAA 5JCUA 1TRWA 1TRVA 4TR1B 4XS4B 3IXRA 2H6YA 4OFNA 2MBSA 4ZBDA 3DWVA 2X8GA 1U88A 2QGVA 4Z2UA 1CQHA 1HNBA 4IKHA 1ABAA 4BVXB 4ZB9A 3EWLA 1ZYQB 2AJQB 3FR9A 6GSYA 3E9JB 3S9FA 2O85A 5G5EA 1THXA 1G0TA 5G2ZA 1B48A 3DRNA 19GSA 1JLVA 1FB0A 2LQQA 4EIPA 2XPEA 1URMA 3P8WA 1TP9A 4FYCA 5IMAA 2WDUA 3GNJA 2LRNA 2TRCP 1HYUA 3KMNA 2FY6A 3LQ7A 1Z3EA 4CW9A 1SK2A 2FD3A 2P5RA 4MLYA 3K8NA 4ZBBA 3R3EA 4PQHA 3GTUA 3Q74A 2CV4A 4MF7A 3QAGA 3O3TA 3H8QA 3IOSA 3KTBA 3AY8A 1O85A 3KH9A 3EMPA 1TXXA 4AF2A 4QL7A 4IGJA 3IDVA 11GSA 1GUHA 1K0MA 2PVQA 2YJ7A 2XBQA 1XWGA 4K0NA 1QK8A 3HZ4A 4TW5A 1N25A 3FYGA 5EPFA 2GT6A 4O32A 2WJUA 5F0GA 1J0FA 5CRWA 4G19A 13GSA 1R5PA 2FA8A 3VI7A 3UJ1A 5D8IA 2VKZG 1T8EB 1PKZA 5HR2A 3IAM2 4DVCA 1AXDA 4HQSA 3VWVA 1PQNA 1J9BA 2F3MA 3J7Yb 2LUSA 4EF0A 1PL2A 1XZOA 3KM6A 5D9WA 2EC4A 4ACSA 5IO0A 4ZL7A 4ID0A 1B9XC 3UL3A 1J08A 2M46A 2C3NA 5DALA 3G9BA 1O73A 1GSSA 3UVHA 1TI1A 4PXOA 4K2DA 3VK9A 1DUGA 3LW9A 18GSA 2ALBA 3RPNA 2VCQA 2A4VA 2JACA 2CAQA 3JCML 3QCPA 1SVOA 2PUKC 3G7IA 2PVOC 4TOPA 3M9KA 4TR1A 1YVLA 4XS4A 4K8MA 2FWFA 1GLPA 5DCGA 3QR6A 1BG1A 1DE1A 3Q6OA 1MDKA 4KDUA 3QAVA 2TRXA 1ACVA 1S3CA 5HFGA 4ZB7A 3QOUA 1U3IA 3C71A 3IBHA 2K8VA 2L4CA 5CRGA 4MPGA 3U6VA 1A2MA 2B1LA 3FRCA 4MH2A 4F0CA 1B8XA 1V57A 3W8JA 4AJ6A 1DSBA 3QMXA 1SJZA 4HOJA 2BMXA 1WWJA 4FIWA 2C4JA 1YKAA 2H72A 2OACA 3ZITA 4YQMA 3ISOA 2VD1A 1KEBA 3TOTA 3FKFA 4MF6A 3MNGA 2VD0A 4IW9A 3CWGA 1BX9A 3A3TA 3VFIA 3D4TA 2QA2A 3WGEA 1SJIA 5C04A 4IS0A 3VWWA 4HU7A 4HZ2A 2FCHA 5A5KA 2VCWA 4K6XA 1AAZA 4LL4B 2C0DA 4TKYA 2HNLA 3KIJA 2ZUPA 5G5FA 3UIWA 4KGIA 3IRAA 4Q5RA 4Z7XA 3CRUA 3HHVA 3EURA 3IK7A 1BF5A 3BOAA 3FZAA 2QA1A 1F6MC 2DBCA 2HFDA 2LS5A 2MZCA 3MYDA 1E6BA 3FZ9A 1TDIA 3C1RA 2RM6A 4MZCA 4MF5A 2OBKA 3BD2A 1O8XA 2OT3A 2GQMA 2I3YA 1ZGNA 2LV3A 5DAKB 1BJXA 4E8EA 1Z7PA 2VCZA 3GA4A 3ZZXA 4POKA 1F2EA 3C73A 3HYPA 2B6MA 4I5QA 1I9DA 2DJJA 1TU7A 3D5JA 2DJ2A 1FVJA 1PX6A 3F6DA 4Z2RA 2IMFA 2IPAA 2VCTA 5G1KA 3GSSA 4TR4A 2AAWA 4TRXA 4OFTA 4LL1B 3U5RE 1T3BA 1XWAA 4PNFA 2R37A 2CVDA 5J4YA 3E3EA 2E2MA 1V2AA 3D22A 1OE8A 2Z9SA 2IFQA 5B7CA 2KHPA 2NPBA 4IELA 4WETA 3IPZA 1ML6A 1T1VA 1LBKA 4IHUA 1U3AA 4GTUA 4BWSA 3IR4A 1A8LA 2JSZA 5DQYA 1H75A 4O5QA 1XOBA 3WGXA 5ECMB 5A1NB 2KP2A 2AYTA 2P5QA 4J56E 4WKWA 5ECOB 5IPHA 1U6TA 3D0ZA 2HSHA 4MJAA 5AIXA 2ZCTA 1TTZA 4W66A 3UARA 2BJXA 4AJ8A 2JSYA 1GL8A 1SENA 5BMUA 4RI6A 4XS6A 5ECHB 1K0AA 1EOHA 5HR3A 1Z5YE 4N11A 1ZZYA 1XBSA 4IP6A 2DIYA 5KN3A 3Q18A 4XS1A 4OO5A 3ME7A 1WIKA 4EXJA 5C00A 4EKZA 4FQUA 4PGTA 3ZFBA 4KCEA 1Z9HA 5EL8A 1TXUA 1PSQA 2WZ9A 4YKFA 1WE0A 4WF5A 1EWXA 1SJ6A 5KOWA 5ECRB 3F4RA 1G7EA 12GSA 4HUAA 4ML6A 3EU3A 2NVLA 4IQ1A 3BCKA 1JFUA 2GS3A 1NHYA 1MEKA 1QFNA 3GSTA 2GQLA 5DAKA 4IQAA 1Y1UA 4O5UA 3TJBA 14GSA 5L71A 3PGTA 5ABRA 2FHEA 4EUYA 4D73A 3L9VA 2VLVA 5A4UA 5HR1A 4TXOA 3EMXA 3FZ5A 2PPTA 4BA7A 4L8EA 4PUAA 4HQZA 4ZL9A 5GZZB 1WPIA 3TRXA 1TRUA 1M0UA 5IPGA 4RQRA 2B3SA 2HRAA 1UA5A 5AN1A 2L57A 2YP6A 2LRTA 5JCGA 4CDOA 1VGLA 5A5HB 2K18A 1JLWA 3HJOA 2NBSA 2H30A 2JZSA 4FO5A 2QC7A 4HU9A 2YCDA 4WF4A 2OKAA 4OD7A 5INYA 2PBJA 4ILFA 5ECLB 1TU8A 3TB2A 2YV7A 2HSMB 5BRTA 2B5YA 3LSZA 2GVPA 3KTLA 2HSYA 1USBA 4NHWA 4MZBA 2XPDA 3VLNA 3APQA 2V6KA 3DD3A 2V6OA 3E0UA 3I69A 1XOAA 3KH7A 4K7IA 5J9BA 1XWCA 3UBKA 5AISA 1K0NA 2RUEA 2GSTA 2AB6A 5A4VA 3LYKA 2X99A 16GSA 3ED3A 2FWGA 2ZNMA 4P3YB 2N5AA 2HYXA 2GT5A 1GTAA 5JCWA 1FW1A 4KW6A 2YWOA 5J41A 3GN3A 1Y6EA 3LEFA 2WFCA 1V98A 2H6XA 2MMOA 4NXIA 4OFMA 1CQGA 4JR4A 5B8AA 3EPTA 5KEJA 2HZEB 1HNCA 2IWTA 1EP7A 1T4ZA 2FWEA 4MPFA 4PQ1A 1GSDA 1TW9A 3I9V2 3OR5A 1VF3A 1VF1A 4PX1A 4DEJA 4GXZA 1YF1A 4GQCA 1EP8A 3TKPA 5E59A 3EINA 2B7KA 1XXUA 4XIHA 2FWHA 3TJFA 4L5OA 3P7XA 3TRPA 1G6YA 2WRTA 2VAFA 1PD21 4JBBA 1XCCA 3TJJA 1M2DA 5IMFA 4KCAA 2PU9C 4KUNA 2KLXA 1FHEA 2HRNA 1XFLA 5AGYA 3PR8A 2R5GA 4HI7A 2DMLA 17GSA 3A2VA 4K5SA 4F0BA 10GSA 2IMDA 4TVEA 1ERUA 2H75A 3HVVA 4G0IA 3PPUA 5LNKe 4GWRA 1C72A 3F8UA 5A34A 4J2FA 4OCEA 5H5SA 2L5OA 1BYEA 4MJEA 3ZREA 3DKSA 9GSSA 1BAYA 4KNDA 1OVNA 4G2EA 4H86A 1OAZA 3D6IA 5COHA 1B4QA 1YKCA 4I2UA 20GSA 1OC9A 3MIXA 3F6FA 5J3RA 3HCZA 1M99A 6GSUA 4N3ZA 2C3QA 4NV2A 2PN8A 5ID2A 5J47A 4G9HA 5ECSA 1SL1B 2VL3A 4KAEA 3I6AA 3RHCA 4YAVA 2H6ZA 4DSSB 4MJCA 2VIMA 1IYHA 5E4WA 4IBPA 2VCXA 2I81A 2AHEA 1EV9A 2N5BA 1TKDB 8GSSA 2ON5A 2CQ9A 2DLXA 4AJ7A 1MTCA 2KUCA 3EVIA 1EOGA 1SK0A 2AV4A 2VLUA 2WGRA 1IYIA 5DJMA 3P2AA 2V41A 1R4WA 3A5IA 2G0FA 1YY7A 4BVXA 4ECBA 2R6KA 3H93A 3LORA 4NV5A 2VM1A 3HJMA 3GUSA 3HA9A 5GSTA 4OCFA 5GAND 5J5NA 3FR6A 3CXGA 4X43A 4EO3A 2H8LA 1V9WA 2YWIA 1MD3A 3HJPA 5F8BA 2HQTA 3A2XA 1ZYEA 1X9WB 4WBRD 4EIQA 2EIOA 3RPPA 1SYRA 1GUKA 2H1BA 4O7HA 3FR3A 2HZFA 4E68A 3P90A 1QQ2A 1EEJA 2DJ0A 4X1UA 4Q5FA 2E7PA 3CTFA 4BL7B 3I43A 2ON7A 4MDCA 2CX4A 4OWYA 4EE0A 3LJRA 2HXKA 4RUVA 3L4NA 1EEMA 5B8BA 4EVMA 5CRHA 2QKEA 1QMVA 5J4VA 2UV8G 2GZPA 2H0HA 3ZRDA 1PMTA 5HR0A 2LSTA 2L5LA 1SK1A 1TJDA 2K6VA 3LXZA 2HRKB 3NIVA 4IJ3A 4N30A 5D9XA 3DMLA 2OE3A 4MABA 3F3RA 2P0GA 2VL9A 3ME8A 3HVSA 3RBTA 1SD8A 1V58A 1YZXA 3IHQA 1GLQA 1ST9A 1AC1A 1FB6A 2WB9A 3WT2A 2H1DA 1N2AA 4ZBAA 4L0UA 1A2JA 2A2PA 5ECNB 2KOKA 3KZQA 4MNNA 1OKDA 1B4PA 2LKUA 4I8BA 4ZXGA 2H74A 1KBNA 3IK9A 3L78A 3IE3A 4OMVA 3FHKA 1R26A 2IL3A 4ULXA 3LWAA 4XRAA 4V1Ag
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MYG A;  4K9Z A;  3MWH A;  1PL1 A;  3GUR A;  3LXT A;  4WBJ A;  2VCV A;  5CO3 A;  3H79 A;  5D73 A;  1WMJ A;  4GF0 A;  1RK4 A;  1GNW A;  3ZL5 A;  1JZO A;  1UC7 A;  1PKW A;  5IIZ A;  4TR3 A;  1T7P B;  1TI3 A;  3ERW A;  1M7T A;  3WD6 A;  4KDY A;  2O8V B;  4KX4 A;  1NSW A;  3GHA A;  3VWU A;  1ILO A;  5KN0 A;  2PGT A;  1A24 A;  1AIU A;  3ZMK A;  4N0V A;  4NAX A;  4MCU A;  1X5D A;  1H4O A;  5EY6 A;  4NWY A;  2HSN B;  1MDI A;  3ZFL A;  4PUF C;  2PER A;  2GGT A;  3TDG A;  6GSW A;  4KB3 A;  5G31 A;  2GSQ A;  4JU5 A;  5B6M A;  1N8J A;  2LJA A;  4G10 A;  2F8F A;  2WUL A;  1O6J A;  2H66 A;  4GST A;  3ZTL A;  1F9M A;  5DQS A;  1M2A A;  2H0I A;  3DVW A;  5IOW A;  4NHZ A;  1OC3 A;  4IN0 A;  3GV1 A;  2L59 A;  5IO2 A;  5IOX A;  3MSZ A;  3IA1 A;  1G7O A;  4MZW A;  3GYK A;  4MP4 A;  1X5C A;  6GST A;  4MMM A;  5ECK B;  2OE0 A;  2ES7 A;  2FA4 A;  2OJL A;  5HFK A;  2LNS A;  1MD4 A;  3F3Q A;  4FYU A;  3N9J A;  4PUR A;  4JR6 A;  1K3L A;  2HT9 A;  2O89 A;  1BED A;  4WR4 A;  2LJK A;  1YEP A;  2HE3 A;  5CNW A;  5A4W A;  5HQP A;  3FW2 A;  4GSS A;  3M8N A;  2RLI