4F03A

Crystal structure of the glutathione transferase gte1 from phanerochaete chrysosporium
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
251
Chain Sequence
AQPIVFYDIPSNERIKHSPWSPNTWKIRYALNYKGLKYKTEWVEYPDIAGVVQKLGGKPTEKTPDGRDHYTLPVIYDPNTKKVVEDSAAIAKYLDETYPDTPKLFPAGTDAFQAAFLDFAWPVLGFPVFMLVILDTANSLLPRSHDYFRSTREQKFGKKLEELATEEEWAKVEAGLAKLKGYLDANGKGNDLLLMGAQGGITYSDIQIASFFVWAKIIWGEGSEKWKRLISLHDGKWAQFYAQFTKFEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase
publication title Characterization of a Phanerochaete chrysosporium Glutathione Transferase Reveals a Novel Structural and Functional Class with Ligandin Properties.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 93
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4f03A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f03A01
1BJXA 2MMOA 3HYPA 3L9VA 1SL0B 4IJIA 2I4AA 4JEDA 4TR4A 1WJKA 1OC8A 3GTUB 4TW5A 4IP6A 2B7KA 5A4VA 1T00A 1S3AA 1KEBA 1X9WB 1AQVA 4G2EA 2E2MA 5GSTA 4F03A 5J4UA 4DVCA 3US3A 3L9UA 5AIVA 1A24A 3HVVA 1EWXA 3QFBC 2JZTA 4TR0A 1GTUA 4IQAA 4OCEA 3GL3A 2H8LA 3GN3A 3ZRDA 5J3RA 1G0TA 4ZBDA 4ZIJA 3C71A 2F8FA 6GSUA 3UARA 4BL7A 4FYBA 2WB9A 1I5GA 3RPPA 4K8MA 2VLUA 2F51A 1XWGA 4PQIA 2AV4A 4NPBA 2C80A 1Z6NA 1VF2A 3CSHA 2D2ZA 1LJRA 3M3MA 4IKHA 1BEDA 2MYGA 3GSTA 1GTIA 4JZQA 2L4CA 3KM6A 1Z7PA 4GSNA 2L5OA 1VF1A 3G7JA 2X8CA 3IPZA 2LUSA 1YJ6A 3LSZA 1WMJA 1YEPA 3HY2A 3TRPA 2CAIA 4K7OA 2A4VA 1LU4A 3ZFLA 2CX4A 3KIJA 3RAZA 3UVTA 3GKMA 2LNSA 3PINA 5B8BA 3ZL5A 2DMMA 5LD0A 4ECJA 3EU4A 2C4JA 5DDLA 1EP8A 4K7IA 4AJ7A 4MJBA 1RK4A 2GGTA 5ECNB 5F07A 2XHFA 3LORA 3N5OA 1M2BA 4KSMA 5JCUA 5H5SA 4RI6A 1JZWA 1EV9A 4WETA 2ON7A 3DKSA 3IE3A 2LEGA 1GSYA 1TK0B 4WR5A 1O8WA 3I69A 3FR6A 1HNCA 4O92A 4G10A 3MNGA 2LSTA 2OADA 1VRSD 3A5WA 2KOKA 19GSA 2R2JA 4O32A 3GFKA 5L71A 1AIUA 5IO0A 1LBKA 5CRWA 3MSZA 4PTSA 3EYTA 3RHBA 2H1AA 3UL3A 1B4QA 4EC0A 4FYUA 1PL2A 2I81A 1MD3A 1GUKA 4K0NA 1DE2A 1WWJA 5IMFA 3CSIA 5DJLA 4AJ6A 1GSEA 2HRNA 2PWJA 1K0DA 4HJ2A 4EKZA 3GA4A 1GUMA 4RQXA 3D6IA 4KUNA 3P7XA 4N0ZA 2ZCTA 3APQA 2HT9A 1YQ1A 4ZILA 1SL2B 1GLPA 4YQMA 2EIQA 4X43A 3FZ9A 3KP9A 4EF0A 1EZKA 3G9BA 5IMVA 3DEXA 3U6VA 1TXXA 2KP2A 4TR1B 2CA8A 4GQCA 4Z7XA 5IMAA 1X5CA 2GSSA 4KF9A 2H76A 4F0CA 5ECQB 2M72A 4TKYA 5ECLB 2YP6A 2B1LA 3P8WA 3VWVA 3QMXA 1BG5A 3F6DA 5J9CA 2K8VA 1K3LA 2FD3A 2WULA 4D73A 1GSSA 4IQ1A 1OKDA 4GCIA 2PERA 1T8EB 2B1KA 1V58A 3F3QA 3WGEA 4PNFA 4TVEA 1WRYA 2C8UA 4K6XA 5ID2A 2V1MA 3IHQA 1NM3A 2L5LA 1YEXA 4J56E 5IMDA 5C04A 2VO4A 1HNBA 1FVJA 4TRXA 1GNWA 3GURA 4PNGA 4K7NA 1R4WA 3TJJA 4XRAA 2HXKA 2XPEA 2CVDA 4BVYA 1XZOA 1FB6A 17GSA 3Q19A 2EC4A 2OBIA 1MDIA 1XWAA 2GQLA 1GULA 4ML6A 1OC3A 1GSQA 4GXZA 1N8JA 3M9JA 1PQNA 1G6WA 5ECIB 2IMIA 2CX3A 2X99A 3TGZA 1MEKA 3FZAA 4GQFA 3ZITA 3KGKA 4OMVA 1W89A 2YWIA 2F9SA 4MJAA 3CRUA 3RPNA 2IMKA 4X1UA 3VPTA 2E2GA 1CQHA 3KZQA 4IHUA 3VWWA 3F63A 1SK2A 1M99A 4L5OA 5FT3A 4Q5FA 2G2QA 4TXOA 4XS1A 2YWMA 3ZMKA 1TW9A 2P5QA 1TRSA 4KE3A 3FHKA 3EINA 3NZNA 4F2IA 2MBTA 2R5GA 3QR6A 2G0FA 3TKSA 20GSA 2B7JA 1ABAA 2YWNA 4TN8A 2GT6A 3FEUA 4F0BA 5IMCA 5ECMB 4N11A 2VL2A 1U88A 2DJJA 10GSA 4MPGA 2GT5A 1X5EA 3SBCA 5GAPD 4J2FA 5LNKe 1IYIA 3L78A 4N30A 4OO4A 3UVHA 3VFIA 1U3IA 2JACA 3TUEA 5J9BA 1Z5YE 3KTBA 3EURA 3ZVJA 4EL1A 3KCMA 5DJMA 4K1FA 2JSZA 2C1YA 1I9DA 2A2RA 2LKUA 3ME8A 2AJQB 2YV9A 3GRXA 1THXA 4GF0A 3TJBA 3GKXA 5B7CA 1J9BA 1PKZA 1Z3EA 1TU7A 2H6YA 5EL8A 1B8XA 4G0IA 1V2AA 4MA9A 3QFAC 3LYKA 3H79A 3A2XA 4FH8A 3ZFBA 4MLYA 3VWXA 2ZUPA 2O85A 2QGVA 3UBLA 2X8GA 2H0IA 3FKFA 1Z9HA 1EV4A 1V98A 5DAKA 2R4VA 4LA1A 3ZVJD 4LL1B 3GMFA 4MK3A 4XRDA 1K0CA 1YKAA 1SKSB 3ERFA 1K0OA 3HA9A 4BA7A 2MZCA 2FWHA 3R3EA 7GSSA 4OD7A 5CP1A 1SYRA 4CHSA 5CRHA 4ZB9A 4ZL9A 5IIZA 2FA4A 2WS2A 1PA3A 2QSIA 5E4WA 3ED3A 12GSA 1NHYA 4P3YB 1GP1A 2AYTA 2VAFA 1C72A 2HYXA 3IA1A 1TKDB 4USSA 5DVBA 1TRWA 5D9XA 5ENUA 2CVKA 4D73B 5G1KA 3ZIJA 3PR8A 2GDRA 4PXOA 2H71A 3DVXA 4CDOA 4IGJA 5HQPA 4V2LA 2H1DA 1G7EA 5ID2B 4IBPA 3HVXA 2GZYA 5DCHA 3UMAA 4DSRA 4MZBA 3ZYWA 4GTUA 5KN3A 4MABA 4AF2A 1HYUA 1B48A 6GSSA 9GSSA 3DD3A 3TKSE 3VLNA 1EOGA 1AQXA 3VI7A 3D4TA 3F9UA 3KTLA 1GTBA 5EPFA 2YN1A 3CBUA 4BVYB 4I2TA 4RI7A 3TKSC 2H0GA 2BJXA 1PL1A 1XWBA 2E7PA 4I5QA 2GQMA 2VD1A 4L5LA 3L0HA 3CTGA 2I1UA 2OJLA 2VCVA 1SK1A 3LYPA 4MZWA 3HJMA 4FIWA 2C3NA 4GSSA 2VL2C 4FYCA 3EMPA 3FZ4A 5DALA 5IQYA 3FYGA 3G7YA 2LRTA 3F4RA 1H4OA 1ILOA 3GL5A 3F6FA 2JSYA 2R37A 5ECRB 3DIEA 1ST9A 2FWEA 5HR3A 2OE0A 1QMVA 4XTSA 2VCWA 3TDGA 2DJ3A 1PMTA 3HHVA 4PQHA 5F06A 5F8BA 2KP1A 4I8BA 1A0FA 4TXOB 4ZB6A 5GZZB 2DJ1A 2IJYA 5C00A 1X0RA 5COHA 5CRDA 1TDIA 4XCSA 1ON4A 1S3DA 1TP9A 1JLVA 3IC8A 4PUAA 2RM6A 3HZ8A 2Z9SA 3EU3A 5G31A 3BD2A 4GRFA 4Q5QA 3DVWA 4POLA 1ERUA 1TK8B 2KHPA 4HQZA 1VF4A 4KSOA 1EGRA 13GSA 4F9ZA 3L9SA 1YZXA 1TK5B 1EEJA 2LJAA 2VLVA 5GSSA 3CXGA 4G0KA 1QK8A 3QCPA 2OA7A 5HR2A 5CO3A 2PN8A 5DBQA 1MTCA 4HQSA 4KCEA 2FNOA 4LMWA 1XVQA 2GSRA 3KH7A 4OO5A 1XW6A 3FZ5A 3VURA 4KB3A 1PN9A 1UVZA 2HFDA 4NXIA 2HZEA 1IYHA 1FOVA 4HZ2A 1U6TA 2PVOC 1FW1A 3FRCA 1Y6EA 3HVSA 4XS6A 3GH9A 2PPTA 2BMXA 3IOSA 1SJZA 3C73A 4BPYA 5KN0A 1ML6A 1R7HA 1AC1A 4HU7A 1XFLA 2VD0A 2CZ3A 5IM9A 2WRTA 5DAKB 1WOUA 2MBSA 2VLTA 2VUPA 4G19A 2RIIA 3VWUA 2H72A 1QXHA 4Q5RA 5IOXA 4J57E 3N9JA 4WBRD 2LV3A 3I43A 3PH9A 3QAWA 2V41A 2PVQA 2E0QA 2CVBA 2HSYA 14GSA 1TI1A 2J23A 2RUFA 3CSJA 1DE1A 1R5AA 1W4VA 1WP0A 2O87A 1GRXA 3EWLA 3A2VA 2HLSA 3E9JB 2H19A 5HFIA 3Q18A 2O8VB 2ALBA 2IL3A 4GLTA 4PGTA 3L4NA 3D0ZA 2QKEA 1TU8A 1XXUA 4ULXA 4V1Ap 3PPUA 1OVNA 1THOA 2GQKA 1XW9A 5J5NA 2VCZA 2OE3A 2V2GA 5F0GA 3A2WA 4IS0A 2DLXA 2H0HA 3ZREA 4OFMA 4ML1A 4WBJA 3WGXA 4KDYA 2IN3A 2FHEA 4WEYA 4HI7A 5IPHA 5AGYA 2C0GA 3VI5A 4YH2A 3KP8A 2X8HA 5JWQB 4PX1A 1PSQA 1T3BA 1O85A 3KJYA 2JU5A 3DMLA 1XBSA 1YDKA 1Z7RA 4BWSA 1F3BA 5G5FA 1YKCA 3BCIA 3IBHA 4HOJA 3DYRA 1M7TA 2XBQA 3WD6A 1SJIA 3KMNA 5DALB 3J7Yb 4MZCA 4ID0A 5IMZA 3O6TA 1WE0A 2O89A 3UAPA 2WDUA 3W6GA 2O7KA 3W8JA 1OE8A 4BL7B 3UIWA 2H6ZA 3GTUA 3GX8A 2IMDA 2IPAA 2HSMA 2OACA 6GSYA 3A3TA 2FCHA 3TOTA 2YWOA 3EMXA 2V32A 4HUAA 1K3YA 3RHCA 3O76A 2AHEA 2WCIA 2HRKA 4KDUA 4NHWA 2YZHA 22GSA 3D22A 4ECCA 3QPMA 2JADA 3AY8A 5JCGA 2P5RA 2ZNMA 1Y25A 5ECSA 3I9V2 1FG4A 1URMA 4K2DA 1XVWA 2K18A 4KGIA 2RLIA 1JZOA 5D96A 2H01A 4MP4A 2FA8A 5G1LA 1AXDA 4RQRA 5CNWA 2DC5A 2FUG2 4KCAA 2YJ7A 1SKRB 6GSVA 4WR4A 1TI3A 1GSFA 1WPIA 2FWFA 1G7OA 2VOCA 2K6VA 3FR9A 4G9HA 2LJKA 1T4ZA 3P2AA 1DUGA 2MMNA 1K0NA 4L0UA 11GSA 4TR3A 4HDEA 3TCOA 4PQ1A 4EDZA 4QQ7A 4OFTA 3UOMA 1R26A 2LRCA 5GAND 1SL1B 4ACSA 3IK7A 2HZEB 2V6KA 2WZ9A 2KLXA 5B8AA 3CYNA 3KXOA 1XIYA 1WIKA 3HDCA 3QAVA 1M0UA 4MH3A 3DRNA 2EIRA 3C1SA 5CYYA 3D21A 1SYXA 1SD8A 1Q98A 4OWYA 1HNAA 1GLQA 2IWTA 2CQ9A 1O81A 2HRAA 1V9WA 4JU5A 6GSWA 4NMUA 4EE0A 3VPQA 2AUVA 2HSNB 4XS4A 4OFNA 4WF4A 1AW9A 3M9KA 2C0FA 2YCDA 3D4MA 1T4YA 5AIXA 2X64A 2IMFA 3BJ5A 3IXRA 1T7PB 4TXVA 4LL4B 2C3TA 4KNDA 2LTKA 3LGCA 5EVOA 2PBJA 4DSQA 4X0XA 3C7MA 3ZLPA 1R5PA 1XOAA 3HZ4A 1GTAA 3LQ7A 5INYA 2JZSA 4BWQA 2F8AA 2YOIA 1AUCA 4MDCA 4MCUA 5H5RA 2RUEA 2H74A 2C0DA 3NIVA 5JCWA 3RDWA 1BQ7A 6GSXA 5B6MA 1A8LA 3FY7A 3IAM2 2XC2A 1TJDA 3EC3A 3ZIVA 1EP7A 2H73A 1U3AA 2DSAA 4K9ZA 3RBTA 2C3QA 4POKA 2WFCA 1NSWA 5IO2A 1F9MA 1SU9A 1FHEA 4ISDA 2B5EA 4IVFA 3ZTLA 2RM5A 4XHMA 2HRFA 2B5XA 3KEBA 3QAGA 1NW2A 3G7IA 3IR4A 2L4QA 2DJ0A 1B9XC 4JBBA 1HD2A 3MAKA 4F82A 3FW2A 1A23A 2GS3A 1MDKA 1G6YA 4KH7A 5J41A 4HS1A 2PMTA 5H5QA 3ZZXA 2YNXA 2MMZA 4O7HA 3H8QA 5KN2A 1EEMA 1MDJA 5E59A 2HSMB 3APSA 5HFGA 2H6XA 4LLRA 1GSUA 2CV4A 2M46A 2VCTA 2C0EA 1M9BA 1ZGNA 2CT6A 2DMLA 4MH2A 2ON5A 2HRKB 3F0IA 2I9HA 3KH9A 3WGDA 2OKAA 1KBNA 5ECKB 1M2DA 4JE1A 2HSHA 4FO5A 3R2QA 1PD21 3QOUA 4MMMA 3HXSA 1QQ2A 1VGLA 4K0GA 3CRTA 4IW9A 1OC9A 2QC7A 2A2SA 1S3CA 1SJ6A 2L57A 5D93A 2WJUA 3Q6OA 2DJ2A 3FR3A 2YANA 5G2ZA 2CAQA 1A2LA 3HCZA 2L59A 5CREA 2GSQA 3PGTA 5IPGA 3IC4A 2TRCP 4V2MA 1OYJA 1UC7A 3QD9A 3LXTA 1GL8A 3LXZA 2PU9C 4HEA2 4EDYA 3U5RE 4MJEA 2L6DA 3UJ1A 2GLRA 2IIYA 4DSSA 1V40A 4H86A 4ZXGA 2FY6A 5HFKA 5G5EA 2FGXA 2TIRA 1GSDA 1XWCA 5ECPB 1RW1A 3J7Yk 2UZ8A 2OE1A 2FLSA 4JRRA 1A8YA 4QL9A 2NTOA 4EO3A 3K8NA 1F2EA 2L6CA 5D9VA 1QGVA 3DGQA 1SKWB 2H66A 3E0UA 1A0RP 1RQMA 3DWVA 1FB0A 2NDOA 1T1VA 2K8SA 1K3OA 3HD5A 1EGOA 1MD4A 2N5AA 2PGTA 1KTEA 4XS4B 1VF3A 3GKKA 2YV7A 1ERTA 4TOPA 4OCFA 4IN0A 5B6NA 3WT1A 5A5KA 1ZOFA 3IAS2 1JZDA 3BCKA 4ZL8A 4YAVA 3LEFA 4N10A 2LQOA 3HJOA 4MPFA 3H93A 1F37A 5FWGA 1HQOA 3ERWA 1E6BA 4ILFA 8GSSA 1J0FA 3FK8A 1M9AA 2LQQA 3MDKA 1UA5A 2AB6A 1M2AA 2P0GA 3TB2A 1NHOA 1QFNA 4MF6A 3ISOA 4PURA 2YJHA 1ACVA 1O6JA 4GWRA 4L0WA 5HR0A 2IFQA 1BAYA 4KDXA 5CRGA 4NV5A 3TRQA 1F6MC 2VIMA 2WGRA 3W8SA 5F05A 2R6KA 1GH2A 3ERGA 4JR6A 1GWCA 3GYKA 4E8EA 4I2UA 4O5RA 4PUFC 2GTUA 3KD0A 18GSA 4MF5A 1XWKA 2HI7A 1XCCA 3SWLA 1SD9A 1PKWA 1K0AA 1J08A 4V1Ag 1SK0A 3C1RA 4BVXA 3V1WA 3TKRA 3C8EA 5EY6A 1Z6MA 1B9YC 5D73A 2OBKA 4KX4A 3VK9A 4NV2A 4JR4A 3GSSA 5BMUA 4Q5NA 3EVIA 1Q4JA 4ZBAA 3TJGA 2J9HA 4ZB8A 2F3MA 1PX6A 2NBSA 3MWHA 3TRXA 3LJRA 2NPBA 3KMOA 3WT2A 2KUCA 2DJKA 2YZUA 4YQUA 1X9SB 2TRXA 5AISA 5G30A 1H75A 2LRNA 1O8XA 3P90A 2BTOT 2V6OA 1N2AA 1JLWA 4WXTA 3TJFA 2MMAA 4HJMA 3UEMA 2PUKC 5ELAA 1A2JA 3EE2A 2FWGA 2JZRA 2N5FA 4ECBA 1OC9B 2LNTA 5D9WA 1X9MB 4IELA 3E3EA 6GSTA 1PRXA 4CW9A 1AQWA 2GSTA 1DBYA 5AN1A 4EUYA 1OAZA 2VM1A 2HNLA 3TKQA 2VCXA 3H1NA 5A4UA 2VL9A 2B6MA 1A2MA 4IJ3A 3LWAA 2EIOA 4ZL7A 4POMA 1UN2A 3IRAA 1F3AA 3JCML 2B3SA 4EXJA 5A4WA 4YAPA 4DEJA 5LCZA 1YF0A 3M0FA 5DCGA 2I3YA 1OE7A 4MF7A 5JWOB 4DSSB 3GUSA 4AJ8A 1PGTA 4KW6A 3LG6A 5CAXA 1BYEA 5ABRA 3GX0A 3LFLA 1JZRA 2JL4A 3GV1A 3WYWA 4ZBBA 1ZZYA 4MJCA 3S9FA 4KA0A 1XPVA 4KAEA 3BBYA 5DQSA 1ZCPA 2ES7A 3Q74A 2GZPA 5KN1A 5D9TA 3GH6A 3F4SA 3D5JA 4QL7A 1TOFA 2GZZA 4GSTA 1U87A 1K0MA 2H1GA 1DSBA 3HJPA 3GHAA 2VCQA 1FO5A 1SENA 3OR5A 5ECOB 1O7UA 4LMVA 2DIYA 5FHIA 1KNGA 4L8EA 4E8HA 3BOAA 2R3XA 1X5DA 3F4TA 2CZ2A 1ZYEA 3IK9A 2M80A 3TKPA 1K0BA 5ELGA 5ECHB 3M1GA 5IOWA 2P31A 4FQUA 3CTFA 2XPDA 3GIXA 3GKNA 1TRUA 4NHZA 1E2YA 2HE3A 4HZ4A 2H75A 3O3TA 2N5BA 3UBKA 2VL3A 3CMIA 3TJKA 4NAXA 2B5YA 4V2NA 1XW5A 3DXBA 2H70A 3ZMLA 1V57A 3ME7A 2IFQB 5KEJA 3I6AA 2LJRA 4I6XA 2REMA 1USBA 1B4PA 3IDVA 2LS5A 4I97A 4WKWA 2VM2A 3QDNA 4RUVA 3F3RA 1GUHA 5JWRB 5HR1A 3NOFA 1PX7A 1ERWA 2IMEA 1GNEA 16GSA 1AAZA 1ZL9A 1ERVA 2NVLA 2AAWA 1TTZA 1XOBA 5D8IA 4IP1A 2H1BA 4BVXB 1TRVA 2XBIA 1FAAA 4YQVA 4POBA 1CQGA 2H30A 3HKRA 2K9FA 1EOHA 1O73A 4XIHA 1ZYQB 1OKTA 3TOUA 1BX9A 1FVKA 1YF1A 2DBCA 4G0LA 3M8NA 2HZFA 3H4KA 4EVMA 4WF5A 2YPMA 2GVPA 4TR1A 5DQYA 1QUWA 1YY7A 4AGSA 1JHBA 3APOA 1ZMAA 4HU9A 3GNJA 2HQTA 4ECIA 1JFUA 4NWYA 2DIZA 3IV4A 4N0VA 3F8UA
