5A4VA

Atgstf2 from arabidopsis thaliana in complex with quercetin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
AGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 84
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a4vA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a4vA01
1NM3A 3LXZA 5HFKA 1UA5A 5F07A 4ECIA 1GSUA 4BVYB 3DRNA 4TKYA 5IMDA 4EKZA 2KP1A 3VURA 1VF1A 3M9KA 4EO3A 5CRWA 1TI1A 5CRGA 1J9BA 4NWYA 2F8AA 2HSMB 1PL2A 3EMPA 2VD0A 3GA4A 4I2UA 3F8UA 5A5KA 1SL1B 4ECCA 4OO4A 5J41A 2C0FA 3G9BA 3HJPA 3LYPA 1YDKA 1K0OA 4MJCA 2XHFA 3KZQA 5CREA 4V2NA 3W8JA 6GSYA 4G10A 2ES7A 5AIVA 2FWGA 4I97A 2NBSA 2ZUPA 4WR4A 2VLTA 2FHEA 1ZYQB 3GL5A 3MDKA 3F6DA 4JZQA 3US3A 2YPMA 1V2AA 3KXOA 4IBPA 4KB3A 2H01A 2YNXA 3HVXA 3ZVJA 2VCQA 4K9ZA 4AGSA 4EE0A 1XWGA 4TXOA 1B4PA 3TKSC 5HR0A 2ON7A 5JWQB 3TRXA 4TR0A 4IJ3A 3EURA 2GSRA 2QKEA 1ERTA 4MDCA 3RPPA 2MZCA 3C73A 1ZCPA 2GZZA 3UBLA 2XPEA 4USSA 2EC4A 1F3AA 2GQKA 1W4VA 5DQSA 2L57A 7GSSA 2JL4A 4FH8A 1SD8A 1DUGA 3F0IA 2X99A 11GSA 3IC8A 3GSTA 3TJBA 4MA9A 3GKKA 4BVXA 4K1FA 2FY6A 2X64A 4MPFA 3L78A 4BWSA 4O5RA 2WDUA 1T7PB 4WBJA 3QDNA 3M0FA 3CTFA 4POLA 3HDCA 5HR2A 4NXIA 2B6MA 1TW9A 4XTSA 4ILFA 1QMVA 2ZCTA 1R7HA 3CSIA 4IW9A 4LMWA 4GQCA 4OMVA 2DMMA 3TKSA 3ZZXA 2HZFA 4LL4B 5J4UA 2VM2A 2HRKB 1V9WA 1FB0A 1ERVA 2C4JA 2LJKA 5KN3A 3HJMA 2DJ2A 3F4RA 1Y25A 2HSHA 3TKSE 2FD3A 4PNFA 1B48A 2O89A 3IHQA 2AB6A 4L0WA 1T00A 1M2AA 5LNKe 16GSA 1GRXA 2HRNA 2C80A 4GSSA 4GLTA 2JZRA 1AQVA 2VCXA 2MBTA 2H1DA 2H1BA 4GXZA 1OE8A 3GMFA 4I6XA 3C8EA 5FWGA 1NHOA 2C3TA 5HR1A 2GTUA 5D9WA 2WULA 1SKWB 3TJKA 3KTBA 2MMZA 4TW5A 3MWHA 4K7OA 5JCUA 4N0VA 1GNWA 1BJXA 3HZ4A 2LS5A 4XCSA 4BPYA 2NVLA 3FR3A 3D6IA 1SD9A 3GSSA 4EDZA 4ULXA 1WRYA 2AYTA 3RBTA 1SK1A 4DSRA 2IJYA 3UL3A 1GTIA 1ST9A 5DJLA 1IYIA 1JZRA 1O81A 3D4MA 4D73B 3DGQA 2GS3A 1PX6A 1XOBA 3ZLPA 5DALA 1FVJA 1C72A 5IMVA 4J2FA 2G0FA 2BTOT 4MJBA 3GL3A 4MZBA 4KNDA 5B6NA 5IMFA 3KMOA 1MDJA 4POBA 4IVFA 1USBA 4WETA 5AIXA 2H19A 4I2TA 1X9MB 4RQXA 4JR4A 2VOCA 3IAS2 1GUKA 4GCIA 4HI7A 3HJOA 2B5XA 2CQ9A 3P7XA 2NTOA 2X8HA 5GAPD 1EEJA 4NHWA 4JE1A 2JACA 5IOXA 1N2AA 4K8MA 2EIOA 1OKTA 3RAZA 3DVXA 3IOSA 3GKXA 3FZ4A 2H75A 4X1UA 2PBJA 4OFTA 2ON5A 2AUVA 4OFMA 2KLXA 3WGXA 3RPNA 3S9FA 2J23A 3QMXA 1RQMA 4MJAA 5ECQB 1V58A 4XRAA 4YQMA 3FHKA 4ML1A 2H8LA 3L9VA 3BJ5A 1FG4A 2DBCA 3EWLA 2R2JA 2XBIA 3LG6A 5DAKA 4KAEA 1SK2A 3BD2A 3VFIA 1PSQA 2H74A 3QPMA 2LRTA 2I3YA 3F9UA 1M7TA 3KGKA 3APSA 3GX0A 1SJZA 3FZAA 1R26A 4EL1A 1XBSA 1BQ7A 1B4QA 2VCVA 1SJIA 3TKRA 2OE0A 3QFBC 4PURA 2H72A 2X8CA 1R5PA 4JBBA 3H1NA 2YWIA 4I5QA 4NMUA 1RW1A 1DE1A 3GURA 5DJMA 5IPHA 4MABA 4O32A 5ID2B 1OVNA 4K2DA 4DSSA 4F2IA 2VL9A 2H73A 3CSJA 4HZ4A 2K8VA 1X5CA 1EV4A 2H6ZA 2KP2A 3BBYA 4OO5A 1O6JA 1Q98A 1J08A 3TKPA 5IMCA 1PL1A 4KH7A 2L5OA 1WP0A 2WJUA 2K6VA 1KBNA 4AJ8A 1UVZA 3Q74A 1YKCA 2B1LA 3MSZA 2G2QA 2IWTA 2X8GA 3WGDA 2DC5A 4BL7A 2H0IA 3F6FA 4E8EA 4JR6A 1HNBA 3E9JB 3O76A 4P3YB 3HZ8A 1HYUA 3CBUA 2ZNMA 2RUEA 3ME7A 1SJ6A 2PN8A 2MBSA 3J7Yk 1YJ6A 4DSQA 3UAPA 2L4QA 1V40A 1ILOA 2YWNA 1GTBA 2PUKC 4KUNA 4N11A 1SL0B 2K9FA 1HNCA 4HOJA 4GTUA 4TXOB 4KCAA 22GSA 1K0CA 9GSSA 3EYTA 2VO4A 5E4WA 1VF2A 3KJYA 2GQLA 3NOFA 4G0KA 4TR1A 2JZTA 3CYNA 2R37A 2RLIA 1ABAA 4V1Ap 5BMUA 5AGYA 3O6TA 2LQOA 2DJ0A 4KDUA 5F0GA 3APQA 1UC7A 5C04A 4KGIA 3CTGA 4BA7A 5DQYA 3ZFLA 3LGCA 2FWFA 3TKQA 1GWCA 2CT6A 3QFAC 5ECNB 5EL8A 4ID0A 3TJFA 4XS4B 1K0DA 4HS1A 3CRTA 2CX3A 2R3XA 2JSYA 1TI3A 18GSA 2IMEA 3WT1A 3NZNA 3PINA 3QCPA 1XXUA 5D9XA 4AJ7A 4WXTA 2IFQB 12GSA 3DKSA 4KSOA 4J56E 3HVVA 3A3TA 1THXA 2H6XA 1XFLA 3VI5A 2O87A 4GRFA 1PD21 2O8VB 4BWQA 1HNAA 2B1KA 1E2YA 4Q5NA 4N30A 1YZXA 4K7NA 3FZ9A 4KA0A 1JZOA 1G0TA 1BAYA 3UARA 3ZMKA 4XRDA 1DE2A 2VAFA 4OD7A 1TRWA 2VLUA 5J9BA 3GKMA 4MK3A 1TJDA 3PPUA 1M0UA 1G7EA 5LD0A 3DVWA 1WJKA 4GWRA 3HHVA 4MZCA 2LSTA 1FB6A 5INYA 3W8SA 2YZHA 4GF0A 2VLVA 5IMAA 4XIHA 4MF7A 3P2AA 2AJQB 5DCGA 1B9YC 4HEA2 1TRVA 2L6DA 4FO5A 4OWYA 3I43A 4MP4A 3GIXA 3LSZA 2QC7A 4QQ7A 3A5WA 4MH2A 2I4AA 5CP1A 4EDYA 2WRTA 3ERGA 1GSFA 1VF4A 5D73A 4LA1A 2C8UA 2VCWA 3L9SA 3IPZA 3CSHA 2JSZA 4RI6A 5G1KA 5J5NA 5C00A 3ZIVA 2F9SA 3OR5A 4ZL8A 1OC9A 4QL9A 3VK9A 1YQ1A 3IE3A 2I81A 2V1MA 2GZYA 2E7PA 1KNGA 5ECRB 3VI7A 5GSSA 4FIWA 3GRXA 4PQIA 4WF4A 3V1WA 4RQRA 2LKUA 1A0FA 2LQQA 1PQNA 2GT6A 5IMZA 5IO0A 1WPIA 3L0HA 4JRRA 1ML6A 3VWUA 3FEUA 4AF2A 5IQYA 1GUHA 2D2ZA 2YZUA 2R4VA 4KCEA 1K3LA 5ELAA 1OC3A 1ZL9A 1XIYA 2YWOA 2YV9A 3DEXA 3EVIA 1K0BA 4IQAA 2L5LA 2PERA 5DAKB 1XPVA 4MH3A 5ECKB 3KD0A 3AY8A 1TTZA 4ZBBA 2F3MA 1EV9A 2AHEA 2C0GA 8GSSA 2EIQA 2FA8A 3F3QA 1A8LA 4BVYA 4KW6A 1BG5A 3JCML 2CX4A 3UEMA 1X9WB 5JWOB 3FW2A 2GSSA 1T3BA 5HFGA 5A4WA 1NW2A 3J7Yb 5G1LA 4K7IA 1M99A 2CA8A 5B8AA 3LFLA 2MMOA 4EC0A 3GH9A 4IQ1A 5H5SA 1JFUA 3BCIA 5EPFA 2HFDA 3H93A 1JLVA 4NPBA 1XW9A 1A24A 6GSVA 4OCEA 3IXRA 1ACVA 5DCHA 3WYWA 4AJ6A 1AQWA 4ZL7A 2FNOA 4G2EA 1NSWA 4ZBDA 2MMAA 2LTKA 3I6AA 1OKDA 3EU4A 2KUCA 2OKAA 1QK8A 3ZREA 1F3BA 3VPTA 3LQ7A 1OE7A 1Z5YE 1GUMA 4G0LA 1OC8A 1YF0A 4KE3A 3D21A 5ABRA 2BMXA 1GSDA 1Z9HA 2HRAA 4BL7B 10GSA 4LL1B 2REMA 3TCOA 2LNSA 3KCMA 3Q6OA 2V41A 1XVWA 2HRFA 4FYBA 1SKRB 5CYYA 3TUEA 1XW5A 4GQFA 3VPQA 19GSA 3IDVA 5J9CA 1MD3A 5FHIA 5G30A 3G7YA 4L0UA 2HI7A 4V2LA 2FGXA 2IPAA 4DVCA 4JEDA 3CMIA 4K0GA 1WIKA 1BX9A 2M72A 3FZ5A 1H4OA 4HU7A 2YCDA 3F3RA 1KEBA 1VGLA 1XCCA 2AV4A 1QXHA 1YEPA 3EU3A 4EXJA 1MDIA 1GLQA 1TRUA 2A4VA 1FAAA 2YJ7A 1SU9A 2LJAA 3H4KA 2DIYA 1XW6A 4OCFA 2VL2C 3LYKA 1F2EA 2GSTA 3IBHA 3GYKA 1TK5B 3QOUA 5A4VA 6GSWA 2A2SA 4TOPA 3WT2A 1Z3EA 4FYCA 6GSUA 4MPGA 3D5JA 1ZOFA 5DBQA 2DIZA 5DDLA 3K8NA 3N9JA 4ZILA 1T8EB 1DBYA 1K0MA 2FUG2 1AIUA 2ALBA 3PGTA 4G0IA 5H5RA 1QUWA 6GSXA 2GGTA 1E6BA 4F03A 1MEKA 3ISOA 1AAZA 3HXSA 1GNEA 1YKAA 3A2XA 3KP9A 1M2DA 4V1Ag 4MF6A 3C1SA 4PUAA 5LCZA 4PNGA 3GKNA 2FWEA 3BOAA 3PH9A 2UZ8A 1J0FA 5F8BA 1LJRA 1EOHA 2NPBA 3UMAA 2LJRA 1PN9A 2P0GA 2H70A 2B5EA 3L4NA 3FRCA 2V2GA 1T1VA 4I8BA 3F4SA 3G7IA 2N5BA 3LEFA 3TOTA 4PQHA 3U6VA 4E8HA 2TRXA 1ZZYA 5ECOB 2VL2A 1GP1A 1Z6MA 3IAM2 4YAPA 3QR6A 2LNTA 4D73A 2P31A 1A2MA 2GQMA 2XC2A 2WS2A 5KN2A 4XHMA 2C3NA 3EC3A 1A2LA 4ZB9A 2CV4A 5CO3A 4IGJA 3UBKA 4ACSA 3ZVJD 1MD4A 2HLSA 3IK7A 5CNWA 1Y6EA 1G7OA 4HU9A 4IS0A 3KEBA 1EGOA 3TDGA 5HFIA 1X0RA 5JWRB 5ECSA 3HYPA 2PVOC 4HJ2A 5G31A 5ECHB 5GAND 1MDKA 3DWVA 4IN0A 4X0XA 3H8QA 4IHUA 3F63A 1PKZA 2IIYA 2FLSA 1JLWA 2OA7A 4L5LA 4LLRA 1XWCA 1TDIA 1O73A 1HQOA 1AUCA 4F82A 2C0EA 2N5AA 2HSNB 5JCWA 4IELA 5D9TA 4IJIA 4F0BA 2NDOA 3EMXA 1QFNA 1X5EA 1K0NA 5JCGA 1Q4JA 4Q5QA 2C3QA 3CXGA 1AC1A 4MMMA 5F05A 2RM6A 4BVXB 2JZSA 2R5GA 1SK0A 1A23A 3TOUA 5D9VA 4EF0A 2RM5A 3H79A 2HZEA 5KEJA 4HDEA 5H5QA 4NHZA 4MJEA 1EWXA 2H1AA 1TU8A 1XZOA 1A0RP 3ZL5A 2YOIA 2H66A 3WD6A 1VRSD 1TKDB 4KSMA 3ZRDA 3KIJA 2YV7A 3M1GA 3QAWA 1FW1A 2H0GA 17GSA 2I9HA 2K18A 1VF3A 3DMLA 3IV4A 1BEDA 1F37A 2B7KA 2LEGA 2BJXA 4OFNA 1GL8A 1PA3A 4QL7A 2E2MA 3LWAA 2OADA 2DLXA 5ID2A 2VD1A 3ZMLA 3LJRA 2YN1A 2MYGA 2P5RA 2IMDA 1TU7A 1CQGA 4TRXA 4WEYA 1M9AA 2IL3A 1YEXA 2DSAA 1XWKA 4O7HA 4WF5A 3ZYWA 1Z7PA 1ZYEA 4ZBAA 2V6OA 3R3EA 2B3SA 1R5AA 3HD5A 1H75A 3UOMA 4DEJA 3W6GA 3UJ1A 1RK4A 4IKHA 5B6MA 4ECJA 2O85A 3KTLA 3IRAA 1EOGA 4MLYA 2QSIA 1AXDA 4TR4A 3D4TA 2J9HA 4PUFC 2B5YA 4PQ1A 4POMA 2H6YA 3HA9A 4KDYA 2LV3A 1V98A 4N10A 3ERFA 2YJHA 1SKSB 2KHPA 1X5DA 5DALB 6GSTA 2QGVA 2LRNA 3VWXA 3P90A 4WBRD 4Q5RA 1YY7A 2CZ2A 1K3YA 5IPGA 1AQXA 3A2WA 3IR4A 2L59A 4HJMA 4MF5A 3CRUA 2DMLA 4CW9A 2YANA 2O7KA 5IM9A 3ERWA 1GTUA 3FYGA 3A2VA 2I1UA 1U3IA 2TRCP 13GSA 3M9JA 2CVKA 3RHCA 1T4YA 4PTSA 2IMFA 2PU9C 1I9DA 3UVTA 3KM6A 1O85A 1KTEA 4NV2A 2CVBA 1GULA 4JU5A 2B7JA 5IO2A 4YQVA 2V32A 3IK9A 2A2RA 4Q5FA 1O7UA 3C71A 4G9HA 4ZIJA 4FYUA 1FOVA 1PX7A 3GUSA 1ON4A 3VWWA 4NAXA 5ECMB 3GTUA 1PMTA 5B8BA 1PRXA 3TJGA 3QAGA 4V2MA 3U5RE 1K3OA 1GLPA 1Z6NA 5D93A 4XS4A 3M8NA 4H86A 2CAIA 1EP8A 4F0CA 4G19A 1JZWA 4MZWA 2PWJA 1TP9A 2IFQA 3DIEA 2DJKA 5ECIB 2XBQA 3BCKA 2HNLA 5ELGA 5KN0A 5CAXA 5HR3A 2PMTA 4ECBA 1SYXA 3EINA 4YQUA 5E59A 1G6YA 5G2ZA 2CAQA 2WGRA 2HE3A 4FQUA 2HSYA 3QD9A 4XS6A 1CQHA 3KMNA 1SL2B 3TGZA 3RDWA 2VM1A 2HSMA 4ZXGA 1PKWA 3TB2A 2H71A 1URMA 2OBKA 2VIMA 3HKRA 1QGVA 1X9SB 3KH7A 3MAKA 1FHEA 2H0HA 1GSEA 4Z7XA 4YAVA 4CHSA 3SWLA 3FY7A 4DSSB 3DXBA 3WGEA 1ZGNA 4TN8A 5HQPA 3LXTA 2MMNA 2RUFA 2H1GA 1M2BA 3UVHA 5GZZB 2C0DA 5G5EA 4XS1A 1U87A 5G5FA 2C1YA 2M80A 2VCTA 1OYJA 2K8SA 4CDOA 4K0NA 2AAWA 1UN2A 4L5OA 3GH6A 1WOUA 4EVMA 5AISA 2LUSA 2HQTA 4HQSA 5CRHA 1SENA 2PVQA 2VCZA 2CVDA 3KP8A 1ZMAA 1GSYA 2WB9A 2HYXA 3M3MA 1TOFA 1TK0B 1EP7A 2M46A 2L6CA 1THOA 2GSQA 5FT3A 1XWAA 1I5GA 2P5QA 1GTAA 5L71A 1MTCA 1M9BA 1S3CA 3UIWA 1F6MC 4GSTA 4MCUA 2IMIA 1ERWA 2JADA 3L9UA 1N8JA 4N0ZA 1U3AA 2FWHA 4TR1B 3I9V2 5ECPB 2H30A 2IN3A 1WWJA 1DSBA 1O8XA 20GSA 1F9MA 1XVQA 1A2JA 1EEMA 1TRSA 2PPTA 1XOAA 2IMKA 1JZDA 3HCZA 5EVOA 3DYRA 5IIZA 2HRKA 3D0ZA 3ED3A 3ME8A 1OAZA 1LU4A 4TXVA 1T4ZA 1FO5A 2L4CA 3RHBA 4RI7A 2HZEB 2GVPA 4KX4A 2OE3A 2YWMA 4J57E 1PGTA 1TK8B 2F8FA 1EZKA 2GZPA 2XPDA 3FR6A 3GV1A 4HZ2A 3DD3A 2OE1A 3ZIJA 4KF9A 3LORA 3P8WA 3O3TA 4HUAA 3D22A 4K6XA 3ZFBA 1EGRA 4IP1A 2Z9SA 3G7JA 3KH9A 2GDRA 2GLRA 3F4TA 1HD2A 5ECLB 1LBKA 1GSQA 1O8WA 2KOKA 5D96A 3HVSA 2WZ9A 2OBIA 2F51A 4RUVA 1U88A 3GFKA 3SBCA 4ISDA 3N5OA 5EY6A 1A8YA 2TIRA 4LMVA 1GH2A 5DVBA 1BYEA 5AN1A 3GHAA 4HQZA 4PGTA 4NV5A 1ERUA 1R4WA 3TRPA 1Z7RA 2DJJA 2E2GA 1TXXA 2DJ3A 4WKWA 2WFCA 2OJLA 4KDXA 4ZB8A 4IP6A 3IC4A 1JHBA 1S3AA 2RIIA 3E0UA 3HY2A 3VLNA 3FKFA 4YH2A 1NHYA 1U6TA 2YP6A 3ZITA 2OACA 1FVKA 14GSA 3TRQA 4PXOA 3IA1A 2FCHA 3GN3A 2V6KA 5CRDA 1B8XA 1SYRA 3VWVA 1AW9A 4EUYA 3GNJA 3C7MA 1OC9B 2DJ1A 2EIRA 3PR8A 2JU5A 4X43A 5A4UA 2H76A 4POKA 3I69A 2E0QA 3Q18A 4TR3A 3GX8A 3R2QA 3QAVA 3APOA 1YF1A 5F06A 3C1RA 2CZ3A 4GSNA 1GSSA 4ZL9A 5KN1A 4F9ZA 5J3RA 2VL3A 3ZTLA 4PX1A 5GSTA 1G6WA 3TJJA 3GTUB 5IOWA 5B7CA 3MNGA 1K0AA 2GT5A 5D8IA 5ENUA 1WMJA 1WE0A 3Q19A 3FK8A 2WCIA 1QQ2A 1XWBA 2N5FA 6GSSA 4O92A 2VUPA 3E3EA 3EE2A 3FR9A 2FA4A 1IYHA 4L8EA 1V57A 4ZB6A 4WR5A 4TVEA 2R6KA 2PGTA 1W89A 1S3DA 2HT9A 2HXKA 1B9XC 5COHA 2LRCA 4ML6A 3NIVA