A;  5KN2 A;  3QPM A;  1X9M B;  1WP0 A;  2VL2 C;  4TR0 A;  2C80 A;  2LEG A;  3VI5 A;  2J9H A;  4ECJ A;  3UVT A;  5IMZ A;  1A23 A;  2YWM A;  1SKS B;  4K0G A;  1A0F A;  2I1U A;  4HZ4 A;  3UEM A;  1M2B A;  3BJ5 A;  1DBY A;  2C3T A;  2YN1 A;  3ERG A;  1GSF A;  2VO4 A;  4V2M A;  2H73 A;  3GKK A;  3PH9 A;  4X0X A;  3US3 A;  3KXO A;  4G0K A;  4LA1 A;  2L6D A;  3G7Y A;  2UZ8 A;  5JWR B;  2H71 A;  3KMO A;  2YPM A;  3CRT A;  2DC5 A;  1PGT A;  4PTS A;  3W6G A;  3G7J A;  4KA0 A;  1Z7R A;  1RW1 A;  1EGR A;  4HS1 A;  5DBQ A;  2K8S A;  2H0G A;  2FGX A;  2H1A A;  3HY2 A;  1T00 A;  1F3A A;  3CSJ A;  1F37 A;  1OYJ A;  4V1A p;  2HRF A;  1OE7 A;  3SWL A;  2VOC A;  4BWQ A;  4EDY A;  5DVB A;  5ECP B;  1Z6N A;  4WXT A;  2TIR A;  2XHF A;  4ISD A;  3IAS 2;  5ECQ B;  2PWJ A;  3O76 A;  3M1G A;  5IMC A;  2LQO A;  4OO4 A;  2CT6 A;  2D2Z A;  1GRX A;  1XW5 A;  5DAL B;  4YQU A;  2IJY A;  3LYP A;  2YWN A;  5IM9 A;  1FVK A;  2CX3 A;  4DSQ A;  3ERF A;  4USS A;  3H4K A;  1ERV A;  3GRX A;  4QL9 A;  1YEX A;  2M72 A;  3TRQ A;  2DSA A;  1TK5 B;  6GSS A;  2H70 A;  2VL2 A;  1KTE A;  1YJ6 A;  2L4Q A;  4EC0 A;  5F06 A;  1HD2 A;  1XPV A;  5D9V A;  2R2J A;  1GP1 A;  3LGC A;  2FUG 2;  4ML1 A;  1AQX A;  4KDX A;  2A2R A;  1U87 A;  1Q4J A;  3Q19 A;  3BBY A;  4LLR A;  3IC8 A;  3GH9 A;  1WJK A;  1GH2 A;  3HXS A;  1JZW A;  1QUW A;  1O7U A;  4GRF A;  2L6C A;  1YF0 A;  1EV4 A;  3RDW A;  4JZQ A;  2LRC A;  1DE2 A;  4HJ2 A;  1QGV A;  5DDL A;  2I9H A;  3LFL A;  4NPB A;  2WCI A;  4DSR A;  4Q5Q A;  5F05 A;  4ZL8 A;  4MJB A;  3HVX A;  1PX7 A;  3A2W A;  4O5R A;  1XW9 A;  4ZB6 A;  4POM A;  4BVY B;  2RII A;  2CAI A;  3C7M A;  2MMA A;  1ZCP A;  2C0G A;  1F3B A;  5IMD A;  5JWO B;  2BTO T;  2GQK A;  1W4V A;  4N10 A;  5F07 A;  3TKS C;  1A8Y A;  4AGS A;  2F9S A;  2DJ1 A;  2FLS A;  4K1F A;  2VLT A;  3QAW A;  2HSM A;  1THO A;  1GSY A;  3UMA A;  4XCS A;  3SBC A;  1BG5 A;  3NOF A;  4F82 A;  3L9U A;  4LMV A;  3GX8 A;  2C0F A;  3IC4 A;  4MK3 A;  2B5E A;  4IVF A;  2VUP A;  4RI7 A;  1JZR A;  4MA9 A;  2E0Q A;  1AW9 A;  1OKT A;  4G0L A;  4ZIL A;  2DIZ A;  2IIY A;  2JZT A;  1M9A A;  4GLT A;  1G6W A;  4LMW A;  1XVW A;  1XVQ A;  1O8W A;  2C1Y A;  2H76 A;  2GSS A;  2CZ2 A;  2RM5 A;  3VUR A;  1A0R P;  1LJR A;  2OA7 A;  3WYW A;  4FH8 A;  3CMI A;  4Q5N A;  1K0C A;  1PRX A;  5CAX A;  3GH6 A;  3HZ8 A;  2CA8 A;  2NDO A;  3HDC A;  2OAD A;  3L9S A;  4GSN A;  6GSV A;  1GUL A;  2HZE A;  3EU4 A;  4K7N A;  5B6N A;  3RHB A;  1ERW A;  2NTO A;  3KGK A;  5DJL A;  4YQV A;  2LNT A;  1K3O A;  3WT1 A;  4V2N A;  1KNG A;  3M3M A;  3D21 A;  2YOI A;  3WGD A;  1V40 A;  1S3D A;  3GFK A;  3NZN A;  2DJK A;  5D96 A;  1TOF A;  1UN2 A;  2MMN A;  2IFQ B;  1XWK A;  2IME A;  4HEA 2;  4BPY A;  2H19 A;  2GZZ A;  1XW6 A;  2O87 A;  2WS2 A;  2CVK A;  2O7K A;  5H5Q A;  2RUF A;  2MMZ A;  1SD9 A;  3TKS A;  3HKR A;  2I4A A;  3DVX A;  2M80 A;  4L5L A;  5DCH A;  1GTU A;  1SU9 A;  3ZLP A;  22GS A;  4JE1 A;  2AUV A;  2A2S A;  1T4Y A;  3DEX A;  1I5G A;  2V32 A;  4I2T A;  2LTK A;  1S3A A;  4BVY A;  4POB A;  3A5W A;  1K0B A;  2GZY A;  2IN3 A;  1GTB A;  3HD5 A;  3VPQ A;  1GWC A;  3O6T A;  1GTI A;  2C0E A;  4TXV A;  3CYN A;  1FG4 A;  4KSM A;  2XBI A;  4PQI A;  5J4U A;  2CZ3 A;  2YAN A;  1K0O A;  3F4S A;  2GDR A;  3F9U A;  5FWG A;  2KP1 A;  3GL5 A;  2JU5 A;  2F8A A;  3ZIJ A;  1X5E A;  3GL3 A;  1JZD A;  4F9Z A;  1JHB A;  4KF9 A;  3F63 A;  1M9B A;  5FT3 A;  3EYT A;  1X0R A;  3J7Y k;  4WR5 A;  3TOU A;  4DSS A;  1GUM A;  1AUC A;  3RAZ A;  4L0W A;  1E2Y A;  3GMF A;  3ZVJ A;  3QD9 A;  7GSS A;  1BQ7 A;  2JAD A;  4EL1 A;  1PA3 A;  5CRE A;  2YV9 A;  3BCI A;  5GSS A;  1QXH A;  1FO5 A;  3KP8 A;  4RQX A;  2HI7 A;  5LCZ A;  1TRS A;  4D73 B;  2R4V A;  4TXO B;  1SL2 B;  4XHM A;  5CRD A;  2N5F A;  3D4M A;  2EIQ A;  1ERT A;  2GLR A;  3GKM A;  3TKR A;  3DGQ A;  4I6X A;  1HNA A;  2EIR A;  5H5R A;  3V1W A;  4N0Z A;  3MAK A;  3TJG A;  1ZOF A;  2GSR A;  3UAP A;  1YQ1 A;  4F2I A;  2E2G A;  4XTS A;  5ECI B;  3ZIV A;  4ECC A;  3KJY A;  3C1S A;  1EGO A;  1AQV A;  2GTU A;  3CSI A;  4ZIJ A;  3KCM A;  3TKQ A;  2VM2 A;  2J23 A;  5GAP D;  5CYY A;  5D93 A;  3GKX A;  1VF2 A;  3L0H A;  4YAP A;  2MBT A;  5IMV A;  1SL0 B;  4WEY A;  2LJR A;  2H1G A;  2X8H A;  3ZVJ D;  1EZK A;  2IMK A;  3TUE A;  4F03 A;  4PNG A;  3R2Q A;  1OC8 A;  3CSH A;  2DJ3 A;  1PN9 A;  4BL7 A;  2PMT A;  2JL4 A;  1ZL9 A;  3UOM A;  3M0F A;  1VF4 A;  3UBL A;  3TCO A;  1WRY A;  5FHI A;  2B7J A;  3ZYW A;  3QFB C;  4O92 A;  3DXB A;  1RQM A;  2C8U A;  4JED A;  5G30 A;  1XWB A;  2IMI A;  1HQO A;  2H01 A;  2CVB A;  4K7O A;  2X64 A;  2B5X A;  2V1M A;  2HRK A;  1K0D A;  1A2L A;  3ZML A;  4IP1 A;  3TGZ A;  3PIN A;  3F4T A;  2YZH A;  3FY7 A;  4ZB8 A;  1Q98 A;  1SKW B;  1K3Y A;  5G1L A;  1NW2 A;  6GSX A;  5IQY A;  4GQF A;  1W89 A;  3FK8 A;  1AQW A;  1O81 A;  2G2Q A;  2HLS A;  5AIV A;  3W8S A;  1YDK A;  2B1K A;  2XC2 A;  1VRS D;  3EE2 A;  3DIE A;  3APO A;  4J57 E;  4QQ7 A;  4KH7 A;  3TKS E;  3KEB A;  2YJH A;  1UVZ A;  1ON4 A;  3N5O A;  4YH2 A;  1GSU A;  4JRR A;  1NM3 A;  1GNE A;  5ELG A;  3M9J A;  1FOV A;  3EC3 A;  1SKR B;  1R5A A;  4KE3 A;  1B9Y C;  1Y25 A;  5LD0 A;  1Z6M A;  3IV4 A;  3GTU B;  2K9F A;  5CP1 A;  3VWX A;  4V2L A;  3VPT A;  1R7H A;  3F0I A;  1TK8 B;  3GKN A;  5HFI A;  2R3X A;  1SYX A;  5J9C A;  2FNO A;  3DYR A;  3MDK A;  5JWQ B;  1GSQ A;  4NMU A;  1NHO A;  5ENU A;  2REM A;  4KSO A;  1MDJ A;  3QFA C;  2X8C A;  2DMM A;  4HJM A;  3C8E A;  3KD0 A;  4IJI A;  4CHS A;  2JZR A;  1ZMA A;  4EDZ A;  3APS A;  1TK0 B;  4E8H A;  3FZ4 A;  4XRD A;  1X9S B;  4I97 A;  4FYB A;  5D9T A;  2F51 A;  2QSI A;  3TJK A;  2V2G A;  4POL A;  3QDN A;  3H1N A;  4GCI A;  2P31 A;  5KN1 A;  3CBU A;  1OC9 B;  3GX0 A;  4ECI A;  3CTG A;  5ID2 B;  1XIY A;  2OE1 A;  4MH3 A;  3LG6 A;  3FEU A;  5ELA A;  2OBI A;  5EVO A;  2YZU A;  3GIX A;  1GSE A;  4HDE A;  4TN8 A;  1LU4 A;  2YNX A;  3KP9 A;  1WOU A;  1FAA A;  5JCU A;  1TRW A;  1TRV A;  4TR1 B;  4XS4 B;  3IXR A;  2H6Y A;  4OFN A;  2MBS A;  4ZBD A;  3DWV A;  2X8G A;  1U88 A;  2QGV A;  1CQH A;  1HNB A;  4IKH A;  1ABA A;  4BVX B;  4ZB9 A;  3EWL A;  1ZYQ B;  2AJQ B;  3FR9 A;  6GSY A;  3E9J B;  3S9F A;  2O85 A;  5G5E A;  1THX A;  1G0T A;  5G2Z A;  1B48 A;  3DRN A;  19GS A;  1JLV A;  1FB0 A;  2LQQ A;  2XPE A;  1URM A;  3P8W