chains in the Genus database with same CATH superfamily
1BJXA 2MMOA 3HYPA 3L9VA 1SL0B 4IJIA 2I4AA 4JEDA 4TR4A 1WJKA 1OC8A 3GTUB 4TW5A 4IP6A 2B7KA 5A4VA 5KOXA 1T00A 1S3AA 1KEBA 1X9WB 1AQVA 4G2EA 2E2MA 5GSTA 4F03A 5J4UA 4DVCA 3US3A 3L9UA 5AIVA 1A24A 3HVVA 1EWXA 3QFBC 5J40A 2JZTA 4TR0A 1GTUA 4IQAA 4OCEA 3GL3A 2H8LA 3GN3A 5J4YA 3ZRDA 5J3RA 1G0TA 1PFOA 4ZBDA 4ZIJA 3C71A 2F8FA 2WVZA 6GSUA 4N3ZA 3UARA 4BL7A 4FYBA 2WB9A 2WVXA 1I5GA 3RPPA 4K8MA 2VLUA 2F51A 1XWGA 4PQIA 2AV4A 4NPBA 2C80A 1Z6NA 1VF2A 3CSHA 2D2ZA 1LJRA 3M3MA 4IKHA 1BEDA 2MYGA 3GSTA 1GTIA 4JZQA 2L4CA 3KM6A 1Z7PA 4GSNA 2L5OA 1VF1A 3G7JA 2X8CA 3IPZA 4A5PA 2LUSA 1YJ6A 3LSZA 1WMJA 1YEPA 3HY2A 3TRPA 2CAIA 4K7OA 2A4VA 1LU4A 3ZFLA 2CX4A 3KIJA 3RAZA 3UVTA 3GKMA 2LNSA 3PINA 5B8BA 3ZL5A 2DMMA 5LD0A 4ECJA 3EU4A 2C4JA 5DDLA 1EP8A 4K7IA 2EFHA 4AJ7A 4MJBA 1RK4A 2GGTA 5ECNB 5F07A 2XHFA 3LORA 3N5OA 1M2BA 4KSMA 5JCUA 5H5SA 4BIKA 1N25A 4RI6A 1JZWA 1EV9A 2DKIA 2O3EA 4WETA 2ON7A 3DKSA 3IE3A 2LEGA 1GSYA 1TK0B 4WR5A 1O8WA 4YKFA 3I69A 3FR6A 2X4AA 1HNCA 4O92A 4G10A 3MNGA 2LSTA 2OADA 1VRSD 3A5WA 2KOKA 19GSA 2R2JA 4O32A 3GFKA 5L71A 1AIUA 5IO0A 1LBKA 5CRWA 3MSZA 4PTSA 3EYTA 3RHBA 2H1AA 3UL3A 1B4QA 4EC0A 4FYUA 1PL2A 2I81A 1MD3A 1GUKA 4K0NA 1DE2A 1WWJA 5IMFA 3CSIA 4X4JA 5DJLA 4AJ6A 1GSEA 2HRNA 2PWJA 1K0DA 4HJ2A 4EKZA 3GA4A 1GUMA 4RQXA 3D6IA 4KUNA 3P7XA 4N0ZA 2ZCTA 3APQA 2HT9A 1YQ1A 4ZILA 1SL2B 1GLPA 4YQMA 2EIQA 4X43A 3FZ9A 3KP9A 4EF0A 1EZKA 3G9BA 5IMVA 3DEXA 3U6VA 1TXXA 2KP2A 4TR1B 2CA8A 4GQCA 3RFRC 4Z7XA 5IMAA 1X5CA 4YKGA 2GSSA 4KF9A 2H76A 4F0CA 5ECQB 2M72A 4TKYA 5ECLB 5A34B 2YP6A 2B1LA 3P8WA 3VWVA 3QMXA 4EIQA 1BG5A 3F6DA 5J9CA 2K8VA 1K3LA 2FD3A 2WULA 4D73A 1GSSA 4IQ1A 1OKDA 4GCIA 2PERA 1T8EB 2B1KA 1V58A 3F3QA 3WGEA 4Z2TA 4PNFA 4TVEA 1WRYA 2C8UA 4K6XA 5ID2A 2V1MA 3IHQA 1NM3A 2L5LA 1YEXA 4J56E 5IMDA 5C04A 2VO4A 1HNBA 1FVJA 4TRXA 1GNWA 3GURA 4AKIA 4PNGA 4K7NA 1R4WA 3TJJA 4XRAA 2HXKA 2XPEA 2CVDA 4BVYA 1XZOA 1FB6A 17GSA 3Q19A 2EC4A 2OBIA 1MDIA 1XWAA 2GQLA 1GULA 4ML6A 1OC3A 1GSQA 4GXZA 3RGBC 1N8JA 2WVXB 3M9JA 1PQNA 4E68A 1G6WA 5ECIB 2IMIA 1YEWC 2CX3A 2X99A 4AKHA 3TGZA 1MEKA 3FZAA 4GQFA 3ZITA 3KGKA 4OMVA 1W89A 2YWIA 2F9SA 2EFEA 4MJAA 3CRUA 3RPNA 2IMKA 4X1UA 3VPTA 2EFCA 2E2GA 1CQHA 3KZQA 4IHUA 3VWWA 3F63A 1SK2A 1M99A 4L5OA 3HVNA 5FT3A 4Q5FA 2G2QA 4TXOA 4XS1A 2YWMA 3ZMKA 2R0GA 1TW9A 2P5QA 1TRSA 4KE3A 3FHKA 3EINA 3NZNA 4F2IA 2MBTA 2R5GA 3QR6A 2G0FA 3TKSA 20GSA 2B7JA 1ABAA 4AI6A 2YWNA 4TN8A 2GT6A 3FEUA 4F0BA 5IMCA 5ECMB 4N11A 2VL2A 1U88A 2DJJA 10GSA 4MPGA 2GT5A 1X5EA 3SBCA 5GAPD 4J2FA 5LNKe 2A4HA 2OT3A 1IYIA 3L78A 4N30A 4OO4A 3UVHA 2WW3A 3VFIA 1U3IA 2JACA 3TUEA 5J9BA 1Z5YE 3KTBA 3EURA 3ZVJA 4EL1A 3KCMA 5DJMA 4K1FA 2JSZA 2C1YA 1I9DA 2A2RA 2LKUA 3ME8A 2AJQB 2YV9A 3GRXA 1THXA 4GF0A 3TJBA 3GKXA 5B7CA 1J9BA 1PKZA 1Z3EA 1TU7A 2H6YA 5EL8A 3MIXA 1B8XA 1V2AA 4G0IA 4K5SA 4MA9A 3QFAC 3LYKA 3H79A 3A2XA 4FH8A 3ZFBA 4MLYA 3VWXA 2ZUPA 2O85A 2QGVA 3UBLA 2X8GA 2H0IA 3FKFA 1Z9HA 1EV4A 5A5HA 1V98A 5DAKA 2R4VA 4LA1A 3ZVJD 4PI2C 4LL1B 3GMFA 4MK3A 4XRDA 1K0CA 1YKAA 1SKSB 3ERFA 1K0OA 3HA9A 4BA7A 2MZCA 2FWHA 3R3EA 7GSSA 4OD7A 5CP1A 1SYRA 4CHSA 5CRHA 4ZB9A 1SVOA 4ZL9A 2DKHA 5IIZA 2FA4A 2WS2A 1PA3A 2QSIA 5E4WA 3ED3A 12GSA 1NHYA 4P3YB 1GP1A 2AYTA 2VAFA 1C72A 2HYXA 3IA1A 1S3RA 1TKDB 4USSA 5DVBA 1TRWA 5D9XA 5ENUA 2CVKA 4D73B 5G1KA 3IHGA 3ZIJA 4Z2RA 3PR8A 4ICYA 2GDRA 4PXOA 2H71A 3DVXA 4CDOA 4IGJA 5HQPA 4V2LA 2H1DA 2H1LA 1G7EA 5ID2B 4IBPA 3HVXA 2GZYA 5DCHA 3UMAA 4DSRA 4MZBA 3ZYWA 4GTUA 5KN3A 4MABA 4AF2A 1HYUA 1B48A 6GSSA 9GSSA 3DD3A 3TKSE 3VLNA 1EOGA 1AQXA 3VI7A 3D4TA 3F9UA 3KTLA 1GTBA 5EPFA 2YN1A 3CBUA 4BVYB 4I2TA 4RI7A 3TKSC 2H0GA 2BJXA 1PL1A 1XWBA 2E7PA 4I5QA 2GQMA 2VD1A 4L5LA 3L0HA 3CTGA 2I1UA 2OJLA 2VCVA 1SK1A 3LYPA 4MZWA 3HJMA 4FIWA 2C3NA 4ZB7A 4GSSA 2VL2C 4FYCA 3EMPA 3FZ4A 5DALA 5IQYA 3FYGA 3G7YA 2LRTA 3F4RA 1SVLA 4QMKA 1H4OA 1ILOA 3GL5A 3F6FA 2JSYA 2R37A 5ECRB 3DIEA 1ST9A 2FWEA 5HR3A 2OE0A 1QMVA 4XTSA 2VCWA 3TDGA 2DJ3A 1PMTA 3HHVA 1S4BP 4PQHA 5F06A 5F8BA 2KP1A 4I8BA 1A0FA 4TXOB 4ZB6A 5GZZB 2A2PA 2QA2A 2DJ1A 2IJYA 5C00A 1X0RA 5COHA 5CRDA 1TDIA 4XCSA 1ON4A 1S3DA 1TP9A 1JLVA 3IC8A 4PUAA 2RM6A 3HZ8A 2Z9SA 3EU3A 5G31A 3BD2A 4GRFA 4Q5QA 3DVWA 4POLA 1ERUA 1TK8B 2KHPA 4HQZA 1VF4A 4KSOA 1EGRA 13GSA 4F9ZA 3L9SA 1YZXA 1TK5B 1EEJA 2LJAA 2VLVA 5GSSA 3CXGA 4G0KA 1QK8A 3QCPA 2OA7A 5HR2A 5CO3A 2PN8A 5DBQA 1MTCA 4HQSA 4KCEA 2FNOA 4LMWA 1XVQA 2GSRA 3KH7A 4OO5A 1XW6A 3FZ5A 3VURA 4KB3A 1PN9A 1UVZA 2HFDA 4NXIA 2HZEA 1IYHA 1FOVA 4HZ2A 1U6TA 2PVOC 1FW1A 3FRCA 1Y6EA 3HVSA 4XS6A 3GH9A 2PPTA 2VKZG 2BMXA 3IOSA 1SJZA 3C73A 4BPYA 5KN0A 1ML6A 1R7HA 1AC1A 4HU7A 1XFLA 2VD0A 2CZ3A 5IM9A 2HSNA 2WRTA 5DAKB 1WOUA 2MBSA 2VLTA 2VUPA 4G19A 2RIIA 3VWUA 2H72A 1QXHA 2WW0A 4Q5RA 5IOXA 4J57E 3N9JA 4WBRD 2LV3A 3I43A 3PH9A 3QAWA 2V41A 2PVQA 2E0QA 2CVBA 2HSYA 14GSA 1TI1A 2J23A 2RUFA 3CSJA 1DE1A 1R5AA 1W4VA 1WP0A 2O87A 1GRXA 3EWLA 3A2VA 2HLSA 3E9JB 2H19A 5HFIA 3Q18A 2O8VB 2ALBA 2IL3A 4GLTA 4PGTA 3L4NA 3D0ZA 2QKEA 1TU8A 1XXUA 4ULXA 4V1Ap 3PPUA 5BRTA 1OVNA 1THOA 2GQKA 3A5IA 1XW9A 5J5NA 2VCZA 2OE3A 2V2GA 5F0GA 3A2WA 4IS0A 2DLXA 2H0HA 2R0CA 3ZREA 4OFMA 4ML1A 4WBJA 3WGXA 4KDYA 2IN3A 2FHEA 4WEYA 4HI7A 5IPHA 5AGYA 2C0GA 3VI5A 4YH2A 3EPTA 3KP8A 2WZSA 2X8HA 5JWQB 4PX1A 1PSQA 1T3BA 1O85A 3KJYA 2JU5A 3DMLA 1XBSA 1YDKA 1Z7RA 4BWSA 1F3BA 5G5FA 1YKCA 3BCIA 3IBHA 4CY8A 4HOJA 3DYRA 1M7TA 2XBQA 3WD6A 1SJIA 3KMNA 5DALB 3J7Yb 4MZCA 4ID0A 5IMZA 3O6TA 1WE0A 2O89A 3UAPA 2WDUA 3W6GA 3MYDA 2O7KA 3W8JA 1OE8A 4BL7B 3UIWA 2H6ZA 3GTUA 3GX8A 2IMDA 2IPAA 2HSMA 1XG8A 2OACA 6GSYA 3A3TA 2FCHA 3TOTA 2YWOA 3EMXA 2V32A 4HUAA 1K3YA 3RHCA 3O76A 2AHEA 4Z2UA 2WCIA 2HRKA 4KDUA 4NHWA 2YZHA 22GSA 3D22A 4ECCA 3QPMA 2JADA 3AY8A 5JCGA 2P5RA 2ZNMA 1Y25A 5ECSA 3I9V2 1FG4A 1URMA 1TXUA 4K2DA 1XVWA 2K18A 4KGIA 2RLIA 1JZOA 2WVYA 5D96A 2H01A 4MP4A 2FA8A 5G1LA 1AXDA 4RQRA 5CNWA 2DC5A 2FUG2 4KCAA 2YJ7A 1SKRB 6GSVA 4WR4A 1TI3A 2O36A 1GSFA 1WPIA 2FWFA 1G7OA 2VOCA 2K6VA 3FR9A 4G9HA 2LJKA 1T4ZA 3P2AA 1DUGA 2MMNA 1K0NA 4L0UA 11GSA 4TR3A 4HDEA 3TCOA 4PQ1A 4EDZA 4QQ7A 4OFTA 3UOMA 1R26A 2LRCA 5GAND 1SL1B 4ACSA 3IK7A 2HZEB 2V6KA 2WZ9A 2KLXA 5B8AA 3CYNA 3KXOA 1XIYA 1WIKA 3HDCA 3QAVA 1M0UA 4MH3A 3DRNA 2EIRA 3C1SA 5CYYA 5A1NA 3D21A 1SYXA 1SD8A 1Q98A 4OWYA 1HNAA 1GLQA 2IWTA 2CQ9A 1O81A 2HRAA 1V9WA 4JU5A 6GSWA 4NMUA 4EE0A 3VPQA 2AUVA 2HSNB 4XS4A 4OFNA 4WF4A 1AW9A 3M9KA 2C0FA 2YCDA 3D4MA 1T4YA 5AIXA 2X64A 2IMFA 3BJ5A 3IXRA 1T7PB 4TXVA 4LL4B 2C3TA 4KNDA 4AKXB 2LTKA 3LGCA 5EVOA 2PBJA 4DSQA 2WW1A 4X0XA 3C7MA 3ZLPA 1R5PA 1XOAA 3HZ4A 1GTAA 3LQ7A 5INYA 2JZSA 4BWQA 2F8AA 2YOIA 1AUCA 4MDCA 1PN0A 4MCUA 5H5RA 2RUEA 2H74A 2C0DA 3NIVA 5JCWA 3RDWA 1BQ7A 6GSXA 5B6MA 1A8LA 3FY7A 4MNNA 3IAM2 2XC2A 1TJDA 3EC3A 3ZIVA 1EP7A 2H73A 1U3AA 2DSAA 4K9ZA 3RBTA 2C3QA 4POKA 1M3JA 2WFCA 1NSWA 5IO2A 1F9MA 1SU9A 1FHEA 4ISDA 2B5EA 4IVFA 3ZTLA 2RM5A 4XHMA 2HRFA 2X49A 2B5XA 4GDFA 3KEBA 3QAGA 1NW2A 3G7IA 1M3IA 3IR4A 2L4QA 2DJ0A 1B9XC 4JBBA 1HD2A 3MAKA 4F82A 3FW2A 1A23A 2GS3A 1MDKA 1G6YA 4KH7A 5J41A 4HS1A 2PMTA 5H5QA 3ZZXA 2YNXA 2MMZA 4O7HA 3H8QA 5KN2A 1EEMA 1MDJA 5E59A 2HSMB 3APSA 3CWGA 5HFGA 2H6XA 4LLRA 1GSUA 2CV4A 2M46A 2VCTA 2C0EA 1M9BA 1ZGNA 1SVMA 2CT6A 2DMLA 4MH2A 2ON5A 2HRKB 3F0IA 2I9HA 3KH9A 3WGDA 2OKAA 1KBNA 5ECKB 1M2DA 4JE1A 2HSHA 4FO5A 3R2QA 2QA1A 1PD21 3QOUA 4MMMA 3HXSA 1QQ2A 1VGLA 4K0GA 3CRTA 4IW9A 1OC9A 2QC7A 2A2SA 1S3CA 1SJ6A 2L57A 5D93A 2WJUA 3Q6OA 2DJ2A 3FR3A 2YANA 5G2ZA 2CAQA 1A2LA 3HCZA 2L59A 5CREA 1Y1UA 2GSQA 3PGTA 5IPGA 3IC4A 2TRCP 4V2MA 4W66A 1OYJA 1UC7A 3FMWA 3QD9A 3LXTA 1GL8A 3LXZA 2PU9C 4HEA2 4EDYA 3U5RE 3LW9A 2L6DA 4MJEA 3UJ1A 2GLRA 2IIYA 4DSSA 1V40A 4H86A 4FXYP 4ZXGA 1ZYNA 2FY6A 1YVLA 5G5EA 5HFKA 3TU3B 2FGXA 2TIRA 1GSDA 1XWCA 5ECPB 1RW1A 3J7Yk 2UZ8A 2OE1A 2FLSA 4JRRA 1A8YA 4QL9A 2NTOA 4EO3A 3K8NA 1F2EA 5A1NB 2L6CA 5D9VA 1QGVA 3DGQA 1SKWB 2H66A 3E0UA 1A0RP 1RQMA 3DWVA 4O5QA 1FB0A 2NDOA 1T1VA 2K8SA 1K3OA 3HD5A 1EGOA 1MD4A 2N5AA 2PGTA 1KTEA 4XS4B 1VF3A 3GKKA 2YV7A 1ERTA 4TOPA 4OCFA 4IN0A 5B6NA 3WT1A 5A5KA 1ZOFA 3IAS2 2UV8G 1JZDA 3BCKA 4ZL8A 4YAVA 3LEFA 4N10A 2LQOA 3HJOA 4MPFA 3H93A 1F37A 5A5HB 5FWGA 1HQOA 3ERWA 1E6BA 4ILFA 8GSSA 1J0FA 3FK8A 1M9AA 2LQQA 3MDKA 1UA5A 2AB6A 1M2AA 2P0GA 3TB2A 1NHOA 1QFNA 4MF6A 3ISOA 4PURA 2YJHA 1ACVA 1O6JA 4GWRA 4L0WA 5HR0A 2IFQA 1BAYA 4KDXA 5CRGA 4CY6A 4NV5A 3TRQA 1F6MC 2VIMA 2WGRA 3W8SA 5F05A 2R6KA 1GH2A 3ERGA 4JR6A 1GWCA 3GYKA 3CHXC 4E8EA 4I2UA 4O5RA 4PUFC 2GTUA 3KD0A 18GSA 4MF5A 1XWKA 2HI7A 1XCCA 3SWLA 1SD9A 1PKWA 1K0AA 1FOHA 1J08A 4V1Ag 2R0PA 1SK0A 3C1RA 4BVXA 3V1WA 5J47A 3TKRA 3CQFA 3C8EA 5EY6A 2EFDA 1Z6MA 1B9YC 5D73A 2OBKA 4KX4A 3VK9A 4NV2A 4JR4A 3GSSA 5BMUA 4Q5NA 3EVIA 1Q4JA 4ZBAA 3TJGA 2J9HA 4ZB8A 2F3MA 1PX6A 2NBSA 