chains in the Genus database with same CATH superfamily
1NM3A 3LXZA 5HFKA 1UA5A 5F07A 4ECIA 1GSUA 4BVYB 3DRNA 4TKYA 5IMDA 4EKZA 2KP1A 3VURA 1VF1A 3M9KA 4EO3A 5CRWA 1TI1A 5CRGA 1J9BA 4NWYA 2F8AA 2HSMB 1PL2A 3EMPA 2VD0A 3GA4A 4I2UA 3F8UA 5A5KA 1SL1B 4ECCA 4OO4A 5J41A 2C0FA 3G9BA 2VKZG 3HJPA 1YDKA 3LYPA 1K0OA 4MJCA 2XHFA 3KZQA 5CREA 4V2NA 3W8JA 6GSYA 4G10A 2ES7A 5AIVA 2FWGA 4I97A 2H1LA 2NBSA 2ZUPA 4WR4A 2VLTA 2FHEA 1ZYQB 3GL5A 3MDKA 3F6DA 4JZQA 3US3A 2YPMA 1V2AA 3KXOA 4IBPA 4KB3A 2H01A 2YNXA 3HVXA 3ZVJA 2VCQA 4K9ZA 4AGSA 4EE0A 1XWGA 4TXOA 1B4PA 3TKSC 5HR0A 2ON7A 5JWQB 3TRXA 4TR0A 4IJ3A 3EURA 2GSRA 2QKEA 1ERTA 4MDCA 3RPPA 2MZCA 3C73A 1ZCPA 2GZZA 3UBLA 2XPEA 4A5PA 4USSA 2EC4A 1F3AA 2GQKA 1W4VA 5DQSA 2L57A 7GSSA 2JL4A 4FH8A 2DKHA 1SD8A 1DUGA 3CQFA 3F0IA 2X99A 11GSA 3IC8A 3GSTA 3TJBA 4MA9A 3GKKA 4BVXA 4K1FA 2FY6A 2X64A 4MPFA 3L78A 4BWSA 2QA2A 4O5RA 2WDUA 4W66A 1T7PB 4WBJA 3QDNA 3M0FA 3CTFA 4POLA 3HDCA 5HR2A 4NXIA 2B6MA 1TW9A 1S3RA 4XTSA 4ILFA 1QMVA 2ZCTA 1R7HA 3CSIA 4IW9A 4LMWA 4GQCA 4OMVA 2DMMA 3TKSA 3RFRC 2DKIA 3ZZXA 2HZFA 4LL4B 5J4UA 2VM2A 2R0CA 2HRKB 1V9WA 1FB0A 1ERVA 2C4JA 2LJKA 5KN3A 3HJMA 2DJ2A 3F4RA 1Y25A 2HSHA 3TKSE 2FD3A 4PNFA 1B48A 2O89A 3IHQA 2AB6A 4L0WA 1T00A 4PI0C 1M2AA 5LNKe 16GSA 1GRXA 2HRNA 2C80A 4GSSA 4GLTA 2JZRA 1AQVA 1ZYPA 2VCXA 2MBTA 2H1DA 2H1BA 4GXZA 1OE8A 3GMFA 4I6XA 3C8EA 5FWGA 1NHOA 2C3TA 5HR1A 2GTUA 5D9WA 2WULA 1SKWB 3TJKA 3KTBA 2MMZA 4TW5A 3MWHA 4K7OA 5JCUA 4N0VA 1GNWA 1BJXA 3HZ4A 2LS5A 4XCSA 4BPYA 2NVLA 3FR3A 3D6IA 5A34B 1SD9A 3GSSA 4EDZA 4ULXA 1WRYA 2AYTA 3RBTA 1SK1A 4DSRA 2IJYA 3UL3A 1GTIA 1ST9A 5DJLA 1IYIA 1JZRA 1O81A 3D4MA 4D73B 3DGQA 2GS3A 1PX6A 1XOBA 3ZLPA 4QMKA 5DALA 1FVJA 1C72A 5IMVA 4J2FA 2G0FA 2BTOT 4MJBA 3GL3A 4MZBA 4KNDA 5B6NA 5IMFA 3KMOA 1MDJA 4POBA 4IVFA 1USBA 4WETA 5AIXA 2H19A 4I2TA 1X9MB 4RQXA 4JR4A 4Z2UA 2VOCA 3IAS2 1GUKA 4GCIA 4HI7A 3HJOA 2B5XA 2CQ9A 3P7XA 2NTOA 2X8HA 5GAPD 1EEJA 4NHWA 4JE1A 2JACA 5IOXA 1N2AA 4K8MA 2EIOA 1OKTA 3RAZA 3DVXA 3IOSA 3GKXA 3FZ4A 2H75A 4X1UA 2PBJA 4OFTA 2ON5A 2AUVA 4OFMA 2KLXA 3WGXA 4K2XA 2EFHA 3RPNA 3S9FA 2J23A 3QMXA 1RQMA 4MJAA 5ECQB 4HSCX 1V58A 2QA1A 4CY8A 4XRAA 4YQMA 3FHKA 4ML1A 2H8LA 3L9VA 3BJ5A 1FG4A 2DBCA 3EWLA 2R2JA 2XBIA 3LG6A 5DAKA 4KAEA 1SK2A 3BD2A 1Y1UA 3VFIA 1PSQA 2H74A 3QPMA 2LRTA 2I3YA 3F9UA 4AKIA 1M7TA 3KGKA 3APSA 3GX0A 1SJZA 2O3EA 3FZAA 1R26A 4EL1A 1XBSA 1BQ7A 1B4QA 2VCVA 1FOHA 1SJIA 3TKRA 2OE0A 1TXUA 3QFBC 4PURA 2H72A 2X8CA 1R5PA 4JBBA 3H1NA 2YWIA 4I5QA 4NMUA 1RW1A 1DE1A 3GURA 2EFDA 5DJMA 5IPHA 4MABA 4O32A 5ID2B 1OVNA 4K2DA 4Z2RA 4DSSA 4F2IA 2VL9A 2H73A 3CSJA 4HZ4A 2K8VA 1X5CA 1EV4A 2H6ZA 2UV8G 2KP2A 3BBYA 4OO5A 1O6JA 1Q98A 1J08A 3TKPA 5IMCA 2EFCA 1PL1A 4KH7A 2L5OA 1WP0A 2WJUA 2K6VA 1KBNA 4AJ8A 1UVZA 3Q74A 1YKCA 2B1LA 3MSZA 2G2QA 2IWTA 2X8GA 3WGDA 2DC5A 4BL7A 5A5HB 2H0IA 3F6FA 4E8EA 4JR6A 1HNBA 3E9JB 3O76A 4P3YB 4EIQA 3HZ8A 1HYUA 3CBUA 2ZNMA 2RUEA 3ME7A 1SJ6A 5J47A 2PN8A 2MBSA 3J7Yk 1YJ6A 4DSQA 3UAPA 2L4QA 1V40A 1ILOA 2YWNA 1GTBA 2PUKC 4KUNA 4N11A 1SL0B 2K9FA 1HNCA 4HOJA 4GTUA 4TXOB 4KCAA 22GSA 1K0CA 9GSSA 3EYTA 2VO4A 3RGBC 5E4WA 1VF2A 3KJYA 2GQLA 3NOFA 4G0KA 5A1NA 4TR1A 1ZYNA 5J40A 2JZTA 3CYNA 2R37A 2WVXA 2RLIA 1ABAA 4V1Ap 5BMUA 5AGYA 3O6TA 2LQOA 2DJ0A 4KDUA 5F0GA 3APQA 4PHZC 1UC7A 5C04A 4KGIA 3CTGA 4BA7A 5DQYA 3ZFLA 3LGCA 2FWFA 3HVNA 3TKQA 1GWCA 2CT6A 3EPTA 3QFAC 5ECNB 5EL8A 4ID0A 3TJFA 4XS4B 1K0DA 4HS1A 3CRTA 2CX3A 2R3XA 2JSYA 1TI3A 18GSA 2IMEA 3WT1A 3NZNA 3PINA 3QCPA 1XXUA 5D9XA 4AJ7A 4WXTA 2IFQB 12GSA 3DKSA 4KSOA 4YKGA 4J56E 3HVVA 3A3TA 1THXA 4O5UA 2H6XA 1XFLA 3VI5A 2O87A 4GRFA 4CY6A 1PD21 3LW9A 2O8VB 4BWQA 1HNAA 2B1KA 1N25A 1E2YA 4Q5NA 4N30A 1YZXA 4K7NA 3FZ9A 4KA0A 1JZOA 1G0TA 1BAYA 3UARA 3ZMKA 4XRDA 1DE2A 2VAFA 4OD7A 1TRWA 2VLUA 5J9BA 3GKMA 4MK3A 1TJDA 3PPUA 1M0UA 1G7EA 5LD0A 3DVWA 1WJKA 4GWRA 1M3IA 3HHVA 4MZCA 2LSTA 1FB6A 5INYA 3W8SA 2O5VA 2YZHA 4GF0A 2VLVA 5IMAA 4AKXB 4XIHA 4MF7A 5KOWA 3P2AA 2AJQB 5DCGA 1B9YC 4HEA2 1TRVA 2L6DA 4FO5A 4OWYA 3I43A 2WVZA 4MP4A 3GIXA 3LSZA 2QC7A 4QQ7A 3A5WA 4MH2A 2I4AA 5CP1A 4EDYA 2WRTA 3ERGA 1GSFA 1VF4A 5D73A 4LA1A 2C8UA 2HSNA 2VCWA 3L9SA 3IPZA 3CSHA 2JSZA 4RI6A 5G1KA 5J5NA 5C00A 3ZIVA 2F9SA 3OR5A 4ZL8A 1OC9A 4QL9A 3VK9A 4AKHA 1YQ1A 3IE3A 2I81A 2V1MA 2GZYA 2E7PA 1KNGA 5ECRB 3VI7A 5GSSA 4FIWA 3GRXA 4PQIA 4WF4A 3V1WA 4RQRA 3MYDA 2LKUA 1A0FA 2LQQA 1PQNA 2GT6A 5IMZA 5IO0A 1WPIA 3L0HA 4JRRA 1ML6A 3VWUA 3FEUA 4AI6A 4AF2A 5IQYA 1GUHA 2D2ZA 2YZUA 2R4VA 4KCEA 1K3LA 5ELAA 1OC3A 1ZL9A 1XIYA 2YWOA 2YV9A 3DEXA 3EVIA 1K0BA 4IQAA 2L5LA 2PERA 5DAKB 1XPVA 4MH3A 5ECKB 3KD0A 3AY8A 1TTZA 4ZBBA 2F3MA 1EV9A 2AHEA 2C0GA 8GSSA 2A2PA 2EIQA 4K5RA 2FA8A 3F3QA 1A8LA 4BVYA 4KW6A 1BG5A 3JCML 2CX4A 3UEMA 1X9WB 5JWOB 3FW2A 2GSSA 1T3BA 5HFGA 5A4WA 1NW2A 4G01A 3J7Yb 5G1LA 4K7IA 1M99A 2CA8A 5B8AA 3LFLA 2MMOA 4EC0A 3GH9A 4IQ1A 5H5SA 1JFUA 3BCIA 5EPFA 2HFDA 3H93A 1JLVA 4NPBA 1XW9A 1A24A 6GSVA 4OCEA 3IXRA 1ACVA 5DCHA 3WYWA 4AJ6A 1AQWA 4ZL7A 2FNOA 4G2EA 1NSWA 4ZBDA 2MMAA 2LTKA 3I6AA 1OKDA 3EU4A 2KUCA 2OKAA 1QK8A 3ZREA 1F3BA 3VPTA 1SVLA 3LQ7A 1OE7A 1Z5YE 1YEWC 1GUMA 4G0LA 1OC8A 1YF0A 4KE3A 3D21A 5ABRA 2BMXA 1GSDA 1Z9HA 2A4HA 2HRAA 4BL7B 10GSA 4LL1B 3CHXC 2REMA 3TCOA 2LNSA 3KCMA 3Q6OA 2V41A 1XVWA 2HRFA 4FYBA 1SKRB 5CYYA 3TUEA 1XW5A 4GQFA 3VPQA 19GSA 2R0GA 3IDVA 5J9CA 1MD3A 5FHIA 5G30A 3G7YA 4L0UA 2O36A 2HI7A 2X4AA 4V2LA 2FGXA 2IPAA 4DVCA 4JEDA 3CMIA 4K0GA 1WIKA 1BX9A 2M72A 3FZ5A 1H4OA 4HU7A 2YCDA 3F3RA 1KEBA 1VGLA 1XCCA 2AV4A 1QXHA 1YEPA 3EU3A 4EXJA 2WW3A 1MDIA 1GLQA 4BIKA 1TRUA 2A4VA 1FAAA 2YJ7A 1SU9A 2LJAA 3H4KA 2DIYA 1XW6A 4OCFA 2VL2C 2WW2A 3LYKA 1F2EA 2GSTA 3IBHA 3GYKA 1TK5B 3QOUA 5A4VA 6GSWA 2A2SA 4TOPA 3WT2A 1Z3EA 4FYCA 6GSUA 4MPGA 3D5JA 1ZOFA 5DBQA 2DIZA 5DDLA 3K8NA 3N9JA 4ZILA 1T8EB 1DBYA 4EIPA 4MNNA 1K0MA 2FUG2 1AIUA 1XG8A 2ALBA 3PGTA 4G0IA 5H5RA 1QUWA 6GSXA 2GGTA 1E6BA 4F03A 1MEKA 3ISOA 1AAZA 3HXSA 1GNEA 1YKAA 3A2XA 3KP9A 1M2DA 4V1Ag 4MF6A 3C1SA 4PUAA 5LCZA 4PNGA 3GKNA 2FWEA 3BOAA 3PH9A 2UZ8A 1J0FA 5F8BA 1LJRA 1EOHA 2NPBA 3UMAA 2LJRA 1PN9A 2P0GA 2H70A 2B5EA 3L4NA 3FRCA 2V2GA 1T1VA 4I8BA 3F4SA 3G7IA 2N5BA 3LEFA 3TOTA 4PQHA 3U6VA 4E8HA 2TRXA 1ZZYA 5ECOB 2VL2A 1GP1A 1Z6MA 3IAM2 4YAPA 3QR6A 2LNTA 4D73A 2P31A 1A2MA 2GQMA 2XC2A 2WS2A 5KN2A 4XHMA 2C3NA 3EC3A 1A2LA 4ZB9A 2CV4A 5CO3A 4IGJA 3UBKA 4ACSA 3ZVJD 1MD4A 2HLSA 3IK7A 5CNWA 1Y6EA 1G7OA 4HU9A 4IS0A 3KEBA 1EGOA 3TDGA 5HFIA 1X0RA 5JWRB 5ECSA 3HYPA 2PVOC 4HJ2A 5G31A 5ECHB 5GAND 2WW1A 1MDKA 3DWVA 4IN0A 4X0XA 3H8QA 4IHUA 3F63A 1PKZA 2IIYA 2FLSA 1JLWA 2OA7A 4L5LA 4PI2C 4LLRA 1XWCA 1TDIA 1O73A 1HQOA 1AUCA 4F82A 2C0EA 2N5AA 2HSNB 5JCWA 4IELA 5D9TA 4IJIA 4F0BA 2NDOA 3EMXA 1QFNA 1X5EA 1K0NA 5JCGA 1Q4JA 4Q5QA 2C3QA 3CXGA 1AC1A 4MMMA 5F05A 2RM6A 4BVXB 2JZSA 2R5GA 1SK0A 1A23A 4N3ZA 3TOUA 5D9VA 4EF0A 2RM5A 3H79A 2HZEA 5KEJA 4HDEA 5H5QA 4NHZA 4MJEA 1EWXA 2H1AA 1TU8A 1XZOA 1A0RP 3ZL5A 2YOIA 2H66A 3WD6A 1VRSD 1PFOA 1TKDB 4KSMA 3ZRDA 3KIJA 2YV7A 3M1GA 3QAWA 1FW1A 2H0GA 17GSA 2I9HA 2K18A 1VF3A 3DMLA 3IV4A 3FMWA 1BEDA 1F37A 2B7KA 2LEGA 2BJXA 4OFNA 1GL8A 1PA3A 4QL7A 2E2MA 3LWAA 2OADA 2DLXA 5ID2A 2VD1A 3ZMLA 3LJRA 2YN1A 2MYGA 2P5RA 4O5QA 2IMDA 1TU7A 1CQGA 4TRXA 4WEYA 1M9AA 2IL3A 1YEXA 1SVOA 2DSAA 1XWKA 4O7HA 4WF5A 3ZYWA 1Z7PA 1ZYEA 4ZBAA 2V6OA 3R3EA 5BRTA 2B3SA 1R5AA 3HD5A 1H75A 3UOMA 4DEJA 3W6GA 3UJ1A 1RK4A 4IKHA 5B6MA 4ECJA 2O85A 3KTLA 3IRAA 3HMJG 4FXYP 5A5HA 1EOGA 4MLYA 2QSIA 1AXDA 4TR4A 3D4TA 2J9HA 4PUFC 2B5YA 4PQ1A 4POMA 2H6YA 4YKFA 3HA9A 4KDYA 2LV3A 1V98A 4N10A 3ERFA 2YJHA 1SKSB 2KHPA 1X5DA 5DALB 1S4BP 6GSTA 2QGVA 2LRNA 3VWXA 3P90A 4WBRD 4Q5RA 1YY7A 2CZ2A 1K3YA 5IPGA 3TU3B 1AQXA 3A2WA 3IR4A 2L59A 4HJMA 4MF5A 5J4YA 3CRUA 2DMLA 4CW9A 2YANA 2O7KA 5IM9A 3ERWA 1GTUA 3FYGA 3A2VA 2I1UA 1U3IA 2TRCP 13GSA 3M9JA 2CVKA 3RHCA 1T4YA 4PTSA 2IMFA 2PU9C 1I9DA 1BG1A 4ICYA 3UVTA 3KM6A 1O85A 1KTEA 4NV2A 2CVBA 1GULA 4JU5A 2B7JA 1PN0A 5IO2A 4YQVA 2V32A 3IK9A 2A2RA 4Q5FA 1O7UA 3C71A 4G9HA 4ZIJA 4FYUA 1FOVA 1PX7A 3GUSA 1ON4A 3VWWA 4NAXA 5ECMB 3GTUA 1PMTA 5B8BA 1PRXA 3TJGA 3QAGA 4V2MA 3U5RE 1K3OA 1GLPA 1Z6NA 5D93A 4XS4A 1I1IP 3M8NA 4H86A 2CAIA 1EP8A 4F0CA 4G19A 1JZWA 4MZWA 2PWJA 1TP9A 2IFQA 3DIEA 2DJKA 5ECIB 2XBQA 3BCKA 2HNLA 5ELGA 5KN0A 5CAXA 5HR3A 2PMTA 4ECBA 1SYXA 3EINA 4YQUA 5E59A 2WZSA 1G6YA 5G2ZA 4Z2TA 2CAQA 2WGRA 2HE3A 4FQUA 2HSYA 3QD9A 4XS6A 1CQHA 3KMNA 1SL2B 3TGZA 3RDWA 2VM1A 2HSMA 4ZXGA 1PKWA 3TB2A 2H71A 1URMA 2OBKA 2WW0A 2VIMA 3HKRA 1QGVA 1X9SB 3KH7A 3MAKA 1FHEA 2H0HA 1GSEA 4Z7XA 4YAVA 4CHSA 3SWLA 3FY7A 4DSSB 3DXBA 2EFEA 3WGEA 1ZGNA 4TN8A 5HQPA 3LXTA 2MMNA 2RUFA 2H1GA 1M2BA 3UVHA 4ZB7A 5GZZB 2C0DA 5G5EA 4XS1A 1U87A 5G5FA 2C1YA 2M80A 2VCTA 1OYJA 1M3JA 2K8SA 4CDOA 4K0NA 2AAWA 1UN2A 4L5OA 3GH6A 1WOUA 4EVMA 5AISA 2LUSA 2HQTA 4HQSA 4E68A 5CRHA 1SENA 2PVQA 2VCZA 2CVDA 3KP8A 1ZMAA 1GSYA 2WB9A 2HYXA 3M3MA 1TOFA 1TK0B 1EP7A 2M46A 2L6CA 1THOA 2GSQA 5FT3A 1XWAA 1I5GA 2P5QA 1GTAA 5L71A 1MTCA 1M9BA 1S3CA 3UIWA 1F6MC 4GSTA 4MCUA 2IMIA 1ERWA 2JADA 3A5IA 3L9UA 1N8JA 4N0ZA 1U3AA 2FWHA 5A1NB 4TR1B 3I9V2 5ECPB 2H30A 2IN3A 1SVMA 1WWJA 2WVXB 1DSBA 1O8XA 20GSA 1F9MA 1XVQA 1A2JA 1EEMA 1TRSA 5BMUB 2PPTA 1XOAA 2IMKA 1JZDA 3HCZA 5EVOA 3DYRA 5IIZA 2HRKA 3D0ZA 3ED3A 3ME8A 1OAZA 1LU4A 4TXVA 1T4ZA 1FO5A 2L4CA 3RHBA 4RI7A 2HZEB 2GVPA 4KX4A 2OE3A 2YWMA 4J57E 1PGTA 1TK8B 2F8FA 1EZKA 2GZPA 2XPDA 3FR6A 3GV1A 4HZ2A 3DD3A 2OE1A 3ZIJA 4KF9A 3LORA 3P8WA 3O3TA 4HUAA 3D22A 4K6XA 3ZFBA 1EGRA 4IP1A 2Z9SA 3G7JA 3KH9A 2GDRA 2GLRA 3F4TA 1HD2A 5ECLB 1LBKA 1GSQA 1O8WA 2KOKA 5D96A 3HVSA 2WZ9A 2OBIA 2F51A 4RUVA 5A34A 1U88A 3GFKA 3SBCA 4ISDA 3N5OA 5EY6A 1A8YA 2TIRA 4LMVA 1GH2A 5DVBA 2OT3A 1BYEA 5AN1A 3GHAA 4HQZA 4PGTA 4NV5A 1ERUA 1R4WA 3TRPA 1Z7RA 2DJJA 2E2GA 1TXXA 2DJ3A 2X49A 3IHGA 4WKWA 2WFCA 2OJLA 4KDXA 4ZB8A 4IP6A 3IC4A 1JHBA 1S3AA 2RIIA 3E0UA 3HY2A 3VLNA 3FKFA 4YH2A 1NHYA 1U6TA 5J4VA 2YP6A 3ZITA 2R0PA 2OACA 4AKGA 1FVKA 14GSA 3TRQA 4PXOA 3IA1A 2FCHA 3GN3A 2V6KA 2WVYA 5CRDA 1B8XA 1SYRA 3VWVA 1AW9A 4EUYA 3GNJA 3C7MA 1OC9B 2DJ1A 2EIRA 3PR8A 2JU5A 4X43A 5A4UA 2H76A 4POKA 3I69A 2E0QA 3Q18A 4TR3A 1YVLA 3GX8A 3R2QA 3QAVA 3APOA 1BF5A 1YF1A 5F06A 3C1RA 2CZ3A 4GSNA 1GSSA 4ZL9A 5KN1A 4F9ZA 5J3RA 2VL3A 3ZTLA 3MIXA 4GDFA 4PX1A 5GSTA 1G6WA 3TJJA 3GTUB 5IOWA 5B7CA 3MNGA 1K0AA 2GT5A 5D8IA 5ENUA 5KOXA 1WMJA 1WE0A 3Q19A 3FK8A 4K5SA 2WCIA 1QQ2A 1XWBA 2N5FA 6GSSA 4O92A 2VUPA 3E3EA 3EE2A 3FR9A 2FA4A 1IYHA 4L8EA 3CWGA 1V57A 4ZB6A 4WR5A 4TVEA 2R6KA 2PGTA 1W89A 4X4JA 1S3DA 2HT9A 2HXKA 1B9XC 5COHA 2LRCA 4ML6A 3NIVA