A;  1TP9 A;  4FYC A;  5IMA A;  2WDU A;  3GNJ A;  2LRN A;  2TRC P;  1HYU A;  3KMN A;  2FY6 A;  3LQ7 A;  1Z3E A;  4CW9 A;  1SK2 A;  2FD3 A;  2P5R A;  4MLY A;  3K8N A;  4ZBB A;  3R3E A;  4PQH A;  3GTU A;  3Q74 A;  2CV4 A;  4MF7 A;  3QAG A;  3O3T A;  3H8Q A;  3IOS A;  3KTB A;  3AY8 A;  1O85 A;  3KH9 A;  3EMP A;  1TXX A;  4AF2 A;  4QL7 A;  4IGJ A;  3IDV A;  11GS A;  1GUH A;  1K0M A;  2PVQ A;  2YJ7 A;  2XBQ A;  1XWG A;  4K0N A;  1QK8 A;  3HZ4 A;  4TW5 A;  3FYG A;  5EPF A;  2GT6 A;  4O32 A;  2WJU A;  5F0G A;  1J0F A;  5CRW A;  4G19 A;  13GS A;  1R5P A;  2FA8 A;  3VI7 A;  3UJ1 A;  5D8I A;  1T8E B;  1PKZ A;  5HR2 A;  3IAM 2;  4DVC A;  1AXD A;  4HQS A;  3VWV A;  1PQN A;  1J9B A;  2F3M A;  3J7Y b;  2LUS A;  4EF0 A;  1PL2 A;  1XZO A;  3KM6 A;  5D9W A;  2EC4 A;  4ACS A;  5IO0 A;  4ZL7 A;  4ID0 A;  1B9X C;  3UL3 A;  1J08 A;  2M46 A;  2C3N A;  5DAL A;  3G9B A;  1O73 A;  1GSS A;  3UVH A;  1TI1 A;  4PXO A;  4K2D A;  3VK9 A;  1DUG A;  18GS A;  2ALB A;  3RPN A;  2VCQ A;  2A4V A;  2JAC A;  2CAQ A;  3JCM L;  3QCP A;  2PUK C;  3G7I A;  2PVO C;  4TOP A;  3M9K A;  4TR1 A;  4XS4 A;  4K8M A;  2FWF A;  1GLP A;  5DCG A;  3QR6 A;  1DE1 A;  3Q6O A;  1MDK A;  4KDU A;  3QAV A;  2TRX A;  1ACV A;  1S3C A;  5HFG A;  3QOU A;  1U3I A;  3C71 A;  3IBH A;  2K8V A;  2L4C A;  5CRG A;  4MPG A;  3U6V A;  1A2M A;  2B1L A;  3FRC A;  4MH2 A;  4F0C A;  1B8X A;  1V57 A;  3W8J A;  4AJ6 A;  1DSB A;  3QMX A;  1SJZ A;  4HOJ A;  2BMX A;  1WWJ A;  4FIW A;  2C4J A;  1YKA A;  2H72 A;  2OAC A;  3ZIT A;  4YQM A;  3ISO A;  2VD1 A;  1KEB A;  3TOT A;  3FKF A;  4MF6 A;  3MNG A;  2VD0 A;  4IW9 A;  1BX9 A;  3A3T A;  3VFI A;  3D4T A;  3WGE A;  1SJI A;  5C04 A;  4IS0 A;  3VWW A;  4HU7 A;  4HZ2 A;  2FCH A;  5A5K A;  2VCW A;  4K6X A;  1AAZ A;  4LL4 B;  2C0D A;  4TKY A;  2HNL A;  3KIJ A;  2ZUP A;  5G5F A;  3UIW A;  4KGI A;  3IRA A;  4Q5R A;  4Z7X A;  3CRU A;  3HHV A;  3EUR A;  3IK7 A;  3BOA A;  3FZA A;  1F6M C;  2DBC A;  2HFD A;  2LS5 A;  2MZC A;  1E6B A;  3FZ9 A;  1TDI A;  3C1R A;  2RM6 A;  4MZC A;  4MF5 A;  2OBK A;  3BD2 A;  1O8X A;  2GQM A;  2I3Y A;  1ZGN A;  2LV3 A;  5DAK B;  1BJX A;  4E8E A;  1Z7P A;  2VCZ A;  3GA4 A;  3ZZX A;  4POK A;  1F2E A;  3C73 A;  3HYP A;  2B6M A;  4I5Q A;  1I9D A;  2DJJ A;  1TU7 A;  3D5J A;  2DJ2 A;  1FVJ A;  1PX6 A;  3F6D A;  2IMF A;  2IPA A;  2VCT A;  5G1K A;  3GSS A;  4TR4 A;  2AAW A;  4TRX A;  4OFT A;  4LL1 B;  3U5R E;  1T3B A;  1XWA A;  4PNF A;  2R37 A;  2CVD A;  3E3E A;  2E2M A;  1V2A A;  3D22 A;  1OE8 A;  2Z9S A;  2IFQ A;  5B7C A;  2KHP A;  2NPB A;  4IEL A;  4WET A;  3IPZ A;  1ML6 A;  1T1V A;  1LBK A;  4IHU A;  1U3A A;  4GTU A;  4BWS A;  3IR4 A;  1A8L A;  2JSZ A;  5DQY A;  1H75 A;  1XOB A;  3WGX A;  5ECM B;  2KP2 A;  2AYT A;  2P5Q A;  4J56 E;  4WKW A;  5ECO B;  5IPH A;  1U6T A;  3D0Z A;  2HSH A;  4MJA A;  5AIX A;  2ZCT A;  1TTZ A;  3UAR A;  2BJX A;  4AJ8 A;  2JSY A;  1GL8 A;  1SEN A;  5BMU A;  4RI6 A;  4XS6 A;  5ECH B;  1K0A A;  1EOH A;  5HR3 A;  1Z5Y E;  4N11 A;  1ZZY A;  1XBS A;  4IP6 A;  2DIY A;  5KN3 A;  3Q18 A;  4XS1 A;  4OO5 A;  3ME7 A;  1WIK A;  4EXJ A;  5C00 A;  4EKZ A;  4FQU A;  4PGT A;  3ZFB A;  4KCE A;  1Z9H A;  5EL8 A;  1PSQ A;  2WZ9 A;  1WE0 A;  4WF5 A;  1EWX A;  1SJ6 A;  1G7E A;  5ECR B;  3F4R A;  12GS A;  4HUA A;  4ML6 A;  3EU3 A;  2NVL A;  4IQ1 A;  3BCK A;  1JFU A;  2GS3 A;  1NHY A;  1MEK A;  1QFN A;  3GST A;  2GQL A;  5DAK A;  4IQA A;  3TJB A;  14GS A;  5L71 A;  3PGT A;  5ABR A;  2FHE A;  4EUY A;  4D73 A;  3L9V A;  2VLV A;  5A4U A;  5HR1 A;  4TXO A;  3EMX A;  3FZ5 A;  2PPT A;  4BA7 A;  4L8E A;  4PUA A;  4HQZ A;  4ZL9 A;  5GZZ B;  1WPI A;  3TRX A;  1TRU A;  1M0U A;  5IPG A;  4RQR A;  2B3S A;  2HRA A;  1UA5 A;  5AN1 A;  2L57 A;  2YP6 A;  2LRT A;  5JCG A;  4CDO A;  1VGL A;  2K18 A;  1JLW A;  3HJO A;  2NBS A;  2H30 A;  2JZS A;  4FO5 A;  2QC7 A;  4HU9 A;  2YCD A;  4WF4 A;  2OKA A;  4OD7 A;  5INY A;  2PBJ A;  4ILF A;  5ECL B;  1TU8 A;  3TB2 A;  2YV7 A;  2HSM B;  2B5Y A;  3LSZ A;  2GVP A;  3KTL A;  2HSY A;  1USB A;  4NHW A;  4MZB A;  2XPD A;  3VLN A;  3APQ A;  2V6K A;  3DD3 A;  2V6O A;  3E0U A;  3I69 A;  1XOA A;  3KH7 A;  4K7I A;  5J9B A;  1XWC A;  3UBK A;  5AIS A;  1K0N A;  2RUE A;  2GST A;  2AB6 A;  5A4V A;  3LYK A;  2X99 A;  16GS A;  3ED3 A;  2FWG A;  2ZNM A;  4P3Y B;  2N5A A;  2HYX A;  2GT5 A;  1GTA A;  5JCW A;  1FW1 A;  4KW6 A;  2YWO A;  5J41 A;  3GN3 A;  1Y6E A;  3LEF A;  2WFC A;  1V98 A;  2H6X A;  2MMO A;  4NXI A;  4OFM A;  1CQG A;  4JR4 A;  5B8A A;  5KEJ A;  2HZE B;  1HNC A;  2IWT A;  1EP7 A;  1T4Z A;  2FWE A;  4MPF A;  4PQ1 A;  1GSD A;  1TW9 A;  3I9V 2;  3OR5 A;  1VF3 A;  1VF1 A;  4PX1 A;  4DEJ A;  4GXZ A;  1YF1 A;  4GQC A;  1EP8 A;  3TKP A;  5E59 A;  3EIN A;  2B7K A;  1XXU A;  4XIH A;  2FWH A;  3TJF A;  4L5O A;  3P7X A;  3TRP A;  1G6Y A;  2WRT A;  2VAF A;  1PD2 1;  4JBB A;  1XCC A;  3TJJ A;  1M2D A;  5IMF A;  4KCA A;  2PU9 C;  4KUN A;  2KLX A;  1FHE A;  2HRN A;  1XFL A;  5AGY A;  3PR8 A;  2R5G A;  4HI7 A;  2DML A;  17GS A;  3A2V A;  4F0B A;  10GS A;  2IMD A;  4TVE A;  1ERU A;  2H75 A;  3HVV A;  4G0I A;  3PPU A;  5LNK e;  4GWR A;  1C72 A;  3F8U A;  4J2F A;  4OCE A;  5H5S A;  2L5O A;  1BYE A;  4MJE A;  3ZRE A;  3DKS A;  9GSS A;  1BAY A;  4KND A;  1OVN A;  4G2E A;  4H86 A;  1OAZ A;  3D6I A;  5COH A;  1B4Q A;  1YKC A;  4I2U A;  20GS A;  1OC9 A;  3F6F A;  5J3R A;  3HCZ A;  1M99 A;  6GSU A;  2C3Q A;  4NV2 A;  2PN8 A;  5ID2 A;  4G9H A;  5ECS A;  1SL1 B;  2VL3 A;  4KAE A;  3I6A A;  3RHC A;  4YAV A;  2H6Z A;  4DSS B;  4MJC A;  2VIM A;  1IYH A;  5E4W A;  4IBP A;  2VCX A;  2I81 A;  2AHE A;  1EV9 A;  2N5B A;  1TKD B;  8GSS A;  2ON5 A;  2CQ9 A;  2DLX A;  4AJ7 A;  1MTC A;  2KUC A;  3EVI A;  1EOG A;  1SK0 A;  2AV4 A;  2VLU A;  2WGR A;  1IYI A;  5DJM A;  3P2A A;  2V41 A;  1R4W A;  2G0F A;  1YY7 A;  4BVX A;  4ECB A;  2R6K A;  3H93 A;  3LOR A;  4NV5 A;  2VM1 A;  3HJM A;  3GUS A;  3HA9 A;  5GST A;  4OCF A;  5GAN D;  5J5N A;  3FR6 A;  3CXG A;  4X43 A;  4EO3 A;  2H8L A;  1V9W A;  2YWI A;  1MD3 A;  3HJP A;  5F8B A;  2HQT A;  3A2X A;  1ZYE A;  1X9W B;  4WBR D;  2EIO A;  3RPP A;  1SYR A;  1GUK A;  2H1B A;  4O7H A;  3FR3 A;  2HZF A;  3P90 A;  1QQ2 A;  1EEJ A;  2DJ0 A;  4X1U A;  4Q5F A;  2E7P A;  3CTF A;  4BL7 B;  3I43 A;  2ON7 A;  4MDC A;  2CX4 A;  4OWY A;  4EE0 A;  3LJR A;  2HXK A;  4RUV A;  3L4N A;  1EEM A;  5B8B A;  4EVM A;  5CRH A;  2QKE A;  1QMV A;  2GZP A;  2H0H A;  3ZRD A;  1PMT A;  5HR0 A;  2LST A;  2L5L A;  1SK1 A;  1TJD A;  2K6V A;  3LXZ A;  2HRK B;  3NIV A;  4IJ3 A;  4N30 A;  5D9X A;  3DML A;  2OE3 A;  4MAB A;  3F3R A;  2P0G A;  2VL9 A;  3ME8 A;  3HVS A;  3RBT A;  1SD8 A;  1V58 A;  1YZX A;  3IHQ A;  1GLQ A;  1ST9 A;  1AC1 A;  1FB6 A;  2WB9 A;  3WT2 A;  2H1D A;  1N2A A;  4ZBA A;  4L0U A;  1A2J A;  5ECN B;  2KOK A;  3KZQ A;  1OKD A;  1B4P A;  2LKU A;  4I8B A;  4ZXG A;  2H74 A;  1KBN A;  3IK9 A;  3L78 A;  3IE3 A;  4OMV A;  3FHK A;  1R26 A;  2IL3 A;  4ULX A;  3LWA A;  4XRA A;  4V1A g; 