3MWHA 3TRXA 3LJRA 2NPBA 3KMOA 3WT2A 2KUCA 2DJKA 2YZUA 4YQUA 1X9SB 2TRXA 5AISA 5G30A 1H75A 2LRNA 1O8XA 3P90A 2BTOT 2V6OA 1N2AA 1JLWA 4WXTA 3TJFA 2MMAA 4HJMA 3UEMA 2PUKC 5KOWA 5ELAA 1ZYPA 1A2JA 3EE2A 2FWGA 2JZRA 2N5FA 4ECBA 1OC9B 4K2XA 2LNTA 5D9WA 1X9MB 4IELA 3E3EA 6GSTA 1PRXA 4CW9A 1AQWA 2GSTA 1DBYA 5AN1A 4EUYA 1OAZA 4K5RA 2VM1A 2HNLA 3TKQA 2VCXA 3H1NA 5A4UA 2VL9A 2B6MA 1A2MA 4IJ3A 3LWAA 2EIOA 4ZL7A 4POMA 1UN2A 3IRAA 3HMJG 1F3AA 3JCML 2B3SA 4EXJA 5A4WA 4YAPA 4DEJA 5LCZA 1YF0A 3M0FA 5DCGA 2I3YA 1OE7A 4MF7A 1BG1A 5JWOB 5J4VA 4DSSB 3GUSA 4AJ8A 1PGTA 4KW6A 4AKGA 3LG6A 5CAXA 1BYEA 5ABRA 3GX0A 3LFLA 1JZRA 2JL4A 3GV1A 1I1IP 3WYWA 4ZBBA 1ZZYA 4MJCA 3S9FA 4KA0A 1XPVA 4KAEA 2O5VA 3BBYA 5DQSA 1ZCPA 4O5UA 2ES7A 3Q74A 2GZPA 5KN1A 5D9TA 3GH6A 3F4SA 3D5JA 4QL7A 1TOFA 2GZZA 4GSTA 1U87A 1K0MA 2H1GA 1DSBA 3HJPA 3GHAA 2VCQA 1FO5A 2WW2A 1SENA 3OR5A 5ECOB 1O7UA 4LMVA 2DIYA 5FHIA 1KNGA 4L8EA 4G01A 4E8HA 3BOAA 2R3XA 1X5DA 3F4TA 4EIPA 2CZ2A 1ZYEA 3IK9A 2M80A 3TKPA 1K0BA 5ELGA 5ECHB 3M1GA 5IOWA 2P31A 4FQUA 3CTFA 2XPDA 3GIXA 3GKNA 1TRUA 4NHZA 1E2YA 2HE3A 4HZ4A 2H75A 4PI0C 3O3TA 2N5BA 3UBKA 2VL3A 3CMIA 3TJKA 4NAXA 2B5YA 4V2NA 1XW5A 3DXBA 2H70A 3ZMLA 1V57A 3ME7A 2IFQB 5KEJA 3I6AA 2LJRA 4I6XA 2REMA 1USBA 1B4PA 3IDVA 2LS5A 4I97A 4WKWA 2VM2A 3QDNA 4RUVA 3F3RA 1GUHA 5JWRB 5HR1A 3NOFA 1PX7A 1ERWA 2IMEA 1GNEA 16GSA 1BF5A 1AAZA 4PHZC 1ZL9A 1ERVA 2NVLA 2AAWA 1TTZA 1XOBA 5D8IA 4IP1A 2H1BA 4BVXB 1TRVA 2XBIA 1FAAA 4YQVA 4POBA 1CQGA 2H30A 3HKRA 5BMUB 2K9FA 1EOHA 1O73A 4XIHA 1ZYQB 1OKTA 3TOUA 1BX9A 1FVKA 1YF1A 2DBCA 4G0LA 3M8NA 2HZFA 3H4KA 4EVMA 4WF5A 2YPMA 2GVPA 4TR1A 5DQYA 1QUWA 1YY7A 4AGSA 1JHBA 3APOA 1ZMAA 4HU9A 3GNJA 2HQTA 4ECIA 1JFUA 4NWYA 2DIZA 3IV4A 5A34A 4N0VA 3F8UA 4HSCX
chains in the Genus database with same CATH topology
1BJXA 2MMOA 3HYPA 3L9VA 1SL0B 4IJIA 2I4AA 4JEDA 4TR4A 1WJKA 1OC8A 3GTUB 4TW5A 4IP6A 2B7KA 5A4VA 5KOXA 1T00A 1S3AA 1KEBA 1X9WB 1AQVA 4G2EA 2E2MA 5GSTA 4F03A 5J4UA 4DVCA 3US3A 3L9UA 5AIVA 1A24A 3HVVA 1EWXA 3QFBC 5J40A 2JZTA 4TR0A 1GTUA 4IQAA 4OCEA 3GL3A 2H8LA 3GN3A 5J4YA 3ZRDA 5J3RA 1G0TA 4ZBDA 4ZIJA 3C71A 2F8FA 6GSUA 4N3ZA 3UARA 4BL7A 4FYBA 2WB9A 1I5GA 3RPPA 4K8MA 2VLUA 2F51A 1XWGA 4PQIA 2AV4A 4NPBA 2C80A 1Z6NA 1VF2A 3CSHA 2D2ZA 1LJRA 3M3MA 4IKHA 1BEDA 2MYGA 3GSTA 1GTIA 4JZQA 2L4CA 3KM6A 1Z7PA 4GSNA 2L5OA 1VF1A 3G7JA 2X8CA 3IPZA 4A5PA 2LUSA 1YJ6A 3LSZA 1WMJA 1YEPA 3HY2A 3TRPA 2CAIA 4K7OA 2A4VA 1LU4A 3ZFLA 2CX4A 3KIJA 3RAZA 3UVTA 3GKMA 2LNSA 3PINA 5B8BA 3ZL5A 2DMMA 5LD0A 4ECJA 3EU4A 2C4JA 5DDLA 1EP8A 4K7IA 2EFHA 4AJ7A 4MJBA 1RK4A 2GGTA 5ECNB 5F07A 2XHFA 3LORA 3N5OA 1M2BA 4KSMA 5JCUA 5H5SA 1N25A 4RI6A 1JZWA 1EV9A 2DKIA 4WETA 2ON7A 3DKSA 3IE3A 2LEGA 1GSYA 1TK0B 4WR5A 1O8WA 4YKFA 3I69A 3FR6A 2X4AA 1HNCA 4O92A 4G10A 3MNGA 2LSTA 2OADA 1VRSD 3A5WA 2KOKA 19GSA 2R2JA 4O32A 3GFKA 5L71A 1AIUA 5IO0A 1LBKA 5CRWA 3MSZA 4PTSA 3EYTA 3RHBA 2H1AA 3UL3A 1B4QA 4EC0A 4FYUA 1PL2A 2I81A 1MD3A 1GUKA 4K0NA 1DE2A 1WWJA 5IMFA 3CSIA 4X4JA 5DJLA 4AJ6A 1GSEA 2HRNA 2PWJA 1K0DA 4HJ2A 4EKZA 3GA4A 1GUMA 4RQXA 3D6IA 4KUNA 3P7XA 4N0ZA 2ZCTA 3APQA 2HT9A 1YQ1A 4ZILA 1SL2B 1GLPA 4YQMA 2EIQA 4X43A 3FZ9A 3KP9A 4EF0A 1EZKA 3G9BA 5IMVA 3DEXA 3U6VA 1TXXA 2KP2A 4TR1B 2CA8A 4GQCA 4Z7XA 5IMAA 1X5CA 4YKGA 2GSSA 4KF9A 2H76A 4F0CA 5ECQB 2M72A 4TKYA 5ECLB 5A34B 2YP6A 2B1LA 3P8WA 3VWVA 3QMXA 4EIQA 1BG5A 3F6DA 5J9CA 2K8VA 1K3LA 2FD3A 2WULA 4D73A 1GSSA 4IQ1A 1OKDA 4GCIA 2PERA 1T8EB 2B1KA 1V58A 3F3QA 3WGEA 4Z2TA 4PNFA 4TVEA 1WRYA 2C8UA 4K6XA 5ID2A 2V1MA 3IHQA 1NM3A 2L5LA 1YEXA 4J56E 5IMDA 5C04A 2VO4A 1HNBA 1FVJA 4TRXA 1GNWA 3GURA 4AKIA 4PNGA 4K7NA 1R4WA 3TJJA 4XRAA 2HXKA 2XPEA 2CVDA 4BVYA 1XZOA 1FB6A 17GSA 3Q19A 2EC4A 2OBIA 1MDIA 1XWAA 2GQLA 1GULA 4ML6A 1OC3A 1GSQA 4GXZA 1N8JA 3M9JA 1PQNA 4E68A 1G6WA 5ECIB 2IMIA 2CX3A 2X99A 4AKHA 3TGZA 1MEKA 3FZAA 4GQFA 3ZITA 3KGKA 4OMVA 1W89A 2YWIA 2F9SA 2EFEA 4MJAA 3CRUA 3RPNA 2IMKA 4X1UA 3VPTA 2EFCA 2E2GA 1CQHA 3KZQA 4IHUA 3VWWA 3F63A 1SK2A 1M99A 4L5OA 5FT3A 4Q5FA 2G2QA 4TXOA 4XS1A 2YWMA 3ZMKA 2R0GA 1TW9A 2P5QA 1TRSA 4KE3A 3FHKA 3EINA 3NZNA 4F2IA 2MBTA 2R5GA 3QR6A 2G0FA 3TKSA 20GSA 2B7JA 1ABAA 4AI6A 2YWNA 4TN8A 2GT6A 3FEUA 4F0BA 5IMCA 5ECMB 4N11A 2VL2A 1U88A 2DJJA 10GSA 4MPGA 2GT5A 1X5EA 3SBCA 5GAPD 4J2FA 5LNKe 2A4HA 2OT3A 1IYIA 3L78A 4N30A 4OO4A 3UVHA 3VFIA 1U3IA 2JACA 3TUEA 5J9BA 1Z5YE 3KTBA 3EURA 3ZVJA 4EL1A 3KCMA 5DJMA 4K1FA 2JSZA 2C1YA 1I9DA 2A2RA 2LKUA 3ME8A 2AJQB 2YV9A 3GRXA 1THXA 4GF0A 3TJBA 3GKXA 5B7CA 1J9BA 1PKZA 1Z3EA 1TU7A 2H6YA 5EL8A 3MIXA 1B8XA 1V2AA 4G0IA 4K5SA 4MA9A 3QFAC 3LYKA 3H79A 3A2XA 4FH8A 3ZFBA 4MLYA 3VWXA 2ZUPA 2O85A 2QGVA 3UBLA 2X8GA 2H0IA 3FKFA 1Z9HA 1EV4A 5A5HA 1V98A 5DAKA 2R4VA 4LA1A 3ZVJD 4LL1B 3GMFA 4MK3A 4XRDA 1K0CA 1YKAA 1SKSB 3ERFA 1K0OA 3HA9A 4BA7A 2MZCA 2FWHA 3R3EA 7GSSA 4OD7A 5CP1A 1SYRA 4CHSA 5CRHA 4ZB9A 1SVOA 4ZL9A 2DKHA 5IIZA 2FA4A 2WS2A 1PA3A 2QSIA 5E4WA 3ED3A 12GSA 1NHYA 4P3YB 1GP1A 2AYTA 2VAFA 1C72A 2HYXA 3IA1A 1TKDB 4USSA 5DVBA 1TRWA 5D9XA 5ENUA 2CVKA 4D73B 5G1KA 3IHGA 3ZIJA 4Z2RA 3PR8A 4ICYA 2GDRA 4PXOA 2H71A 3DVXA 4CDOA 4IGJA 5HQPA 4V2LA 2H1DA 2H1LA 1G7EA 5ID2B 4IBPA 3HVXA 2GZYA 5DCHA 3UMAA 4DSRA 4MZBA 3ZYWA 4GTUA 5KN3A 4MABA 4AF2A 1HYUA 1B48A 6GSSA 9GSSA 3DD3A 3TKSE 3VLNA 1EOGA 1AQXA 3VI7A 3D4TA 3F9UA 3KTLA 1GTBA 5EPFA 2YN1A 3CBUA 4BVYB 4I2TA 4RI7A 3TKSC 2H0GA 2BJXA 1PL1A 1XWBA 2E7PA 4I5QA 2GQMA 2VD1A 4L5LA 3L0HA 3CTGA 2I1UA 2OJLA 2VCVA 1SK1A 3LYPA 4MZWA 3HJMA 4FIWA 2C3NA 4ZB7A 4GSSA 2VL2C 4FYCA 3EMPA 3FZ4A 5DALA 5IQYA 3FYGA 3G7YA 2LRTA 3F4RA 1SVLA 4QMKA 1H4OA 1ILOA 3GL5A 3F6FA 2JSYA 2R37A 5ECRB 3DIEA 1ST9A 2FWEA 5HR3A 2OE0A 1QMVA 4XTSA 2VCWA 3TDGA 2DJ3A 1PMTA 3HHVA 4PQHA 5F06A 5F8BA 2KP1A 4I8BA 1A0FA 4TXOB 4ZB6A 5GZZB 2A2PA 2QA2A 2DJ1A 2IJYA 5C00A 1X0RA 5COHA 5CRDA 1TDIA 4XCSA 1ON4A 1S3DA 1TP9A 1JLVA 3IC8A 4PUAA 2RM6A 3HZ8A 2Z9SA 3EU3A 5G31A 3BD2A 4GRFA 4Q5QA 3DVWA 4POLA 1ERUA 1TK8B 2KHPA 4HQZA 1VF4A 4KSOA 1EGRA 13GSA 4F9ZA 3L9SA 1YZXA 1TK5B 1EEJA 2LJAA 2VLVA 5GSSA 3CXGA 4G0KA 1QK8A 3QCPA 2OA7A 5HR2A 5CO3A 2PN8A 5DBQA 1MTCA 4HQSA 4KCEA 2FNOA 4LMWA 1XVQA 2GSRA 3KH7A 4OO5A 1XW6A 3FZ5A 3VURA 4KB3A 1PN9A 1UVZA 2HFDA 4NXIA 2HZEA 1IYHA 1FOVA 4HZ2A 1U6TA 2PVOC 1FW1A 3FRCA 1Y6EA 3HVSA 4XS6A 3GH9A 2PPTA 2VKZG 2BMXA 3IOSA 1SJZA 3C73A 4BPYA 5KN0A 1ML6A 1R7HA 1AC1A 4HU7A 1XFLA 2VD0A 2CZ3A 5IM9A 2HSNA 2WRTA 5DAKB 1WOUA 2MBSA 2VLTA 2VUPA 4G19A 2RIIA 3VWUA 2H72A 1QXHA 4Q5RA 5IOXA 4J57E 3N9JA 4WBRD 2LV3A 3I43A 3PH9A 3QAWA 2V41A 2PVQA 2E0QA 2CVBA 2HSYA 14GSA 1TI1A 2J23A 2RUFA 3CSJA 1DE1A 1R5AA 1W4VA 1WP0A 2O87A 1GRXA 3EWLA 3A2VA 2HLSA 3E9JB 2H19A 5HFIA 3Q18A 2O8VB 2ALBA 2IL3A 4GLTA 4PGTA 3L4NA 3D0ZA 2QKEA 1TU8A 1XXUA 4ULXA 4V1Ap 3PPUA 5BRTA 1OVNA 1THOA 2GQKA 3A5IA 1XW9A 5J5NA 2VCZA 2OE3A 2V2GA 5F0GA 3A2WA 4IS0A 2DLXA 2H0HA 2R0CA 3ZREA 4OFMA 4ML1A 4WBJA 3WGXA 4KDYA 2IN3A 2FHEA 4WEYA 4HI7A 5IPHA 5AGYA 2C0GA 3VI5A 4YH2A 3EPTA 3KP8A 2X8HA 5JWQB 4PX1A 1PSQA 1T3BA 1O85A 3KJYA 2JU5A 3DMLA 1XBSA 1YDKA 1Z7RA 4BWSA 1F3BA 5G5FA 1YKCA 3BCIA 3IBHA 4CY8A 4HOJA 3DYRA 1M7TA 2XBQA 3WD6A 1SJIA 3KMNA 5DALB 3J7Yb 4MZCA 4ID0A 5IMZA 3O6TA 1WE0A 2O89A 3UAPA 2WDUA 3W6GA 3MYDA 2O7KA 3W8JA 1OE8A 4BL7B 3UIWA 2H6ZA 3GTUA 3GX8A 2IMDA 2IPAA 2HSMA 2OACA 6GSYA 3A3TA 2FCHA 3TOTA 2YWOA 3EMXA 2V32A 4HUAA 1K3YA 3RHCA 3O76A 2AHEA 4Z2UA 2WCIA 2HRKA 4KDUA 4NHWA 2YZHA 22GSA 3D22A 4ECCA 3QPMA 2JADA 3AY8A 5JCGA 2P5RA 2ZNMA 1Y25A 5ECSA 3I9V2 1FG4A 1URMA 1TXUA 4K2DA 1XVWA 2K18A 4KGIA 2RLIA 1JZOA 5D96A 2H01A 4MP4A 2FA8A 5G1LA 1AXDA 4RQRA 5CNWA 2DC5A 2FUG2 4KCAA 2YJ7A 1SKRB 6GSVA 4WR4A 1TI3A 1GSFA 1WPIA 2FWFA 1G7OA 2VOCA 2K6VA 3FR9A 4G9HA 2LJKA 1T4ZA 3P2AA 1DUGA 2MMNA 1K0NA 4L0UA 11GSA 4TR3A 4HDEA 3TCOA 4PQ1A 4EDZA 4QQ7A 4OFTA 3UOMA 1R26A 2LRCA 5GAND 1SL1B 4ACSA 3IK7A 2HZEB 2V6KA 2WZ9A 2KLXA 5B8AA 3CYNA 3KXOA 1XIYA 1WIKA 3HDCA 3QAVA 1M0UA 4MH3A 3DRNA 2EIRA 3C1SA 5CYYA 5A1NA 3D21A 1SYXA 1SD8A 1Q98A 4OWYA 1HNAA 1GLQA 2IWTA 2CQ9A 1O81A 2HRAA 1V9WA 4JU5A 6GSWA 4NMUA 4EE0A 3VPQA 2AUVA 2HSNB 4XS4A 4OFNA 4WF4A 1AW9A 3M9KA 2C0FA 2YCDA 3D4MA 1T4YA 5AIXA 2X64A 2IMFA 3BJ5A 3IXRA 1T7PB 4TXVA 4LL4B 2C3TA 4KNDA 4AKXB 2LTKA 3LGCA 5EVOA 2PBJA 4DSQA 4X0XA 3C7MA 3ZLPA 1R5PA 1XOAA 3HZ4A 1GTAA 3LQ7A 5INYA 2JZSA 4BWQA 2F8AA 2YOIA 1AUCA 4MDCA 1PN0A 4MCUA 5H5RA 2RUEA 2H74A 2C0DA 3NIVA 5JCWA 3RDWA 1BQ7A 6GSXA 5B6MA 1A8LA 3FY7A 4MNNA 3IAM2 2XC2A 1TJDA 3EC3A 3ZIVA 1EP7A 2H73A 1U3AA 2DSAA 4K9ZA 3RBTA 2C3QA 4POKA 2WFCA 1NSWA 5IO2A 1F9MA 1SU9A 1FHEA 4ISDA 2B5EA 4IVFA 3ZTLA 2RM5A 4XHMA 2HRFA 2X49A 2B5XA 4GDFA 3KEBA 3QAGA 1NW2A 3G7IA 3IR4A 2L4QA 2DJ0A 1B9XC 4JBBA 1HD2A 3MAKA 4F82A 3FW2A 1A23A 2GS3A 1MDKA 1G6YA 4KH7A 5J41A 4HS1A 2PMTA 5H5QA 3ZZXA 2YNXA 2MMZA 4O7HA 3H8QA 5KN2A 1EEMA 1MDJA 5E59A 2HSMB 3APSA 3CWGA 5HFGA 2H6XA 4LLRA 1GSUA 2CV4A 2M46A 2VCTA 2C0EA 1M9BA 1ZGNA 1SVMA 2CT6A 2DMLA 4MH2A 2ON5A 2HRKB 3F0IA 2I9HA 3KH9A 3WGDA 2OKAA 1KBNA 5ECKB 1M2DA 4JE1A 2HSHA 4FO5A 3R2QA 2QA1A 1PD21 3QOUA 4MMMA 3HXSA 1QQ2A 1VGLA 4K0GA 3CRTA 4IW9A 1OC9A 2QC7A 2A2SA 1S3CA 1SJ6A 2L57A 5D93A 2WJUA 3Q6OA 2DJ2A 3FR3A 2YANA 5G2ZA 2CAQA 1A2LA 3HCZA 2L59A 5CREA 1Y1UA 2GSQA 3PGTA 5IPGA 3IC4A 2TRCP 4V2MA 4W66A 1OYJA 1UC7A 3FMWA 3QD9A 3LXTA 1GL8A 3LXZA 2PU9C 4HEA2 4EDYA 3U5RE 3LW9A 2L6DA 4MJEA 3UJ1A 2GLRA 2IIYA 4DSSA 1V40A 4H86A 4ZXGA 1ZYNA 2FY6A 1YVLA 5G5EA 5HFKA 3TU3B 2FGXA 2TIRA 1GSDA 1XWCA 5ECPB 1RW1A 3J7Yk 2UZ8A 2OE1A 2FLSA 4JRRA 1A8YA 4QL9A 2NTOA 4EO3A 3K8NA 1F2EA 5A1NB 2L6CA 5D9VA 1QGVA 3DGQA 1SKWB 2H66A 3E0UA 1A0RP 1RQMA 3DWVA 4O5QA 1FB0A 2NDOA 1T1VA 2K8SA 1K3OA 3HD5A 1EGOA 1MD4A 2N5AA 2PGTA 1KTEA 4XS4B 1VF3A 3GKKA 2YV7A 1ERTA 4TOPA 4OCFA 4IN0A 5B6NA 