chains in the Genus database with same CATH topology
1NM3A 3LXZA 5HFKA 1UA5A 5F07A 4ECIA 1GSUA 4BVYB 3DRNA 4TKYA 5IMDA 4EKZA 2KP1A 3VURA 1VF1A 3M9KA 4EO3A 5CRWA 1TI1A 5CRGA 1J9BA 4NWYA 2F8AA 2HSMB 1PL2A 3EMPA 2VD0A 3GA4A 4I2UA 3F8UA 5A5KA 1SL1B 4ECCA 4OO4A 5J41A 2C0FA 3G9BA 2VKZG 3HJPA 3LYPA 1YDKA 1K0OA 4MJCA 2XHFA 3KZQA 5CREA 4V2NA 3W8JA 6GSYA 4G10A 2ES7A 5AIVA 2FWGA 4I97A 2H1LA 2NBSA 2ZUPA 4WR4A 2VLTA 2FHEA 1ZYQB 3GL5A 3MDKA 3F6DA 4JZQA 3US3A 2YPMA 1V2AA 3KXOA 4IBPA 4KB3A 2H01A 2YNXA 3HVXA 3ZVJA 2VCQA 4K9ZA 4AGSA 4EE0A 1XWGA 4TXOA 1B4PA 3TKSC 5HR0A 2ON7A 5JWQB 3TRXA 4TR0A 4IJ3A 3EURA 2GSRA 2QKEA 1ERTA 4MDCA 3RPPA 2MZCA 3C73A 1ZCPA 2GZZA 3UBLA 2XPEA 4A5PA 4USSA 2EC4A 1F3AA 2GQKA 1W4VA 5DQSA 2L57A 7GSSA 2JL4A 4FH8A 2DKHA 1SD8A 1DUGA 3F0IA 2X99A 11GSA 3IC8A 3GSTA 3TJBA 4MA9A 3GKKA 4BVXA 4K1FA 2FY6A 2X64A 4MPFA 3L78A 4BWSA 2QA2A 4O5RA 2WDUA 4W66A 1T7PB 4WBJA 3QDNA 3M0FA 3CTFA 4POLA 3HDCA 5HR2A 4NXIA 2B6MA 1TW9A 4XTSA 4ILFA 1QMVA 2ZCTA 1R7HA 3CSIA 4IW9A 4LMWA 4GQCA 4OMVA 2DMMA 3TKSA 2DKIA 3ZZXA 2HZFA 4LL4B 5J4UA 2VM2A 2R0CA 2HRKB 1V9WA 1FB0A 1ERVA 2C4JA 2LJKA 5KN3A 3HJMA 2DJ2A 3F4RA 1Y25A 2HSHA 3TKSE 2FD3A 4PNFA 1B48A 2O89A 3IHQA 2AB6A 4L0WA 1T00A 1M2AA 5LNKe 16GSA 1GRXA 2HRNA 2C80A 4GSSA 4GLTA 2JZRA 1AQVA 1ZYPA 2VCXA 2MBTA 2H1DA 2H1BA 4GXZA 1OE8A 3GMFA 4I6XA 3C8EA 5FWGA 1NHOA 2C3TA 5HR1A 2GTUA 5D9WA 2WULA 1SKWB 3TJKA 3KTBA 2MMZA 4TW5A 3MWHA 4K7OA 5JCUA 4N0VA 1GNWA 1BJXA 3HZ4A 2LS5A 4XCSA 4BPYA 2NVLA 3FR3A 3D6IA 5A34B 1SD9A 3GSSA 4EDZA 4ULXA 1WRYA 2AYTA 3RBTA 1SK1A 4DSRA 2IJYA 3UL3A 1GTIA 1ST9A 5DJLA 1IYIA 1JZRA 1O81A 3D4MA 4D73B 3DGQA 2GS3A 1PX6A 1XOBA 3ZLPA 4QMKA 5DALA 1FVJA 1C72A 5IMVA 4J2FA 2G0FA 2BTOT 4MJBA 3GL3A 4MZBA 4KNDA 5B6NA 5IMFA 3KMOA 1MDJA 4POBA 4IVFA 1USBA 4WETA 5AIXA 2H19A 4I2TA 1X9MB 4RQXA 4JR4A 4Z2UA 2VOCA 3IAS2 1GUKA 4GCIA 4HI7A 3HJOA 2B5XA 2CQ9A 3P7XA 2NTOA 2X8HA 5GAPD 1EEJA 4NHWA 4JE1A 2JACA 5IOXA 1N2AA 4K8MA 2EIOA 1OKTA 3RAZA 3DVXA 3IOSA 3GKXA 3FZ4A 2H75A 4X1UA 2PBJA 4OFTA 2ON5A 2AUVA 4OFMA 2KLXA 3WGXA 4K2XA 2EFHA 3RPNA 3S9FA 2J23A 3QMXA 1RQMA 4MJAA 5ECQB 1V58A 2QA1A 4CY8A 4XRAA 4YQMA 3FHKA 4ML1A 2H8LA 3L9VA 3BJ5A 1FG4A 2DBCA 3EWLA 2R2JA 2XBIA 3LG6A 5DAKA 4KAEA 1SK2A 3BD2A 1Y1UA 3VFIA 1PSQA 2H74A 3QPMA 2LRTA 2I3YA 3F9UA 4AKIA 1M7TA 3KGKA 3APSA 3GX0A 1SJZA 3FZAA 1R26A 4EL1A 1XBSA 1BQ7A 1B4QA 2VCVA 1FOHA 1SJIA 3TKRA 2OE0A 1TXUA 3QFBC 4PURA 2H72A 2X8CA 1R5PA 4JBBA 3H1NA 2YWIA 4I5QA 4NMUA 1RW1A 1DE1A 3GURA 2EFDA 5DJMA 5IPHA 4MABA 4O32A 5ID2B 1OVNA 4K2DA 4Z2RA 4DSSA 4F2IA 2VL9A 2H73A 3CSJA 4HZ4A 2K8VA 1X5CA 1EV4A 2H6ZA 2UV8G 2KP2A 3BBYA 4OO5A 1O6JA 1Q98A 1J08A 3TKPA 5IMCA 2EFCA 1PL1A 4KH7A 2L5OA 1WP0A 2WJUA 2K6VA 1KBNA 4AJ8A 1UVZA 3Q74A 1YKCA 2B1LA 3MSZA 2G2QA 2IWTA 2X8GA 3WGDA 2DC5A 4BL7A 5A5HB 2H0IA 3F6FA 4E8EA 4JR6A 1HNBA 3E9JB 3O76A 4P3YB 4EIQA 3HZ8A 1HYUA 3CBUA 2ZNMA 2RUEA 3ME7A 1SJ6A 5J47A 2PN8A 2MBSA 3J7Yk 1YJ6A 4DSQA 3UAPA 2L4QA 1V40A 1ILOA 2YWNA 1GTBA 2PUKC 4KUNA 4N11A 1SL0B 2K9FA 1HNCA 4HOJA 4GTUA 4TXOB 4KCAA 22GSA 1K0CA 9GSSA 3EYTA 2VO4A 5E4WA 1VF2A 3KJYA 2GQLA 3NOFA 4G0KA 5A1NA 4TR1A 1ZYNA 5J40A 2JZTA 3CYNA 2R37A 2RLIA 1ABAA 4V1Ap 5BMUA 5AGYA 3O6TA 2LQOA 2DJ0A 4KDUA 5F0GA 3APQA 1UC7A 5C04A 4KGIA 3CTGA 4BA7A 5DQYA 3ZFLA 3LGCA 2FWFA 3TKQA 1GWCA 2CT6A 3EPTA 3QFAC 5ECNB 5EL8A 4ID0A 3TJFA 4XS4B 1K0DA 4HS1A 3CRTA 2CX3A 2R3XA 2JSYA 1TI3A 18GSA 2IMEA 3WT1A 3NZNA 3PINA 3QCPA 1XXUA 5D9XA 4AJ7A 4WXTA 2IFQB 12GSA 3DKSA 4KSOA 4YKGA 4J56E 3HVVA 3A3TA 1THXA 4O5UA 2H6XA 1XFLA 3VI5A 2O87A 4GRFA 4CY6A 1PD21 3LW9A 2O8VB 4BWQA 1HNAA 2B1KA 1N25A 1E2YA 4Q5NA 4N30A 1YZXA 4K7NA 3FZ9A 4KA0A 1JZOA 1G0TA 1BAYA 3UARA 3ZMKA 4XRDA 1DE2A 2VAFA 4OD7A 1TRWA 2VLUA 5J9BA 3GKMA 4MK3A 1TJDA 3PPUA 1M0UA 1G7EA 5LD0A 3DVWA 1WJKA 4GWRA 3HHVA 4MZCA 2LSTA 1FB6A 5INYA 3W8SA 2O5VA 2YZHA 4GF0A 2VLVA 5IMAA 4AKXB 4XIHA 4MF7A 5KOWA 3P2AA 2AJQB 5DCGA 1B9YC 4HEA2 1TRVA 2L6DA 4FO5A 4OWYA 3I43A 4MP4A 3GIXA 3LSZA 2QC7A 4QQ7A 3A5WA 4MH2A 2I4AA 5CP1A 4EDYA 2WRTA 3ERGA 1GSFA 1VF4A 5D73A 4LA1A 2C8UA 2HSNA 2VCWA 3L9SA 3IPZA 3CSHA 2JSZA 4RI6A 5G1KA 5J5NA 5C00A 3ZIVA 2F9SA 3OR5A 4ZL8A 1OC9A 4QL9A 3VK9A 4AKHA 1YQ1A 3IE3A 2I81A 2V1MA 2GZYA 2E7PA 1KNGA 5ECRB 3VI7A 5GSSA 4FIWA 3GRXA 4PQIA 4WF4A 3V1WA 4RQRA 3MYDA 2LKUA 1A0FA 2LQQA 1PQNA 2GT6A 5IMZA 5IO0A 1WPIA 3L0HA 4JRRA 1ML6A 3VWUA 3FEUA 4AI6A 4AF2A 5IQYA 1GUHA 2D2ZA 2YZUA 2R4VA 4KCEA 1K3LA 5ELAA 1OC3A 1ZL9A 1XIYA 2YWOA 2YV9A 3DEXA 3EVIA 1K0BA 4IQAA 2L5LA 2PERA 5DAKB 1XPVA 4MH3A 5ECKB 3KD0A 3AY8A 1TTZA 4ZBBA 2F3MA 1EV9A 2AHEA 2C0GA 8GSSA 2A2PA 2EIQA 4K5RA 2FA8A 3F3QA 1A8LA 4BVYA 4KW6A 1BG5A 3JCML 2CX4A 3UEMA 1X9WB 5JWOB 3FW2A 2GSSA 1T3BA 5HFGA 5A4WA 1NW2A 4G01A 3J7Yb 5G1LA 4K7IA 1M99A 2CA8A 5B8AA 3LFLA 2MMOA 4EC0A 3GH9A 4IQ1A 5H5SA 1JFUA 3BCIA 5EPFA 2HFDA 3H93A 1JLVA 4NPBA 1XW9A 1A24A 6GSVA 4OCEA 3IXRA 1ACVA 5DCHA 3WYWA 4AJ6A 1AQWA 4ZL7A 2FNOA 4G2EA 1NSWA 4ZBDA 2MMAA 2LTKA 3I6AA 1OKDA 3EU4A 2KUCA 2OKAA 1QK8A 3ZREA 1F3BA 3VPTA 1SVLA 3LQ7A 1OE7A 1Z5YE 1GUMA 4G0LA 1OC8A 1YF0A 4KE3A 3D21A 5ABRA 2BMXA 1GSDA 1Z9HA 2A4HA 2HRAA 4BL7B 10GSA 4LL1B 2REMA 3TCOA 2LNSA 3KCMA 3Q6OA 2V41A 1XVWA 2HRFA 4FYBA 1SKRB 5CYYA 3TUEA 1XW5A 4GQFA 3VPQA 19GSA 2R0GA 3IDVA 5J9CA 1MD3A 5FHIA 5G30A 3G7YA 4L0UA 2HI7A 2X4AA 4V2LA 2FGXA 2IPAA 4DVCA 4JEDA 3CMIA 4K0GA 1WIKA 1BX9A 2M72A 3FZ5A 1H4OA 4HU7A 2YCDA 3F3RA 1KEBA 1VGLA 1XCCA 2AV4A 1QXHA 1YEPA 3EU3A 4EXJA 1MDIA 1GLQA 1TRUA 2A4VA 1FAAA 2YJ7A 1SU9A 2LJAA 3H4KA 2DIYA 1XW6A 4OCFA 2VL2C 3LYKA 1F2EA 2GSTA 3IBHA 3GYKA 1TK5B 3QOUA 5A4VA 6GSWA 2A2SA 4TOPA 3WT2A 1Z3EA 4FYCA 6GSUA 4MPGA 3D5JA 1ZOFA 5DBQA 2DIZA 5DDLA 3K8NA 3N9JA 4ZILA 1T8EB 1DBYA 4EIPA 4MNNA 1K0MA 2FUG2 1AIUA 2ALBA 3PGTA 4G0IA 5H5RA 1QUWA 6GSXA 2GGTA 1E6BA 4F03A 1MEKA 3ISOA 1AAZA 3HXSA 1GNEA 1YKAA 3A2XA 3KP9A 1M2DA 4V1Ag 4MF6A 3C1SA 4PUAA 5LCZA 4PNGA 3GKNA 2FWEA 3BOAA 3PH9A 2UZ8A 1J0FA 5F8BA 1LJRA 1EOHA 2NPBA 3UMAA 2LJRA 1PN9A 2P0GA 2H70A 2B5EA 3L4NA 3FRCA 2V2GA 1T1VA 4I8BA 3F4SA 3G7IA 2N5BA 3LEFA 3TOTA 4PQHA 3U6VA 4E8HA 2TRXA 1ZZYA 5ECOB 2VL2A 1GP1A 1Z6MA 3IAM2 4YAPA 3QR6A 2LNTA 4D73A 2P31A 1A2MA 2GQMA 2XC2A 2WS2A 5KN2A 4XHMA 2C3NA 3EC3A 1A2LA 4ZB9A 2CV4A 5CO3A 4IGJA 3UBKA 4ACSA 3ZVJD 1MD4A 2HLSA 3IK7A 5CNWA 1Y6EA 1G7OA 4HU9A 4IS0A 3KEBA 1EGOA 3TDGA 5HFIA 1X0RA 5JWRB 5ECSA 3HYPA 2PVOC 4HJ2A 5G31A 5ECHB 5GAND 1MDKA 3DWVA 4IN0A 4X0XA 3H8QA 4IHUA 3F63A 1PKZA 2IIYA 2FLSA 1JLWA 2OA7A 4L5LA 4LLRA 1XWCA 1TDIA 1O73A 1HQOA 1AUCA 4F82A 2C0EA 2N5AA 2HSNB 5JCWA 4IELA 5D9TA 4IJIA 4F0BA 2NDOA 3EMXA 1QFNA 1X5EA 1K0NA 5JCGA 1Q4JA 4Q5QA 2C3QA 3CXGA 1AC1A 4MMMA 5F05A 2RM6A 4BVXB 2JZSA 2R5GA 1SK0A 1A23A 4N3ZA 3TOUA 5D9VA 4EF0A 2RM5A 3H79A 2HZEA 5KEJA 4HDEA 5H5QA 4NHZA 4MJEA 1EWXA 2H1AA 1TU8A 1XZOA 1A0RP 3ZL5A 2YOIA 2H66A 3WD6A 1VRSD 1TKDB 4KSMA 3ZRDA 3KIJA 2YV7A 3M1GA 3QAWA 1FW1A 2H0GA 17GSA 2I9HA 2K18A 1VF3A 3DMLA 3IV4A 3FMWA 1BEDA 1F37A 2B7KA 2LEGA 2BJXA 4OFNA 1GL8A 1PA3A 4QL7A 2E2MA 3LWAA 2OADA 2DLXA 5ID2A 2VD1A 3ZMLA 3LJRA 2YN1A 2MYGA 2P5RA 4O5QA 2IMDA 1TU7A 1CQGA 4TRXA 4WEYA 1M9AA 2IL3A 1YEXA 1SVOA 2DSAA 1XWKA 4O7HA 4WF5A 3ZYWA 1Z7PA 1ZYEA 4ZBAA 2V6OA 3R3EA 5BRTA 2B3SA 1R5AA 3HD5A 1H75A 3UOMA 4DEJA 3W6GA 3UJ1A 1RK4A 4IKHA 5B6MA 4ECJA 2O85A 3KTLA 3IRAA 3HMJG 5A5HA 1EOGA 4MLYA 2QSIA 1AXDA 4TR4A 3D4TA 2J9HA 4PUFC 2B5YA 4PQ1A 4POMA 2H6YA 4YKFA 3HA9A 4KDYA 2LV3A 1V98A 4N10A 3ERFA 2YJHA 1SKSB 2KHPA 1X5DA 5DALB 6GSTA 2QGVA 2LRNA 3VWXA 3P90A 4WBRD 4Q5RA 1YY7A 2CZ2A 1K3YA 5IPGA 3TU3B 1AQXA 3A2WA 3IR4A 2L59A 4HJMA 4MF5A 5J4YA 3CRUA 2DMLA 4CW9A 2YANA 2O7KA 5IM9A 3ERWA 1GTUA 3FYGA 3A2VA 2I1UA 1U3IA 2TRCP 13GSA 3M9JA 2CVKA 3RHCA 1T4YA 4PTSA 2IMFA 2PU9C 1I9DA 1BG1A 4ICYA 3UVTA 3KM6A 1O85A 1KTEA 4NV2A 2CVBA 1GULA 4JU5A 2B7JA 1PN0A 5IO2A 4YQVA 2V32A 3IK9A 2A2RA 4Q5FA 1O7UA 3C71A 4G9HA 4ZIJA 4FYUA 1FOVA 1PX7A 3GUSA 1ON4A 3VWWA 4NAXA 5ECMB 3GTUA 1PMTA 5B8BA 1PRXA 3TJGA 3QAGA 4V2MA 3U5RE 1K3OA 1GLPA 1Z6NA 5D93A 4XS4A 3M8NA 4H86A 2CAIA 1EP8A 4F0CA 4G19A 1JZWA 4MZWA 2PWJA 1TP9A 2IFQA 3DIEA 2DJKA 5ECIB 2XBQA 3BCKA 2HNLA 5ELGA 5KN0A 5CAXA 5HR3A 2PMTA 4ECBA 1SYXA 3EINA 4YQUA 5E59A 1G6YA 5G2ZA 4Z2TA 2CAQA 2WGRA 2HE3A 4FQUA 2HSYA 3QD9A 4XS6A 1CQHA 3KMNA 1SL2B 3TGZA 3RDWA 2VM1A 2HSMA 4ZXGA 1PKWA 3TB2A 2H71A 1URMA 2OBKA 2VIMA 3HKRA 1QGVA 1X9SB 3KH7A 3MAKA 1FHEA 2H0HA 1GSEA 4Z7XA 4YAVA 4CHSA 3SWLA 3FY7A 4DSSB 3DXBA 2EFEA 3WGEA 1ZGNA 4TN8A 5HQPA 3LXTA 2MMNA 2RUFA 2H1GA 1M2BA 3UVHA 4ZB7A 5GZZB 2C0DA 5G5EA 4XS1A 1U87A 5G5FA 2C1YA 2M80A 2VCTA 1OYJA 2K8SA 4CDOA 4K0NA 2AAWA 1UN2A 4L5OA 3GH6A 1WOUA 4EVMA 5AISA 2LUSA 2HQTA 4HQSA 4E68A 5CRHA 1SENA 2PVQA 2VCZA 2CVDA 3KP8A 1ZMAA 1GSYA 2WB9A 2HYXA 3M3MA 1TOFA 1TK0B 1EP7A 2M46A 2L6CA 1THOA 2GSQA 5FT3A 1XWAA 1I5GA 2P5QA 1GTAA 5L71A 1MTCA 1M9BA 1S3CA 3UIWA 1F6MC 4GSTA 4MCUA 2IMIA 1ERWA 2JADA 3A5IA 3L9UA 1N8JA 4N0ZA 1U3AA 2FWHA 5A1NB 4TR1B 3I9V2 5ECPB 2H30A 2IN3A 1SVMA 1WWJA 1DSBA 1O8XA 20GSA 1F9MA 1XVQA 1A2JA 1EEMA 1TRSA 5BMUB 2PPTA 1XOAA 2IMKA 1JZDA 3HCZA 5EVOA 3DYRA 5IIZA 2HRKA 3D0ZA 3ED3A 3ME8A 1OAZA 1LU4A 4TXVA 1T4ZA 1FO5A 2L4CA 3RHBA 4RI7A 2HZEB 2GVPA 4KX4A 2OE3A 2YWMA 4J57E 1PGTA 1TK8B 2F8FA 1EZKA 2GZPA 2XPDA 3FR6A 3GV1A 4HZ2A 3DD3A 2OE1A 3ZIJA 4KF9A 3LORA 3P8WA 3O3TA 4HUAA 3D22A 4K6XA 3ZFBA 1EGRA 4IP1A 2Z9SA 3G7JA 3KH9A 2GDRA 2GLRA 3F4TA 1HD2A 5ECLB 1LBKA 1GSQA 1O8WA 2KOKA 5D96A 3HVSA 2WZ9A 2OBIA 2F51A 4RUVA 5A34A 1U88A 3GFKA 3SBCA 4ISDA 3N5OA 5EY6A 1A8YA 2TIRA 4LMVA 1GH2A 5DVBA 2OT3A 1BYEA 5AN1A 3GHAA 4HQZA 4PGTA 4NV5A 1ERUA 1R4WA 3TRPA 1Z7RA 2DJJA 2E2GA 1TXXA 2DJ3A 2X49A 3IHGA 4WKWA 2WFCA 2OJLA 4KDXA 4ZB8A 4IP6A 3IC4A 1JHBA 1S3AA 2RIIA 3E0UA 3HY2A 3VLNA 3FKFA 4YH2A 1NHYA 1U6TA 5J4VA 2YP6A 3ZITA 2R0PA 2OACA 4AKGA 1FVKA 14GSA 3TRQA 4PXOA 3IA1A 2FCHA 3GN3A 2V6KA 5CRDA 1B8XA 1SYRA 3VWVA 1AW9A 4EUYA 3GNJA 3C7MA 1OC9B 2DJ1A 2EIRA 3PR8A 2JU5A 4X43A 5A4UA 2H76A 4POKA 3I69A 2E0QA 3Q18A 4TR3A 1YVLA 3GX8A 3R2QA 3QAVA 3APOA 1BF5A 1YF1A 5F06A 3C1RA 2CZ3A 4GSNA 1GSSA 4ZL9A 5KN1A 4F9ZA 5J3RA 2VL3A 3ZTLA 3MIXA 4GDFA 4PX1A 5GSTA 1G6WA 3TJJA 3GTUB 5IOWA 5B7CA 3MNGA 1K0AA 2GT5A 5D8IA 5ENUA 5KOXA 1WMJA 1WE0A 3Q19A 3FK8A 4K5SA 2WCIA 1QQ2A 1XWBA 2N5FA 6GSSA 4O92A 2VUPA 3E3EA 3EE2A 3FR9A 2FA4A 1IYHA 4L8EA 3CWGA 1V57A 4ZB6A 4WR5A 4TVEA 2R6KA 2PGTA 1W89A 4X4JA 1S3DA 2HT9A 2HXKA 1B9XC 5COHA 2LRCA 4ML6A 3NIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NM3 A;  3LXZ A;  5HFK A;  1UA5 A;  5F07 A;  4ECI A;  1GSU A;  4BVY B;  3DRN A;  4TKY A;  5IMD A;  4EKZ A;  2KP1 A;  3VUR A;  1VF1 A;  3M9K A;  4EO3 A;  5CRW A;  1TI1 A;  5CRG A;  1J9B A;  4NWY A;  2F8A A;  2HSM B;  1PL2 A;  3EMP A;  2VD0 A;  3GA4 A;  4I2U A;  3F8U A;  5A5K A;  1SL1 B;  4ECC A;  4OO4 A;  5J41 A;  2C0F A;  3G9B A;  3HJP A;  3LYP A;  1YDK A;  1K0O A;  4MJC A;  2XHF A;  3KZQ A;  5CRE A;  4V2N A;  3W8J A;  6GSY A;  4G10 A;  2ES7 A;  5AIV A;  2FWG A;  4I97 A;  2NBS A;  2ZUP A;  4WR4 A;  2VLT A;  2FHE A;  1ZYQ B;  3GL5 A;  3MDK A;  3F6D A;  4JZQ A;  3US3 A;  2YPM A;  1V2A A;  3KXO A;  4IBP A;  4KB3 A;  2H01 A;  2YNX A;  3HVX A;  3ZVJ A;  2VCQ A;  4K9Z A;  4AGS A;  4EE0 A;  1XWG A;  4TXO A;  1B4P A;  3TKS C;  5HR0 A;  2ON7 A;  5JWQ B;  3TRX A;  4TR0 A;  4IJ3 A;  3EUR A;  2GSR A;  2QKE A;  1ERT A;  4MDC A;  3RPP A;  2MZC A;  3C73 A;  1ZCP A;  2GZZ A;  3UBL A;  2XPE A;  4USS A;  2EC4 A;  1F3A A;  2GQK A;  1W4V A;  5DQS A;  2L57 A;  7GSS A;  2JL4 A;  4FH8 A;  1SD8 A;  1DUG A;  3F0I A;  2X99 A;  11GS A;  3IC8 A;  3GST A;  3TJB A;  4MA9 A;  3GKK A;  4BVX A;  4K1F A;  2FY6 A;  2X64 A;  4MPF A;  3L78 A;  4BWS A;  4O5R A;  2WDU A;  1T7P B;  4WBJ A;  3QDN A;  3M0F A;  3CTF A;  4POL A;  3HDC A;  5HR2 A;  4NXI A;  2B6M A;  1TW9 A;  4XTS A;  4ILF A;  1QMV A;  2ZCT A;  1R7H A;  3CSI A;  4IW9 A;  4LMW A;  4GQC A;  4OMV A;  2DMM A;  3TKS A;  3ZZX A;  2HZF A;  4LL4 B;  5J4U A;  2VM2 A;  2HRK B;  1V9W A;  1FB0 A;  1ERV A;  2C4J A;  2LJK A;  5KN3 A;  3HJM A;  2DJ2 A;  3F4R A;  1Y25 A;  2HSH A;  3TKS E;  2FD3 A;  4PNF A;  1B48 A;  2O89 A;  3IHQ A;  2AB6 A;  4L0W A;  1T00 A;  1M2A A;  5LNK e;  16GS A;  1GRX A;  2HRN A;  2C80 A;  4GSS A;  4GLT A;  2JZR A;  1AQV A;  2VCX A;  2MBT A;  2H1D A;  2H1B A;  4GXZ A;  1OE8 A;  3GMF A;  4I6X A;  3C8E A;  5FWG A;  1NHO A;  2C3T A;  5HR1 A;  2GTU A;  5D9W A;  2WUL A;  1SKW B;  3TJK A;  3KTB A;  2MMZ A;  4TW5 A;  3MWH A;  4K7O A;  5JCU A;  4N0V A;  1GNW A;  1BJX A;  3HZ4 A;  2LS5 A;  4XCS A;  4BPY A;  2NVL A;  3FR3 A;  3D6I A;  1SD9 A;  3GSS A;  4EDZ A;  4ULX A;  1WRY A;  2AYT A;  3RBT A;  1SK1 A;  4DSR A;  2IJY A;  3UL3 A;  1GTI A;  1ST9 A;  5DJL A;  1IYI A;  1JZR A;  1O81 A;  3D4M A;  4D73 B;  3DGQ A;  2GS3 A;  1PX6 A;  1XOB A;  3ZLP A;  5DAL A;  1FVJ A;  1C72 A;  5IMV A;  4J2F A;  2G0F A;  2BTO T;  4MJB A;  3GL3 A;  4MZB A;  4KND A;  5B6N A;  5IMF A;  3KMO A;  1MDJ A;  4POB A;  4IVF A;  1USB A;  4WET A;  5AIX A;  2H19 A;  4I2T A;  1X9M B;  4RQX A;  4JR4 A;  2VOC A;  3IAS 2;  1GUK A;  4GCI A;  4HI7 A;  3HJO A;  2B5X A;  2CQ9 A;  3P7X A;  2NTO A;  2X8H A;  5GAP D;  1EEJ A;  4NHW A;  4JE1 A;  2JAC A;  5IOX A;  1N2A A;  4K8M A;  2EIO A;  1OKT A;  3RAZ A;  3DVX A;  3IOS A;  3GKX A;  3FZ4 A;  2H75 A;  4X1U A;  2PBJ A;  4OFT A;  2ON5 A;  2AUV A;  4OFM A;  2KLX A;  3WGX A;  3RPN A;  3S9F A;  2J23 A;  3QMX A;  1RQM A;  4MJA A;  5ECQ B;  1V58 A;  4XRA A;  4YQM A;  3FHK A;  4ML1 A;  2H8L A;  3L9V A;  3BJ5 A;  1FG4 A;  2DBC A;  3EWL A;  2R2J A;  2XBI A;  3LG6 A;  5DAK A;  4KAE A;  1SK2 A;  3BD2 A;  3VFI A;  1PSQ A;  2H74 A;  3QPM A;  2LRT A;  2I3Y A;  3F9U A;  1M7T A;  3KGK A;  3APS A;  3GX0 A;  1SJZ A;  3FZA A;  1R26 A;  4EL1 A;  1XBS A;  1BQ7 A;  1B4Q A;  2VCV A;  1SJI A;  3TKR A;  2OE0 A;  3QFB C;  4PUR A;  2H72 A;  2X8C A;  1R5P A;  4JBB A;  3H1N A;  2YWI A;  4I5Q A;  4NMU A;  1RW1 A;  1DE1 A;  3GUR A;  5DJM A;  5IPH A;  4MAB A;  4O32 A;  5ID2 B;  1OVN A;  4K2D A;  4DSS A;  4F2I A;  2VL9 A;  2H73 A;  3CSJ A;  4HZ4 A;  2K8V A;  1X5C A;  1EV4 A;  2H6Z A;  2KP2 A;  3BBY A;  4OO5 A;  1O6J A;  1Q98 A;  1J08 A;  3TKP A;  5IMC A;  1PL1 A;  4KH7 A;  2L5O A;  1WP0 A;  2WJU A;  2K6V A;  1KBN A;  4AJ8 A;  1UVZ A;  3Q74 A;  1YKC A;  2B1L A;  3MSZ A;  2G2Q A;  2IWT A;  2X8G A;  3WGD A;  2DC5 A;  4BL7 A;  2H0I A;  3F6F A;  4E8E A;  4JR6 A;  1HNB A;  3E9J B;  3O76 A;  4P3Y B;  3HZ8 A;  1HYU A;  3CBU A;  2ZNM A;  2RUE A;  3ME7 A;  1SJ6 A;  2PN8 A;  2MBS A;  3J7Y k;  1YJ6 A;  4DSQ A;  3UAP A;  2L4Q A;  1V40 A;  1ILO A;  2YWN A;  1GTB A;  2PUK C;  4KUN A;  4N11 A;  1SL0 B;  2K9F A;  1HNC A;  4HOJ A;  4GTU A;  4TXO B;  4KCA A;  22GS A;  1K0C A;  9GSS A;  3EYT A;  2VO4 A;  5E4W A;  1VF2 A;  3KJY A;  2GQL A;  3NOF A;  4G0K A;  4TR1 A;  2JZT A;  3CYN A;  2R37 A;  2RLI A;  1ABA A;  4V1A p;  5BMU A;  5AGY A;  3O6T A;  2LQO A;  2DJ0 A;  4KDU A;  5F0G A;  3APQ A;  1UC7 A;  5C04 A;  4KGI A;  3CTG A;  4BA7 A;  5DQY A;  3ZFL A;  3LGC A;  2FWF A;  3TKQ A;  1GWC A;  2CT6 A;  3QFA C;  5ECN B;  5EL8 A;  4ID0 A;  3TJF A;  4XS4 B;  1K0D A;  4HS1 A;  3CRT A;  2CX3 A;  2R3X A;  2JSY A;  1TI3 A;  18GS A;  2IME A;  3WT1 A;  3NZN A;  3PIN A;  3QCP A;  1XXU A;  5D9X A;  4AJ7 A;  4WXT A;  2IFQ B;  12GS A;  3DKS A;  4KSO A;  4J56 E;  3HVV A;  3A3T A;  1THX A;  2H6X A;  1XFL A;  3VI5 A;  2O87 A;  4GRF A;  1PD2 1;  2O8V B;  4BWQ A;  1HNA A;  2B1K A;  1E2Y A;  4Q5N A;  4N30 A;  1YZX A;  4K7N A;  3FZ9 A;  4KA0 A;  1JZO A;  1G0T A;  1BAY A;  3UAR A;  3ZMK A;  4XRD A;  1DE2 A;  2VAF A;  4OD7 A;  1TRW A;  2VLU A;  5J9B A;  3GKM A;  4MK3 A;  1TJD A;  3PPU A;  1M0U A;  1G7E A;  5LD0 A;  3DVW A;  1WJK A;  4GWR A;  3HHV A;  4MZC A;  2LST A;  1FB6 A;  5INY A;  3W8S A;  2YZH A;  4GF0 A;  2VLV A;  5IMA A;  4XIH A;  4MF7 A;  3P2A A;  2AJQ B;  5DCG A;  1B9Y C;  4HEA 2;  1TRV A;  2L6D A;  4FO5 A;  4OWY A;  3I43 A;  4MP4 A;  3GIX A;  3LSZ A;  2QC7 A;  4QQ7 A;  3A5W A;  4MH2 A;  2I4A A;  5CP1 A;  4EDY A;  2WRT A;  3ERG A;  1GSF A;  1VF4 A;  5D73 A;  4LA1 A;  2C8U A;  2VCW A;  3L9S A;  3IPZ A;  3CSH A;  2JSZ A;  4RI6 A;  5G1K A;  5J5N A;  5C00 A;  3ZIV A;  2F9S A;  3OR5 A;  4ZL8 A;  1OC9 A;  4QL9 A;  3VK9 A;  1YQ1 A;  3IE3 A;  2I81 A;  2V1M A;  2GZY A;  2E7P A;  1KNG A;  5ECR B;  3VI7 A;  5GSS A;  4FIW A;  3GRX A;  4PQI A;  4WF4 A;  3V1W A;  4RQR A;  2LKU A;  1A0F A;  2LQQ A;  1PQN A;  2GT6 A;  5IMZ A;  5IO0 A;  1WPI A;  3L0H A;  4JRR A;  1ML6 A;  3VWU A;  3FEU A;  4AF2 A;  5IQY A;  1GUH A;  2D2Z A;  2YZU A;  2R4V A;  4KCE A;  1K3L A;  5ELA A;  1OC3 A;  1ZL9 A;  1XIY A;  2YWO A;  2YV9 A;  3DEX A;  3EVI A;  1K0B A;  4IQA A;  2L5L A;  2PER A;  5DAK B;  1XPV A;  4MH3 A;  5ECK B;  3KD0 A;  3AY8 A;  1TTZ A;  4ZBB A;  2F3M A;  1EV9 A;  2AHE A;  2C0G A;  8GSS A;  2EIQ A;  2FA8 A;  3F3Q A;  1A8L A;  4BVY A;  4KW6 A;  1BG5 A;  3JCM L;  2CX4 A;  3UEM A;  1X9W B;  5JWO B;  3FW2 A;  2GSS A;  1T3B A;  5HFG A;  5A4W A;  1NW2 A;  3J7Y b;  5G1L A;  4K7I A;  1M99 A;  2CA8 A;  5B8A A;  3LFL A;  2MMO A;  4EC0 A;  3GH9 A;  4IQ1 A;  5H5S A;  1JFU A;  3BCI A;  5EPF A;  2HFD A;  3H93 A;  1JLV A;  4NPB A;  1XW9 A;  1A24 A;  6GSV A;  4OCE A;  3IXR A;  1ACV A;  5DCH A;  3WYW A;  4AJ6 A;  1AQW A;  4ZL7 A;  2FNO A;  4G2E A;  1NSW A;  4ZBD A;  2MMA A;  2LTK A;  3I6A A;  1OKD A;  3EU4 A;  2KUC A;  2OKA A;  1QK8 A;  3ZRE A;  1F3B A;  3VPT A;  3LQ7 A;  1OE7 A;  1Z5Y E;  1GUM A;  4G0L A;  1OC8 A;  1YF0 A;  4KE3 A;  3D21 A;  5ABR A;  2BMX A;  1GSD A;  1Z9H A;  2HRA A;  4BL7 B;  10GS A;  4LL1 B;  2REM A;  3TCO A;  2LNS A;  3KCM A;  3Q6O A;  2V41 A;  1XVW A;  2HRF A;  4FYB A;  1SKR B;  5CYY A;  3TUE A;  1XW5 A;  4GQF A;  3VPQ A;  19GS A;  3IDV A;  5J9C A;  1MD3 A;  5FHI A;  5G30 A;  3G7Y A;  4L0U A;  2HI7 A;  4V2L A;  2FGX A;  2IPA A;  4DVC A;  4JED A;  3CMI A;  4K0G A;  1WIK A;  1BX9 A;  