#chains in the Genus database with same CATH topology
 2MYG A;  4K9Z A;  3MWH A;  1PL1 A;  3GUR A;  3LXT A;  4WBJ A;  2VCV A;  5CO3 A;  3H79 A;  5D73 A;  1WMJ A;  4GF0 A;  1RK4 A;  1GNW A;  3ZL5 A;  1JZO A;  1UC7 A;  1PKW A;  5IIZ A;  4TR3 A;  1T7P B;  1TI3 A;  3ERW A;  1M7T A;  3WD6 A;  4KDY A;  2O8V B;  4KX4 A;  1NSW A;  3GHA A;  3VWU A;  1ILO A;  5KN0 A;  2PGT A;  1A24 A;  1AIU A;  3ZMK A;  4N0V A;  4NAX A;  4MCU A;  1X5D A;  1H4O A;  5EY6 A;  4NWY A;  2HSN B;  1MDI A;  3ZFL A;  4PUF C;  2PER A;  2GGT A;  3TDG A;  6GSW A;  4KB3 A;  5G31 A;  2GSQ A;  4JU5 A;  5B6M A;  1N8J A;  2LJA A;  4G10 A;  2F8F A;  2WUL A;  1O6J A;  2H66 A;  4GST A;  2X49 A;  3ZTL A;  1F9M A;  5DQS A;  1M2A A;  2H0I A;  3DVW A;  5IOW A;  4NHZ A;  1OC3 A;  4IN0 A;  3GV1 A;  2L59 A;  5IO2 A;  5IOX A;  3MSZ A;  2DKH A;  3IA1 A;  1G7O A;  4MZW A;  3GYK A;  4MP4 A;  1X5C A;  2R0C A;  6GST A;  4MMM A;  5ECK B;  2OE0 A;  2ES7 A;  2FA4 A;  2WVZ A;  4G01 A;  2OJL A;  5HFK A;  1ZYN A;  5J40 A;  2LNS A;  1MD4 A;  3F3Q A;  4FYU A;  3N9J A;  4PUR A;  4JR6 A;  1K3L A;  2HT9 A;  2O89 A;  1BED A;  1I1I P;  4WR4 A;  2LJK A;  1YEP A;  2HE3 A;  2A4H A;  5CNW A;  4AKG A;  5A4W A;  5HQP A;  4K5R A;  3FW2 A;  4GSS A;  3M8N A;  2RLI A;  5KN2 A;  3QPM A;  1X9M B;  1WP0 A;  2VL2 C;  4Z2T A;  4TR0 A;  2C80 A;  2LEG A;  3VI5 A;  2J9H A;  4ECJ A;  3UVT A;  5IMZ A;  1A23 A;  2YWM A;  1SKS B;  4K0G A;  1A0F A;  2I1U A;  4HZ4 A;  3UEM A;  1M2B A;  3BJ5 A;  1DBY A;  2C3T A;  2YN1 A;  3ERG A;  1GSF A;  2VO4 A;  4V2M A;  2H73 A;  3GKK A;  3PH9 A;  4X0X A;  3US3 A;  3KXO A;  4G0K A;  4LA1 A;  2L6D A;  3G7Y A;  2UZ8 A;  5JWR B;  3FMW A;  2H71 A;  4AKH A;  4CY6 A;  3KMO A;  2YPM A;  3CRT A;  2DC5 A;  3RFR C;  1PGT A;  4PTS A;  3W6G A;  3G7J A;  3TU3 B;  4KA0 A;  1Z7R A;  1RW1 A;  1EGR A;  4HS1 A;  5DBQ A;  2K8S A;  2H0G A;  5A1N A;  2FGX A;  2H1A A;  3HY2 A;  1T00 A;  1F3A A;  3CSJ A;  1F37 A;  1OYJ A;  4V1A p;  2HRF A;  1OE7 A;  3SWL A;  2VOC A;  4BWQ A;  4EDY A;  5DVB A;  5ECP B;  1Z6N A;  4WXT A;  2TIR A;  2XHF A;  4ISD A;  3IAS 2;  5ECQ B;  2PWJ A;  3O76 A;  3M1G A;  5IMC A;  2LQO A;  4OO4 A;  2CT6 A;  2D2Z A;  1GRX A;  1XW5 A;  5DAL B;  4YQU A;  2IJY A;  2EFC A;  3LYP A;  2YWN A;  5IM9 A;  1FVK A;  4AI6 A;  2CX3 A;  4DSQ A;  3ERF A;  4USS A;  3H4K A;  1ERV A;  3GRX A;  4QL9 A;  1YEX A;  2M72 A;  3TRQ A;  2DSA A;  1TK5 B;  6GSS A;  2H70 A;  2VL2 A;  1KTE A;  1YJ6 A;  2L4Q A;  4EC0 A;  5F06 A;  1HD2 A;  1XPV A;  5D9V A;  2R2J A;  4A5P A;  1GP1 A;  3LGC A;  2FUG 2;  4ML1 A;  1AQX A;  4KDX A;  2A2R A;  1U87 A;  1Q4J A;  3Q19 A;  1PFO A;  3BBY A;  4LLR A;  3IC8 A;  3GH9 A;  1WJK A;  1GH2 A;  3HXS A;  1JZW A;  5KOX A;  1QUW A;  1O7U A;  4GRF A;  2L6C A;  1YF0 A;  1EV4 A;  3RDW A;  4JZQ A;  2LRC A;  1DE2 A;  4HJ2 A;  1QGV A;  5DDL A;  2I9H A;  3LFL A;  4NPB A;  2WCI A;  4DSR A;  4Q5Q A;  5F05 A;  4ZL8 A;  4MJB A;  4AKI A;  3HVX A;  1PX7 A;  3A2W A;  4O5R A;  1XW9 A;  4ZB6 A;  4POM A;  4BVY B;  2RII A;  2CAI A;  3C7M A;  2MMA A;  5A5H A;  1ZCP A;  2C0G A;  1F3B A;  5IMD A;  5JWO B;  2BTO T;  2GQK A;  1W4V A;  4N10 A;  5F07 A;  3TKS C;  1A8Y A;  4AGS A;  2F9S A;  2DJ1 A;  2FLS A;  4K1F A;  2VLT A;  3QAW A;  2HSM A;  1THO A;  1GSY A;  3UMA A;  4XCS A;  3SBC A;  1BG5 A;  3NOF A;  4F82 A;  3L9U A;  2WVX B;  4LMV A;  3GX8 A;  2C0F A;  3IC4 A;  4MK3 A;  2B5E A;  4IVF A;  2VUP A;  4RI7 A;  1JZR A;  4MA9 A;  2E0Q A;  1AW9 A;  1OKT A;  4G0L A;  4ZIL A;  2DIZ A;  2IIY A;  2JZT A;  1M9A A;  4GLT A;  1G6W A;  4LMW A;  1XVW A;  1XVQ A;  1O8W A;  2C1Y A;  2H76 A;  4AKX B;  2GSS A;  2CZ2 A;  2RM5 A;  3VUR A;  1A0R P;  1LJR A;  2OA7 A;  3WYW A;  4FH8 A;  3CMI A;  4Q5N A;  1K0C A;  1PRX A;  5CAX A;  1ZYP A;  3GH6 A;  3HZ8 A;  2CA8 A;  2NDO A;  3HDC A;  2OAD A;  3L9S A;  4GSN A;  6GSV A;  1GUL A;  2HZE A;  3EU4 A;  4K7N A;  5B6N A;  3RHB A;  1ERW A;  2NTO A;  3KGK A;  5DJL A;  4YQV A;  2LNT A;  1K3O A;  3WT1 A;  4V2N A;  1KNG A;  3M3M A;  3D21 A;  2YOI A;  3WGD A;  1V40 A;  1S3D A;  3GFK A;  4BIK A;  3NZN A;  4ICY A;  2DJK A;  5D96 A;  1TOF A;  1UN2 A;  2MMN A;  2IFQ B;  1XWK A;  2IME A;  4HEA 2;  4BPY A;  2H19 A;  2GZZ A;  1XW6 A;  2O87 A;  2WS2 A;  2CVK A;  2O7K A;  5H5Q A;  2RUF A;  2MMZ A;  1SD9 A;  3TKS A;  1SVL A;  3HKR A;  2I4A A;  3DVX A;  2M80 A;  2H1L A;  4L5L A;  3HVN A;  5DCH A;  1GTU A;  1SU9 A;  3ZLP A;  22GS A;  4JE1 A;  2AUV A;  2A2S A;  1T4Y A;  3DEX A;  1I5G A;  2V32 A;  4I2T A;  2LTK A;  1S3A A;  3HMJ G;  4BVY A;  4POB A;  3A5W A;  1K0B A;  2GZY A;  2IN3 A;  1GTB A;  3CQF A;  3HD5 A;  3VPQ A;  1GWC A;  3O6T A;  1GTI A;  2C0E A;  4TXV A;  3CYN A;  1FG4 A;  4KSM A;  5BMU B;  2XBI A;  4PQI A;  5J4U A;  2CZ3 A;  2YAN A;  1K0O A;  3F4S A;  2GDR A;  3F9U A;  5FWG A;  2KP1 A;  3GL5 A;  2JU5 A;  2F8A A;  3ZIJ A;  1SVM A;  1X5E A;  3GL3 A;  1JZD A;  4F9Z A;  1JHB A;  4KF9 A;  3F63 A;  4K2X A;  1M9B A;  5FT3 A;  3EYT A;  1X0R A;  3J7Y k;  4WR5 A;  3TOU A;  4DSS A;  1GUM A;  1AUC A;  3RAZ A;  4L0W A;  1E2Y A;  3GMF A;  3ZVJ A;  3QD9 A;  7GSS A;  1BQ7 A;  2JAD A;  4EL1 A;  1PA3 A;  5CRE A;  2YV9 A;  3BCI A;  5GSS A;  2O5V A;  1QXH A;  1FO5 A;  3KP8 A;  4RQX A;  2HI7 A;  5LCZ A;  1TRS A;  4D73 B;  2R4V A;  4TXO B;  1SL2 B;  4XHM A;  5CRD A;  2N5F A;  3D4M A;  2EIQ A;  1ERT A;  2GLR A;  3GKM A;  3IHG A;  3TKR A;  3DGQ A;  4I6X A;  1HNA A;  2EIR A;  5H5R A;  3V1W A;  4N0Z A;  3MAK A;  3TJG A;  1ZOF A;  2GSR A;  3UAP A;  1YQ1 A;  4F2I A;  2E2G A;  1XG8 A;  4XTS A;  5ECI B;  2EFD A;  3ZIV A;  4ECC A;  3KJY A;  3C1S A;  1EGO A;  1AQV A;  2GTU A;  3CSI A;  4ZIJ A;  3KCM A;  3TKQ A;  2VM2 A;  2J23 A;  5GAP D;  5CYY A;  5D93 A;  3GKX A;  1VF2 A;  3L0H A;  4YAP A;  2MBT A;  5IMV A;  1SL0 B;  4WEY A;  2LJR A;  2H1G A;  2X8H A;  3ZVJ D;  1EZK A;  1M3J A;  2IMK A;  3TUE A;  4F03 A;  4PNG A;  3R2Q A;  1OC8 A;  3CSH A;  2DJ3 A;  1PN9 A;  4BL7 A;  2PMT A;  2JL4 A;  1ZL9 A;  3UOM A;  3M0F A;  1VF4 A;  3UBL A;  3TCO A;  1WRY A;  5FHI A;  2B7J A;  3ZYW A;  3QFB C;  4O92 A;  3DXB A;  1RQM A;  2C8U A;  2EFE A;  4JED A;  5G30 A;  1XWB A;  2IMI A;  1HQO A;  2H01 A;  2CVB A;  4K7O A;  2X64 A;  3RGB C;  2V1M A;  2B5X A;  1PN0 A;  2HRK A;  1K0D A;  1A2L A;  3ZML A;  4IP1 A;  3TGZ A;  3PIN A;  2DKI A;  4QMK A;  3F4T A;  2YZH A;  2R0G A;  3FY7 A;  4ZB8 A;  1Q98 A;  1SKW B;  1K3Y A;  5G1L A;  1NW2 A;  4CY8 A;  6GSX A;  5IQY A;  4GQF A;  1W89 A;  3FK8 A;  1AQW A;  1O81 A;  2G2Q A;  2HLS A;  4GDF A;  5AIV A;  3W8S A;  1YDK A;  4X4J A;  2B1K A;  2XC2 A;  1VRS D;  3EE2 A;  3DIE A;  4PHZ C;  3APO A;  4J57 E;  2WZS A;  4QQ7 A;  4YKG A;  4KH7 A;  3TKS E;  3KEB A;  2YJH A;  1UVZ A;  1ON4 A;  3N5O A;  4YH2 A;  1GSU A;  4JRR A;  1NM3 A;  2EFH A;  1FOH A;  1GNE A;  5ELG A;  3M9J A;  2R0P A;  1FOV A;  3EC3 A;  1SKR B;  1R5A A;  4KE3 A;  1B9Y C;  1Y25 A;  5LD0 A;  1Z6M A;  3IV4 A;  3GTU B;  2K9F A;  5CP1 A;  3VWX A;  4V2L A;  3VPT A;  1R7H A;  3F0I A;  1TK8 B;  3GKN A;  5HFI A;  2R3X A;  1SYX A;  5J9C A;  2FNO A;  3DYR A;  3MDK A;  5JWQ B;  1GSQ A;  4NMU A;  1NHO A;  5ENU A;  2REM A;  4KSO A;  1MDJ A;  3QFA C;  2X4A A;  2HSN A;  5A34 B;  2X8C A;  2DMM A;  4HJM A;  3C8E A;  3KD0 A;  4IJI A;  4CHS A;  2JZR A;  1ZMA A;  4EDZ A;  3APS A;  1TK0 B;  4E8H A;  3FZ4 A;  4XRD A;  1X9S B;  4I97 A;  4FYB A;  5D9T A;  2F51 A;  2QSI A;  3TJK A;  2V2G A;  4POL A;  3QDN A;  3H1N A;  4GCI A;  2P31 A;  5KN1 A;  3CBU A;  1OC9 B;  3GX0 A;  4ECI A;  3CTG A;  5ID2 B;  1XIY A;  2OE1 A;  4MH3 A;  3LG6 A;  3FEU A;  5ELA A;  2OBI A;  5EVO A;  2YZU A;  3GIX A;  1GSE A;  4HDE A;  4TN8 A;  1LU4 A;  2YNX A;  3KP9 A;  1WOU A;  1FAA A;  5JCU A;  1TRW A;  1TRV A;  4TR1 B;  4XS4 B;  3IXR A;  2H6Y A;  4OFN A;  2MBS A;  4ZBD A;  3DWV A;  2X8G A;  1U88 A;  2QGV A;  4Z2U A;  1CQH A;  1HNB A;  4IKH A;  1ABA A;  4BVX B;  4ZB9 A;  3EWL A;  1ZYQ B;  2AJQ B;  3FR9 A;  6GSY A;  3E9J B;  3S9F A;  2O85 A;  5G5E A;  1THX A;  1G0T A;  5G2Z A;  1B48 A;  3DRN A;  19GS A;  1JLV A;  1FB0 A;  2LQQ A;  4EIP A;  2XPE A;  1URM A;  3P8W A;  1TP9 A;  4FYC A;  5IMA A;  2WDU A;  3GNJ A;  2WW1 A;  2LRN A;  2TRC P;  1HYU A;  3KMN A;  2FY6 A;  3LQ7 A;  1Z3E A;  4CW9 A;  1SK2 A;  2FD3 A;  2P5R A;  4MLY A;  3K8N A;  4ZBB A;  3R3E A;  4PQH A;  3GTU A;  3Q74 A;  2CV4 A;  4MF7 A;  3QAG A;  3O3T A;  3H8Q A;  3IOS A;  3KTB A;  3AY8 A;  1O85 A;  3KH9 A;  3EMP A;  1TXX A;  4AF2 A;  4QL7 A;  4IGJ A;  3IDV A;  11GS A;  1GUH A;  1K0M A;  2PVQ A;  2YJ7 A;  2XBQ A;  1XWG A;  4K0N A;  1QK8 A;  3HZ4 A;  4TW5 A;  1N25 A;  3FYG A;  5EPF A;  2GT6 A;  4O32 A;  2WJU A;  5F0G A;  1J0F A;  2WVY A;  5CRW A;  4G19 A;  13GS A;  1R5P A;  2FA8 A;  3VI7 A;  3UJ1 A;  5D8I A;  2VKZ G;  1T8E B;  1PKZ A;  5HR2 A;  3IAM 2;  4DVC A;  1AXD A;  4HQS A;  3VWV A;  1PQN A;  1J9B A;  2F3M A;  3J7Y b;  2LUS A;  4EF0 A;  1PL2 A;  1XZO A;  3KM6 A;  5D9W A;  2EC4 A;  4ACS A;  5IO0 A;  4ZL7 A;  4ID0 A;  1B9X C;  3UL3 A;  1J08 A;  2M46 A;  2C3N A;  5DAL A;  3G9B A;  1O73 A;  1GSS A;  3UVH A;  1TI1 A;  4PXO A;  4K2D A;  3VK9 A;  1DUG A;  3LW9 A;  18GS A;  2ALB A;  3RPN A;  2VCQ A;  2A4V A;  2JAC A;  2CAQ A;  3JCM L;  3QCP A;  1SVO A;  2PUK C;  3G7I A;  2PVO C;  4TOP A;  3M9K A;  4TR1 A;  1YVL A;  4XS4 A;  4K8M A;  2FWF A;  1GLP A;  5DCG A;  3QR6 A;  1BG1 A;  1DE1 A;  3Q6O A;  1MDK A;  4KDU A;  3QAV A;  2TRX A;  1ACV A;  1S3C A;  5HFG A;  4ZB7 A;  3QOU A;  1U3I A;  3C71 A;  3IBH A;  2K8V A;  2L4C A;  5CRG A;  1S3R A;  4MPG A;  3U6V A;  1A2M A;  2B1L A;  3FRC A;  4MH2 A;  4F0C A;  1B8X A;  1V57 A;  3W8J A;  4AJ6 A;  2WW2 A;  1DSB A;  3QMX A;  1SJZ A;  4HOJ A;  2BMX A;  1WWJ A;  4FIW A;  2C4J A;  1YKA A;  2H72 A;  2OAC A;  3ZIT A;  4YQM A;  3ISO A;  2VD1 A;  1KEB A;  3TOT A;  3FKF A;  4MF6 A;  3MNG A;  2VD0 A;  4IW9 A;  3CWG A;  1BX9 A;  3A3T A;  3VFI A;  3D4T A;  2QA2 A;  3WGE A;  1SJI A;  5C04 A;  4IS0 A;  3VWW A;  4HU7 A;  4HZ2 A;  2FCH A;  5A5K A;  2VCW A;  4K6X A;  1AAZ A;  4LL4 B;  2C0D A;  4TKY A;  2HNL A;  3KIJ A;  4PI2 C;  2ZUP A;  5G5F A;  3UIW A;  4KGI A;  3IRA A;  4Q5R A;  2WVX A;  4Z7X A;  3CRU A;  3HHV A;  3EUR A;  3IK7 A;  1BF5 A;  3BOA A;  3FZA A;  2QA1 A;  1F6M C;  2DBC A;  2HFD A;  2LS5 A;  2MZC A;  1E6B A;  3MYD A;  3FZ9 A;  1TDI A;  2O36 A;  3C1R A;  2RM6 A;  4MZC A;  4PI0 C;  4MF5 A;  2OBK A;  3BD2 A;  1O8X A;  2OT3 A;  2GQM A;  2I3Y A;  1ZGN A;  2LV3 A;  5DAK B;  1BJX A;  4E8E A;  1Z7P A;  2VCZ A;  3GA4 A;  3ZZX A;  4POK A;  1F2E A;  3C73 A;  3HYP A;  2B6M A;  4I5Q A;  1I9D A;  2DJJ A;  1TU7 A;  3D5J A;  2DJ2 A;  1FVJ A;  1PX6 A;  3F6D A;  4Z2R A;  2IMF A;  2IPA A;  2VCT A;  5G1K A;  3GSS A;  4TR4 A;  2AAW A;  4TRX A;  4OFT A;  4LL1 B;  3U5R E;  1T3B A;  1XWA A;  4PNF A;  2R37 A;  2CVD A;  5J4Y A;  3E3E A;  2E2M A;  1V2A A;  3D22 A;  1OE8 A;  2Z9S A;  2IFQ A;  5B7C A;  2KHP A;  2NPB A;  4IEL A;  4WET A;  3IPZ A;  1ML6 A;  1T1V A;  1LBK A;  4IHU A;  1U3A A;  4GTU A;  4BWS A;  3IR4 A;  1A8L A;  2JSZ A;  5DQY A;  1H75 A;  4O5Q A;  1XOB A;  3WGX A;  5ECM B;  5A1N B;  2KP2 A;  2AYT A;  4FXY P;  2P5Q A;  4J56 E;  4WKW A;  5ECO B;  5IPH A;  1U6T A;  3D0Z A;  2HSH A;  4MJA A;  5AIX A;  2ZCT A;  1TTZ A;  4W66 A;  3UAR A;  2BJX A;  4AJ8 A;  2JSY A;  1GL8 A;  1SEN A;  5BMU A;  4RI6 A;  4XS6 A;  5ECH B;  1K0A A;  1EOH A;  5HR3 A;  1Z5Y E;  4N11 A;  2WW3 A;  1ZZY A;  1XBS A;  4IP6 A;  2DIY A;  5KN3 A;  3Q18 A;  4XS1 A;  4OO5 A;  3ME7 A;  1WIK A;  4EXJ A;  5C00 A;  4EKZ A;  4FQU A;  4PGT A;  3ZFB A;  4KCE A;  1Z9H A;  5EL8 A;  1TXU A;  1PSQ A;  2WZ9 A;  4YKF A;  1WE0 A;  4WF5 A;  1EWX A;  1SJ6 A;  5KOW A;  5ECR B;  3F4R A;  1G7E A;  12GS A;  4HUA A;  4ML6 A;  3EU3 A;  2NVL A;  4IQ1 A;  3BCK A;  1JFU A;  2GS3 A;  1NHY A;  1MEK A;  1QFN A;  3GST A;  2GQL A;  5DAK A;  4IQA A;  1Y1U A;  4O5U A;  3TJB A;  14GS A;  5L71 A;  4HSC X;  3PGT A;  5ABR A;  2FHE A;  4EUY A;  4D73 A;  3L9V A;  2VLV A;  5A4U A;  5HR1 A;  4TXO A;  3EMX A;  3FZ5 A;  2PPT