3WT1A 5A5KA 1ZOFA 3IAS2 2UV8G 1JZDA 3BCKA 4ZL8A 4YAVA 3LEFA 4N10A 2LQOA 3HJOA 4MPFA 3H93A 1F37A 5A5HB 5FWGA 1HQOA 3ERWA 1E6BA 4ILFA 8GSSA 1J0FA 3FK8A 1M9AA 2LQQA 3MDKA 1UA5A 2AB6A 1M2AA 2P0GA 3TB2A 1NHOA 1QFNA 4MF6A 3ISOA 4PURA 2YJHA 1ACVA 1O6JA 4GWRA 4L0WA 5HR0A 2IFQA 1BAYA 4KDXA 5CRGA 4CY6A 4NV5A 3TRQA 1F6MC 2VIMA 2WGRA 3W8SA 5F05A 2R6KA 1GH2A 3ERGA 4JR6A 1GWCA 3GYKA 4E8EA 4I2UA 4O5RA 4PUFC 2GTUA 3KD0A 18GSA 4MF5A 1XWKA 2HI7A 1XCCA 3SWLA 1SD9A 1PKWA 1K0AA 1FOHA 1J08A 4V1Ag 2R0PA 1SK0A 3C1RA 4BVXA 3V1WA 5J47A 3TKRA 3C8EA 5EY6A 2EFDA 1Z6MA 1B9YC 5D73A 2OBKA 4KX4A 3VK9A 4NV2A 4JR4A 3GSSA 5BMUA 4Q5NA 3EVIA 1Q4JA 4ZBAA 3TJGA 2J9HA 4ZB8A 2F3MA 1PX6A 2NBSA 3MWHA 3TRXA 3LJRA 2NPBA 3KMOA 3WT2A 2KUCA 2DJKA 2YZUA 4YQUA 1X9SB 2TRXA 5AISA 5G30A 1H75A 2LRNA 1O8XA 3P90A 2BTOT 2V6OA 1N2AA 1JLWA 4WXTA 3TJFA 2MMAA 4HJMA 3UEMA 2PUKC 5KOWA 5ELAA 1ZYPA 1A2JA 3EE2A 2FWGA 2JZRA 2N5FA 4ECBA 1OC9B 4K2XA 2LNTA 5D9WA 1X9MB 4IELA 3E3EA 6GSTA 1PRXA 4CW9A 1AQWA 2GSTA 1DBYA 5AN1A 4EUYA 1OAZA 4K5RA 2VM1A 2HNLA 3TKQA 2VCXA 3H1NA 5A4UA 2VL9A 2B6MA 1A2MA 4IJ3A 3LWAA 2EIOA 4ZL7A 4POMA 1UN2A 3IRAA 3HMJG 1F3AA 3JCML 2B3SA 4EXJA 5A4WA 4YAPA 4DEJA 5LCZA 1YF0A 3M0FA 5DCGA 2I3YA 1OE7A 4MF7A 1BG1A 5JWOB 5J4VA 4DSSB 3GUSA 4AJ8A 1PGTA 4KW6A 4AKGA 3LG6A 5CAXA 1BYEA 5ABRA 3GX0A 3LFLA 1JZRA 2JL4A 3GV1A 3WYWA 4ZBBA 1ZZYA 4MJCA 3S9FA 4KA0A 1XPVA 4KAEA 2O5VA 3BBYA 5DQSA 1ZCPA 4O5UA 2ES7A 3Q74A 2GZPA 5KN1A 5D9TA 3GH6A 3F4SA 3D5JA 4QL7A 1TOFA 2GZZA 4GSTA 1U87A 1K0MA 2H1GA 1DSBA 3HJPA 3GHAA 2VCQA 1FO5A 1SENA 3OR5A 5ECOB 1O7UA 4LMVA 2DIYA 5FHIA 1KNGA 4L8EA 4G01A 4E8HA 3BOAA 2R3XA 1X5DA 3F4TA 4EIPA 2CZ2A 1ZYEA 3IK9A 2M80A 3TKPA 1K0BA 5ELGA 5ECHB 3M1GA 5IOWA 2P31A 4FQUA 3CTFA 2XPDA 3GIXA 3GKNA 1TRUA 4NHZA 1E2YA 2HE3A 4HZ4A 2H75A 3O3TA 2N5BA 3UBKA 2VL3A 3CMIA 3TJKA 4NAXA 2B5YA 4V2NA 1XW5A 3DXBA 2H70A 3ZMLA 1V57A 3ME7A 2IFQB 5KEJA 3I6AA 2LJRA 4I6XA 2REMA 1USBA 1B4PA 3IDVA 2LS5A 4I97A 4WKWA 2VM2A 3QDNA 4RUVA 3F3RA 1GUHA 5JWRB 5HR1A 3NOFA 1PX7A 1ERWA 2IMEA 1GNEA 16GSA 1BF5A 1AAZA 1ZL9A 1ERVA 2NVLA 2AAWA 1TTZA 1XOBA 5D8IA 4IP1A 2H1BA 4BVXB 1TRVA 2XBIA 1FAAA 4YQVA 4POBA 1CQGA 2H30A 3HKRA 5BMUB 2K9FA 1EOHA 1O73A 4XIHA 1ZYQB 1OKTA 3TOUA 1BX9A 1FVKA 1YF1A 2DBCA 4G0LA 3M8NA 2HZFA 3H4KA 4EVMA 4WF5A 2YPMA 2GVPA 4TR1A 5DQYA 1QUWA 1YY7A 4AGSA 1JHBA 3APOA 1ZMAA 4HU9A 3GNJA 2HQTA 4ECIA 1JFUA 4NWYA 2DIZA 3IV4A 5A34A 4N0VA 3F8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJX A;  2MMO A;  3HYP A;  3L9V A;  1SL0 B;  4IJI A;  2I4A A;  4JED A;  4TR4 A;  1WJK A;  1OC8 A;  3GTU B;  4TW5 A;  4IP6 A;  2B7K A;  5A4V A;  1T00 A;  1S3A A;  1KEB A;  1X9W B;  1AQV A;  4G2E A;  2E2M A;  5GST A;  4F03 A;  5J4U A;  4DVC A;  3US3 A;  3L9U A;  5AIV A;  1A24 A;  3HVV A;  1EWX A;  3QFB C;  2JZT A;  4TR0 A;  1GTU A;  4IQA A;  4OCE A;  3GL3 A;  2H8L A;  3GN3 A;  3ZRD A;  5J3R A;  1G0T A;  4ZBD A;  4ZIJ A;  3C71 A;  2F8F A;  6GSU A;  3UAR A;  4BL7 A;  4FYB A;  2WB9 A;  1I5G A;  3RPP A;  4K8M A;  2VLU A;  2F51 A;  1XWG A;  4PQI A;  2AV4 A;  4NPB A;  2C80 A;  1Z6N A;  1VF2 A;  3CSH A;  2D2Z A;  1LJR A;  3M3M A;  4IKH A;  1BED A;  2MYG A;  3GST A;  1GTI A;  4JZQ A;  2L4C A;  3KM6 A;  1Z7P A;  4GSN A;  2L5O A;  1VF1 A;  3G7J A;  2X8C A;  3IPZ A;  2LUS A;  1YJ6 A;  3LSZ A;  1WMJ A;  1YEP A;  3HY2 A;  3TRP A;  2CAI A;  4K7O A;  2A4V A;  1LU4 A;  3ZFL A;  2CX4 A;  3KIJ A;  3RAZ A;  3UVT A;  3GKM A;  2LNS A;  3PIN A;  5B8B A;  3ZL5 A;  2DMM A;  5LD0 A;  4ECJ A;  3EU4 A;  2C4J A;  5DDL A;  1EP8 A;  4K7I A;  4AJ7 A;  4MJB A;  1RK4 A;  2GGT A;  5ECN B;  5F07 A;  2XHF A;  3LOR A;  3N5O A;  1M2B A;  4KSM A;  5JCU A;  5H5S A;  4RI6 A;  1JZW A;  1EV9 A;  4WET A;  2ON7 A;  3DKS A;  3IE3 A;  2LEG A;  1GSY A;  1TK0 B;  4WR5 A;  1O8W A;  3I69 A;  3FR6 A;  1HNC A;  4O92 A;  4G10 A;  3MNG A;  2LST A;  2OAD A;  1VRS D;  3A5W A;  2KOK A;  19GS A;  2R2J A;  4O32 A;  3GFK A;  5L71 A;  1AIU A;  5IO0 A;  1LBK A;  5CRW A;  3MSZ A;  4PTS A;  3EYT A;  3RHB A;  2H1A A;  3UL3 A;  1B4Q A;  4EC0 A;  4FYU A;  1PL2 A;  2I81 A;  1MD3 A;  1GUK A;  4K0N A;  1DE2 A;  1WWJ A;  5IMF A;  3CSI A;  5DJL A;  4AJ6 A;  1GSE A;  2HRN A;  2PWJ A;  1K0D A;  4HJ2 A;  4EKZ A;  3GA4 A;  1GUM A;  4RQX A;  3D6I A;  4KUN A;  3P7X A;  4N0Z A;  2ZCT A;  3APQ A;  2HT9 A;  1YQ1 A;  4ZIL A;  1SL2 B;  1GLP A;  4YQM A;  2EIQ A;  4X43 A;  3FZ9 A;  3KP9 A;  4EF0 A;  1EZK A;  3G9B A;  5IMV A;  3DEX A;  3U6V A;  1TXX A;  2KP2 A;  4TR1 B;  2CA8 A;  4GQC A;  4Z7X A;  5IMA A;  1X5C A;  2GSS A;  4KF9 A;  2H76 A;  4F0C A;  5ECQ B;  2M72 A;  4TKY A;  5ECL B;  2YP6 A;  2B1L A;  3P8W A;  3VWV A;  3QMX A;  1BG5 A;  3F6D A;  5J9C A;  2K8V A;  1K3L A;  2FD3 A;  2WUL A;  4D73 A;  1GSS A;  4IQ1 A;  1OKD A;  4GCI A;  2PER A;  1T8E B;  2B1K A;  1V58 A;  3F3Q A;  3WGE A;  4PNF A;  4TVE A;  1WRY A;  2C8U A;  4K6X A;  5ID2 A;  2V1M A;  3IHQ A;  1NM3 A;  2L5L A;  1YEX A;  4J56 E;  5IMD A;  5C04 A;  2VO4 A;  1HNB A;  1FVJ A;  4TRX A;  1GNW A;  3GUR A;  4PNG A;  4K7N A;  1R4W A;  3TJJ A;  4XRA A;  2HXK A;  2XPE A;  2CVD A;  4BVY A;  1XZO A;  1FB6 A;  17GS A;  3Q19 A;  2EC4 A;  2OBI A;  1MDI A;  1XWA A;  2GQL A;  1GUL A;  4ML6 A;  1OC3 A;  1GSQ A;  4GXZ A;  1N8J A;  3M9J A;  1PQN A;  1G6W A;  5ECI B;  2IMI A;  2CX3 A;  2X99 A;  3TGZ A;  1MEK A;  3FZA A;  4GQF A;  3ZIT A;  3KGK A;  4OMV A;  1W89 A;  2YWI A;  2F9S A;  4MJA A;  3CRU A;  3RPN A;  2IMK A;  4X1U A;  3VPT A;  2E2G A;  1CQH A;  3KZQ A;  4IHU A;  3VWW A;  3F63 A;  1SK2 A;  1M99 A;  4L5O A;  5FT3 A;  4Q5F A;  2G2Q A;  4TXO A;  4XS1 A;  2YWM A;  3ZMK A;  1TW9 A;  2P5Q A;  1TRS A;  4KE3 A;  3FHK A;  3EIN A;  3NZN A;  4F2I A;  2MBT A;  2R5G A;  3QR6 A;  2G0F A;  3TKS A;  20GS A;  2B7J A;  1ABA A;  2YWN A;  4TN8 A;  2GT6 A;  3FEU A;  4F0B A;  5IMC A;  5ECM B;  4N11 A;  2VL2 A;  1U88 A;  2DJJ A;  10GS A;  4MPG A;  2GT5 A;  1X5E A;  3SBC A;  5GAP D;  4J2F A;  5LNK e;  1IYI A;  3L78 A;  4N30 A;  4OO4 A;  3UVH A;  3VFI A;  1U3I A;  2JAC A;  3TUE A;  5J9B A;  1Z5Y E;  3KTB A;  3EUR A;  3ZVJ A;  4EL1 A;  3KCM A;  5DJM A;  4K1F A;  2JSZ A;  2C1Y A;  1I9D A;  2A2R A;  2LKU A;  3ME8 A;  2AJQ B;  2YV9 A;  3GRX A;  1THX A;  4GF0 A;  3TJB A;  3GKX A;  5B7C A;  1J9B A;  1PKZ A;  1Z3E A;  1TU7 A;  2H6Y A;  5EL8 A;  1B8X A;  4G0I A;  1V2A A;  4MA9 A;  3QFA C;  3LYK A;  3H79 A;  3A2X A;  4FH8 A;  3ZFB A;  4MLY A;  3VWX A;  2ZUP A;  2O85 A;  2QGV A;  3UBL A;  2X8G A;  2H0I A;  3FKF A;  1Z9H A;  1EV4 A;  1V98 A;  5DAK A;  2R4V A;  4LA1 A;  3ZVJ D;  4LL1 B;  3GMF A;  4MK3 A;  4XRD A;  1K0C A;  1YKA A;  1SKS B;  3ERF A;  1K0O A;  3HA9 A;  4BA7 A;  2MZC A;  2FWH A;  3R3E A;  7GSS A;  4OD7 A;  5CP1 A;  1SYR A;  4CHS A;  5CRH A;  4ZB9 A;  4ZL9 A;  5IIZ A;  2FA4 A;  2WS2 A;  1PA3 A;  2QSI A;  5E4W A;  3ED3 A;  12GS A;  1NHY A;  4P3Y B;  1GP1 A;  2AYT A;  2VAF A;  1C72 A;  2HYX A;  3IA1 A;  1TKD B;  4USS A;  5DVB A;  1TRW A;  5D9X A;  5ENU A;  2CVK A;  4D73 B;  5G1K A;  3ZIJ A;  3PR8 A;  2GDR A;  4PXO A;  2H71 A;  3DVX A;  4CDO A;  4IGJ A;  5HQP A;  4V2L A;  2H1D A;  1G7E A;  5ID2 B;  4IBP A;  3HVX A;  2GZY A;  5DCH A;  3UMA A;  4DSR A;  4MZB A;  3ZYW A;  4GTU A;  5KN3 A;  4MAB A;  4AF2 A;  1HYU A;  1B48 A;  6GSS A;  9GSS A;  3DD3 A;  3TKS E;  3VLN A;  1EOG A;  1AQX A;  3VI7 A;  3D4T A;  3F9U A;  3KTL A;  1GTB A;  5EPF A;  2YN1 A;  3CBU A;  4BVY B;  4I2T A;  4RI7 A;  3TKS C;  2H0G A;  2BJX A;  1PL1 A;  1XWB A;  2E7P A;  4I5Q A;  2GQM A;  2VD1 A;  4L5L A;  3L0H A;  3CTG A;  2I1U A;  2OJL A;  2VCV A;  1SK1 A;  3LYP A;  4MZW A;  3HJM A;  4FIW A;  2C3N A;  4GSS A;  2VL2 C;  4FYC A;  3EMP A;  3FZ4 A;  5DAL A;  5IQY A;  3FYG A;  3G7Y A;  2LRT A;  3F4R A;  1H4O A;  1ILO A;  3GL5 A;  3F6F A;  2JSY A;  2R37 A;  5ECR B;  3DIE A;  1ST9 A;  2FWE A;  5HR3 A;  2OE0 A;  1QMV A;  4XTS A;  2VCW A;  3TDG A;  2DJ3 A;  1PMT A;  3HHV A;  4PQH A;  5F06 A;  5F8B A;  2KP1 A;  4I8B A;  1A0F A;  4TXO B;  4ZB6 A;  5GZZ B;  2DJ1 A;  2IJY A;  5C00 A;  1X0R A;  5COH A;  5CRD A;  1TDI A;  4XCS A;  1ON4 A;  1S3D A;  1TP9 A;  1JLV A;  3IC8 A;  4PUA A;  2RM6 A;  3HZ8 A;  2Z9S A;  3EU3 A;  5G31 A;  3BD2 A;  4GRF A;  4Q5Q A;  3DVW A;  4POL A;  1ERU A;  1TK8 B;  2KHP A;  4HQZ A;  1VF4 A;  4KSO A;  1EGR A;  13GS A;  4F9Z A;  3L9S A;  1YZX A;  1TK5 B;  1EEJ A;  2LJA A;  2VLV A;  5GSS A;  3CXG A;  4G0K A;  1QK8 A;  3QCP A;  2OA7 A;  5HR2 A;  5CO3 A;  2PN8 A;  5DBQ A;  1MTC A;  4HQS A;  4KCE A;  2FNO A;  4LMW A;  1XVQ A;  2GSR A;  3KH7 A;  4OO5 A;  1XW6 A;  3FZ5 A;  3VUR A;  4KB3 A;  1PN9 A;  1UVZ A;  2HFD A;  4NXI A;  2HZE A;  1IYH A;  1FOV A;  4HZ2 A;  1U6T A;  2PVO C;  1FW1 A;  3FRC A;  1Y6E A;  3HVS A;  4XS6 A;  3GH9 A;  2PPT A;  2BMX A;  3IOS A;  1SJZ A;  3C73 A;  4BPY A;  5KN0 A;  1ML6 A;  1R7H A;  1AC1 A;  4HU7 A;  1XFL A;  2VD0 A;  2CZ3 A;  5IM9 A;  2WRT A;  5DAK B;  1WOU A;  2MBS A;  2VLT A;  2VUP A;  4G19 A;  2RII A;  3VWU A;  2H72 A;  1QXH A;  4Q5R A;  5IOX A;  4J57 E;  3N9J A;  4WBR D;  2LV3 A;  3I43 A;  3PH9 A;  3QAW A;  2V41 A;  2PVQ A;  2E0Q A;  2CVB A;  2HSY A;  14GS A;  1TI1 A;  2J23 A;  2RUF A;  3CSJ A;  1DE1 A;  1R5A A;  1W4V A;  1WP0 A;  2O87 A;  1GRX A;  3EWL A;  3A2V A;  2HLS A;  3E9J B;  2H19 A;  5HFI A;  3Q18 A;  2O8V B;  2ALB A;  2IL3 A;  4GLT A;  4PGT A;  3L4N A;  3D0Z A;  2QKE A;  1TU8 A;  1XXU A;  4ULX A;  4V1A p;  3PPU A;  1OVN A;  1THO A;  2GQK A;  1XW9 A;  5J5N A;  2VCZ A;  2OE3 A;  2V2G A;  5F0G A;  3A2W A;  4IS0 A;  2DLX A;  2H0H A;  3ZRE A;  4OFM A;  4ML1 A;  4WBJ A;  3WGX A;  4KDY A;  2IN3 A;  2FHE A;  4WEY A;  4HI7 A;  5IPH A;  5AGY A;  2C0G A;  3VI5 A;  4YH2 A;  3KP8 A;  2X8H A;  5JWQ B;  4PX1 A;  1PSQ A;  1T3B A;  1O85 A;  3KJY A;  2JU5 A;  3DML A;  1XBS A;  1YDK A;  1Z7R A;  4BWS A;  1F3B A;  5G5F A;  1YKC A;  3BCI A;  3IBH A;  4HOJ A;  3DYR A;  1M7T A;  2XBQ A;  3WD6 A;  1SJI A;  3KMN A;  5DAL B;  3J7Y b;  4MZC A;  4ID0 A;  5IMZ A;  3O6T A;  1WE0 A;  2O89 A;  3UAP A;  2WDU A;  3W6G A;  2O7K A;  3W8J A;  1OE8 A;  4BL7 B;  3UIW A;  2H6Z A;  3GTU A;  3GX8 A;  2IMD A;  2IPA A;  2HSM A;  2OAC A;  6GSY A;  3A3T A;  2FCH A;  3TOT A;  2YWO A;  3EMX A;  2V32 A;  4HUA A;  1K3Y A;  3RHC A;  3O76 A;  2AHE A;  2WCI A;  2HRK A;  4KDU A;  4NHW A;  2YZH A;  22GS A;  3D22 A;  4ECC A;  3QPM A;  2JAD A;  3AY8 A;  5JCG A;  2P5R A;  2ZNM A;  1Y25 A;  5ECS A;  3I9V 2;  1FG4 A;  1URM A;  4K2D A;  1XVW A;  2K18 A;  4KGI A;  2RLI A;  1JZO A;  5D96 A;  2H01 A;  4MP4 A;  2FA8 A;  5G1L A;  1AXD A;  4RQR A;  5CNW A;  2DC5 A;  2FUG 2;  4KCA A;  2YJ7 A;  1SKR B;  6GSV A;  4WR4 A;  1TI3 A;  1GSF A;  1WPI A;  2FWF A;  1G7O A;  2VOC A;  2K6V A;  3FR9 A;  4G9H A;  2LJK A;  1T4Z A;  3P2A A;  1DUG A;  2MMN A;  1K0N A;  4L0U A;  11GS A;  4TR3 A;  4HDE A;  3TCO A;  4PQ1 A;  4EDZ A;  4QQ7 A;  4OFT A;  3UOM A;  1R26 A;  2LRC A;  5GAN D;  1SL1 B;  4ACS A;  3IK7 A;  2HZE B;  2V6K A;  2WZ9 A;  2KLX A;  5B8A A;  3CYN A;  3KXO A;  1XIY A;  1WIK A;  3HDC A;  3QAV A;  1M0U A;  4MH3 A;  3DRN A;  2EIR A;  3C1S A;  5CYY A;  3D21 A;  1SYX A;  1SD8 A;  1Q98 A;  4OWY A;  1HNA A;  1GLQ A;  2IWT A;  2CQ9 A;  1O81 A;  2HRA A;  1V9W A;  4JU5 A;  6GSW A;  4NMU A;  4EE0 A;  3VPQ A;  2AUV A;  2HSN B;  4XS4 A;  4OFN A;  4WF4 A;  1AW9 A;  3M9K A;  2C0F A;  2YCD A;  3D4M A;  1T4Y A;  5AIX A;  2X64 A;  2IMF A;  3BJ5 A;  3IXR A;  1T7P B;  4TXV A;  4LL4 B;  2C3T A;  4KND A;  2LTK A;  3LGC A;  5EVO A;  2PBJ A;  4DSQ A;  4X0X A;  3C7M A;  3ZLP A;  1R5P A;  1XOA A;  3HZ4 A;  1GTA A;  3LQ7 A;  5INY A;  2JZS A;  4BWQ A;  2F8A A;  2YOI A;  1AUC A;  4MDC A;  4MCU A;  5H5R A;  2RUE A;  2H74 A;  2C0D A;  3NIV A;  5JCW A;  3RDW A;  1BQ7 A;  6GSX A;  5B6M A;  1A8L A;  3FY7 A;  3IAM 2;  2XC2 A;  1TJD A;  3EC3 A;  3ZIV A;  1EP7 A;  2H73 A;  1U3A A;  2DSA A;  4K9Z A;  3RBT A;  2C3Q A;  4POK A;  2WFC A;  1NSW A;  5IO2 A;  1F9M A;  1SU9 A;  1FHE A;  4ISD A;  2B5E A;  4IVF A;  3ZTL A;  2RM5 A;  4XHM A;  2HRF A;  2B5X A;  3KEB A;  3QAG A;  1NW2 A;  3G7I A;  3IR4 A;  2L4Q A;  2DJ0 A;  1B9X C;  4JBB A;  1HD2 A;  3MAK A;  4F82 A;  3FW2 A;  1A23 A;  2GS3 A;  1MDK A;  1G6Y A;  4KH7 A;  5J41 A;  4HS1 A;  2PMT A;  5H5Q A;  3ZZX A;  2YNX A;  2MMZ A;  4O7H A;  3H8Q A;  5KN2 A;  1EEM A;  1MDJ A;  5E59 A;  2HSM B;  3APS A;  5HFG A;  2H6X A;  4LLR A;  1GSU A;  2CV4 A;  2M46 A;  2VCT A;  2C0E A;  1M9B A;  1ZGN A;  2CT6 A;  2DML A;  4MH2 A;  2ON5 A;  2HRK B;  3F0I A;  2I9H A;  3KH9 A;  3WGD A;  2OKA A;  1KBN A;  5ECK B;  1M2D A;  4JE1 A;  2HSH A;  4FO5 A;  3R2Q A;  1PD2 1;  3QOU A;  4MMM A;  3HXS A;  1QQ2 A;  1VGL A;  4K0G A;  3CRT A;  4IW9 A;  1OC9 A;  2QC7 A;  2A2S A;  1S3C A;  1SJ6 A;  2L57 A;  5D93 A;  2WJU A;  3Q6O A;  2DJ2 A;  3FR3 A;  2YAN A;  5G2Z A;  2CAQ A;  1A2L A;  3HCZ A;  2L59 A;  5CRE A;  2GSQ A;  3PGT A;  5IPG A;  3IC4 A;  2TRC P;  4V2M A;  1OYJ A;  1UC7 A;  3QD9 A;  3LXT A;  1GL8 A;  3LXZ A;  2PU9 C;  4HEA 2;  4EDY A;  3U5R E;  4MJE A;  2L6D A;  3UJ1 A;  2GLR A;  2IIY A;  4DSS A;  1V40 A;  4H86 A;  4ZXG A;  2FY6 A;  5HFK A;  5G5E A;  2FGX A;  2TIR A;  1GSD A;  1XWC A;  5ECP B;  1RW1 A;  3J7Y k;  2UZ8 A;  2OE1 A;  2FLS A;  4JRR A;  1A8Y A;  4QL9 A;  2NTO A;  4EO3 A;  3K8N A;  1F2E A;  2L6C A;  5D9V A;  1QGV A;  3DGQ A;  1SKW B;  2H66 A;  3E0U A;  1A0R P;  1RQM A;  3DWV A;  1FB0 A;  2NDO A;  1T1V A;  2K8S A;  1K3O A;  3HD5 A;  1EGO A;  1MD4 A;  2N5A A;  2PGT A;  1KTE A;  4XS4 B;  1VF3 A;  3GKK A;  2YV7 A;  1ERT A;  4TOP A;  4OCF A;  4IN0 A;  5B6N A;  3WT1 A;  5A5K A;  1ZOF A;  3IAS 2;  1JZD A;  3BCK A;  4ZL8 A;  4YAV A;  3LEF A;  4N10 A;  2LQO A;  3HJO A;  4MPF A;  3H93 A;  1F37 A;  5FWG A;  1HQO A;  3ERW A;  1E6B A;  4ILF A;  8GSS A;  1J0F A;  3FK8 A;  1M9A A;  2LQQ A;  3MDK A;  1UA5 A;  2AB6 A;  1M2A A;  2P0G A;  3TB2 A;  1NHO A;  1QFN A;  4MF6 A;  3ISO A;  4PUR A;  2YJH A;  1ACV A;  1O6J A;  4GWR A;  4L0W A;  5HR0 A;  2IFQ A;  1BAY A;  4KDX A;  5CRG A;  4NV5 A;  3TRQ A;  1F6M C;  2VIM A;  2WGR A;  3W8S A;  5F05 A;  2R6K A;  1GH2 A;  3ERG A;  4JR6 A;  1GWC A;  3GYK A;  4E8E A;  4I2U A;  4O5R A;  4PUF C;  2GTU A;  3KD0 A;  18GS A;  4MF5 A;  1XWK A;  2HI7 A;  1XCC A;  3SWL A;  1SD9 A;  1PKW A;  1K0A A;  1J08 A;  4V1A g;  1SK0 A;  3C1R A;  4BVX A;  3V1W A;  3TKR A;  3C8E A;  5EY6 A;  1Z6M A;  1B9Y C;  5D73 A;  2OBK A;  4KX4 A;  3VK9 A;  4NV2 A;  4JR4 A;  3GSS A;  5BMU A;  4Q5N A;  3EVI A;  1Q4J A;  4ZBA A;  3TJG A;  2J9H A;  4ZB8 A;  2F3M A;  1PX6 A;  2NBS A;  3MWH A;  3TRX A;  3LJR A;  2NPB A;  3KMO A;  3WT2 A;  2KUC A;  2DJK A;  2YZU A;  4YQU A;  1X9S B;  2TRX A;  5AIS A;  5G30 A;  1H75 A;  2LRN A;  1O8X A;  3P90 A;  2BTO T;  2V6O A;  1N2A A;  1JLW A;  4WXT A;  3TJF A;  2MMA A;  4HJM A;  3UEM A;  2PUK C;  5ELA A;  1A2J A;  3EE2 A;  2FWG A;  2JZR A;  2N5F A;  4ECB A;  1OC9 B;  2LNT A;  5D9W A;  1X9M B;  4IEL A;  3E3E A;  6GST A;  1PRX A;  4CW9 A;  1AQW A;  2GST A;  1DBY A;  5AN1 A;  4EUY A;  1OAZ A;  2VM1 A;  2HNL A;  3TKQ A;  2VCX A;  3H1N A;  5A4U A;  2VL9 A;  2B6M A;  1A2M A;  4IJ3 A;  3LWA A;  2EIO A;  4ZL7 A;  4POM A;  1UN2 A;  3IRA A;  1F3A A;  3JCM L;  2B3S A;  4EXJ A;  5A4W A;  4YAP A;  4DEJ A;  5LCZ A;  1YF0 A;  3M0F A;  5DCG A;  2I3Y A;  1OE7 A;  4MF7 A;  5JWO B;  4DSS B;  3GUS A;  4AJ8 A;  1PGT A;  4KW6 A;  3LG6 A;  5CAX A;  1BYE A;  5ABR A;  3GX0 A;  3LFL A;  1JZR A;  2JL4 A;  3GV1 A;  3WYW A;  4ZBB A;  1ZZY A;  4MJC A;  3S9F A;  4KA0 A;  1XPV A;  4KAE A;  3BBY A;  5DQS A;  1ZCP A;  2ES7 A;  3Q74 A;  2GZP A;  5KN1 A;  5D9T A;  3GH6 A;  3F4S A;  3D5J A;  4QL7 A;  1TOF A;  2GZZ A;  4GST A;  1U87 A;  1K0M A;  2H1G A;  1DSB A;  3HJP A;  3GHA A;  2VCQ A;  1FO5 A;  1SEN A;  3OR5 A;  5ECO B;  1O7U A;  4LMV A;  2DIY A;  5FHI A;  1KNG A;  4L8E A;  4E8H A;  3BOA A;  2R3X A;  1X5D A;  3F4T A;  2CZ2 A;  1ZYE A;  3IK9 A;  2M80 A;  3TKP A;  1K0B A;  5ELG A;  5ECH B;  3M1G A;  5IOW A;  2P31 A;  4FQU A;  3CTF A;  2XPD A;  3GIX A;  3GKN A;  1TRU A;  4NHZ A;  1E2Y A;  2HE3 A;  4HZ4 A;  2H75 A;  3O3T A;  2N5B A;  3UBK A;  2VL3 A;  3CMI A;  3TJK A;  4NAX A;  2B5Y A;  4V2N A;  1XW5 A;  3DXB A;  2H70 A;  3ZML A;  1V57 A;  3ME7 A;  2IFQ B;  5KEJ A;  3I6A A;  2LJR A;  4I6X A;  2REM A;  1USB A;  1B4P A;  3IDV A;  2LS5 A;  4I97 A;  4WKW A;  2VM2 A;  3QDN A;  4RUV A;  3F3R A;  1GUH A;  5JWR B;  5HR1 A;  3NOF A;  1PX7 A;  1ERW A;  2IME A;  1GNE A;  16GS A;  1AAZ A;  1ZL9 A;  1ERV A;  2NVL A;  2AAW A;  1TTZ A;  1XOB A;  5D8I A;  4IP1 A;  2H1B A;  4BVX B;  1TRV A;  2XBI A;  1FAA A;  4YQV A;  4POB A;  1CQG A;  2H30 A;  3HKR A;  2K9F A;  1EOH A;  1O73 A;  4XIH A;  1ZYQ B;  1OKT A;  3TOU A;  1BX9 A;  1FVK A;  1YF1 A;  2DBC A;  4G0L A;  3M8N A;  2HZF A;  3H4K A;  4EVM A;  4WF5 A;  2YPM A;  2GVP A;  4TR1 A;  5DQY A;  1QUW A;  1YY7 A;  4AGS A;  1JHB A;  3APO A;  1ZMA A;  4HU9 A;  3GNJ A;  2HQT A;  4ECI A;  1JFU A;  4NWY A;  2DIZ A;  3IV4 A;  4N0V A;  3F8U A; 
#chains in the Genus database with same CATH topology
 1BJX A;  2MMO A;  3HYP A;  3L9V A;  1SL0 B;  4IJI A;  2I4A A;  4JED A;  4TR4 A;  1WJK A;  1OC8 A;  3GTU B;  4TW5 A;  4IP6 A;  2B7K A;  5A4V A;  5KOX A;  1T00 A;  1S3A A;  1KEB A;  1X9W B;  1AQV A;  4G2E A;  2E2M A;  5GST A;  4F03 A;  5J4U A;  4DVC A;  3US3 A;  3L9U A;  5AIV A;  1A24 A;  3HVV A;  1EWX A;  3QFB C;  5J40 A;  2JZT A;  4TR0 A;  1GTU A;  4IQA A;  4OCE A;  3GL3 A;  2H8L A;  3GN3 A;  5J4Y A;  3ZRD A;  5J3R A;  1G0T A;  1PFO A;  4ZBD A;  4ZIJ A;  3C71 A;  2F8F A;  2WVZ A;  6GSU A;  4N3Z A;  3UAR A;  4BL7 A;  4FYB A;  2WB9 A;  2WVX A;  1I5G A;  3RPP A;  4K8M A;  2VLU A;  2F51 A;  1XWG A;  4PQI A;  2AV4 A;  4NPB A;  2C80 A;  1Z6N A;  1VF2 A;  3CSH A;  2D2Z A;  1LJR A;  3M3M A;  4IKH A;  1BED A;  2MYG A;  3GST A;  1GTI A;  4JZQ A;  2L4C A;  3KM6 A;  1Z7P A;  4GSN A;  2L5O A;  1VF1 A;  3G7J A;  2X8C A;  3IPZ A;  4A5P A;  2LUS A;  1YJ6 A;  3LSZ A;  1WMJ A;  1YEP A;  3HY2 A;  3TRP A;  2CAI A;  4K7O A;  2A4V A;  1LU4 A;  3ZFL A;  2CX4 A;  3KIJ A;  3RAZ A;  3UVT A;  3GKM A;  2LNS A;  3PIN A;  5B8B A;  3ZL5 A;  2DMM A;  5LD0 A;  4ECJ A;  3EU4 A;  2C4J A;  5DDL A;  1EP8 A;  4K7I A;  2EFH A;  4AJ7 A;  4MJB A;  1RK4 A;  2GGT A;  5ECN B;  5F07 A;  2XHF A;  3LOR A;  3N5O A;  1M2B A;  4KSM A;  5JCU A;  5H5S A;  4BIK A;  1N25 A;  4RI6 A;  1JZW A;  1EV9 A;  2DKI A;  2O3E A;  4WET A;  2ON7 A;  3DKS A;  3IE3 A;  2LEG A;  1GSY A;  1TK0 B;  4WR5 A;  1O8W A;  4YKF A;  3I69 A;  3FR6 A;  2X4A A;  1HNC A;  4O92 A;  4G10 A;  3MNG A;  2LST A;  2OAD A;  1VRS D;  3A5W A;  2KOK A;  19GS A;  2R2J A;  4O32 A;  3GFK A;  5L71 A;  1AIU A;  5IO0 A;  1LBK A;  5CRW A;  3MSZ A;  4PTS A;  3EYT A;  3RHB A;  2H1A A;  3UL3 A;  1B4Q A;  4EC0 A;  4FYU A;  1PL2 A;  2I81 A;  1MD3 A;  1GUK A;  4K0N A;  1DE2 A;  1WWJ A;  5IMF A;  3CSI A;  4X4J A;  5DJL A;  4AJ6 A;  1GSE A;  2HRN A;  2PWJ A;  1K0D A;  4HJ2 A;  4EKZ A;  3GA4 A;  1GUM A;  4RQX A;  3D6I A;  4KUN A;  3P7X A;  4N0Z A;  2ZCT A;  3APQ A;  2HT9 A;  1YQ1 A;  4ZIL A;  1SL2 B;  1GLP A;  4YQM A;  2EIQ A;  4X43 A;  3FZ9 A;  3KP9 A;  4EF0 A;  1EZK A;  3G9B A;  5IMV A;  3DEX A;  3U6V A;  1TXX A;  2KP2 A;  4TR1 B;  2CA8 A;  4GQC A;  3RFR C;  4Z7X A;  