2M72 A;  3FZ5 A;  1H4O A;  4HU7 A;  2YCD A;  3F3R A;  1KEB A;  1VGL A;  1XCC A;  2AV4 A;  1QXH A;  1YEP A;  3EU3 A;  4EXJ A;  1MDI A;  1GLQ A;  1TRU A;  2A4V A;  1FAA A;  2YJ7 A;  1SU9 A;  2LJA A;  3H4K A;  2DIY A;  1XW6 A;  4OCF A;  2VL2 C;  3LYK A;  1F2E A;  2GST A;  3IBH A;  3GYK A;  1TK5 B;  3QOU A;  5A4V A;  6GSW A;  2A2S A;  4TOP A;  3WT2 A;  1Z3E A;  4FYC A;  6GSU A;  4MPG A;  3D5J A;  1ZOF A;  5DBQ A;  2DIZ A;  5DDL A;  3K8N A;  3N9J A;  4ZIL A;  1T8E B;  1DBY A;  1K0M A;  2FUG 2;  1AIU A;  2ALB A;  3PGT A;  4G0I A;  5H5R A;  1QUW A;  6GSX A;  2GGT A;  1E6B A;  4F03 A;  1MEK A;  3ISO A;  1AAZ A;  3HXS A;  1GNE A;  1YKA A;  3A2X A;  3KP9 A;  1M2D A;  4V1A g;  4MF6 A;  3C1S A;  4PUA A;  5LCZ A;  4PNG A;  3GKN A;  2FWE A;  3BOA A;  3PH9 A;  2UZ8 A;  1J0F A;  5F8B A;  1LJR A;  1EOH A;  2NPB A;  3UMA A;  2LJR A;  1PN9 A;  2P0G A;  2H70 A;  2B5E A;  3L4N A;  3FRC A;  2V2G A;  1T1V A;  4I8B A;  3F4S A;  3G7I A;  2N5B A;  3LEF A;  3TOT A;  4PQH A;  3U6V A;  4E8H A;  2TRX A;  1ZZY A;  5ECO B;  2VL2 A;  1GP1 A;  1Z6M A;  3IAM 2;  4YAP A;  3QR6 A;  2LNT A;  4D73 A;  2P31 A;  1A2M A;  2GQM A;  2XC2 A;  2WS2 A;  5KN2 A;  4XHM A;  2C3N A;  3EC3 A;  1A2L A;  4ZB9 A;  2CV4 A;  5CO3 A;  4IGJ A;  3UBK A;  4ACS A;  3ZVJ D;  1MD4 A;  2HLS A;  3IK7 A;  5CNW A;  1Y6E A;  1G7O A;  4HU9 A;  4IS0 A;  3KEB A;  1EGO A;  3TDG A;  5HFI A;  1X0R A;  5JWR B;  5ECS A;  3HYP A;  2PVO C;  4HJ2 A;  5G31 A;  5ECH B;  5GAN D;  1MDK A;  3DWV A;  4IN0 A;  4X0X A;  3H8Q A;  4IHU A;  3F63 A;  1PKZ A;  2IIY A;  2FLS A;  1JLW A;  2OA7 A;  4L5L A;  4LLR A;  1XWC A;  1TDI A;  1O73 A;  1HQO A;  1AUC A;  4F82 A;  2C0E A;  2N5A A;  2HSN B;  5JCW A;  4IEL A;  5D9T A;  4IJI A;  4F0B A;  2NDO A;  3EMX A;  1QFN A;  1X5E A;  1K0N A;  5JCG A;  1Q4J A;  4Q5Q A;  2C3Q A;  3CXG A;  1AC1 A;  4MMM A;  5F05 A;  2RM6 A;  4BVX B;  2JZS A;  2R5G A;  1SK0 A;  1A23 A;  3TOU A;  5D9V A;  4EF0 A;  2RM5 A;  3H79 A;  2HZE A;  5KEJ A;  4HDE A;  5H5Q A;  4NHZ A;  4MJE A;  1EWX A;  2H1A A;  1TU8 A;  1XZO A;  1A0R P;  3ZL5 A;  2YOI A;  2H66 A;  3WD6 A;  1VRS D;  1TKD B;  4KSM A;  3ZRD A;  3KIJ A;  2YV7 A;  3M1G A;  3QAW A;  1FW1 A;  2H0G A;  17GS A;  2I9H A;  2K18 A;  1VF3 A;  3DML A;  3IV4 A;  1BED A;  1F37 A;  2B7K A;  2LEG A;  2BJX A;  4OFN A;  1GL8 A;  1PA3 A;  4QL7 A;  2E2M A;  3LWA A;  2OAD A;  2DLX A;  5ID2 A;  2VD1 A;  3ZML A;  3LJR A;  2YN1 A;  2MYG A;  2P5R A;  2IMD A;  1TU7 A;  1CQG A;  4TRX A;  4WEY A;  1M9A A;  2IL3 A;  1YEX A;  2DSA A;  1XWK A;  4O7H A;  4WF5 A;  3ZYW A;  1Z7P A;  1ZYE A;  4ZBA A;  2V6O A;  3R3E A;  2B3S A;  1R5A A;  3HD5 A;  1H75 A;  3UOM A;  4DEJ A;  3W6G A;  3UJ1 A;  1RK4 A;  4IKH A;  5B6M A;  4ECJ A;  2O85 A;  3KTL A;  3IRA A;  1EOG A;  4MLY A;  2QSI A;  1AXD A;  4TR4 A;  3D4T A;  2J9H A;  4PUF C;  2B5Y A;  4PQ1 A;  4POM A;  2H6Y A;  3HA9 A;  4KDY A;  2LV3 A;  1V98 A;  4N10 A;  3ERF A;  2YJH A;  1SKS B;  2KHP A;  1X5D A;  5DAL B;  6GST A;  2QGV A;  2LRN A;  3VWX A;  3P90 A;  4WBR D;  4Q5R A;  1YY7 A;  2CZ2 A;  1K3Y A;  5IPG A;  1AQX A;  3A2W A;  3IR4 A;  2L59 A;  4HJM A;  4MF5 A;  3CRU A;  2DML A;  4CW9 A;  2YAN A;  2O7K A;  5IM9 A;  3ERW A;  1GTU A;  3FYG A;  3A2V A;  2I1U A;  1U3I A;  2TRC P;  13GS A;  3M9J A;  2CVK A;  3RHC A;  1T4Y A;  4PTS A;  2IMF A;  2PU9 C;  1I9D A;  3UVT A;  3KM6 A;  1O85 A;  1KTE A;  4NV2 A;  2CVB A;  1GUL A;  4JU5 A;  2B7J A;  5IO2 A;  4YQV A;  2V32 A;  3IK9 A;  2A2R A;  4Q5F A;  1O7U A;  3C71 A;  4G9H A;  4ZIJ A;  4FYU A;  1FOV A;  1PX7 A;  3GUS A;  1ON4 A;  3VWW A;  4NAX A;  5ECM B;  3GTU A;  1PMT A;  5B8B A;  1PRX A;  3TJG A;  3QAG A;  4V2M A;  3U5R E;  1K3O A;  1GLP A;  1Z6N A;  5D93 A;  4XS4 A;  3M8N A;  4H86 A;  2CAI A;  1EP8 A;  4F0C A;  4G19 A;  1JZW A;  4MZW A;  2PWJ A;  1TP9 A;  2IFQ A;  3DIE A;  2DJK A;  5ECI B;  2XBQ A;  3BCK A;  2HNL A;  5ELG A;  5KN0 A;  5CAX A;  5HR3 A;  2PMT A;  4ECB A;  1SYX A;  3EIN A;  4YQU A;  5E59 A;  1G6Y A;  5G2Z A;  2CAQ A;  2WGR A;  2HE3 A;  4FQU A;  2HSY A;  3QD9 A;  4XS6 A;  1CQH A;  3KMN A;  1SL2 B;  3TGZ A;  3RDW A;  2VM1 A;  2HSM A;  4ZXG A;  1PKW A;  3TB2 A;  2H71 A;  1URM A;  2OBK A;  2VIM A;  3HKR A;  1QGV A;  1X9S B;  3KH7 A;  3MAK A;  1FHE A;  2H0H A;  1GSE A;  4Z7X A;  4YAV A;  4CHS A;  3SWL A;  3FY7 A;  4DSS B;  3DXB A;  3WGE A;  1ZGN A;  4TN8 A;  5HQP A;  3LXT A;  2MMN A;  2RUF A;  2H1G A;  1M2B A;  3UVH A;  5GZZ B;  2C0D A;  5G5E A;  4XS1 A;  1U87 A;  5G5F A;  2C1Y A;  2M80 A;  2VCT A;  1OYJ A;  2K8S A;  4CDO A;  4K0N A;  2AAW A;  1UN2 A;  4L5O A;  3GH6 A;  1WOU A;  4EVM A;  5AIS A;  2LUS A;  2HQT A;  4HQS A;  5CRH A;  1SEN A;  2PVQ A;  2VCZ A;  2CVD A;  3KP8 A;  1ZMA A;  1GSY A;  2WB9 A;  2HYX A;  3M3M A;  1TOF A;  1TK0 B;  1EP7 A;  2M46 A;  2L6C A;  1THO A;  2GSQ A;  5FT3 A;  1XWA A;  1I5G A;  2P5Q A;  1GTA A;  5L71 A;  1MTC A;  1M9B A;  1S3C A;  3UIW A;  1F6M C;  4GST A;  4MCU A;  2IMI A;  1ERW A;  2JAD A;  3L9U A;  1N8J A;  4N0Z A;  1U3A A;  2FWH A;  4TR1 B;  3I9V 2;  5ECP B;  2H30 A;  2IN3 A;  1WWJ A;  1DSB A;  1O8X A;  20GS A;  1F9M A;  1XVQ A;  1A2J A;  1EEM A;  1TRS A;  2PPT A;  1XOA A;  2IMK A;  1JZD A;  3HCZ A;  5EVO A;  3DYR A;  5IIZ A;  2HRK A;  3D0Z A;  3ED3 A;  3ME8 A;  1OAZ A;  1LU4 A;  4TXV A;  1T4Z A;  1FO5 A;  2L4C A;  3RHB A;  4RI7 A;  2HZE B;  2GVP A;  4KX4 A;  2OE3 A;  2YWM A;  4J57 E;  1PGT A;  1TK8 B;  2F8F A;  1EZK A;  2GZP A;  2XPD A;  3FR6 A;  3GV1 A;  4HZ2 A;  3DD3 A;  2OE1 A;  3ZIJ A;  4KF9 A;  3LOR A;  3P8W A;  3O3T A;  4HUA A;  3D22 A;  4K6X A;  3ZFB A;  1EGR A;  4IP1 A;  2Z9S A;  3G7J A;  3KH9 A;  2GDR A;  2GLR A;  3F4T A;  1HD2 A;  5ECL B;  1LBK A;  1GSQ A;  1O8W A;  2KOK A;  5D96 A;  3HVS A;  2WZ9 A;  2OBI A;  2F51 A;  4RUV A;  1U88 A;  3GFK A;  3SBC A;  4ISD A;  3N5O A;  5EY6 A;  1A8Y A;  2TIR A;  4LMV A;  1GH2 A;  5DVB A;  1BYE A;  5AN1 A;  3GHA A;  4HQZ A;  4PGT A;  4NV5 A;  1ERU A;  1R4W A;  3TRP A;  1Z7R A;  2DJJ A;  2E2G A;  1TXX A;  2DJ3 A;  4WKW A;  2WFC A;  2OJL A;  4KDX A;  4ZB8 A;  4IP6 A;  3IC4 A;  1JHB A;  1S3A A;  2RII A;  3E0U A;  3HY2 A;  3VLN A;  3FKF A;  4YH2 A;  1NHY A;  1U6T A;  2YP6 A;  3ZIT A;  2OAC A;  1FVK A;  14GS A;  3TRQ A;  4PXO A;  3IA1 A;  2FCH A;  3GN3 A;  2V6K A;  5CRD A;  1B8X A;  1SYR A;  3VWV A;  1AW9 A;  4EUY A;  3GNJ A;  3C7M A;  1OC9 B;  2DJ1 A;  2EIR A;  3PR8 A;  2JU5 A;  4X43 A;  5A4U A;  2H76 A;  4POK A;  3I69 A;  2E0Q A;  3Q18 A;  4TR3 A;  3GX8 A;  3R2Q A;  3QAV A;  3APO A;  1YF1 A;  5F06 A;  3C1R A;  2CZ3 A;  4GSN A;  1GSS A;  4ZL9 A;  5KN1 A;  4F9Z A;  5J3R A;  2VL3 A;  3ZTL A;  4PX1 A;  5GST A;  1G6W A;  3TJJ A;  3GTU B;  5IOW A;  5B7C A;  3MNG A;  1K0A A;  2GT5 A;  5D8I A;  5ENU A;  1WMJ A;  1WE0 A;  3Q19 A;  3FK8 A;  2WCI A;  1QQ2 A;  1XWB A;  2N5F A;  6GSS A;  4O92 A;  2VUP A;  3E3E A;  3EE2 A;  3FR9 A;  2FA4 A;  1IYH A;  4L8E A;  1V57 A;  4ZB6 A;  4WR5 A;  4TVE A;  2R6K A;  2PGT A;  1W89 A;  1S3D A;  2HT9 A;  2HXK A;  1B9X C;  5COH A;  2LRC A;  4ML6 A;  3NIV A; 
#chains in the Genus database with same CATH topology
 1NM3 A;  3LXZ A;  5HFK A;  1UA5 A;  5F07 A;  4ECI A;  1GSU A;  4BVY B;  3DRN A;  4TKY A;  5IMD A;  4EKZ A;  2KP1 A;  3VUR A;  1VF1 A;  3M9K A;  4EO3 A;  5CRW A;  1TI1 A;  5CRG A;  1J9B A;  4NWY A;  2F8A A;  2HSM B;  1PL2 A;  3EMP A;  2VD0 A;  3GA4 A;  4I2U A;  3F8U A;  5A5K A;  1SL1 B;  4ECC A;  4OO4 A;  5J41 A;  2C0F A;  3G9B A;  2VKZ G;  3HJP A;  1YDK A;  3LYP A;  1K0O A;  4MJC A;  2XHF A;  3KZQ A;  5CRE A;  4V2N A;  3W8J A;  6GSY A;  4G10 A;  2ES7 A;  5AIV A;  2FWG A;  4I97 A;  2H1L A;  2NBS A;  2ZUP A;  4WR4 A;  2VLT A;  2FHE A;  1ZYQ B;  3GL5 A;  3MDK A;  3F6D A;  4JZQ A;  3US3 A;  2YPM A;  1V2A A;  3KXO A;  4IBP A;  4KB3 A;  2H01 A;  2YNX A;  3HVX A;  3ZVJ A;  2VCQ A;  4K9Z A;  4AGS A;  4EE0 A;  1XWG A;  4TXO A;  1B4P A;  3TKS C;  5HR0 A;  2ON7 A;  5JWQ B;  3TRX A;  4TR0 A;  4IJ3 A;  3EUR A;  2GSR A;  2QKE A;  1ERT A;  4MDC A;  3RPP A;  2MZC A;  3C73 A;  1ZCP A;  2GZZ A;  3UBL A;  2XPE A;  4A5P A;  4USS A;  2EC4 A;  1F3A A;  2GQK A;  1W4V A;  5DQS A;  2L57 A;  7GSS A;  2JL4 A;  4FH8 A;  2DKH A;  1SD8 A;  1DUG A;  3CQF A;  3F0I A;  2X99 A;  11GS A;  3IC8 A;  3GST A;  3TJB A;  4MA9 A;  3GKK A;  4BVX A;  4K1F A;  2FY6 A;  2X64 A;  4MPF A;  3L78 A;  4BWS A;  2QA2 A;  4O5R A;  2WDU A;  4W66 A;  1T7P B;  4WBJ A;  3QDN A;  3M0F A;  3CTF A;  4POL A;  3HDC A;  5HR2 A;  4NXI A;  2B6M A;  1TW9 A;  1S3R A;  4XTS A;  4ILF A;  1QMV A;  2ZCT A;  1R7H A;  3CSI A;  4IW9 A;  4LMW A;  4GQC A;  4OMV A;  2DMM A;  3TKS A;  3RFR C;  2DKI A;  3ZZX A;  2HZF A;  4LL4 B;  5J4U A;  2VM2 A;  2R0C A;  2HRK B;  1V9W A;  1FB0 A;  1ERV A;  2C4J A;  2LJK A;  5KN3 A;  3HJM A;  2DJ2 A;  3F4R A;  1Y25 A;  2HSH A;  3TKS E;  2FD3 A;  4PNF A;  1B48 A;  2O89 A;  3IHQ A;  2AB6 A;  4L0W A;  1T00 A;  4PI0 C;  1M2A A;  5LNK e;  16GS A;  1GRX A;  2HRN A;  2C80 A;  4GSS A;  4GLT A;  2JZR A;  1AQV A;  1ZYP A;  2VCX A;  2MBT A;  2H1D A;  2H1B A;  4GXZ A;  1OE8 A;  3GMF A;  4I6X A;  3C8E A;  5FWG A;  1NHO A;  2C3T A;  5HR1 A;  2GTU A;  5D9W A;  2WUL A;  1SKW B;  3TJK A;  3KTB A;  2MMZ A;  4TW5 A;  3MWH A;  4K7O A;  5JCU A;  4N0V A;  1GNW A;  1BJX A;  3HZ4 A;  2LS5 A;  4XCS A;  4BPY A;  2NVL A;  3FR3 A;  3D6I A;  5A34 B;  1SD9 A;  3GSS A;  4EDZ A;  4ULX A;  1WRY A;  2AYT A;  3RBT A;  1SK1 A;  4DSR A;  2IJY A;  3UL3 A;  1GTI A;  1ST9 A;  5DJL A;  1IYI A;  1JZR A;  1O81 A;  3D4M A;  4D73 B;  3DGQ A;  2GS3 A;  1PX6 A;  1XOB A;  3ZLP A;  4QMK A;  5DAL A;  1FVJ A;  1C72 A;  5IMV A;  4J2F A;  2G0F A;  2BTO T;  4MJB A;  3GL3 A;  4MZB A;  4KND A;  5B6N A;  5IMF A;  3KMO A;  1MDJ A;  4POB A;  4IVF A;  1USB A;  4WET A;  5AIX A;  2H19 A;  4I2T A;  1X9M B;  4RQX A;  4JR4 A;  4Z2U A;  2VOC A;  3IAS 2;  1GUK A;  4GCI A;  4HI7 A;  3HJO A;  2B5X A;  2CQ9 A;  3P7X A;  2NTO A;  2X8H A;  5GAP D;  1EEJ A;  4NHW A;  4JE1 A;  2JAC A;  5IOX A;  1N2A A;  4K8M A;  2EIO A;  1OKT A;  3RAZ A;  3DVX A;  3IOS A;  3GKX A;  3FZ4 A;  2H75 A;  4X1U A;  2PBJ A;  4OFT A;  2ON5 A;  2AUV A;  4OFM A;  2KLX A;  3WGX A;  4K2X A;  2EFH A;  3RPN A;  3S9F A;  2J23 A;  3QMX A;  1RQM A;  4MJA A;  5ECQ B;  4HSC X;  1V58 A;  2QA1 A;  4CY8 A;  4XRA A;  4YQM A;  3FHK A;  4ML1 A;  2H8L A;  3L9V A;  3BJ5 A;  1FG4 A;  2DBC A;  3EWL A;  2R2J A;  2XBI A;  3LG6 A;  5DAK A;  4KAE A;  1SK2 A;  3BD2 A;  1Y1U A;  3VFI A;  1PSQ A;  2H74 A;  3QPM A;  2LRT A;  2I3Y A;  3F9U A;  4AKI A;  1M7T A;  3KGK A;  3APS A;  3GX0 A;  1SJZ A;  2O3E A;  3FZA A;  1R26 A;  4EL1 A;  1XBS A;  1BQ7 A;  1B4Q A;  2VCV A;  1FOH A;  1SJI A;  3TKR A;  2OE0 A;  1TXU A;  3QFB C;  4PUR A;  2H72 A;  2X8C A;  1R5P A;  4JBB A;  3H1N A;  2YWI A;  4I5Q A;  4NMU A;  1RW1 A;  1DE1 A;  3GUR A;  2EFD A;  5DJM A;  5IPH A;  4MAB A;  4O32 A;  5ID2 B;  1OVN A;  4K2D A;  4Z2R A;  4DSS A;  4F2I A;  2VL9 A;  2H73 A;  3CSJ A;  4HZ4 A;  2K8V A;  1X5C A;  1EV4 A;  2H6Z A;  2UV8 G;  2KP2 A;  3BBY A;  4OO5 A;  1O6J A;  1Q98 A;  1J08 A;  3TKP A;  5IMC A;  2EFC A;  1PL1 A;  4KH7 A;  2L5O A;  1WP0 A;  2WJU A;  2K6V A;  1KBN A;  4AJ8 A;  1UVZ A;  3Q74 A;  1YKC A;  2B1L A;  3MSZ A;  2G2Q A;  2IWT A;  2X8G A;  3WGD A;  2DC5 A;  4BL7 A;  5A5H B;  2H0I A;  3F6F A;  4E8E A;  4JR6 A;  1HNB A;  3E9J B;  3O76 A;  4P3Y B;  4EIQ A;  3HZ8 A;  1HYU A;  3CBU A;  2ZNM A;  2RUE A;  3ME7 A;  1SJ6 A;  5J47 A;  2PN8 A;  2MBS A;  3J7Y k;  1YJ6 A;  4DSQ A;  3UAP A;  2L4Q A;  1V40 A;  1ILO A;  2YWN A;  1GTB A;  2PUK C;  4KUN A;  4N11 A;  1SL0 B;  2K9F A;  1HNC A;  4HOJ A;  4GTU A;  4TXO B;  4KCA A;  22GS A;  1K0C A;  9GSS A;  3EYT A;  2VO4 A;  3RGB C;  5E4W A;  1VF2 A;  3KJY A;  2GQL A;  3NOF A;  4G0K A;  5A1N A;  4TR1 A;  1ZYN A;  5J40 A;  2JZT A;  3CYN A;  2R37 A;  2WVX A;  2RLI A;  1ABA A;  4V1A p;  5BMU A;  5AGY A;  3O6T A;  2LQO A;  2DJ0 A;  4KDU A;  5F0G A;  3APQ A;  4PHZ C;  1UC7 A;  5C04 A;  4KGI A;  3CTG A;  4BA7 A;  5DQY A;  3ZFL A;  3LGC A;  2FWF A;  3HVN A;  3TKQ A;  1GWC A;  2CT6 A;  3EPT A;  3QFA C;  5ECN B;  5EL8 A;  4ID0 A;  3TJF A;  4XS4 B;  1K0D A;  4HS1 A;  3CRT A;  2CX3 A;  2R3X A;  2JSY A;  1TI3 A;  18GS A;  2IME A;  3WT1 A;  3NZN A;  3PIN A;  3QCP A;  1XXU A;  5D9X A;  4AJ7 A;  4WXT A;  2IFQ B;  12GS A;  3DKS A;  4KSO A;  4YKG A;  4J56 E;  3HVV A;  3A3T A;  1THX A;  4O5U A;  2H6X A;  1XFL A;  3VI5 A;  2O87 A;  4GRF A;  4CY6 A;  1PD2 1;  3LW9 A;  2O8V B;  4BWQ A;  1HNA A;  2B1K A;  1N25 A;  1E2Y A;  4Q5N A;  4N30 A;  1YZX A;  4K7N A;  3FZ9 A;  4KA0 A;  1JZO A;  1G0T A;  1BAY A;  3UAR A;  3ZMK A;  4XRD A;  1DE2 A;  2VAF A;  4OD7 A;  1TRW A;  2VLU A;  5J9B A;  3GKM A;  4MK3 A;  1TJD A;  3PPU A;  1M0U A;  1G7E A;  5LD0 A;  3DVW A;  1WJK A;  4GWR A;  1M3I A;  3HHV A;  4MZC A;  2LST A;  1FB6 A;  5INY A;  3W8S A;  2O5V A;  2YZH A;  4GF0 A;  2VLV A;  5IMA A;  4AKX B;  4XIH A;  4MF7 A;  5KOW A;  3P2A A;  2AJQ B;  5DCG A;  1B9Y C;  4HEA 2;  1TRV A;  2L6D A;  4FO5 A;  4OWY A;  3I43 A;  2WVZ A;  4MP4 A;  3GIX A;  3LSZ A;  2QC7 A;  4QQ7 A;  3A5W A;  4MH2 A;  2I4A A;  5CP1 A;  4EDY A;  2WRT A;  3ERG A;  1GSF A;  1VF4 A;  5D73 A;  4LA1 A;  2C8U A;  2HSN A;  2VCW A;  3L9S A;  3IPZ A;  3CSH A;  2JSZ A;  4RI6 A;  5G1K A;  5J5N A;  5C00 A;  3ZIV A;  2F9S A;  3OR5 A;  4ZL8 A;  1OC9 A;  4QL9 A;  3VK9 A;  4AKH A;  1YQ1 A;  3IE3 A;  2I81 A;  2V1M A;  2GZY A;  2E7P A;  1KNG A;  5ECR B;  3VI7 A;  5GSS A;  4FIW A;  3GRX A;  4PQI A;  4WF4 A;  3V1W A;  4RQR A;  3MYD A;  2LKU A;  1A0F A;  2LQQ A;  1PQN A;  2GT6 A;  5IMZ A;  5IO0 A;  1WPI A;  3L0H A;  4JRR A;  1ML6 A;  3VWU A;  3FEU A;  4AI6 A;  4AF2 A;  5IQY A;  1GUH A;  2D2Z A;  2YZU A;  2R4V A;  4KCE A;  1K3L A;  5ELA A;  1OC3 A;  1ZL9 A;  1XIY A;  2YWO A;  2YV9 A;  3DEX A;  3EVI A;  1K0B A;  4IQA A;  2L5L A;  2PER A;  5DAK B;  1XPV A;  4MH3 A;  5ECK B;  3KD0 A;  3AY8 A;  1TTZ A;  4ZBB A;  2F3M A;  1EV9 A;  2AHE A;  2C0G A;  8GSS A;  2A2P A;  2EIQ A;  4K5R A;  2FA8 A;  3F3Q A;  1A8L A;  4BVY A;  4KW6 A;  1BG5 A;  3JCM L;  2CX4 A;  3UEM A;  1X9W B;  5JWO B;  3FW2 A;  2GSS A;  1T3B A;  5HFG A;  5A4W A;  1NW2 A;  4G01 A;  3J7Y b;  5G1L A;  4K7I A;  1M99 A;  2CA8 A;  5B8A A;  3LFL A;  2MMO A;  4EC0 A;  3GH9 A;  4IQ1 A;  5H5S A;  1JFU A;  3BCI A;  5EPF A;  2HFD A;  3H93 A;  1JLV A;  4NPB A;  1XW9 A;  1A24 A;  6GSV A;  4OCE A;  3IXR A;  1ACV A;  5DCH A;  3WYW A;  4AJ6 A;  1AQW A;  4ZL7 A;  2FNO A;  4G2E A;  1NSW A;  4ZBD A;  2MMA A;  2LTK A;  3I6A A;  1OKD A;  3EU4 A;  2KUC A;  2OKA A;  1QK8 A;  3ZRE A;  1F3B A;  3VPT A;  1SVL A;  3LQ7 A;  1OE7 A;  1Z5Y E;  1YEW C;  1GUM A;  4G0L A;  1OC8 A;  1YF0 A;  4KE3 A;  3D21 A;  5ABR A;  2BMX A;  1GSD A;  1Z9H A;  2A4H A;  2HRA A;  4BL7 B;  10GS A;  4LL1 B;  3CHX C;  2REM A;  3TCO A;  2LNS A;  3KCM A;  3Q6O A;  2V41 A;  1XVW A;  2HRF A;  4FYB A;  1SKR B;  5CYY A;  3TUE A;  1XW5 A;  4GQF A;  3VPQ A;  19GS A;  2R0G A;  3IDV A;  5J9C A;  1MD3 A;  5FHI A;  5G30 A;  3G7Y A;  4L0U A;  2O36 A;  2HI7 A;  2X4A A;  4V2L A;  2FGX A;  2IPA A;  4DVC A;  4JED A;  3CMI A;  4K0G A;  1WIK A;  1BX9 A;  2M72 A;  3FZ5 A;  1H4O A;  4HU7 A;  2YCD A;  3F3R A;  1KEB A;  1VGL A;  1XCC A;  2AV4 A;  1QXH A;  1YEP A;  3EU3 A;  4EXJ A;  2WW3 A;  1MDI A;  1GLQ A;  4BIK A;  1TRU A;  2A4V A;  1FAA A;  2YJ7 A;  1SU9 A;  2LJA A;  3H4K A;  2DIY A;  1XW6 A;  4OCF A;  2VL2 C;  2WW2 A;  3LYK A;  1F2E A;  2GST A;  3IBH A;  3GYK A;  1TK5 B;  3QOU A;  5A4V A;  6GSW A;  2A2S A;  4TOP A;  3WT2 A;  1Z3E A;  4FYC A;  6GSU A;  4MPG A;  3D5J A;  1ZOF A;  5DBQ A;  2DIZ A;  5DDL A;  3K8N A;  3N9J A;  4ZIL A;  1T8E B;  1DBY A;  4EIP A;  4MNN A;  1K0M A;  2FUG 2;  1AIU A;  1XG8 A;  2ALB A;  3PGT A;  4G0I A;  5H5R A;  1QUW A;  6GSX A;  2GGT A;  1E6B A;  4F03 A;  1MEK A;  3ISO A;  1AAZ A;  3HXS A;  1GNE A;  1YKA A;  3A2X A;  3KP9 A;  1M2D A;  4V1A g;  4MF6 A;  3C1S A;  4PUA A;  5LCZ A;  4PNG A;  3GKN A;  2FWE A;  3BOA A;  3PH9 A;  2UZ8 A;  1J0F A;  5F8B A;  1LJR A;  1EOH A;  2NPB A;  3UMA A;  2LJR A;  1PN9 A;  2P0G A;  2H70 A;  2B5E A;  3L4N A;  3FRC A;  2V2G A;  1T1V A;  4I8B A;  3F4S A;  3G7I A;  2N5B A;  3LEF A;  3TOT A;  4PQH A;  3U6V A;  4E8H A;  2TRX A;  1ZZY A;  5ECO B;  2VL2 A;  1GP1 A;  1Z6M A;  3IAM 2;  4YAP A;  3QR6 A;  2LNT A;  4D73 A;  2P31 A;  1A2M A;  2GQM A;  2XC2 A;  2WS2 A;  5KN2 A;  4XHM A;  2C3N A;  3EC3 A;  1A2L A;  4ZB9 A;  2CV4 A;  5CO3 A;  4IGJ A;  3UBK A;  4ACS A;  3ZVJ D;  1MD4 A;  2HLS A;  3IK7 A;  5CNW A;  1Y6E A;  1G7O A;  4HU9 A;  4IS0 A;  3KEB A;  1EGO A;  3TDG A;  5HFI A;  1X0R A;  5JWR B;  5ECS A;  3HYP A;  2PVO C;  4HJ2 A;  5G31 A;  5ECH B;  5GAN D;  2WW1 A;  1MDK A;  3DWV A;  4IN0 A;  4X0X A;  3H8Q A;  4IHU A;  3F63 A;  1PKZ A;  2IIY A;  2FLS A;  1JLW A;  2OA7 A;  4L5L A;  4PI2 C;  4LLR A;  1XWC A;  1TDI A;  1O73 A;  1HQO A;  1AUC A;  4F82 A;  2C0E A;  2N5A A;  2HSN B;  5JCW A;  4IEL A;  5D9T A;  4IJI A;  4F0B A;  2NDO A;  3EMX A;  1QFN A;  1X5E A;  1K0N A;  5JCG A;  1Q4J A;  4Q5Q A;  2C3Q A;  3CXG A;  1AC1 A;  4MMM A;  5F05 A;  2RM6 A;  4BVX B;  2JZS A;  2R5G A;  1SK0 A;  1A23 A;  4N3Z A;  3TOU A;  5D9V A;  4EF0 A;  2RM5 A;  3H79 A;  2HZE A;  5KEJ A;  4HDE A;  5H5Q A;  4NHZ A;  4MJE A;  1EWX A;  2H1A A;  1TU8 A;  1XZO A;  1A0R P;  3ZL5 A;  2YOI A;  2H66 A;  3WD6 A;  1VRS D;  1PFO A;  1TKD B;  4KSM A;  3ZRD A;  3KIJ A;  2YV7 A;  3M1G A;  3QAW A;  1FW1 A;  2H0G A;  17GS A;  2I9H A;  2K18 A;  1VF3 A;  3DML A;  3IV4 A;  3FMW A;  1BED A;  1F37 A;  2B7K A;  2LEG A;  2BJX A;  4OFN A;  1GL8 A;  1PA3 A;  4QL7 A;  2E2M A;  3LWA A;  2OAD A;  2DLX A;  5ID2 A;  2VD1 A;  3ZML A;  3LJR A;  2YN1 A;  2MYG A;  2P5R A;  4O5Q A;  2IMD A;  1TU7 A;  1CQG A;  4TRX A;  4WEY A;  1M9A A;  2IL3 A;  1YEX A;  1SVO A;  2DSA A;  1XWK A;  4O7H A;  4WF5 A;  3ZYW A;  1Z7P A;  1ZYE A;  4ZBA A;  2V6O A;  3R3E A;  5BRT A;  2B3S A;  1R5A A;  3HD5 A;  1H75 A;  3UOM A;  4DEJ A;  3W6G A;  3UJ1 A;  1RK4 A;  4IKH A;  5B6M A;  4ECJ A;  2O85 A;  3KTL A;  3IRA A;  3HMJ G;  4FXY P;  5A5H A;  1EOG A;  4MLY A;  2QSI A;  1AXD A;  4TR4 A;  3D4T A;  2J9H A;  4PUF C;  2B5Y A;  4PQ1 A;  4POM A;  2H6Y A;  4YKF A;  3HA9 A;  4KDY A;  2LV3 A;  1V98 A;  4N10 A;  3ERF A;  2YJH A;  1SKS B;  2KHP A;  1X5D A;  5DAL B;  1S4B P;  6GST A;  2QGV A;  2LRN A;  3VWX A;  3P90 A;  4WBR D;  4Q5R A;  1YY7 A;  2CZ2 A;  1K3Y A;  5IPG A;  3TU3 B;  1AQX A;  3A2W A;  3IR4 A;  2L59 A;  4HJM A;  4MF5 A;  5J4Y A;  3CRU A;  2DML A;  4CW9 A;  2YAN A;  2O7K A;  5IM9 A;  3ERW A;  1GTU A;  3FYG A;  3A2V A;  2I1U A;  1U3I A;  2TRC P;  13GS A;  3M9J A;  2CVK A;  3RHC A;  1T4Y A;  4PTS A;  2IMF A;  2PU9 C;  1I9D A;  1BG1 A;  4ICY A;  3UVT A;  3KM6 A;  1O85 A;  1KTE A;  4NV2 A;  2CVB A;  1GUL A;  4JU5 A;  2B7J A;  1PN0 A;  5IO2 A;  4YQV A;  2V32 A;  3IK9 A;  2A2R A;  4Q5F A;  1O7U A;  3C71 A;  4G9H A;  4ZIJ A;  4FYU A;  1FOV A;  1PX7 A;  3GUS A;  1ON4 A;  3VWW A;  4NAX A;  5ECM B;  3GTU A;  1PMT A;  5B8B A;  1PRX A;  3TJG A;  3QAG A;  4V2M A;  