A;  4BA7 A;  4L8E A;  4PUA A;  4HQZ A;  4ZL9 A;  5GZZ B;  1WPI A;  3TRX A;  1TRU A;  1M0U A;  5IPG A;  4RQR A;  2B3S A;  2HRA A;  1UA5 A;  5AN1 A;  2L57 A;  2YP6 A;  2LRT A;  5JCG A;  4CDO A;  1VGL A;  5A5H B;  2K18 A;  1JLW A;  3HJO A;  2NBS A;  2H30 A;  2JZS A;  4FO5 A;  2QC7 A;  4HU9 A;  2YCD A;  4WF4 A;  2OKA A;  4OD7 A;  5INY A;  2PBJ A;  4ILF A;  5ECL B;  1TU8 A;  3TB2 A;  2YV7 A;  2HSM B;  5BRT A;  2B5Y A;  3LSZ A;  2GVP A;  3KTL A;  2HSY A;  1USB A;  4NHW A;  4MZB A;  2XPD A;  3VLN A;  3APQ A;  2V6K A;  3DD3 A;  2V6O A;  3E0U A;  3I69 A;  1XOA A;  3KH7 A;  4K7I A;  5J9B A;  1XWC A;  3UBK A;  5AIS A;  1K0N A;  2RUE A;  2GST A;  2AB6 A;  5A4V A;  3LYK A;  2X99 A;  16GS A;  3ED3 A;  2FWG A;  2ZNM A;  4P3Y B;  2N5A A;  2HYX A;  2GT5 A;  1GTA A;  5JCW A;  1FW1 A;  4KW6 A;  2YWO A;  5J41 A;  3GN3 A;  1Y6E A;  3LEF A;  2WFC A;  1V98 A;  2H6X A;  2MMO A;  4NXI A;  4OFM A;  1CQG A;  4JR4 A;  5B8A A;  3EPT A;  5KEJ A;  2HZE B;  1HNC A;  2IWT A;  1EP7 A;  1T4Z A;  2FWE A;  4MPF A;  4PQ1 A;  1GSD A;  1TW9 A;  3I9V 2;  3OR5 A;  1VF3 A;  1VF1 A;  4PX1 A;  4DEJ A;  4GXZ A;  1YF1 A;  4GQC A;  1EP8 A;  3TKP A;  5E59 A;  3EIN A;  2B7K A;  1XXU A;  4XIH A;  2FWH A;  3TJF A;  4L5O A;  3P7X A;  3TRP A;  1G6Y A;  2WRT A;  2VAF A;  1PD2 1;  4JBB A;  1XCC A;  3TJJ A;  1M2D A;  5IMF A;  4KCA A;  2PU9 C;  4KUN A;  2KLX A;  1FHE A;  2HRN A;  2WW0 A;  1XFL A;  5AGY A;  3PR8 A;  2R5G A;  4HI7 A;  2DML A;  17GS A;  3A2V A;  4K5S A;  4F0B A;  10GS A;  2IMD A;  4TVE A;  1ERU A;  2H75 A;  3HVV A;  4G0I A;  3PPU A;  5LNK e;  4GWR A;  1C72 A;  3F8U A;  5A34 A;  4J2F A;  4OCE A;  5H5S A;  2L5O A;  1BYE A;  4MJE A;  3ZRE A;  3DKS A;  9GSS A;  1BAY A;  4KND A;  1OVN A;  4G2E A;  4H86 A;  1S4B P;  1OAZ A;  3D6I A;  5COH A;  1B4Q A;  1YKC A;  4I2U A;  20GS A;  1OC9 A;  3MIX A;  3F6F A;  5J3R A;  3HCZ A;  1M99 A;  6GSU A;  4N3Z A;  2C3Q A;  4NV2 A;  2PN8 A;  5ID2 A;  5J47 A;  4G9H A;  5ECS A;  1SL1 B;  2VL3 A;  4KAE A;  3I6A A;  3RHC A;  4YAV A;  2H6Z A;  4DSS B;  4MJC A;  2VIM A;  1IYH A;  1YEW C;  5E4W A;  4IBP A;  2VCX A;  2I81 A;  2AHE A;  1EV9 A;  2N5B A;  1TKD B;  8GSS A;  2ON5 A;  2CQ9 A;  2DLX A;  4AJ7 A;  1MTC A;  2KUC A;  3EVI A;  1EOG A;  1SK0 A;  2AV4 A;  2VLU A;  2WGR A;  1IYI A;  5DJM A;  3P2A A;  2V41 A;  1R4W A;  3A5I A;  2G0F A;  1YY7 A;  4BVX A;  4ECB A;  2R6K A;  3H93 A;  3LOR A;  4NV5 A;  2VM1 A;  3HJM A;  3GUS A;  3HA9 A;  5GST A;  4OCF A;  5GAN D;  5J5N A;  3FR6 A;  3CXG A;  4X43 A;  4EO3 A;  2H8L A;  1V9W A;  2YWI A;  1MD3 A;  3HJP A;  5F8B A;  2HQT A;  3A2X A;  1M3I A;  1ZYE A;  1X9W B;  4WBR D;  4EIQ A;  2EIO A;  3RPP A;  1SYR A;  1GUK A;  2H1B A;  4O7H A;  2O3E A;  3FR3 A;  2HZF A;  4E68 A;  3P90 A;  1QQ2 A;  1EEJ A;  2DJ0 A;  4X1U A;  4Q5F A;  2E7P A;  3CTF A;  4BL7 B;  3I43 A;  2ON7 A;  4MDC A;  2CX4 A;  4OWY A;  4EE0 A;  3LJR A;  2HXK A;  4RUV A;  1EEM A;  3L4N A;  5B8B A;  4EVM A;  5CRH A;  2QKE A;  1QMV A;  5J4V A;  2UV8 G;  2GZP A;  2H0H A;  3ZRD A;  1PMT A;  5HR0 A;  2LST A;  2L5L A;  1SK1 A;  1TJD A;  2K6V A;  3LXZ A;  2HRK B;  3NIV A;  4IJ3 A;  4N30 A;  5D9X A;  3DML A;  2OE3 A;  4MAB A;  3F3R A;  2P0G A;  2VL9 A;  3ME8 A;  3HVS A;  3RBT A;  1SD8 A;  1V58 A;  1YZX A;  3IHQ A;  1GLQ A;  1ST9 A;  1AC1 A;  1FB6 A;  2WB9 A;  3WT2 A;  2H1D A;  1N2A A;  4ZBA A;  4L0U A;  1A2J A;  2A2P A;  5ECN B;  2KOK A;  3KZQ A;  4MNN A;  1OKD A;  1B4P A;  2LKU A;  3CHX C;  4I8B A;  4ZXG A;  2H74 A;  1KBN A;  3IK9 A;  3L78 A;  3IE3 A;  4OMV A;  3FHK A;  1R26 A;  2IL3 A;  4ULX A;  3LWA A;  4XRA A;  4V1A g; 
#chains in the Genus database with same CATH homology
 2MYG A;  4K9Z A;  3MWH A;  1PL1 A;  3GUR A;  3LXT A;  4WBJ A;  2VCV A;  5CO3 A;  3H79 A;  5D73 A;  1WMJ A;  4GF0 A;  1RK4 A;  1GNW A;  3ZL5 A;  1JZO A;  1UC7 A;  1PKW A;  5IIZ A;  4TR3 A;  1T7P B;  1TI3 A;  3ERW A;  1M7T A;  3WD6 A;  4KDY A;  2O8V B;  4KX4 A;  1NSW A;  3GHA A;  3VWU A;  1ILO A;  5KN0 A;  2PGT A;  1A24 A;  1AIU A;  3ZMK A;  4N0V A;  4NAX A;  4MCU A;  1X5D A;  1H4O A;  5EY6 A;  4NWY A;  2HSN B;  1MDI A;  3ZFL A;  4PUF C;  2PER A;  2GGT A;  3TDG A;  6GSW A;  4KB3 A;  5G31 A;  2GSQ A;  4JU5 A;  5B6M A;  1N8J A;  2LJA A;  4G10 A;  2F8F A;  2WUL A;  1O6J A;  2H66 A;  4GST A;  2X49 A;  3ZTL A;  1F9M A;  5DQS A;  1M2A A;  2H0I A;  3DVW A;  5IOW A;  4NHZ A;  1OC3 A;  4IN0 A;  3GV1 A;  2L59 A;  5IO2 A;  5IOX A;  3MSZ A;  2DKH A;  3IA1 A;  1G7O A;  4MZW A;  3GYK A;  4MP4 A;  1X5C A;  2R0C A;  6GST A;  4MMM A;  5ECK B;  2OE0 A;  2ES7 A;  2FA4 A;  4G01 A;  2OJL A;  5HFK A;  1ZYN A;  5J40 A;  2LNS A;  1MD4 A;  3F3Q A;  4FYU A;  3N9J A;  4PUR A;  4JR6 A;  1K3L A;  2HT9 A;  2O89 A;  1BED A;  4WR4 A;  2LJK A;  1YEP A;  2HE3 A;  2A4H A;  5CNW A;  4AKG A;  5A4W A;  5HQP A;  4K5R A;  3FW2 A;  4GSS A;  3M8N A;  2RLI A;  5KN2 A;  3QPM A;  1X9M B;  1WP0 A;  2VL2 C;  4Z2T A;  4TR0 A;  2C80 A;  2LEG A;  3VI5 A;  2J9H A;  4ECJ A;  3UVT A;  5IMZ A;  1A23 A;  2YWM A;  1SKS B;  4K0G A;  1A0F A;  2I1U A;  4HZ4 A;  3UEM A;  1M2B A;  3BJ5 A;  1DBY A;  2C3T A;  2YN1 A;  3ERG A;  1GSF A;  2VO4 A;  4V2M A;  2H73 A;  3GKK A;  3PH9 A;  4X0X A;  3US3 A;  3KXO A;  4G0K A;  4LA1 A;  2L6D A;  3G7Y A;  2UZ8 A;  5JWR B;  3FMW A;  2H71 A;  4AKH A;  4CY6 A;  3KMO A;  2YPM A;  3CRT A;  2DC5 A;  1PGT A;  4PTS A;  3W6G A;  3G7J A;  3TU3 B;  4KA0 A;  1Z7R A;  1RW1 A;  1EGR A;  4HS1 A;  5DBQ A;  2K8S A;  2H0G A;  5A1N A;  2FGX A;  2H1A A;  3HY2 A;  1T00 A;  1F3A A;  3CSJ A;  1F37 A;  1OYJ A;  4V1A p;  2HRF A;  1OE7 A;  3SWL A;  2VOC A;  4BWQ A;  4EDY A;  5DVB A;  5ECP B;  1Z6N A;  4WXT A;  2TIR A;  2XHF A;  4ISD A;  3IAS 2;  5ECQ B;  2PWJ A;  3O76 A;  3M1G A;  5IMC A;  2LQO A;  4OO4 A;  2CT6 A;  2D2Z A;  1GRX A;  1XW5 A;  5DAL B;  4YQU A;  2IJY A;  2EFC A;  3LYP A;  2YWN A;  5IM9 A;  1FVK A;  4AI6 A;  2CX3 A;  4DSQ A;  3ERF A;  4USS A;  3H4K A;  1ERV A;  3GRX A;  4QL9 A;  1YEX A;  2M72 A;  3TRQ A;  2DSA A;  1TK5 B;  6GSS A;  2H70 A;  2VL2 A;  1KTE A;  1YJ6 A;  2L4Q A;  4EC0 A;  5F06 A;  1HD2 A;  1XPV A;  5D9V A;  2R2J A;  4A5P A;  1GP1 A;  3LGC A;  2FUG 2;  4ML1 A;  1AQX A;  4KDX A;  2A2R A;  1U87 A;  1Q4J A;  3Q19 A;  3BBY A;  4LLR A;  3IC8 A;  3GH9 A;  1WJK A;  1GH2 A;  3HXS A;  1JZW A;  5KOX A;  1QUW A;  1O7U A;  4GRF