5IMA A;  1X5C A;  4YKG A;  2GSS A;  4KF9 A;  2H76 A;  4F0C A;  5ECQ B;  2M72 A;  4TKY A;  5ECL B;  5A34 B;  2YP6 A;  2B1L A;  3P8W A;  3VWV A;  3QMX A;  4EIQ A;  1BG5 A;  3F6D A;  5J9C A;  2K8V A;  1K3L A;  2FD3 A;  2WUL A;  4D73 A;  1GSS A;  4IQ1 A;  1OKD A;  4GCI A;  2PER A;  1T8E B;  2B1K A;  1V58 A;  3F3Q A;  3WGE A;  4Z2T A;  4PNF A;  4TVE A;  1WRY A;  2C8U A;  4K6X A;  5ID2 A;  2V1M A;  3IHQ A;  1NM3 A;  2L5L A;  1YEX A;  4J56 E;  5IMD A;  5C04 A;  2VO4 A;  1HNB A;  1FVJ A;  4TRX A;  1GNW A;  3GUR A;  4AKI A;  4PNG A;  4K7N A;  1R4W A;  3TJJ A;  4XRA A;  2HXK A;  2XPE A;  2CVD A;  4BVY A;  1XZO A;  1FB6 A;  17GS A;  3Q19 A;  2EC4 A;  2OBI A;  1MDI A;  1XWA A;  2GQL A;  1GUL A;  4ML6 A;  1OC3 A;  1GSQ A;  4GXZ A;  3RGB C;  1N8J A;  2WVX B;  3M9J A;  1PQN A;  4E68 A;  1G6W A;  5ECI B;  2IMI A;  1YEW C;  2CX3 A;  2X99 A;  4AKH A;  3TGZ A;  1MEK A;  3FZA A;  4GQF A;  3ZIT A;  3KGK A;  4OMV A;  1W89 A;  2YWI A;  2F9S A;  2EFE A;  4MJA A;  3CRU A;  3RPN A;  2IMK A;  4X1U A;  3VPT A;  2EFC A;  2E2G A;  1CQH A;  3KZQ A;  4IHU A;  3VWW A;  3F63 A;  1SK2 A;  1M99 A;  4L5O A;  3HVN A;  5FT3 A;  4Q5F A;  2G2Q A;  4TXO A;  4XS1 A;  2YWM A;  3ZMK A;  2R0G A;  1TW9 A;  2P5Q A;  1TRS A;  4KE3 A;  3FHK A;  3EIN A;  3NZN A;  4F2I A;  2MBT A;  2R5G A;  3QR6 A;  2G0F A;  3TKS A;  20GS A;  2B7J A;  1ABA A;  4AI6 A;  2YWN A;  4TN8 A;  2GT6 A;  3FEU A;  4F0B A;  5IMC A;  5ECM B;  4N11 A;  2VL2 A;  1U88 A;  2DJJ A;  10GS A;  4MPG A;  2GT5 A;  1X5E A;  3SBC A;  5GAP D;  4J2F A;  5LNK e;  2A4H A;  2OT3 A;  1IYI A;  3L78 A;  4N30 A;  4OO4 A;  3UVH A;  2WW3 A;  3VFI A;  1U3I A;  2JAC A;  3TUE A;  5J9B A;  1Z5Y E;  3KTB A;  3EUR A;  3ZVJ A;  4EL1 A;  3KCM A;  5DJM A;  4K1F A;  2JSZ A;  2C1Y A;  1I9D A;  2A2R A;  2LKU A;  3ME8 A;  2AJQ B;  2YV9 A;  3GRX A;  1THX A;  4GF0 A;  3TJB A;  3GKX A;  5B7C A;  1J9B A;  1PKZ A;  1Z3E A;  1TU7 A;  2H6Y A;  5EL8 A;  3MIX A;  1B8X A;  1V2A A;  4G0I A;  4K5S A;  4MA9 A;  3QFA C;  3LYK A;  3H79 A;  3A2X A;  4FH8 A;  3ZFB A;  4MLY A;  3VWX A;  2ZUP A;  2O85 A;  2QGV A;  3UBL A;  2X8G A;  2H0I A;  3FKF A;  1Z9H A;  1EV4 A;  5A5H A;  1V98 A;  5DAK A;  2R4V A;  4LA1 A;  3ZVJ D;  4PI2 C;  4LL1 B;  3GMF A;  4MK3 A;  4XRD A;  1K0C A;  1YKA A;  1SKS B;  3ERF A;  1K0O A;  3HA9 A;  4BA7 A;  2MZC A;  2FWH A;  3R3E A;  7GSS A;  4OD7 A;  5CP1 A;  1SYR A;  4CHS A;  5CRH A;  4ZB9 A;  1SVO A;  4ZL9 A;  2DKH A;  5IIZ A;  2FA4 A;  2WS2 A;  1PA3 A;  2QSI A;  5E4W A;  3ED3 A;  12GS A;  1NHY A;  4P3Y B;  1GP1 A;  2AYT A;  2VAF A;  1C72 A;  2HYX A;  3IA1 A;  1S3R A;  1TKD B;  4USS A;  5DVB A;  1TRW A;  5D9X A;  5ENU A;  2CVK A;  4D73 B;  5G1K A;  3IHG A;  3ZIJ A;  4Z2R A;  3PR8 A;  4ICY A;  2GDR A;  4PXO A;  2H71 A;  3DVX A;  4CDO A;  4IGJ A;  5HQP A;  4V2L A;  2H1D A;  2H1L A;  1G7E A;  5ID2 B;  4IBP A;  3HVX A;  2GZY A;  5DCH A;  3UMA A;  4DSR A;  4MZB A;  3ZYW A;  4GTU A;  5KN3 A;  4MAB A;  4AF2 A;  1HYU A;  1B48 A;  6GSS A;  9GSS A;  3DD3 A;  3TKS E;  3VLN A;  1EOG A;  1AQX A;  3VI7 A;  3D4T A;  3F9U A;  3KTL A;  1GTB A;  5EPF A;  2YN1 A;  3CBU A;  4BVY B;  4I2T A;  4RI7 A;  3TKS C;  2H0G A;  2BJX A;  1PL1 A;  1XWB A;  2E7P A;  4I5Q A;  2GQM A;  2VD1 A;  4L5L A;  3L0H A;  3CTG A;  2I1U A;  2OJL A;  2VCV A;  1SK1 A;  3LYP A;  4MZW A;  3HJM A;  4FIW A;  2C3N A;  4ZB7 A;  4GSS A;  2VL2 C;  4FYC A;  3EMP A;  3FZ4 A;  5DAL A;  5IQY A;  3FYG A;  3G7Y A;  2LRT A;  3F4R A;  1SVL A;  4QMK A;  1H4O A;  1ILO A;  3GL5 A;  3F6F A;  2JSY A;  2R37 A;  5ECR B;  3DIE A;  1ST9 A;  2FWE A;  5HR3 A;  2OE0 A;  1QMV A;  4XTS A;  2VCW A;  3TDG A;  2DJ3 A;  1PMT A;  3HHV A;  1S4B P;  4PQH A;  5F06 A;  5F8B A;  2KP1 A;  4I8B A;  1A0F A;  4TXO B;  4ZB6 A;  5GZZ B;  2A2P A;  2QA2 A;  2DJ1 A;  2IJY A;  5C00 A;  1X0R A;  5COH A;  5CRD A;  1TDI A;  4XCS A;  1ON4 A;  1S3D A;  1TP9 A;  1JLV A;  3IC8 A;  4PUA A;  2RM6 A;  3HZ8 A;  2Z9S A;  3EU3 A;  5G31 A;  3BD2 A;  4GRF A;  4Q5Q A;  3DVW A;  4POL A;  1ERU A;  1TK8 B;  2KHP A;  4HQZ A;  1VF4 A;  4KSO A;  1EGR A;  13GS A;  4F9Z A;  3L9S A;  1YZX A;  1TK5 B;  1EEJ A;  2LJA A;  2VLV A;  5GSS A;  3CXG A;  4G0K A;  1QK8 A;  3QCP A;  2OA7 A;  5HR2 A;  5CO3 A;  2PN8 A;  5DBQ A;  1MTC A;  4HQS A;  4KCE A;  2FNO A;  4LMW A;  1XVQ A;  2GSR A;  3KH7 A;  4OO5 A;  1XW6 A;  3FZ5 A;  3VUR A;  4KB3 A;  1PN9 A;  1UVZ A;  2HFD A;  4NXI A;  2HZE A;  1IYH A;  1FOV A;  4HZ2 A;  1U6T A;  2PVO C;  1FW1 A;  3FRC A;  1Y6E A;  3HVS A;  4XS6 A;  3GH9 A;  2PPT A;  2VKZ G;  2BMX A;  3IOS A;  1SJZ A;  3C73 A;  4BPY A;  5KN0 A;  1ML6 A;  1R7H A;  1AC1 A;  4HU7 A;  1XFL A;  2VD0 A;  2CZ3 A;  5IM9 A;  2HSN A;  2WRT A;  5DAK B;  1WOU A;  2MBS A;  2VLT A;  2VUP A;  4G19 A;  2RII A;  3VWU A;  2H72 A;  1QXH A;  2WW0 A;  4Q5R A;  5IOX A;  4J57 E;  3N9J A;  4WBR D;  2LV3 A;  3I43 A;  3PH9 A;  3QAW A;  2V41 A;  2PVQ A;  2E0Q A;  2CVB A;  2HSY A;  14GS A;  1TI1 A;  2J23 A;  2RUF A;  3CSJ A;  1DE1 A;  1R5A A;  1W4V A;  1WP0 A;  2O87 A;  1GRX A;  3EWL A;  3A2V A;  2HLS A;  3E9J B;  2H19 A;  5HFI A;  3Q18 A;  2O8V B;  2ALB A;  2IL3 A;  4GLT A;  4PGT A;  3L4N A;  3D0Z A;  2QKE A;  1TU8 A;  1XXU A;  4ULX A;  4V1A p;  3PPU A;  5BRT A;  1OVN A;  1THO A;  2GQK A;  3A5I A;  1XW9 A;  5J5N A;  2VCZ A;  2OE3 A;  2V2G A;  5F0G A;  3A2W A;  4IS0 A;  2DLX A;  2H0H A;  2R0C A;  3ZRE A;  4OFM A;  4ML1 A;  4WBJ A;  3WGX A;  4KDY A;  2IN3 A;  2FHE A;  4WEY A;  4HI7 A;  5IPH A;  5AGY A;  2C0G A;  3VI5 A;  4YH2 A;  3EPT A;  3KP8 A;  2WZS A;  2X8H A;  5JWQ B;  4PX1 A;  1PSQ A;  1T3B A;  1O85 A;  3KJY A;  2JU5 A;  3DML A;  1XBS A;  1YDK A;  1Z7R A;  4BWS A;  1F3B A;  5G5F A;  1YKC A;  3BCI A;  3IBH A;  4CY8 A;  4HOJ A;  3DYR A;  1M7T A;  2XBQ A;  3WD6 A;  1SJI A;  3KMN A;  5DAL B;  3J7Y b;  4MZC A;  4ID0 A;  5IMZ A;  3O6T A;  1WE0 A;  2O89 A;  3UAP A;  2WDU A;  3W6G A;  3MYD A;  2O7K A;  3W8J A;  1OE8 A;  4BL7 B;  3UIW A;  2H6Z A;  3GTU A;  3GX8 A;  2IMD A;  2IPA A;  2HSM A;  1XG8 A;  2OAC A;  6GSY A;  3A3T A;  2FCH A;  3TOT A;  2YWO A;  3EMX A;  2V32 A;  4HUA A;  1K3Y A;  3RHC A;  3O76 A;  2AHE A;  4Z2U A;  2WCI A;  2HRK A;  4KDU A;  4NHW A;  2YZH A;  22GS A;  3D22 A;  4ECC A;  3QPM A;  2JAD A;  3AY8 A;  5JCG A;  2P5R A;  2ZNM A;  1Y25 A;  5ECS A;  3I9V 2;  1FG4 A;  1URM A;  1TXU A;  4K2D A;  1XVW A;  2K18 A;  4KGI A;  2RLI A;  1JZO A;  2WVY A;  5D96 A;  2H01 A;  4MP4 A;  2FA8 A;  5G1L A;  1AXD A;  4RQR A;  5CNW A;  2DC5 A;  2FUG 2;  4KCA A;  2YJ7 A;  1SKR B;  6GSV A;  4WR4 A;  1TI3 A;  2O36 A;  1GSF A;  1WPI A;  2FWF A;  1G7O A;  2VOC A;  2K6V A;  3FR9 A;  4G9H A;  2LJK A;  1T4Z A;  3P2A A;  1DUG A;  2MMN A;  1K0N A;  4L0U A;  11GS A;  4TR3 A;  4HDE A;  3TCO A;  4PQ1 A;  4EDZ A;  4QQ7 A;  4OFT A;  3UOM A;  1R26 A;  2LRC A;  5GAN D;  1SL1 B;  4ACS A;  3IK7 A;  2HZE B;  2V6K A;  2WZ9 A;  2KLX A;  5B8A A;  3CYN A;  3KXO A;  1XIY A;  1WIK A;  3HDC A;  3QAV A;  1M0U A;  4MH3 A;  3DRN A;  2EIR A;  3C1S A;  5CYY A;  5A1N A;  3D21 A;  1SYX A;  1SD8 A;  1Q98 A;  4OWY A;  1HNA A;  1GLQ A;  2IWT A;  2CQ9 A;  1O81 A;  2HRA A;  1V9W A;  4JU5 A;  6GSW A;  4NMU A;  4EE0 A;  3VPQ A;  2AUV A;  2HSN B;  4XS4 A;  4OFN A;  4WF4 A;  1AW9 A;  3M9K A;  2C0F A;  2YCD A;  3D4M A;  1T4Y A;  5AIX A;  2X64 A;  2IMF A;  3BJ5 A;  3IXR A;  1T7P B;  4TXV A;  4LL4 B;  2C3T A;  4KND A;  4AKX B;  2LTK A;  3LGC A;  5EVO A;  2PBJ A;  4DSQ A;  2WW1 A;  4X0X A;  3C7M A;  3ZLP A;  1R5P A;  1XOA A;  3HZ4 A;  1GTA A;  3LQ7 A;  5INY A;  2JZS A;  4BWQ A;  2F8A A;  2YOI A;  1AUC A;  4MDC A;  1PN0 A;  4MCU A;  5H5R A;  2RUE A;  2H74 A;  2C0D A;  3NIV A;  5JCW A;  3RDW A;  1BQ7 A;  6GSX A;  5B6M A;  1A8L A;  3FY7 A;  4MNN A;  3IAM 2;  2XC2 A;  1TJD A;  3EC3 A;  3ZIV A;  1EP7 A;  2H73 A;  1U3A A;  2DSA A;  4K9Z A;  3RBT A;  2C3Q A;  4POK A;  1M3J A;  2WFC A;  1NSW A;  5IO2 A;  1F9M A;  1SU9 A;  1FHE A;  4ISD A;  2B5E A;  4IVF A;  3ZTL A;  2RM5 A;  4XHM A;  2HRF A;  2X49 A;  2B5X A;  4GDF A;  3KEB A;  3QAG A;  1NW2 A;  3G7I A;  1M3I A;  3IR4 A;  2L4Q A;  2DJ0 A;  1B9X C;  4JBB A;  1HD2 A;  3MAK A;  4F82 A;  3FW2 A;  1A23 A;  2GS3 A;  1MDK A;  1G6Y A;  4KH7 A;  5J41 A;  4HS1 A;  2PMT A;  5H5Q A;  3ZZX A;  2YNX A;  2MMZ A;  4O7H A;  3H8Q A;  5KN2 A;  1EEM A;  1MDJ A;  5E59 A;  2HSM B;  3APS A;  3CWG A;  5HFG A;  2H6X A;  4LLR A;  1GSU A;  2CV4 A;  2M46 A;  2VCT A;  2C0E A;  1M9B A;  1ZGN A;  1SVM A;  2CT6 A;  2DML A;  4MH2 A;  2ON5 A;  2HRK B;  3F0I A;  2I9H A;  3KH9 A;  3WGD A;  2OKA A;  1KBN A;  5ECK B;  1M2D A;  4JE1 A;  2HSH A;  4FO5 A;  3R2Q A;  2QA1 A;  1PD2 1;  3QOU A;  4MMM A;  3HXS A;  1QQ2 A;  1VGL A;  4K0G A;  3CRT A;  4IW9 A;  1OC9 A;  2QC7 A;  2A2S A;  1S3C A;  1SJ6 A;  2L57 A;  5D93 A;  2WJU A;  3Q6O A;  2DJ2 A;  3FR3 A;  2YAN A;  5G2Z A;  2CAQ A;  1A2L A;  3HCZ A;  2L59 A;  5CRE A;  1Y1U A;  2GSQ A;  3PGT A;  5IPG A;  3IC4 A;  2TRC P;  4V2M A;  4W66 A;  1OYJ A;  1UC7 A;  3FMW A;  3QD9 A;  3LXT A;  1GL8 A;  3LXZ A;  2PU9 C;  4HEA 2;  4EDY A;  3U5R E;  3LW9 A;  2L6D A;  4MJE A;  3UJ1 A;  2GLR A;  2IIY A;  4DSS A;  1V40 A;  4H86 A;  4FXY P;  4ZXG A;  1ZYN A;  2FY6 A;  1YVL A;  5G5E A;  5HFK A;  3TU3 B;  2FGX A;  2TIR A;  1GSD A;  1XWC A;  5ECP B;  1RW1 A;  3J7Y k;  2UZ8 A;  2OE1 A;  2FLS A;  4JRR A;  1A8Y A;  4QL9 A;  2NTO A;  4EO3 A;  3K8N A;  1F2E A;  5A1N B;  2L6C A;  5D9V A;  1QGV A;  3DGQ A;  1SKW B;  2H66 A;  3E0U A;  1A0R P;  1RQM A;  3DWV A;  4O5Q A;  1FB0 A;  2NDO A;  1T1V A;  2K8S A;  1K3O A;  3HD5 A;  1EGO A;  1MD4 A;  2N5A A;  2PGT A;  