3U5R E;  1K3O A;  1GLP A;  1Z6N A;  5D93 A;  4XS4 A;  1I1I P;  3M8N A;  4H86 A;  2CAI A;  1EP8 A;  4F0C A;  4G19 A;  1JZW A;  4MZW A;  2PWJ A;  1TP9 A;  2IFQ A;  3DIE A;  2DJK A;  5ECI B;  2XBQ A;  3BCK A;  2HNL A;  5ELG A;  5KN0 A;  5CAX A;  5HR3 A;  2PMT A;  4ECB A;  1SYX A;  3EIN A;  4YQU A;  5E59 A;  2WZS A;  1G6Y A;  5G2Z A;  4Z2T A;  2CAQ A;  2WGR A;  2HE3 A;  4FQU A;  2HSY A;  3QD9 A;  4XS6 A;  1CQH A;  3KMN A;  1SL2 B;  3TGZ A;  3RDW A;  2VM1 A;  2HSM A;  4ZXG A;  1PKW A;  3TB2 A;  2H71 A;  1URM A;  2OBK A;  2WW0 A;  2VIM A;  3HKR A;  1QGV A;  1X9S B;  3KH7 A;  3MAK A;  1FHE A;  2H0H A;  1GSE A;  4Z7X A;  4YAV A;  4CHS A;  3SWL A;  3FY7 A;  4DSS B;  3DXB A;  2EFE A;  3WGE A;  1ZGN A;  4TN8 A;  5HQP A;  3LXT A;  2MMN A;  2RUF A;  2H1G A;  1M2B A;  3UVH A;  4ZB7 A;  5GZZ B;  2C0D A;  5G5E A;  4XS1 A;  1U87 A;  5G5F A;  2C1Y A;  2M80 A;  2VCT A;  1OYJ A;  1M3J A;  2K8S A;  4CDO A;  4K0N A;  2AAW A;  1UN2 A;  4L5O A;  3GH6 A;  1WOU A;  4EVM A;  5AIS A;  2LUS A;  2HQT A;  4HQS A;  4E68 A;  5CRH A;  1SEN A;  2PVQ A;  2VCZ A;  2CVD A;  3KP8 A;  1ZMA A;  1GSY A;  2WB9 A;  2HYX A;  3M3M A;  1TOF A;  1TK0 B;  1EP7 A;  2M46 A;  2L6C A;  1THO A;  2GSQ A;  5FT3 A;  1XWA A;  1I5G A;  2P5Q A;  1GTA A;  5L71 A;  1MTC A;  1M9B A;  1S3C A;  3UIW A;  1F6M C;  4GST A;  4MCU A;  2IMI A;  1ERW A;  2JAD A;  3A5I A;  3L9U A;  1N8J A;  4N0Z A;  1U3A A;  2FWH A;  5A1N B;  4TR1 B;  3I9V 2;  5ECP B;  2H30 A;  2IN3 A;  1SVM A;  1WWJ A;  2WVX B;  1DSB A;  1O8X A;  20GS A;  1F9M A;  1XVQ A;  1A2J A;  1EEM A;  1TRS A;  5BMU B;  2PPT A;  1XOA A;  2IMK A;  1JZD A;  3HCZ A;  5EVO A;  3DYR A;  5IIZ A;  2HRK A;  3D0Z A;  3ED3 A;  3ME8 A;  1OAZ A;  1LU4 A;  4TXV A;  1T4Z A;  1FO5 A;  2L4C A;  3RHB A;  4RI7 A;  2HZE B;  2GVP A;  4KX4 A;  2OE3 A;  2YWM A;  4J57 E;  1PGT A;  1TK8 B;  2F8F A;  1EZK A;  2GZP A;  2XPD A;  3FR6 A;  3GV1 A;  4HZ2 A;  3DD3 A;  2OE1 A;  3ZIJ A;  4KF9 A;  3LOR A;  3P8W A;  3O3T A;  4HUA A;  3D22 A;  4K6X A;  3ZFB A;  1EGR A;  4IP1 A;  2Z9S A;  3G7J A;  3KH9 A;  2GDR A;  2GLR A;  3F4T A;  1HD2 A;  5ECL B;  1LBK A;  1GSQ A;  1O8W A;  2KOK A;  5D96 A;  3HVS A;  2WZ9 A;  2OBI A;  2F51 A;  4RUV A;  5A34 A;  1U88 A;  3GFK A;  3SBC A;  4ISD A;  3N5O A;  5EY6 A;  1A8Y A;  2TIR A;  4LMV A;  1GH2 A;  5DVB A;  2OT3 A;  1BYE A;  5AN1 A;  3GHA A;  4HQZ A;  4PGT A;  4NV5 A;  1ERU A;  1R4W A;  3TRP A;  1Z7R A;  2DJJ A;  2E2G A;  1TXX A;  2DJ3 A;  2X49 A;  3IHG A;  4WKW A;  2WFC A;  2OJL A;  4KDX A;  4ZB8 A;  4IP6 A;  3IC4 A;  1JHB A;  1S3A A;  2RII A;  3E0U A;  3HY2 A;  3VLN A;  3FKF A;  4YH2 A;  1NHY A;  1U6T A;  5J4V A;  2YP6 A;  3ZIT A;  2R0P A;  2OAC A;  4AKG A;  1FVK A;  14GS A;  3TRQ A;  4PXO A;  3IA1 A;  2FCH A;  3GN3 A;  2V6K A;  2WVY A;  5CRD A;  1B8X A;  1SYR A;  3VWV A;  1AW9 A;  4EUY A;  3GNJ A;  3C7M A;  1OC9 B;  2DJ1 A;  2EIR A;  3PR8 A;  2JU5 A;  4X43 A;  5A4U A;  2H76 A;  4POK A;  3I69 A;  2E0Q A;  3Q18 A;  4TR3 A;  1YVL A;  3GX8 A;  3R2Q A;  3QAV A;  3APO A;  1BF5 A;  1YF1 A;  5F06 A;  3C1R A;  2CZ3 A;  4GSN A;  1GSS A;  4ZL9 A;  5KN1 A;  4F9Z A;  5J3R A;  2VL3 A;  3ZTL A;  3MIX A;  4GDF A;  4PX1 A;  5GST A;  1G6W A;  3TJJ A;  3GTU B;  5IOW A;  5B7C A;  3MNG A;  1K0A A;  2GT5 A;  5D8I A;  5ENU A;  5KOX A;  1WMJ A;  1WE0 A;  3Q19 A;  3FK8 A;  4K5S A;  2WCI A;  1QQ2 A;  1XWB A;  2N5F A;  6GSS A;  4O92 A;  2VUP A;  3E3E A;  3EE2 A;  3FR9 A;  2FA4 A;  1IYH A;  4L8E A;  3CWG A;  1V57 A;  4ZB6 A;  4WR5 A;  4TVE A;  2R6K A;  2PGT A;  1W89 A;  4X4J A;  1S3D A;  2HT9 A;  2HXK A;  1B9X C;  5COH A;  2LRC A;  4ML6 A;  3NIV A; 
#chains in the Genus database with same CATH homology
 1NM3 A;  3LXZ A;  5HFK A;  1UA5 A;  5F07 A;  4ECI A;  1GSU A;  4BVY B;  3DRN A;  4TKY A;  5IMD A;  4EKZ A;  2KP1 A;  3VUR A;  1VF1 A;  3M9K A;  4EO3 A;  5CRW A;  1TI1 A;  5CRG A;  1J9B A;  4NWY A;  2F8A A;  2HSM B;  1PL2 A;  3EMP A;  2VD0 A;  3GA4 A;  4I2U A;  3F8U A;  5A5K A;  1SL1 B;  4ECC A;  4OO4 A;  5J41 A;  2C0F A;  3G9B A;  2VKZ G;  3HJP A;  3LYP A;  1YDK A;  1K0O A;  4MJC A;  2XHF A;  3KZQ A;  5CRE A;  4V2N A;  3W8J A;  6GSY A;  4G10 A;  2ES7 A;  5AIV A;  2FWG A;  4I97 A;  2H1L A;  2NBS A;  2ZUP A;  4WR4 A;  2VLT A;  2FHE A;  1ZYQ B;  3GL5 A;  3MDK A;  3F6D A;  4JZQ A;  3US3 A;  2YPM A;  1V2A A;  3KXO A;  4IBP A;  4KB3 A;  2H01 A;  2YNX A;  3HVX A;  3ZVJ A;  2VCQ A;  4K9Z A;  4AGS A;  4EE0 A;  1XWG A;  4TXO A;  1B4P A;  3TKS C;  5HR0 A;  2ON7 A;  5JWQ B;  3TRX A;  4TR0 A;  4IJ3 A;  3EUR A;  2GSR A;  2QKE A;  1ERT A;  4MDC A;  3RPP A;  2MZC A;  3C73 A;  1ZCP A;  2GZZ A;  3UBL A;  2XPE A;  4A5P A;  4USS A;  2EC4 A;  1F3A A;  2GQK A;  1W4V A;  5DQS A;  2L57 A;  7GSS A;  2JL4 A;  4FH8 A;  2DKH A;  1SD8 A;  1DUG A;  3F0I A;  2X99 A;  11GS A;  3IC8 A;  3GST A;  3TJB A;  4MA9 A;  3GKK A;  4BVX A;  4K1F A;  2FY6 A;  2X64 A;  4MPF A;  3L78 A;  4BWS A;  2QA2 A;  4O5R A;  2WDU A;  4W66 A;  1T7P B;  4WBJ A;  3QDN A;  3M0F A;  3CTF A;  4POL A;  3HDC A;  5HR2 A;  4NXI A;  2B6M A;  1TW9 A;  4XTS A;  4ILF A;  1QMV A;  2ZCT A;  1R7H A;  3CSI A;  4IW9 A;  4LMW A;  4GQC A;  4OMV A;  2DMM A;  3TKS A;  2DKI A;  3ZZX A;  2HZF A;  4LL4 B;  5J4U A;  2VM2 A;  2R0C A;  2HRK B;  1V9W A;  1FB0 A;  1ERV A;  2C4J A;  2LJK A;  5KN3 A;  3HJM A;  2DJ2 A;  3F4R A;  1Y25 A;  2HSH A;  3TKS E;  2FD3 A;  4PNF A;  1B48 A;  2O89 A;  3IHQ A;  2AB6 A;  4L0W A;  1T00 A;  1M2A A;  5LNK e;  16GS A;  1GRX A;  2HRN A;  2C80 A;  4GSS A;  4GLT A;  2JZR A;  1AQV A;  1ZYP A;  2VCX A;  2MBT A;  2H1D A;  2H1B A;  4GXZ A;  1OE8 A;  3GMF A;  4I6X A;  3C8E A;  5FWG A;  1NHO A;  2C3T A;  5HR1 A;  2GTU A;  5D9W A;  2WUL A;  1SKW B;  3TJK A;  3KTB A;  2MMZ A;  4TW5 A;  3MWH A;  4K7O A;  5JCU A;  4N0V A;  1GNW A;  1BJX A;  3HZ4 A;  2LS5 A;  4XCS A;  4BPY A;  2NVL A;  3FR3 A;  3D6I A;  5A34 B;  1SD9 A;  3GSS A;  4EDZ A;  4ULX A;  1WRY A;  2AYT A;  3RBT A;  1SK1 A;  4DSR A;  2IJY A;  3UL3 A;  1GTI A;  1ST9 A;  5DJL A;  1IYI A;  1JZR A;  1O81 A;  3D4M A;  4D73 B;  3DGQ A;  2GS3 A;  1PX6 A;  1XOB A;  3ZLP A;  4QMK A;  5DAL A;  1FVJ A;  1C72 A;  5IMV A;  4J2F A;  2G0F A;  2BTO T;  4MJB A;  3GL3 A;  4MZB A;  4KND A;  5B6N A;  5IMF A;  3KMO A;  1MDJ A;  4POB A;  4IVF A;  1USB A;  4WET A;  5AIX A;  2H19 A;  4I2T A;  1X9M B;  4RQX A;  4JR4 A;  4Z2U A;  2VOC A;  3IAS 2;  1GUK A;  4GCI A;  4HI7 A;  3HJO A;  2B5X A;  2CQ9 A;  3P7X A;  2NTO A;  2X8H A;  5GAP D;  1EEJ A;  4NHW A;  4JE1 A;  2JAC A;  5IOX A;  1N2A A;  4K8M A;  2EIO A;  1OKT A;  3RAZ A;  3DVX A;  3IOS A;  3GKX A;  3FZ4 A;  2H75 A;  4X1U A;  2PBJ A;  4OFT A;  2ON5 A;  2AUV A;  4OFM A;  2KLX A;  3WGX A;  4K2X A;  2EFH A;  3RPN A;  3S9F A;  2J23 A;  3QMX A;  1RQM A;  4MJA A;  5ECQ B;  1V58 A;  2QA1 A;  4CY8 A;  4XRA A;  4YQM A;  3FHK A;  4ML1 A;  2H8L A;  3L9V A;  3BJ5 A;  1FG4 A;  2DBC A;  3EWL A;  2R2J A;  2XBI A;  3LG6 A;  5DAK A;  4KAE A;  1SK2 A;  3BD2 A;  1Y1U A;  3VFI A;  1PSQ A;  2H74 A;  3QPM A;  2LRT A;  2I3Y A;  3F9U A;  4AKI A;  1M7T A;  3KGK A;  3APS A;  3GX0 A;  1SJZ A;  3FZA A;  1R26 A;  4EL1 A;  1XBS A;  1BQ7 A;  1B4Q A;  2VCV A;  1FOH A;  1SJI A;  3TKR A;  2OE0 A;  1TXU A;  3QFB C;  4PUR A;  2H72 A;  2X8C A;  1R5P A;  4JBB A;  3H1N A;  2YWI A;  4I5Q A;  4NMU A;  1RW1 A;  1DE1 A;  3GUR A;  2EFD A;  5DJM A;  5IPH A;  4MAB A;  4O32 A;  5ID2 B;  1OVN A;  4K2D A;  4Z2R A;  4DSS A;  4F2I A;  2VL9 A;  2H73 A;  3CSJ A;  4HZ4 A;  2K8V A;  1X5C A;  1EV4 A;  2H6Z A;  2UV8 G;  2KP2 A;  3BBY A;  4OO5 A;  1O6J A;  1Q98 A;  1J08 A;  3TKP A;  5IMC A;  2EFC A;  1PL1 A;  4KH7 A;  2L5O A;  1WP0 A;  2WJU A;  2K6V A;  1KBN A;  4AJ8 A;  1UVZ A;  3Q74 A;  1YKC A;  2B1L A;  3MSZ A;  2G2Q A;  2IWT A;  2X8G A;  3WGD A;  2DC5 A;  4BL7 A;  5A5H B;  2H0I A;  3F6F A;  4E8E A;  4JR6 A;  1HNB A;  3E9J B;  3O76 A;  4P3Y B;  4EIQ A;  3HZ8 A;  1HYU A;  3CBU A;  2ZNM A;  2RUE A;  3ME7 A;  1SJ6 A;  5J47 A;  2PN8 A;  2MBS A;  3J7Y k;  1YJ6 A;  4DSQ A;  3UAP A;  2L4Q A;  1V40 A;  1ILO A;  2YWN A;  1GTB A;  2PUK C;  4KUN A;  4N11 A;  1SL0 B;  2K9F A;  1HNC A;  4HOJ A;  4GTU A;  4TXO B;  4KCA A;  22GS A;  1K0C A;  9GSS A;  3EYT A;  2VO4 A;  5E4W A;  1VF2 A;  3KJY A;  2GQL A;  3NOF A;  4G0K A;  5A1N A;  4TR1 A;  1ZYN A;  5J40 A;  2JZT A;  3CYN A;  2R37 A;  2RLI A;  1ABA A;  4V1A p;  5BMU A;  5AGY A;  3O6T A;  2LQO A;  2DJ0 A;  4KDU A;  5F0G A;  3APQ A;  1UC7 A;  5C04 A;  4KGI A;  3CTG A;  4BA7 A;  5DQY A;  3ZFL A;  3LGC A;  2FWF A;  3TKQ A;  1GWC A;  2CT6 A;  3EPT A;  3QFA C;  5ECN B;  5EL8 A;  4ID0 A;  3TJF A;  4XS4 B;  1K0D A;  4HS1 A;  3CRT A;  2CX3 A;  2R3X A;  2JSY A;  1TI3 A;  18GS A;  2IME A;  3WT1 A;  3NZN A;  3PIN A;  3QCP A;  1XXU A;  5D9X A;  4AJ7 A;  4WXT A;  2IFQ B;  12GS A;  3DKS A;  4KSO A;  4YKG A;  4J56 E;  3HVV A;  3A3T A;  1THX A;  4O5U A;  2H6X A;  1XFL A;  3VI5 A;  2O87 A;  4GRF A;  4CY6 A;  1PD2 1;  3LW9 A;  2O8V B;  4BWQ A;  1HNA A;  2B1K A;  1N25 A;  1E2Y A;  4Q5N A;  4N30 A;  1YZX A;  4K7N A;  3FZ9 A;  4KA0 A;  1JZO A;  1G0T A;  1BAY A;  3UAR A;  3ZMK A;  4XRD A;  1DE2 A;  2VAF A;  4OD7 A;  1TRW A;  2VLU A;  5J9B A;  3GKM A;  4MK3 A;  1TJD A;  3PPU A;  1M0U A;  1G7E A;  5LD0 A;  3DVW A;  1WJK A;  4GWR A;  3HHV A;  4MZC A;  2LST A;  1FB6 A;  5INY A;  3W8S A;  2O5V A;  2YZH A;  4GF0 A;  2VLV A;  5IMA A;  4AKX B;  4XIH A;  4MF7 A;  5KOW A;  3P2A A;  2AJQ B;  5DCG A;  1B9Y C;  4HEA 2;  1TRV A;  2L6D A;  4FO5 A;  4OWY A;  3I43 A;  4MP4 A;  3GIX A;  