A;  2L6C A;  1YF0 A;  1EV4 A;  3RDW A;  4JZQ A;  2LRC A;  1DE2 A;  4HJ2 A;  1QGV A;  5DDL A;  2I9H A;  3LFL A;  4NPB A;  2WCI A;  4DSR A;  4Q5Q A;  5F05 A;  4ZL8 A;  4MJB A;  4AKI A;  3HVX A;  1PX7 A;  3A2W A;  4O5R A;  1XW9 A;  4ZB6 A;  4POM A;  4BVY B;  2RII A;  2CAI A;  3C7M A;  2MMA A;  5A5H A;  1ZCP A;  2C0G A;  1F3B A;  5IMD A;  5JWO B;  2BTO T;  2GQK A;  1W4V A;  4N10 A;  5F07 A;  3TKS C;  1A8Y A;  4AGS A;  2F9S A;  2DJ1 A;  2FLS A;  4K1F A;  2VLT A;  3QAW A;  2HSM A;  1THO A;  1GSY A;  3UMA A;  4XCS A;  3SBC A;  1BG5 A;  3NOF A;  4F82 A;  3L9U A;  4LMV A;  3GX8 A;  2C0F A;  3IC4 A;  4MK3 A;  2B5E A;  4IVF A;  2VUP A;  4RI7 A;  1JZR A;  4MA9 A;  2E0Q A;  1AW9 A;  1OKT A;  4G0L A;  4ZIL A;  2DIZ A;  2IIY A;  2JZT A;  1M9A A;  4GLT A;  1G6W A;  4LMW A;  1XVW A;  1XVQ A;  1O8W A;  2C1Y A;  2H76 A;  4AKX B;  2GSS A;  2CZ2 A;  2RM5 A;  3VUR A;  1A0R P;  1LJR A;  2OA7 A;  3WYW A;  4FH8 A;  3CMI A;  4Q5N A;  1K0C A;  1PRX A;  5CAX A;  1ZYP A;  3GH6 A;  3HZ8 A;  2CA8 A;  2NDO A;  3HDC A;  2OAD A;  3L9S A;  4GSN A;  6GSV A;  1GUL A;  2HZE A;  3EU4 A;  4K7N A;  5B6N A;  3RHB A;  1ERW A;  2NTO A;  3KGK A;  5DJL A;  4YQV A;  2LNT A;  1K3O A;  3WT1 A;  4V2N A;  1KNG A;  3M3M A;  3D21 A;  2YOI A;  3WGD A;  1V40 A;  1S3D A;  3GFK A;  3NZN A;  4ICY A;  2DJK A;  5D96 A;  1TOF A;  1UN2 A;  2MMN A;  2IFQ B;  1XWK A;  2IME A;  4HEA 2;  4BPY A;  2H19 A;  2GZZ A;  1XW6 A;  2O87 A;  2WS2 A;  2CVK A;  2O7K A;  5H5Q A;  2RUF A;  2MMZ A;  1SD9 A;  3TKS A;  1SVL A;  3HKR A;  2I4A A;  3DVX A;  2M80 A;  2H1L A;  4L5L A;  5DCH A;  1GTU A;  1SU9 A;  3ZLP A;  22GS A;  4JE1 A;  2AUV A;  2A2S A;  1T4Y A;  3DEX A;  1I5G A;  2V32 A;  4I2T A;  2LTK A;  1S3A A;  3HMJ G;  4BVY A;  4POB A;  3A5W A;  1K0B A;  2GZY A;  2IN3 A;  1GTB A;  3HD5 A;  3VPQ A;  1GWC A;  3O6T A;  1GTI A;  2C0E A;  4TXV A;  3CYN A;  1FG4 A;  4KSM A;  5BMU B;  2XBI A;  4PQI A;  5J4U A;  2CZ3 A;  2YAN A;  1K0O A;  3F4S A;  2GDR A;  3F9U A;  5FWG A;  2KP1 A;  3GL5 A;  2JU5 A;  2F8A A;  3ZIJ A;  1SVM A;  1X5E A;  3GL3 A;  1JZD A;  4F9Z A;  1JHB A;  4KF9 A;  3F63 A;  4K2X A;  1M9B A;  5FT3 A;  3EYT A;  1X0R A;  3J7Y k;  4WR5 A;  3TOU A;  4DSS A;  1GUM A;  1AUC A;  3RAZ A;  4L0W A;  1E2Y A;  3GMF A;  3ZVJ A;  3QD9 A;  7GSS A;  1BQ7 A;  2JAD A;  4EL1 A;  1PA3 A;  5CRE A;  2YV9 A;  3BCI A;  5GSS A;  2O5V A;  1QXH A;  1FO5 A;  3KP8 A;  4RQX A;  2HI7 A;  5LCZ A;  1TRS A;  4D73 B;  2R4V A;  4TXO B;  1SL2 B;  4XHM A;  5CRD A;  2N5F A;  3D4M A;  2EIQ A;  1ERT A;  2GLR A;  3GKM A;  3IHG A;  3TKR A;  3DGQ A;  4I6X A;  1HNA A;  2EIR A;  5H5R A;  3V1W A;  4N0Z A;  3MAK A;  3TJG A;  1ZOF A;  2GSR A;  3UAP A;  1YQ1 A;  4F2I A;  2E2G A;  4XTS A;  5ECI B;  2EFD A;  3ZIV A;  4ECC A;  3KJY A;  3C1S A;  1EGO A;  1AQV A;  2GTU A;  3CSI A;  4ZIJ A;  3KCM A;  3TKQ A;  2VM2 A;  2J23 A;  5GAP D;  5CYY A;  5D93 A;  3GKX A;  1VF2 A;  3L0H A;  4YAP A;  2MBT A;  5IMV A;  1SL0 B;  4WEY A;  2LJR A;  2H1G A;  2X8H A;  3ZVJ D;  1EZK A;  2IMK A;  3TUE A;  4F03 A;  4PNG A;  3R2Q A;  1OC8 A;  3CSH A;  2DJ3 A;  1PN9 A;  4BL7 A;  2PMT A;  2JL4 A;  1ZL9 A;  3UOM A;  3M0F A;  1VF4 A;  3UBL A;  3TCO A;  1WRY A;  5FHI A;  2B7J A;  3ZYW A;  3QFB C;  4O92 A;  3DXB A;  1RQM A;  2C8U A;  2EFE A;  4JED A;  5G30 A;  1XWB A;  2IMI A;  1HQO A;  2H01 A;  2CVB A;  4K7O A;  2X64 A;  2B5X A;  2V1M A;  1PN0 A;  2HRK A;  1K0D A;  1A2L A;  3ZML A;  4IP1 A;  3TGZ A;  3PIN A;  2DKI A;  4QMK A;  3F4T A;  2YZH A;  2R0G A;  3FY7 A;  4ZB8 A;  1Q98 A;  1SKW B;  1K3Y A;  5G1L A;  1NW2 A;  4CY8 A;  6GSX A;  5IQY A;  4GQF A;  1W89 A;  3FK8 A;  1AQW A;  1O81 A;  2G2Q A;  2HLS A;  4GDF A;  5AIV A;  3W8S A;  1YDK A;  4X4J A;  2B1K A;  2XC2 A;  1VRS D;  3EE2 A;  3DIE A;  3APO A;  4J57 E;  4QQ7 A;  4YKG A;  4KH7 A;  3TKS E;  3KEB A;  2YJH A;  1UVZ A;  1ON4 A;  3N5O A;  4YH2 A;  1GSU A;  4JRR A;  1NM3 A;  2EFH A;  1FOH A;  1GNE A;  5ELG A;  3M9J A;  2R0P A;  1FOV A;  3EC3 A;  1SKR B;  1R5A A;  4KE3 A;  1B9Y C;  1Y25 A;  5LD0 A;  1Z6M A;  3IV4 A;  3GTU B;  2K9F A;  5CP1 A;  3VWX A;  4V2L A;  3VPT A;  1R7H A;  3F0I A;  1TK8 B;  3GKN A;  5HFI A;  2R3X A;  1SYX A;  5J9C A;  2FNO A;  3DYR A;  3MDK A;  5JWQ B;  1GSQ A;  4NMU A;  1NHO A;  5ENU A;  2REM A;  4KSO A;  1MDJ A;  3QFA C;  2X4A A;  2HSN A;  5A34 B;  2X8C A;  2DMM A;  4HJM A;  3C8E A;  3KD0 A;  4IJI A;  4CHS A;  2JZR A;  1ZMA A;  4EDZ A;  3APS A;  1TK0 B;  4E8H A;  3FZ4 A;  4XRD A;  1X9S B;  4I97 A;  4FYB A;  5D9T A;  2F51 A;  2QSI A;  3TJK A;  2V2G A;  4POL A;  3QDN A;  3H1N A;  4GCI A;  2P31 A;  5KN1 A;  3CBU A;  1OC9 B;  3GX0 A;  4ECI A;  3CTG A;  5ID2 B;  1XIY A;  2OE1 A;  4MH3 A;  3LG6 A;  3FEU A;  5ELA A;  2OBI A;  5EVO A;  2YZU A;  3GIX A;  1GSE A;  4HDE A;  4TN8 A;  1LU4 A;  2YNX A;  3KP9 A;  1WOU A;  1FAA A;  5JCU A;  1TRW A;  1TRV A;  4TR1 B;  4XS4 B;  3IXR A;  2H6Y A;  4OFN A;  2MBS A;  4ZBD A;  3DWV A;  2X8G A;  1U88 A;  2QGV A;  4Z2U A;  1CQH A;  1HNB A;  4IKH A;  1ABA A;  4BVX B;  4ZB9 A;  3EWL A;  1ZYQ B;  2AJQ B;  3FR9 A;  6GSY A;  3E9J B;  3S9F A;  2O85 A;  5G5E A;  1THX A;  1G0T A;  5G2Z A;  1B48 A;  3DRN A;  19GS A;  1JLV A;  1FB0 A;  2LQQ A;  4EIP A;  2XPE A;  1URM A;  3P8W A;  1TP9 A;  4FYC A;  5IMA A;  2WDU A;  3GNJ A;  2LRN A;  2TRC P;  1HYU A;  3KMN A;  2FY6 A;  3LQ7 A;  1Z3E A;  4CW9 A;  1SK2 A;  2FD3 A;  2P5R A;  4MLY A;  3K8N A;  4ZBB A;  3R3E A;  4PQH A;  3GTU A;  3Q74 A;  2CV4 A;  4MF7 A;  3QAG A;  3O3T A;  3H8Q A;  3IOS A;  3KTB A;  3AY8 A;  1O85 A;  3KH9 A;  3EMP A;  1TXX A;  4AF2 A;  4QL7 A;  4IGJ A;  3IDV A;  11GS A;  1GUH A;  1K0M A;  2PVQ A;  2YJ7 A;  2XBQ A;  1XWG A;  4K0N A;  1QK8 A;  3HZ4 A;  4TW5 A;  1N25 A;  3FYG A;  5EPF A;  2GT6 A;  4O32 A;  2WJU A;  5F0G A;  1J0F A;  5CRW A;  4G19 A;  13GS A;  1R5P A;  2FA8 A;  3VI7 A;  3UJ1 A;  5D8I A;  2VKZ G;  1T8E B;  1PKZ A;  5HR2 A;  3IAM 2;  4DVC A;  1AXD A;  4HQS A;  3VWV A;  1PQN A;  1J9B A;  2F3M A;  3J7Y b;  2LUS A;  4EF0 A;  1PL2 A;  1XZO A;  3KM6 A;  5D9W A;  2EC4 A;  4ACS A;  5IO0 A;  4ZL7 A;  4ID0 A;  1B9X C;  3UL3 A;  1J08 A;  2M46 A;  2C3N A;  5DAL A;  3G9B A;  1O73 A;  1GSS A;  3UVH A;  1TI1 A;  4PXO A;  4K2D A;  3VK9 A;  1DUG A;  3LW9 A;  18GS A;  2ALB A;  3RPN A;  2VCQ A;  2A4V A;  2JAC A;  2CAQ A;  3JCM L;  3QCP