1KTE A;  4XS4 B;  1VF3 A;  3GKK A;  2YV7 A;  1ERT A;  4TOP A;  4OCF A;  4IN0 A;  5B6N A;  3WT1 A;  5A5K A;  1ZOF A;  3IAS 2;  2UV8 G;  1JZD A;  3BCK A;  4ZL8 A;  4YAV A;  3LEF A;  4N10 A;  2LQO A;  3HJO A;  4MPF A;  3H93 A;  1F37 A;  5A5H B;  5FWG A;  1HQO A;  3ERW A;  1E6B A;  4ILF A;  8GSS A;  1J0F A;  3FK8 A;  1M9A A;  2LQQ A;  3MDK A;  1UA5 A;  2AB6 A;  1M2A A;  2P0G A;  3TB2 A;  1NHO A;  1QFN A;  4MF6 A;  3ISO A;  4PUR A;  2YJH A;  1ACV A;  1O6J A;  4GWR A;  4L0W A;  5HR0 A;  2IFQ A;  1BAY A;  4KDX A;  5CRG A;  4CY6 A;  4NV5 A;  3TRQ A;  1F6M C;  2VIM A;  2WGR A;  3W8S A;  5F05 A;  2R6K A;  1GH2 A;  3ERG A;  4JR6 A;  1GWC A;  3GYK A;  3CHX C;  4E8E A;  4I2U A;  4O5R A;  4PUF C;  2GTU A;  3KD0 A;  18GS A;  4MF5 A;  1XWK A;  2HI7 A;  1XCC A;  3SWL A;  1SD9 A;  1PKW A;  1K0A A;  1FOH A;  1J08 A;  4V1A g;  2R0P A;  1SK0 A;  3C1R A;  4BVX A;  3V1W A;  5J47 A;  3TKR A;  3CQF A;  3C8E A;  5EY6 A;  2EFD A;  1Z6M A;  1B9Y C;  5D73 A;  2OBK A;  4KX4 A;  3VK9 A;  4NV2 A;  4JR4 A;  3GSS A;  5BMU A;  4Q5N A;  3EVI A;  1Q4J A;  4ZBA A;  3TJG A;  2J9H A;  4ZB8 A;  2F3M A;  1PX6 A;  2NBS A;  3MWH A;  3TRX A;  3LJR A;  2NPB A;  3KMO A;  3WT2 A;  2KUC A;  2DJK A;  2YZU A;  4YQU A;  1X9S B;  2TRX A;  5AIS A;  5G30 A;  1H75 A;  2LRN A;  1O8X A;  3P90 A;  2BTO T;  2V6O A;  1N2A A;  1JLW A;  4WXT A;  3TJF A;  2MMA A;  4HJM A;  3UEM A;  2PUK C;  5KOW A;  5ELA A;  1ZYP A;  1A2J A;  3EE2 A;  2FWG A;  2JZR A;  2N5F A;  4ECB A;  1OC9 B;  4K2X A;  2LNT A;  5D9W A;  1X9M B;  4IEL A;  3E3E A;  6GST A;  1PRX A;  4CW9 A;  1AQW A;  2GST A;  1DBY A;  5AN1 A;  4EUY A;  1OAZ A;  4K5R A;  2VM1 A;  2HNL A;  3TKQ A;  2VCX A;  3H1N A;  5A4U A;  2VL9 A;  2B6M A;  1A2M A;  4IJ3 A;  3LWA A;  2EIO A;  4ZL7 A;  4POM A;  1UN2 A;  3IRA A;  3HMJ G;  1F3A A;  3JCM L;  2B3S A;  4EXJ A;  5A4W A;  4YAP A;  4DEJ A;  5LCZ A;  1YF0 A;  3M0F A;  5DCG A;  2I3Y A;  1OE7 A;  4MF7 A;  1BG1 A;  5JWO B;  5J4V A;  4DSS B;  3GUS A;  4AJ8 A;  1PGT A;  4KW6 A;  4AKG A;  3LG6 A;  5CAX A;  1BYE A;  5ABR A;  3GX0 A;  3LFL A;  1JZR A;  2JL4 A;  3GV1 A;  1I1I P;  3WYW A;  4ZBB A;  1ZZY A;  4MJC A;  3S9F A;  4KA0 A;  1XPV A;  4KAE A;  2O5V A;  3BBY A;  5DQS A;  1ZCP A;  4O5U A;  2ES7 A;  3Q74 A;  2GZP A;  5KN1 A;  5D9T A;  3GH6 A;  3F4S A;  3D5J A;  4QL7 A;  1TOF A;  2GZZ A;  4GST A;  1U87 A;  1K0M A;  2H1G A;  1DSB A;  3HJP A;  3GHA A;  2VCQ A;  1FO5 A;  2WW2 A;  1SEN A;  3OR5 A;  5ECO B;  1O7U A;  4LMV A;  2DIY A;  5FHI A;  1KNG A;  4L8E A;  4G01 A;  4E8H A;  3BOA A;  2R3X A;  1X5D A;  3F4T A;  4EIP A;  2CZ2 A;  1ZYE A;  3IK9 A;  2M80 A;  3TKP A;  1K0B A;  5ELG A;  5ECH B;  3M1G A;  5IOW A;  2P31 A;  4FQU A;  3CTF A;  2XPD A;  3GIX A;  3GKN A;  1TRU A;  4NHZ A;  1E2Y A;  2HE3 A;  4HZ4 A;  2H75 A;  4PI0 C;  3O3T A;  2N5B A;  3UBK A;  2VL3 A;  3CMI A;  3TJK A;  4NAX A;  2B5Y A;  4V2N A;  1XW5 A;  3DXB A;  2H70 A;  3ZML A;  1V57 A;  3ME7 A;  2IFQ B;  5KEJ A;  3I6A A;  2LJR A;  4I6X A;  2REM A;  1USB A;  1B4P A;  3IDV A;  2LS5 A;  4I97 A;  4WKW A;  2VM2 A;  3QDN A;  4RUV A;  3F3R A;  1GUH A;  5JWR B;  5HR1 A;  3NOF A;  1PX7 A;  1ERW A;  2IME A;  1GNE A;  16GS A;  1BF5 A;  1AAZ A;  4PHZ C;  1ZL9 A;  1ERV A;  2NVL A;  2AAW A;  1TTZ A;  1XOB A;  5D8I A;  4IP1 A;  2H1B A;  4BVX B;  1TRV A;  2XBI A;  1FAA A;  4YQV A;  4POB A;  1CQG A;  2H30 A;  3HKR A;  5BMU B;  2K9F A;  1EOH A;  1O73 A;  4XIH A;  1ZYQ B;  1OKT A;  3TOU A;  1BX9 A;  1FVK A;  1YF1 A;  2DBC A;  4G0L A;  3M8N A;  2HZF A;  3H4K A;  4EVM A;  4WF5 A;  2YPM A;  2GVP A;  4TR1 A;  5DQY A;  1QUW A;  1YY7 A;  4AGS A;  1JHB A;  3APO A;  1ZMA A;  4HU9 A;  3GNJ A;  2HQT A;  4ECI A;  1JFU A;  4NWY A;  2DIZ A;  3IV4 A;  5A34 A;  4N0V A;  3F8U A;  4HSC X; 
#chains in the Genus database with same CATH homology
 1BJX A;  2MMO A;  3HYP A;  3L9V A;  1SL0 B;  4IJI A;  2I4A A;  4JED A;  4TR4 A;  1WJK A;  1OC8 A;  3GTU B;  4TW5 A;  4IP6 A;  2B7K A;  5A4V A;  5KOX A;  1T00 A;  1S3A A;  1KEB A;  1X9W B;  1AQV A;  4G2E A;  2E2M A;  5GST A;  4F03 A;  5J4U A;  4DVC A;  3US3 A;  3L9U A;  5AIV A;  1A24 A;  3HVV A;  1EWX A;  3QFB C;  5J40 A;  2JZT A;  4TR0 A;  1GTU A;  4IQA A;  4OCE A;  3GL3 A;  2H8L A;  3GN3 A;  5J4Y A;  3ZRD A;  5J3R A;  1G0T A;  4ZBD A;  4ZIJ A;  3C71 A;  2F8F A;  6GSU A;  4N3Z A;  3UAR A;  4BL7 A;  4FYB A;  2WB9 A;  1I5G A;  3RPP A;  4K8M A;  2VLU A;  2F51 A;  1XWG A;  4PQI A;  2AV4 A;  4NPB A;  2C80 A;  1Z6N A;  1VF2 A;  3CSH A;  2D2Z A;  1LJR A;  3M3M A;  4IKH A;  1BED A;  2MYG A;  3GST A;  1GTI A;  4JZQ A;  2L4C A;  3KM6 A;  1Z7P A;  4GSN A;  2L5O A;  1VF1 A;  3G7J A;  2X8C A;  3IPZ A;  4A5P A;  2LUS A;  1YJ6 A;  3LSZ A;  1WMJ A;  1YEP A;  3HY2 A;  3TRP A;  2CAI A;  4K7O A;  2A4V A;  1LU4 A;  3ZFL A;  2CX4 A;  3KIJ A;  3RAZ A;  3UVT A;  3GKM A;  2LNS A;  3PIN A;  5B8B A;  3ZL5 A;  2DMM A;  5LD0 A;  4ECJ A;  3EU4 A;  2C4J A;  5DDL A;  1EP8 A;  4K7I A;  2EFH A;  4AJ7 A;  4MJB A;  1RK4 A;  2GGT A;  5ECN B;  5F07 A;  2XHF A;  3LOR A;  3N5O A;  1M2B A;  4KSM A;  5JCU A;  5H5S A;  1N25 A;  4RI6 A;  1JZW A;  1EV9 A;  2DKI A;  4WET A;  2ON7 A;  3DKS A;  3IE3 A;  2LEG A;  1GSY A;  1TK0 B;  4WR5 A;  1O8W A;  4YKF A;  3I69 A;  3FR6 A;  2X4A A;  1HNC A;  4O92 A;  4G10 A;  3MNG A;  2LST A;  2OAD A;  1VRS D;  3A5W A;  2KOK A;  19GS A;  2R2J A;  4O32 A;  3GFK A;  5L71 A;  1AIU A;  5IO0 A;  1LBK A;  5CRW A;  3MSZ A;  4PTS A;  3EYT A;  3RHB A;  2H1A A;  3UL3 A;  1B4Q A;  4EC0 A;  4FYU A;  1PL2 A;  2I81 A;  1MD3 A;  1GUK A;  4K0N A;  1DE2 A;  1WWJ A;  5IMF A;  3CSI A;  4X4J A;  5DJL A;  4AJ6 A;  1GSE A;  2HRN A;  2PWJ A;  1K0D A;  4HJ2 A;  4EKZ A;  3GA4 A;  1GUM A;  4RQX A;  3D6I A;  4KUN A;  3P7X A;  4N0Z A;  2ZCT A;  3APQ A;  2HT9 A;  1YQ1 A;  4ZIL A;  1SL2 B;  1GLP A;  4YQM A;  2EIQ A;  4X43 A;  3FZ9 A;  3KP9 A;  4EF0 A;  1EZK A;  3G9B A;  5IMV A;  3DEX A;  3U6V A;  1TXX A;  2KP2 A;  4TR1 B;  2CA8 A;  4GQC A;  4Z7X A;  5IMA A;  1X5C A;  4YKG A;  2GSS A;  4KF9 A;  2H76 A;  4F0C A;  5ECQ B;  2M72 A;  4TKY A;  5ECL B;  5A34 B;  2YP6 A;  2B1L A;  3P8W A;  3VWV A;  3QMX A;  4EIQ A;  1BG5 A;  3F6D A;  5J9C A;  2K8V A;  1K3L A;  2FD3 A;  2WUL A;  4D73 A;  1GSS A;  4IQ1 A;  1OKD A;  4GCI A;  2PER A;  1T8E B;  2B1K A;  1V58 A;  3F3Q A;  3WGE A;  4Z2T A;  4PNF A;  4TVE A;  1WRY A;  2C8U A;  4K6X A;  5ID2 A;  2V1M A;  3IHQ A;  1NM3 A;  2L5L A;  1YEX A;  4J56 E;  5IMD A;  5C04 A;  2VO4 A;  1HNB A;  1FVJ A;  4TRX A;  1GNW A;  3GUR A;  4AKI A;  4PNG A;  4K7N A;  1R4W A;  3TJJ A;  4XRA A;  2HXK A;  2XPE A;  2CVD A;  4BVY A;  1XZO A;  1FB6 A;  17GS A;  3Q19 A;  2EC4 A;  2OBI A;  1MDI A;  1XWA A;  2GQL A;  1GUL A;  4ML6 A;  1OC3 A;  1GSQ A;  4GXZ A;  1N8J A;  3M9J A;  1PQN A;  4E68 A;  1G6W A;  5ECI B;  2IMI A;  2CX3 A;  2X99 A;  4AKH A;  3TGZ A;  1MEK A;  3FZA A;  4GQF A;  3ZIT A;  3KGK A;  4OMV A;  1W89 A;  2YWI A;  2F9S A;  2EFE A;  4MJA A;  3CRU A;  3RPN A;  2IMK A;  4X1U A;  3VPT A;  2EFC A;  2E2G A;  1CQH A;  3KZQ A;  4IHU A;  3VWW A;  3F63 A;  1SK2 A;  1M99 A;  4L5O A;  5FT3 A;  4Q5F A;  2G2Q A;  4TXO A;  4XS1 A;  2YWM A;  3ZMK A;  2R0G A;  1TW9 A;  2P5Q A;  1TRS A;  4KE3 A;  3FHK A;  3EIN A;  3NZN A;  4F2I A;  2MBT A;  2R5G A;  3QR6 A;  2G0F A;  3TKS A;  20GS A;  2B7J A;  1ABA A;  4AI6 A;  2YWN A;  4TN8 A;  2GT6 A;  3FEU A;  4F0B A;  5IMC A;  5ECM B;  4N11 A;  2VL2 A;  1U88 A;  2DJJ A;  10GS A;  4MPG A;  2GT5 A;  1X5E A;  3SBC A;  5GAP D;  4J2F A;  5LNK e;  2A4H A;  2OT3 A;  1IYI A;  3L78 A;  4N30 A;  4OO4 A;  3UVH A;  3VFI A;  1U3I A;  2JAC A;  3TUE A;  5J9B A;  1Z5Y E;  3KTB A;  3EUR A;  3ZVJ A;  4EL1 A;  3KCM A;  5DJM A;  4K1F A;  2JSZ A;  2C1Y A;  1I9D A;  2A2R A;  2LKU A;  3ME8 A;  2AJQ B;  2YV9 A;  3GRX A;  1THX A;  4GF0 A;  3TJB A;  3GKX A;  5B7C A;  1J9B A;  1PKZ A;  1Z3E A;  1TU7 A;  2H6Y A;  5EL8 A;  3MIX A;  1B8X A;  1V2A A;  4G0I A;  4K5S A;  4MA9 A;  3QFA C;  3LYK A;  3H79 A;  3A2X A;  4FH8 A;  3ZFB A;  4MLY A;  3VWX A;  2ZUP A;  2O85 A;  2QGV A;  3UBL A;  2X8G A;  2H0I A;  3FKF A;  1Z9H A;  1EV4 A;  5A5H A;  1V98 A;  5DAK A;  2R4V A;  4LA1 A;  3ZVJ D;  4LL1 B;  3GMF A;  4MK3 A;  4XRD A;  1K0C A;  1YKA A;  1SKS B;  3ERF A;  1K0O A;  3HA9 A;  4BA7 A;  2MZC A;  2FWH A;  3R3E A;  7GSS A;  4OD7 A;  5CP1 A;  1SYR A;  4CHS A;  5CRH A;  4ZB9 A;  1SVO A;  4ZL9 A;  2DKH A;  5IIZ A;  2FA4 A;  2WS2 A;  1PA3 A;  2QSI A;  5E4W A;  3ED3 A;  12GS A;  1NHY A;  4P3Y B;  1GP1 A;  2AYT A;  2VAF A;  1C72 A;  2HYX A;  3IA1 A;  1TKD B;  4USS A;  5DVB A;  1TRW A;  5D9X A;  5ENU A;  2CVK A;  4D73 B;  5G1K A;  3IHG A;  3ZIJ A;  4Z2R A;  3PR8 A;  4ICY A;  2GDR A;  4PXO A;  2H71 A;  3DVX A;  4CDO A;  4IGJ A;  5HQP A;  4V2L A;  2H1D A;  2H1L A;  1G7E A;  5ID2 B;  4IBP A;  3HVX A;  2GZY A;  5DCH A;  3UMA A;  4DSR A;  4MZB A;  3ZYW A;  4GTU A;  5KN3 A;  4MAB A;  4AF2 A;  1HYU A;  1B48 A;  6GSS A;  9GSS A;  3DD3 A;  3TKS E;  3VLN A;  1EOG A;  1AQX A;  3VI7 A;  3D4T A;  3F9U A;  3KTL A;  1GTB A;  5EPF A;  2YN1 A;  3CBU A;  4BVY B;  4I2T A;  4RI7 A;  3TKS C;  2H0G A;  2BJX A;  1PL1 A;  1XWB A;  2E7P A;  4I5Q A;  2GQM A;  2VD1 A;  4L5L A;  3L0H A;  3CTG A;  2I1U A;  2OJL A;  2VCV A;  1SK1 A;  3LYP A;  4MZW A;  3HJM A;  4FIW A;  2C3N A;  4ZB7 A;  4GSS A;  2VL2 C;  4FYC A;  3EMP A;  3FZ4 A;  5DAL A;  5IQY A;  3FYG A;  3G7Y A;  2LRT A;  3F4R A;  1SVL A;  4QMK A;  1H4O A;  1ILO A;  3GL5 A;  3F6F A;  2JSY A;  2R37 A;  5ECR B;  3DIE A;  1ST9 A;  2FWE A;  5HR3 A;  2OE0 A;  1QMV A;  4XTS A;  2VCW A;  3TDG A;  2DJ3 A;  1PMT