3LSZ A;  2QC7 A;  4QQ7 A;  3A5W A;  4MH2 A;  2I4A A;  5CP1 A;  4EDY A;  2WRT A;  3ERG A;  1GSF A;  1VF4 A;  5D73 A;  4LA1 A;  2C8U A;  2HSN A;  2VCW A;  3L9S A;  3IPZ A;  3CSH A;  2JSZ A;  4RI6 A;  5G1K A;  5J5N A;  5C00 A;  3ZIV A;  2F9S A;  3OR5 A;  4ZL8 A;  1OC9 A;  4QL9 A;  3VK9 A;  4AKH A;  1YQ1 A;  3IE3 A;  2I81 A;  2V1M A;  2GZY A;  2E7P A;  1KNG A;  5ECR B;  3VI7 A;  5GSS A;  4FIW A;  3GRX A;  4PQI A;  4WF4 A;  3V1W A;  4RQR A;  3MYD A;  2LKU A;  1A0F A;  2LQQ A;  1PQN A;  2GT6 A;  5IMZ A;  5IO0 A;  1WPI A;  3L0H A;  4JRR A;  1ML6 A;  3VWU A;  3FEU A;  4AI6 A;  4AF2 A;  5IQY A;  1GUH A;  2D2Z A;  2YZU A;  2R4V A;  4KCE A;  1K3L A;  5ELA A;  1OC3 A;  1ZL9 A;  1XIY A;  2YWO A;  2YV9 A;  3DEX A;  3EVI A;  1K0B A;  4IQA A;  2L5L A;  2PER A;  5DAK B;  1XPV A;  4MH3 A;  5ECK B;  3KD0 A;  3AY8 A;  1TTZ A;  4ZBB A;  2F3M A;  1EV9 A;  2AHE A;  2C0G A;  8GSS A;  2A2P A;  2EIQ A;  4K5R A;  2FA8 A;  3F3Q A;  1A8L A;  4BVY A;  4KW6 A;  1BG5 A;  3JCM L;  2CX4 A;  3UEM A;  1X9W B;  5JWO B;  3FW2 A;  2GSS A;  1T3B A;  5HFG A;  5A4W A;  1NW2 A;  4G01 A;  3J7Y b;  5G1L A;  4K7I A;  1M99 A;  2CA8 A;  5B8A A;  3LFL A;  2MMO A;  4EC0 A;  3GH9 A;  4IQ1 A;  5H5S A;  1JFU A;  3BCI A;  5EPF A;  2HFD A;  3H93 A;  1JLV A;  4NPB A;  1XW9 A;  1A24 A;  6GSV A;  4OCE A;  3IXR A;  1ACV A;  5DCH A;  3WYW A;  4AJ6 A;  1AQW A;  4ZL7 A;  2FNO A;  4G2E A;  1NSW A;  4ZBD A;  2MMA A;  2LTK A;  3I6A A;  1OKD A;  3EU4 A;  2KUC A;  2OKA A;  1QK8 A;  3ZRE A;  1F3B A;  3VPT A;  1SVL A;  3LQ7 A;  1OE7 A;  1Z5Y E;  1GUM A;  4G0L A;  1OC8 A;  1YF0 A;  4KE3 A;  3D21 A;  5ABR A;  2BMX A;  1GSD A;  1Z9H A;  2A4H A;  2HRA A;  4BL7 B;  10GS A;  4LL1 B;  2REM A;  3TCO A;  2LNS A;  3KCM A;  3Q6O A;  2V41 A;  1XVW A;  2HRF A;  4FYB A;  1SKR B;  5CYY A;  3TUE A;  1XW5 A;  4GQF A;  3VPQ A;  19GS A;  2R0G A;  3IDV A;  5J9C A;  1MD3 A;  5FHI A;  5G30 A;  3G7Y A;  4L0U A;  2HI7 A;  2X4A A;  4V2L A;  2FGX A;  2IPA A;  4DVC A;  4JED A;  3CMI A;  4K0G A;  1WIK A;  1BX9 A;  2M72 A;  3FZ5 A;  1H4O A;  4HU7 A;  2YCD A;  3F3R A;  1KEB A;  1VGL A;  1XCC A;  2AV4 A;  1QXH A;  1YEP A;  3EU3 A;  4EXJ A;  1MDI A;  1GLQ A;  1TRU A;  2A4V A;  1FAA A;  2YJ7 A;  1SU9 A;  2LJA A;  3H4K A;  2DIY A;  1XW6 A;  4OCF A;  2VL2 C;  3LYK A;  1F2E A;  2GST A;  3IBH A;  3GYK A;  1TK5 B;  3QOU A;  5A4V A;  6GSW A;  2A2S A;  4TOP A;  3WT2 A;  1Z3E A;  4FYC A;  6GSU A;  4MPG A;  3D5J A;  1ZOF A;  5DBQ A;  2DIZ A;  5DDL A;  3K8N A;  3N9J A;  4ZIL A;  1T8E B;  1DBY A;  4EIP A;  4MNN A;  1K0M A;  2FUG 2;  1AIU A;  2ALB A;  3PGT A;  4G0I A;  5H5R A;  1QUW A;  6GSX A;  2GGT A;  1E6B A;  4F03 A;  1MEK A;  3ISO A;  1AAZ A;  3HXS A;  1GNE A;  1YKA A;  3A2X A;  3KP9 A;  1M2D A;  4V1A g;  4MF6 A;  3C1S A;  4PUA A;  5LCZ A;  4PNG A;  3GKN A;  2FWE A;  3BOA A;  3PH9 A;  2UZ8 A;  1J0F A;  5F8B A;  1LJR A;  1EOH A;  2NPB A;  3UMA A;  2LJR A;  1PN9 A;  2P0G A;  2H70 A;  2B5E A;  3L4N A;  3FRC A;  2V2G A;  1T1V A;  4I8B A;  3F4S A;  3G7I A;  2N5B A;  3LEF A;  3TOT A;  4PQH A;  3U6V A;  4E8H A;  2TRX A;  1ZZY A;  5ECO B;  2VL2 A;  1GP1 A;  1Z6M A;  3IAM 2;  4YAP A;  3QR6 A;  2LNT A;  4D73 A;  2P31 A;  1A2M A;  2GQM A;  2XC2 A;  2WS2 A;  5KN2 A;  4XHM A;  2C3N A;  3EC3 A;  1A2L A;  4ZB9 A;  2CV4 A;  5CO3 A;  4IGJ A;  3UBK A;  4ACS A;  3ZVJ D;  1MD4 A;  2HLS A;  3IK7 A;  5CNW A;  1Y6E A;  1G7O A;  4HU9 A;  4IS0 A;  3KEB A;  1EGO A;  3TDG A;  5HFI A;  1X0R A;  5JWR B;  5ECS A;  3HYP A;  2PVO C;  4HJ2 A;  5G31 A;  5ECH B;  5GAN D;  1MDK A;  3DWV A;  4IN0 A;  4X0X A;  3H8Q A;  4IHU A;  3F63 A;  1PKZ A;  2IIY A;  2FLS A;  1JLW A;  2OA7 A;  4L5L A;  4LLR A;  1XWC A;  1TDI A;  1O73 A;  1HQO A;  1AUC A;  4F82 A;  2C0E A;  2N5A A;  2HSN B;  5JCW A;  4IEL A;  5D9T A;  4IJI A;  4F0B A;  2NDO A;  3EMX A;  1QFN A;  1X5E A;  1K0N A;  5JCG A;  1Q4J A;  4Q5Q A;  2C3Q A;  3CXG A;  1AC1 A;  4MMM A;  5F05 A;  2RM6 A;  4BVX B;  2JZS A;  2R5G A;  1SK0 A;  1A23 A;  4N3Z A;  3TOU A;  5D9V A;  4EF0 A;  2RM5 A;  3H79 A;  2HZE A;  5KEJ A;  4HDE A;  5H5Q A;  4NHZ A;  4MJE A;  1EWX A;  2H1A A;  1TU8 A;  1XZO A;  1A0R P;  3ZL5 A;  2YOI A;  2H66 A;  3WD6 A;  1VRS D;  1TKD B;  4KSM A;  3ZRD A;  3KIJ A;  2YV7 A;  3M1G A;  3QAW A;  1FW1 A;  2H0G A;  17GS A;  2I9H A;  2K18 A;  1VF3 A;  3DML A;  3IV4 A;  3FMW A;  1BED A;  1F37 A;  2B7K A;  2LEG A;  2BJX A;  4OFN A;  1GL8 A;  1PA3 A;  4QL7 A;  2E2M A;  3LWA A;  2OAD A;  2DLX A;  5ID2 A;  2VD1 A;  3ZML A;  3LJR A;  2YN1 A;  2MYG A;  2P5R A;  4O5Q A;  2IMD A;  1TU7 A;  1CQG A;  4TRX A;  4WEY A;  1M9A A;  2IL3 A;  1YEX A;  1SVO A;  2DSA A;  1XWK A;  4O7H A;  4WF5 A;  3ZYW A;  1Z7P A;  1ZYE A;  4ZBA A;  2V6O A;  3R3E A;  5BRT A;  2B3S A;  1R5A A;  3HD5 A;  1H75 A;  3UOM A;  4DEJ A;  3W6G A;  3UJ1 A;  1RK4 A;  4IKH A;  5B6M A;  4ECJ A;  2O85 A;  3KTL A;  3IRA A;  3HMJ G;  5A5H A;  1EOG A;  4MLY A;  2QSI A;  1AXD A;  4TR4 A;  3D4T A;  2J9H A;  4PUF C;  2B5Y A;  4PQ1 A;  4POM A;  2H6Y A;  4YKF A;  3HA9 A;  4KDY A;  2LV3 A;  1V98 A;  4N10 A;  3ERF A;  2YJH A;  1SKS B;  2KHP A;  1X5D A;  5DAL B;  6GST A;  2QGV A;  2LRN A;  3VWX A;  3P90 A;  4WBR D;  4Q5R A;  1YY7 A;  2CZ2 A;  1K3Y A;  5IPG A;  3TU3 B;  1AQX A;  3A2W A;  3IR4 A;  2L59 A;  4HJM A;  4MF5 A;  5J4Y A;  3CRU A;  2DML A;  4CW9 A;  2YAN A;  2O7K A;  5IM9 A;  3ERW A;  1GTU A;  3FYG A;  3A2V A;  2I1U A;  1U3I A;  2TRC P;  13GS A;  3M9J A;  2CVK A;  3RHC A;  1T4Y A;  4PTS A;  2IMF A;  2PU9 C;  1I9D A;  1BG1 A;  4ICY A;  3UVT A;  3KM6 A;  1O85 A;  1KTE A;  4NV2 A;  2CVB A;  1GUL A;  4JU5 A;  2B7J A;  1PN0 A;  5IO2 A;  4YQV A;  2V32 A;  3IK9 A;  2A2R A;  4Q5F A;  1O7U A;  3C71 A;  4G9H A;  4ZIJ A;  4FYU A;  1FOV A;  1PX7 A;  3GUS A;  1ON4 A;  3VWW A;  4NAX A;  5ECM B;  3GTU A;  1PMT A;  5B8B A;  1PRX A;  3TJG A;  3QAG A;  4V2M A;  3U5R E;  1K3O A;  1GLP A;  1Z6N A;  5D93 A;  4XS4 A;  3M8N A;  4H86 A;  2CAI A;  1EP8 A;  4F0C A;  4G19 A;  1JZW A;  4MZW A;  2PWJ A;  1TP9 A;  2IFQ A;  3DIE A;  2DJK A;  5ECI B;  2XBQ A;  3BCK A;  2HNL A;  5ELG A;  5KN0 A;  5CAX A;  5HR3 A;  2PMT A;  4ECB A;  1SYX A;  3EIN A;  4YQU A;  5E59 A;  1G6Y A;  5G2Z A;  4Z2T A;  2CAQ A;  2WGR A;  2HE3 A;  4FQU A;  2HSY A;  3QD9 A;  4XS6 A;  1CQH A;  3KMN A;  1SL2 B;  3TGZ A;  3RDW A;  2VM1 A;  2HSM A;  4ZXG A;  1PKW A;  3TB2 A;  2H71 A;  1URM A;  2OBK A;  2VIM A;  3HKR A;  1QGV A;  1X9S B;  3KH7 A;  3MAK A;  1FHE A;  2H0H A;  1GSE A;  4Z7X A;  4YAV A;  4CHS A;  3SWL A;  3FY7 A;  4DSS B;  3DXB A;  2EFE A;  3WGE A;  1ZGN A;  4TN8 A;  5HQP A;  3LXT A;  2MMN A;  2RUF A;  2H1G A;  1M2B A;  3UVH A;  4ZB7 A;  5GZZ B;  2C0D A;  5G5E A;  4XS1 A;  1U87 A;  5G5F A;  2C1Y A;  2M80 A;  2VCT A;  1OYJ A;  2K8S A;  4CDO A;  4K0N A;  2AAW A;  1UN2 A;  4L5O A;  3GH6 A;  1WOU A;  4EVM A;  5AIS A;  2LUS A;  2HQT A;  4HQS A;  4E68 A;  5CRH A;  1SEN A;  2PVQ A;  2VCZ A;  2CVD A;  3KP8 A;  1ZMA A;  1GSY A;  2WB9 A;  2HYX A;  3M3M A;  1TOF A;  1TK0 B;  1EP7 A;  2M46 A;  2L6C A;  1THO A;  2GSQ A;  5FT3 A;  1XWA A;  1I5G A;  2P5Q A;  1GTA A;  5L71 A;  1MTC A;  1M9B A;  1S3C A;  3UIW A;  1F6M C;  4GST A;  4MCU A;  2IMI A;  1ERW A;  2JAD A;  3A5I A;  3L9U A;  1N8J A;  4N0Z A;  1U3A A;  2FWH A;  5A1N B;  4TR1 B;  3I9V 2;  5ECP B;  2H30 A;  2IN3 A;  1SVM A;  1WWJ A;  1DSB A;  1O8X A;  20GS A;  1F9M A;  1XVQ A;  1A2J A;  1EEM A;  1TRS A;  5BMU B;  2PPT A;  1XOA A;  2IMK A;  1JZD A;  3HCZ A;  5EVO A;  3DYR A;  5IIZ A;  2HRK A;  3D0Z A;  3ED3 A;  3ME8 A;  1OAZ A;  1LU4 A;  4TXV A;  1T4Z A;  1FO5 A;  2L4C A;  3RHB A;  4RI7 A;  2HZE B;  2GVP A;  4KX4 A;  2OE3 A;  2YWM A;  4J57 E;  1PGT A;  1TK8 B;  2F8F A;  1EZK A;  2GZP A;  2XPD A;  3FR6 A;  3GV1 A;  4HZ2 A;  3DD3 A;  2OE1 A;  3ZIJ A;  4KF9 A;  3LOR A;  3P8W A;  3O3T A;  4HUA A;  3D22 A;  4K6X A;  3ZFB A;  1EGR A;  4IP1 A;  2Z9S A;  3G7J A;  3KH9 A;  2GDR A;  2GLR A;  3F4T A;  1HD2 A;  5ECL B;  1LBK A;  1GSQ A;  1O8W A;  2KOK A;  5D96 A;  3HVS A;  2WZ9 A;  2OBI A;  2F51 A;  4RUV A;  5A34 A;  1U88 A;  3GFK A;  3SBC A;  4ISD A;  3N5O A;  5EY6 A;  1A8Y A;  2TIR A;  4LMV A;  1GH2 A;  5DVB A;  2OT3 A;  1BYE A;  5AN1 A;  3GHA A;  4HQZ A;  4PGT A;  4NV5 A;  1ERU A;  1R4W A;  3TRP A;  1Z7R A;  2DJJ A;  2E2G A;  1TXX A;  2DJ3 A;  2X49 A;  3IHG A;  4WKW A;  2WFC A;  2OJL A;  4KDX A;  4ZB8 A;  4IP6 A;  3IC4 A;  1JHB A;  1S3A A;  2RII A;  3E0U A;  3HY2 A;  3VLN A;  3FKF A;  4YH2 A;  1NHY A;  1U6T A;  5J4V A;  2YP6 A;  3ZIT A;  2R0P A;  2OAC A;  4AKG A;  1FVK A;  14GS A;  3TRQ A;  4PXO A;  3IA1 A;  2FCH A;  3GN3 A;  2V6K A;  5CRD A;  1B8X A;  1SYR A;  3VWV A;  1AW9 A;  4EUY A;  3GNJ A;  3C7M A;  1OC9 B;  2DJ1 A;  2EIR A;  3PR8 A;  2JU5 A;  4X43 A;  5A4U A;  2H76 A;  4POK A;  3I69 A;  2E0Q A;  3Q18 A;  4TR3 A;  1YVL A;  3GX8 A;  3R2Q A;  3QAV A;  3APO A;  1BF5 A;  1YF1 A;  5F06 A;  3C1R A;  2CZ3 A;  4GSN A;  1GSS A;  4ZL9 A;  5KN1 A;  4F9Z A;  5J3R A;  2VL3 A;  3ZTL A;  3MIX A;  4GDF A;  4PX1 A;  5GST A;  1G6W A;  3TJJ A;  3GTU B;  5IOW A;  5B7C A;  3MNG A;  1K0A A;  2GT5 A;  5D8I A;  5ENU A;  5KOX A;  1WMJ A;  1WE0 A;  3Q19 A;  3FK8 A;  4K5S A;  2WCI A;  1QQ2 A;  1XWB A;  2N5F A;  6GSS A;  4O92 A;  2VUP A;  3E3E A;  3EE2 A;  3FR9 A;  2FA4 A;  1IYH A;  4L8E A;  3CWG A;  1V57 A;  4ZB6 A;  4WR5 A;  4TVE A;  2R6K A;  2PGT A;  1W89 A;  4X4J A;  1S3D A;  2HT9 A;  2HXK A;  1B9X C;  5COH A;  2LRC A;  4ML6 A;  3NIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...