A;  1SVO A;  2PUK C;  3G7I A;  2PVO C;  4TOP A;  3M9K A;  4TR1 A;  1YVL A;  4XS4 A;  4K8M A;  2FWF A;  1GLP A;  5DCG A;  3QR6 A;  1BG1 A;  1DE1 A;  3Q6O A;  1MDK A;  4KDU A;  3QAV A;  2TRX A;  1ACV A;  1S3C A;  5HFG A;  4ZB7 A;  3QOU A;  1U3I A;  3C71 A;  3IBH A;  2K8V A;  2L4C A;  5CRG A;  4MPG A;  3U6V A;  1A2M A;  2B1L A;  3FRC A;  4MH2 A;  4F0C A;  1B8X A;  1V57 A;  3W8J A;  4AJ6 A;  1DSB A;  3QMX A;  1SJZ A;  4HOJ A;  2BMX A;  1WWJ A;  4FIW A;  2C4J A;  1YKA A;  2H72 A;  2OAC A;  3ZIT A;  4YQM A;  3ISO A;  2VD1 A;  1KEB A;  3TOT A;  3FKF A;  4MF6 A;  3MNG A;  2VD0 A;  4IW9 A;  3CWG A;  1BX9 A;  3A3T A;  3VFI A;  3D4T A;  2QA2 A;  3WGE A;  1SJI A;  5C04 A;  4IS0 A;  3VWW A;  4HU7 A;  4HZ2 A;  2FCH A;  5A5K A;  2VCW A;  4K6X A;  1AAZ A;  4LL4 B;  2C0D A;  4TKY A;  2HNL A;  3KIJ A;  2ZUP A;  5G5F A;  3UIW A;  4KGI A;  3IRA A;  4Q5R A;  4Z7X A;  3CRU A;  3HHV A;  3EUR A;  3IK7 A;  1BF5 A;  3BOA A;  3FZA A;  2QA1 A;  1F6M C;  2DBC A;  2HFD A;  2LS5 A;  2MZC A;  3MYD A;  1E6B A;  3FZ9 A;  1TDI A;  3C1R A;  2RM6 A;  4MZC A;  4MF5 A;  2OBK A;  3BD2 A;  1O8X A;  2OT3 A;  2GQM A;  2I3Y A;  1ZGN A;  2LV3 A;  5DAK B;  1BJX A;  4E8E A;  1Z7P A;  2VCZ A;  3GA4 A;  3ZZX A;  4POK A;  1F2E A;  3C73 A;  3HYP A;  2B6M A;  4I5Q A;  1I9D A;  2DJJ A;  1TU7 A;  3D5J A;  2DJ2 A;  1FVJ A;  1PX6 A;  3F6D A;  4Z2R A;  2IMF A;  2IPA A;  2VCT A;  5G1K A;  3GSS A;  4TR4 A;  2AAW A;  4TRX A;  4OFT A;  4LL1 B;  3U5R E;  1T3B A;  1XWA A;  4PNF A;  2R37 A;  2CVD A;  5J4Y A;  3E3E A;  2E2M A;  1V2A A;  3D22 A;  1OE8 A;  2Z9S A;  2IFQ A;  5B7C A;  2KHP A;  2NPB A;  4IEL A;  4WET A;  3IPZ A;  1ML6 A;  1T1V A;  1LBK A;  4IHU A;  1U3A A;  4GTU A;  4BWS A;  3IR4 A;  1A8L A;  2JSZ A;  5DQY A;  1H75 A;  4O5Q A;  1XOB A;  3WGX A;  5ECM B;  5A1N B;  2KP2 A;  2AYT A;  2P5Q A;  4J56 E;  4WKW A;  5ECO B;  5IPH A;  1U6T A;  3D0Z A;  2HSH A;  4MJA A;  5AIX A;  2ZCT A;  1TTZ A;  4W66 A;  3UAR A;  2BJX A;  4AJ8 A;  2JSY A;  1GL8 A;  1SEN A;  5BMU A;  4RI6 A;  4XS6 A;  5ECH B;  1K0A A;  1EOH A;  5HR3 A;  1Z5Y E;  4N11 A;  1ZZY A;  1XBS A;  4IP6 A;  2DIY A;  5KN3 A;  3Q18 A;  4XS1 A;  4OO5 A;  3ME7 A;  1WIK A;  4EXJ A;  5C00 A;  4EKZ A;  4FQU A;  4PGT A;  3ZFB A;  4KCE A;  1Z9H A;  5EL8 A;  1TXU A;  1PSQ A;  2WZ9 A;  4YKF A;  1WE0 A;  4WF5 A;  1EWX A;  1SJ6 A;  5KOW A;  5ECR B;  3F4R A;  1G7E A;  12GS A;  4HUA A;  4ML6 A;  3EU3 A;  2NVL A;  4IQ1 A;  3BCK A;  1JFU A;  2GS3 A;  1NHY A;  1MEK A;  1QFN A;  3GST A;  2GQL A;  5DAK A;  4IQA A;  1Y1U A;  4O5U A;  3TJB A;  14GS A;  5L71 A;  3PGT A;  5ABR A;  2FHE A;  4EUY A;  4D73 A;  3L9V A;  2VLV A;  5A4U A;  5HR1 A;  4TXO A;  3EMX A;  3FZ5 A;  2PPT A;  4BA7 A;  4L8E A;  4PUA A;  4HQZ A;  4ZL9 A;  5GZZ B;  1WPI A;  3TRX A;  1TRU A;  1M0U A;  5IPG A;  4RQR A;  2B3S A;  2HRA A;  1UA5 A;  5AN1 A;  2L57 A;  2YP6 A;  2LRT A;  5JCG A;  4CDO A;  1VGL A;  5A5H B;  2K18 A;  1JLW A;  3HJO A;  2NBS A;  2H30 A;  2JZS A;  4FO5 A;  2QC7 A;  4HU9 A;  2YCD A;  4WF4 A;  2OKA A;  4OD7 A;  5INY A;  2PBJ A;  4ILF A;  5ECL B;  1TU8 A;  3TB2 A;  2YV7 A;  2HSM B;  5BRT A;  2B5Y A;  3LSZ A;  2GVP A;  3KTL A;  2HSY A;  1USB A;  4NHW A;  4MZB A;  2XPD A;  3VLN A;  3APQ A;  2V6K A;  3DD3 A;  2V6O A;  3E0U A;  3I69 A;  1XOA A;  3KH7 A;  4K7I A;  5J9B A;  1XWC A;  3UBK A;  5AIS A;  1K0N A;  2RUE A;  2GST A;  2AB6 A;  5A4V A;  3LYK A;  2X99 A;  16GS A;  3ED3 A;  2FWG A;  2ZNM A;  4P3Y B;  2N5A A;  2HYX A;  2GT5 A;  1GTA A;  5JCW A;  1FW1 A;  4KW6 A;  2YWO A;  5J41 A;  3GN3 A;  1Y6E A;  3LEF A;  2WFC A;  1V98 A;  2H6X A;  2MMO A;  4NXI A;  4OFM A;  1CQG A;  4JR4 A;  5B8A A;  3EPT A;  5KEJ A;  2HZE B;  1HNC A;  2IWT A;  1EP7 A;  1T4Z A;  2FWE A;  4MPF A;  4PQ1 A;  1GSD A;  1TW9 A;  3I9V 2;  3OR5 A;  1VF3 A;  1VF1 A;  4PX1 A;  4DEJ A;  4GXZ A;  1YF1 A;  4GQC A;  1EP8 A;  3TKP A;  5E59 A;  3EIN A;  2B7K A;  1XXU A;  4XIH A;  2FWH A;  3TJF A;  4L5O A;  3P7X A;  3TRP A;  1G6Y A;  2WRT A;  2VAF A;  1PD2 1;  4JBB A;  1XCC A;  3TJJ A;  1M2D A;  5IMF A;  4KCA A;  2PU9 C;  4KUN A;  2KLX A;  1FHE A;  2HRN A;  1XFL A;  5AGY A;  3PR8 A;  2R5G A;  4HI7 A;  2DML A;  17GS A;  3A2V A;  4K5S A;  4F0B A;  10GS A;  2IMD A;  4TVE A;  1ERU A;  2H75 A;  3HVV A;  4G0I A;  3PPU A;  5LNK e;  4GWR A;  1C72 A;  3F8U A;  5A34 A;  4J2F A;  4OCE A;  5H5S A;  2L5O A;  1BYE A;  4MJE A;  3ZRE A;  3DKS A;  9GSS A;  1BAY A;  4KND A;  1OVN A;  4G2E A;  4H86 A;  1OAZ A;  3D6I A;  5COH A;  1B4Q A;  1YKC A;  4I2U A;  20GS A;  1OC9 A;  3MIX A;  3F6F A;  5J3R A;  3HCZ A;  1M99 A;  6GSU A;  4N3Z A;  2C3Q A;  4NV2 A;  2PN8 A;  5ID2 A;  5J47 A;  4G9H A;  5ECS A;  1SL1 B;  2VL3 A;  4KAE A;  3I6A A;  3RHC A;  4YAV A;  2H6Z A;  4DSS B;  4MJC A;  2VIM A;  1IYH A;  5E4W A;  4IBP A;  2VCX A;  2I81 A;  2AHE A;  1EV9 A;  2N5B A;  1TKD B;  8GSS A;  2ON5 A;  2CQ9 A;  2DLX A;  4AJ7 A;  1MTC A;  2KUC A;  3EVI A;  1EOG A;  1SK0 A;  2AV4 A;  2VLU A;  2WGR A;  1IYI A;  5DJM A;  3P2A A;  2V41 A;  1R4W A;  3A5I A;  2G0F A;  1YY7 A;  4BVX A;  4ECB A;  2R6K A;  3H93 A;  3LOR A;  4NV5 A;  2VM1 A;  3HJM A;  3GUS A;  3HA9 A;  5GST A;  4OCF A;  5GAN D;  5J5N A;  3FR6 A;  3CXG A;  4X43 A;  4EO3 A;  2H8L A;  1V9W A;  2YWI A;  1MD3 A;  3HJP A;  5F8B A;  2HQT A;  3A2X A;  1ZYE A;  1X9W B;  4WBR D;  4EIQ A;  2EIO A;  3RPP A;  1SYR A;  1GUK A;  2H1B A;  4O7H A;  3FR3 A;  2HZF A;  4E68 A;  3P90 A;  1QQ2 A;  1EEJ A;  2DJ0 A;  4X1U A;  4Q5F A;  2E7P A;  3CTF A;  4BL7 B;  3I43 A;  2ON7 A;  4MDC A;  2CX4 A;  4OWY A;  4EE0 A;  3LJR A;  2HXK A;  4RUV A;  3L4N A;  1EEM A;  5B8B A;  4EVM A;  5CRH A;  2QKE A;  1QMV A;  5J4V A;  2UV8 G;  2GZP A;  2H0H A;  3ZRD A;  1PMT A;  5HR0 A;  2LST A;  2L5L A;  1SK1 A;  1TJD A;  2K6V A;  3LXZ A;  2HRK B;  3NIV A;  4IJ3 A;  4N30 A;  5D9X A;  3DML A;  2OE3 A;  4MAB A;  3F3R A;  2P0G A;  2VL9 A;  3ME8 A;  3HVS A;  3RBT A;  1SD8 A;  1V58 A;  1YZX A;  3IHQ A;  1GLQ A;  1ST9 A;  1AC1 A;  1FB6 A;  2WB9 A;  3WT2 A;  2H1D A;  1N2A A;  4ZBA A;  4L0U A;  1A2J A;  2A2P A;  5ECN B;  2KOK A;  3KZQ A;  4MNN A;  1OKD A;  1B4P A;  2LKU A;  4I8B A;  4ZXG A;  2H74 A;  1KBN A;  3IK9 A;  3L78 A;  3IE3 A;  4OMV A;  3FHK A;  1R26 A;  2IL3 A;  4ULX A;  3LWA A;  4XRA A;  4V1A g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...