A;  3HHV A;  4PQH A;  5F06 A;  5F8B A;  2KP1 A;  4I8B A;  1A0F A;  4TXO B;  4ZB6 A;  5GZZ B;  2A2P A;  2QA2 A;  2DJ1 A;  2IJY A;  5C00 A;  1X0R A;  5COH A;  5CRD A;  1TDI A;  4XCS A;  1ON4 A;  1S3D A;  1TP9 A;  1JLV A;  3IC8 A;  4PUA A;  2RM6 A;  3HZ8 A;  2Z9S A;  3EU3 A;  5G31 A;  3BD2 A;  4GRF A;  4Q5Q A;  3DVW A;  4POL A;  1ERU A;  1TK8 B;  2KHP A;  4HQZ A;  1VF4 A;  4KSO A;  1EGR A;  13GS A;  4F9Z A;  3L9S A;  1YZX A;  1TK5 B;  1EEJ A;  2LJA A;  2VLV A;  5GSS A;  3CXG A;  4G0K A;  1QK8 A;  3QCP A;  2OA7 A;  5HR2 A;  5CO3 A;  2PN8 A;  5DBQ A;  1MTC A;  4HQS A;  4KCE A;  2FNO A;  4LMW A;  1XVQ A;  2GSR A;  3KH7 A;  4OO5 A;  1XW6 A;  3FZ5 A;  3VUR A;  4KB3 A;  1PN9 A;  1UVZ A;  2HFD A;  4NXI A;  2HZE A;  1IYH A;  1FOV A;  4HZ2 A;  1U6T A;  2PVO C;  1FW1 A;  3FRC A;  1Y6E A;  3HVS A;  4XS6 A;  3GH9 A;  2PPT A;  2VKZ G;  2BMX A;  3IOS A;  1SJZ A;  3C73 A;  4BPY A;  5KN0 A;  1ML6 A;  1R7H A;  1AC1 A;  4HU7 A;  1XFL A;  2VD0 A;  2CZ3 A;  5IM9 A;  2HSN A;  2WRT A;  5DAK B;  1WOU A;  2MBS A;  2VLT A;  2VUP A;  4G19 A;  2RII A;  3VWU A;  2H72 A;  1QXH A;  4Q5R A;  5IOX A;  4J57 E;  3N9J A;  4WBR D;  2LV3 A;  3I43 A;  3PH9 A;  3QAW A;  2V41 A;  2PVQ A;  2E0Q A;  2CVB A;  2HSY A;  14GS A;  1TI1 A;  2J23 A;  2RUF A;  3CSJ A;  1DE1 A;  1R5A A;  1W4V A;  1WP0 A;  2O87 A;  1GRX A;  3EWL A;  3A2V A;  2HLS A;  3E9J B;  2H19 A;  5HFI A;  3Q18 A;  2O8V B;  2ALB A;  2IL3 A;  4GLT A;  4PGT A;  3L4N A;  3D0Z A;  2QKE A;  1TU8 A;  1XXU A;  4ULX A;  4V1A p;  3PPU A;  5BRT A;  1OVN A;  1THO A;  2GQK A;  3A5I A;  1XW9 A;  5J5N A;  2VCZ A;  2OE3 A;  2V2G A;  5F0G A;  3A2W A;  4IS0 A;  2DLX A;  2H0H A;  2R0C A;  3ZRE A;  4OFM A;  4ML1 A;  4WBJ A;  3WGX A;  4KDY A;  2IN3 A;  2FHE A;  4WEY A;  4HI7 A;  5IPH A;  5AGY A;  2C0G A;  3VI5 A;  4YH2 A;  3EPT A;  3KP8 A;  2X8H A;  5JWQ B;  4PX1 A;  1PSQ A;  1T3B A;  1O85 A;  3KJY A;  2JU5 A;  3DML A;  1XBS A;  1YDK A;  1Z7R A;  4BWS A;  1F3B A;  5G5F A;  1YKC A;  3BCI A;  3IBH A;  4CY8 A;  4HOJ A;  3DYR A;  1M7T A;  2XBQ A;  3WD6 A;  1SJI A;  3KMN A;  5DAL B;  3J7Y b;  4MZC A;  4ID0 A;  5IMZ A;  3O6T A;  1WE0 A;  2O89 A;  3UAP A;  2WDU A;  3W6G A;  3MYD A;  2O7K A;  3W8J A;  1OE8 A;  4BL7 B;  3UIW A;  2H6Z A;  3GTU A;  3GX8 A;  2IMD A;  2IPA A;  2HSM A;  2OAC A;  6GSY A;  3A3T A;  2FCH A;  3TOT A;  2YWO A;  3EMX A;  2V32 A;  4HUA A;  1K3Y A;  3RHC A;  3O76 A;  2AHE A;  4Z2U A;  2WCI A;  2HRK A;  4KDU A;  4NHW A;  2YZH A;  22GS A;  3D22 A;  4ECC A;  3QPM A;  2JAD A;  3AY8 A;  5JCG A;  2P5R A;  2ZNM A;  1Y25 A;  5ECS A;  3I9V 2;  1FG4 A;  1URM A;  1TXU A;  4K2D A;  1XVW A;  2K18 A;  4KGI A;  2RLI A;  1JZO A;  5D96 A;  2H01 A;  4MP4 A;  2FA8 A;  5G1L A;  1AXD A;  4RQR A;  5CNW A;  2DC5 A;  2FUG 2;  4KCA A;  2YJ7 A;  1SKR B;  6GSV A;  4WR4 A;  1TI3 A;  1GSF A;  1WPI A;  2FWF A;  1G7O A;  2VOC A;  2K6V A;  3FR9 A;  4G9H A;  2LJK A;  1T4Z A;  3P2A A;  1DUG A;  2MMN A;  1K0N A;  4L0U A;  11GS A;  4TR3 A;  4HDE A;  3TCO A;  4PQ1 A;  4EDZ A;  4QQ7 A;  4OFT A;  3UOM A;  1R26 A;  2LRC A;  5GAN D;  1SL1 B;  4ACS A;  3IK7 A;  2HZE B;  2V6K A;  2WZ9 A;  2KLX A;  5B8A A;  3CYN A;  3KXO A;  1XIY A;  1WIK A;  3HDC A;  3QAV A;  1M0U A;  4MH3 A;  3DRN A;  2EIR A;  3C1S A;  5CYY A;  5A1N A;  3D21 A;  1SYX A;  1SD8 A;  1Q98 A;  4OWY A;  1HNA A;  1GLQ A;  2IWT A;  2CQ9 A;  1O81 A;  2HRA A;  1V9W A;  4JU5 A;  6GSW A;  4NMU A;  4EE0 A;  3VPQ A;  2AUV A;  2HSN B;  4XS4 A;  4OFN A;  4WF4 A;  1AW9 A;  3M9K A;  2C0F A;  2YCD A;  3D4M A;  1T4Y A;  5AIX A;  2X64 A;  2IMF A;  3BJ5 A;  3IXR A;  1T7P B;  4TXV A;  4LL4 B;  2C3T A;  4KND A;  4AKX B;  2LTK A;  3LGC A;  5EVO A;  2PBJ A;  4DSQ A;  4X0X A;  3C7M A;  3ZLP A;  1R5P A;  1XOA A;  3HZ4 A;  1GTA A;  3LQ7 A;  5INY A;  2JZS A;  4BWQ A;  2F8A A;  2YOI A;  1AUC A;  4MDC A;  1PN0 A;  4MCU A;  5H5R A;  2RUE A;  2H74 A;  2C0D A;  3NIV A;  5JCW A;  3RDW A;  1BQ7 A;  6GSX A;  5B6M A;  1A8L A;  3FY7 A;  4MNN A;  3IAM 2;  2XC2 A;  1TJD A;  3EC3 A;  3ZIV A;  1EP7 A;  2H73 A;  1U3A A;  2DSA A;  4K9Z A;  3RBT A;  2C3Q A;  4POK A;  2WFC A;  1NSW A;  5IO2 A;  1F9M A;  1SU9 A;  1FHE A;  4ISD A;  2B5E A;  4IVF A;  3ZTL A;  2RM5 A;  4XHM A;  2HRF A;  2X49 A;  2B5X A;  4GDF A;  3KEB A;  3QAG A;  1NW2 A;  3G7I A;  3IR4 A;  2L4Q A;  2DJ0 A;  1B9X C;  4JBB A;  1HD2 A;  3MAK A;  4F82 A;  3FW2 A;  1A23 A;  2GS3 A;  1MDK A;  1G6Y A;  4KH7 A;  5J41 A;  4HS1 A;  2PMT A;  5H5Q A;  3ZZX A;  2YNX A;  2MMZ A;  4O7H A;  3H8Q A;  5KN2 A;  1EEM A;  1MDJ A;  5E59 A;  2HSM B;  3APS A;  3CWG A;  5HFG A;  2H6X A;  4LLR A;  1GSU A;  2CV4 A;  2M46 A;  2VCT A;  2C0E A;  1M9B A;  1ZGN A;  1SVM A;  2CT6 A;  2DML A;  4MH2 A;  2ON5 A;  2HRK B;  3F0I A;  2I9H A;  3KH9 A;  3WGD A;  2OKA A;  1KBN A;  5ECK B;  1M2D A;  4JE1 A;  2HSH A;  4FO5 A;  3R2Q A;  2QA1 A;  1PD2 1;  3QOU A;  4MMM A;  3HXS A;  1QQ2 A;  1VGL A;  4K0G A;  3CRT A;  4IW9 A;  1OC9 A;  2QC7 A;  2A2S A;  1S3C A;  1SJ6 A;  2L57 A;  5D93 A;  2WJU A;  3Q6O A;  2DJ2 A;  3FR3 A;  2YAN A;  5G2Z A;  2CAQ A;  1A2L A;  3HCZ A;  2L59 A;  5CRE A;  1Y1U A;  2GSQ A;  3PGT A;  5IPG A;  3IC4 A;  2TRC P;  4V2M A;  4W66 A;  1OYJ A;  1UC7 A;  3FMW A;  3QD9 A;  3LXT A;  1GL8 A;  3LXZ A;  2PU9 C;  4HEA 2;  4EDY A;  3U5R E;  3LW9 A;  2L6D A;  4MJE A;  3UJ1 A;  2GLR A;  2IIY A;  4DSS A;  1V40 A;  4H86 A;  4ZXG A;  1ZYN A;  2FY6 A;  1YVL A;  5G5E A;  5HFK A;  3TU3 B;  2FGX A;  2TIR A;  1GSD A;  1XWC A;  5ECP B;  1RW1 A;  3J7Y k;  2UZ8 A;  2OE1 A;  2FLS A;  4JRR A;  1A8Y A;  4QL9 A;  2NTO A;  4EO3 A;  3K8N A;  1F2E A;  5A1N B;  2L6C A;  5D9V A;  1QGV A;  3DGQ A;  1SKW B;  2H66 A;  3E0U A;  1A0R P;  1RQM A;  3DWV A;  4O5Q A;  1FB0 A;  2NDO A;  1T1V A;  2K8S A;  1K3O A;  3HD5 A;  1EGO A;  1MD4 A;  2N5A A;  2PGT A;  1KTE A;  4XS4 B;  1VF3 A;  3GKK A;  2YV7 A;  1ERT A;  4TOP A;  4OCF A;  4IN0 A;  5B6N A;  3WT1 A;  5A5K A;  1ZOF A;  3IAS 2;  2UV8 G;  1JZD A;  3BCK A;  4ZL8 A;  4YAV A;  3LEF A;  4N10 A;  2LQO A;  3HJO A;  4MPF A;  3H93 A;  1F37 A;  5A5H B;  5FWG A;  1HQO A;  3ERW A;  1E6B A;  4ILF A;  8GSS A;  1J0F A;  3FK8 A;  1M9A A;  2LQQ A;  3MDK A;  1UA5 A;  2AB6 A;  1M2A A;  2P0G A;  3TB2 A;  1NHO A;  1QFN A;  4MF6 A;  3ISO A;  4PUR A;  2YJH A;  1ACV A;  1O6J A;  4GWR A;  4L0W A;  5HR0 A;  2IFQ A;  1BAY A;  4KDX A;  5CRG A;  4CY6 A;  4NV5 A;  3TRQ A;  1F6M C;  2VIM A;  2WGR A;  3W8S A;  5F05 A;  2R6K A;  1GH2 A;  3ERG A;  4JR6 A;  1GWC A;  3GYK A;  4E8E A;  4I2U A;  4O5R A;  4PUF C;  2GTU A;  3KD0 A;  18GS A;  4MF5 A;  1XWK A;  2HI7 A;  1XCC A;  3SWL A;  1SD9 A;  1PKW A;  1K0A A;  1FOH A;  1J08 A;  4V1A g;  2R0P A;  1SK0 A;  3C1R A;  4BVX A;  3V1W A;  5J47 A;  3TKR A;  3C8E A;  5EY6 A;  2EFD A;  1Z6M A;  1B9Y C;  5D73 A;  2OBK A;  4KX4 A;  3VK9 A;  4NV2 A;  4JR4 A;  3GSS A;  5BMU A;  4Q5N A;  3EVI A;  1Q4J A;  4ZBA A;  3TJG A;  2J9H A;  4ZB8 A;  2F3M A;  1PX6 A;  2NBS A;  3MWH A;  3TRX A;  3LJR A;  2NPB A;  3KMO A;  3WT2 A;  2KUC A;  2DJK A;  2YZU A;  4YQU A;  1X9S B;  2TRX A;  5AIS A;  5G30 A;  1H75 A;  2LRN A;  1O8X A;  3P90 A;  2BTO T;  2V6O A;  1N2A A;  1JLW A;  4WXT A;  3TJF A;  2MMA A;  4HJM A;  3UEM A;  2PUK C;  5KOW A;  5ELA A;  1ZYP A;  1A2J A;  3EE2 A;  2FWG A;  2JZR A;  2N5F A;  4ECB A;  1OC9 B;  4K2X A;  2LNT A;  5D9W A;  1X9M B;  4IEL A;  3E3E A;  6GST A;  1PRX A;  4CW9 A;  1AQW A;  2GST A;  1DBY A;  5AN1 A;  4EUY A;  1OAZ A;  4K5R A;  2VM1 A;  2HNL A;  3TKQ A;  2VCX A;  3H1N A;  5A4U A;  2VL9 A;  2B6M A;  1A2M A;  4IJ3 A;  3LWA A;  2EIO A;  4ZL7 A;  4POM A;  1UN2 A;  3IRA A;  3HMJ G;  1F3A A;  3JCM L;  2B3S A;  4EXJ A;  5A4W A;  4YAP A;  4DEJ A;  5LCZ A;  1YF0 A;  3M0F A;  5DCG A;  2I3Y A;  1OE7 A;  4MF7 A;  1BG1 A;  5JWO B;  5J4V A;  4DSS B;  3GUS A;  4AJ8 A;  1PGT A;  4KW6 A;  4AKG A;  3LG6 A;  5CAX A;  1BYE A;  5ABR A;  3GX0 A;  3LFL A;  1JZR A;  2JL4 A;  3GV1 A;  3WYW A;  4ZBB A;  1ZZY A;  4MJC A;  3S9F A;  4KA0 A;  1XPV A;  4KAE A;  2O5V A;  3BBY A;  5DQS A;  1ZCP A;  4O5U A;  2ES7 A;  3Q74 A;  2GZP A;  5KN1 A;  5D9T A;  3GH6 A;  3F4S A;  3D5J A;  4QL7 A;  1TOF A;  2GZZ A;  4GST A;  1U87 A;  1K0M A;  2H1G A;  1DSB A;  3HJP A;  3GHA A;  2VCQ A;  1FO5 A;  1SEN A;  3OR5 A;  5ECO B;  1O7U A;  4LMV A;  2DIY A;  5FHI A;  1KNG A;  4L8E A;  4G01 A;  4E8H A;  3BOA A;  2R3X A;  1X5D A;  3F4T A;  4EIP A;  2CZ2 A;  1ZYE A;  3IK9 A;  2M80 A;  3TKP A;  1K0B A;  5ELG A;  5ECH B;  3M1G A;  5IOW A;  2P31 A;  4FQU A;  3CTF A;  2XPD A;  3GIX A;  3GKN A;  1TRU A;  4NHZ A;  1E2Y A;  2HE3 A;  4HZ4 A;  2H75 A;  3O3T A;  2N5B A;  3UBK A;  2VL3 A;  3CMI A;  3TJK A;  4NAX A;  2B5Y A;  4V2N A;  1XW5 A;  3DXB A;  2H70 A;  3ZML A;  1V57 A;  3ME7 A;  2IFQ B;  5KEJ A;  3I6A A;  2LJR A;  4I6X A;  2REM A;  1USB A;  1B4P A;  3IDV A;  2LS5 A;  4I97 A;  4WKW A;  2VM2 A;  3QDN A;  4RUV A;  3F3R A;  1GUH A;  5JWR B;  5HR1 A;  3NOF A;  1PX7 A;  1ERW A;  2IME A;  1GNE A;  16GS A;  1BF5 A;  1AAZ A;  1ZL9 A;  1ERV A;  2NVL A;  2AAW A;  1TTZ A;  1XOB A;  5D8I A;  4IP1 A;  2H1B A;  4BVX B;  1TRV A;  2XBI A;  1FAA A;  4YQV A;  4POB A;  1CQG A;  2H30 A;  3HKR A;  5BMU B;  2K9F A;  1EOH A;  1O73 A;  4XIH A;  1ZYQ B;  1OKT A;  3TOU A;  1BX9 A;  1FVK A;  1YF1 A;  2DBC A;  4G0L A;  3M8N A;  2HZF A;  3H4K A;  4EVM A;  4WF5 A;  2YPM A;  2GVP A;  4TR1 A;  5DQY A;  1QUW A;  1YY7 A;  4AGS A;  1JHB A;  3APO A;  1ZMA A;  4HU9 A;  3GNJ A;  2HQT A;  4ECI A;  1JFU A;  4NWY A;  2DIZ A;  3IV4 A;  5A34 A;  4N0V A;  3F8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...