5A4WA

Atgstf2 from arabidopsis thaliana in complex with quercetrin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
AGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 84
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a4wA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a4wA01
2B1LA 3KMNA 2LV3A 5G5EA 2LJAA 1QFNA 1A8YA 3VFIA 4CDOA 1QGVA 2YWNA 3TJBA 3ZMKA 1XW5A 4V1Ag 4AJ8A 1PA3A 4AGSA 2PN8A 4X43A 3H1NA 2HXKA 2WULA 1Z7RA 4F0BA 3DMLA 4IKHA 3UVTA 2VLVA 4IW9A 2DC5A 1XBSA 1A2LA 3P90A 1JHBA 1URMA 2JSYA 3ZMLA 4Q5FA 5J5NA 2DJ3A 2E2GA 2YV7A 1XVQA 5CO3A 5DALA 3H8QA 1HNAA 4MJBA 2VCXA 2HRKB 4KX4A 3GH9A 2B5YA 4MF6A 2Z9SA 3ZVJD 3ZIJA 3J7Yb 2NTOA 3TKSE 2F8FA 4GQFA 4Q5NA 2VCVA 3HY2A 1HNCA 3L78A 4TN8A 1OE7A 2WCIA 2QC7A 3F8UA 3BOAA 1R5PA 2DIYA 3VWUA 2I1UA 5DCHA 3EU3A 2JZTA 4MF7A 4XRAA 4D73B 2YV9A 4OFMA 5LD0A 3BD2A 3GL3A 3F6DA 2B5EA 4F82A 3UIWA 4GSNA 1BYEA 3C1SA 2FA4A 2HRNA 1I9DA 1KEBA 3A2XA 1V57A 2VL2A 2HZEB 2L59A 3I69A 2RM5A 4BVYB 2OE3A 4XRDA 3A2WA 5DVBA 6GSYA 2HRKA 5ENUA 4WF5A 2PERA 2V2GA 1FHEA 4WXTA 1NSWA 2YZHA 2VL9A 20GSA 3HZ8A 3ME8A 4K6XA 1H75A 2AJQB 1JLWA 2CZ3A 3HJMA 1JZDA 3VK9A 2GSRA 1PX6A 1ABAA 3VWVA 4GLTA 4KCEA 3R2QA 2E0QA 5DBQA 4HU7A 3KXOA 4K0NA 2HRAA 3CMIA 3GIXA 5ECLB 2I4AA 2PPTA 4EDZA 3QPMA 2MMZA 3TJGA 4Q5QA 1YF1A 3RPNA 4KGIA 2L5OA 1T4ZA 1OC8A 1EEJA 2H6ZA 2OE1A 3K8NA 3ZL5A 4V2NA 1AIUA 3OR5A 3P7XA 2JACA 2HZEA 2AV4A 1LU4A 2HYXA 1M2BA 5G1KA 4L5LA 1C72A 4BVYA 3HZ4A 2IMIA 1K0NA 5GSTA 4MH3A 1XPVA 4I97A 3V1WA 1OE8A 3GN3A 4PX1A 3GX0A 2V6KA 1QQ2A 3KZQA 16GSA 1JFUA 4BPYA 2X64A 4P3YB 2CV4A 1B4QA 2XPEA 4G0IA 2VD0A 3VPTA 3ZFLA 4YQUA 4TXOA 2VOCA 2B6MA 4WBRD 1G7OA 9GSSA 1YZXA 3LJRA 1TOFA 3BCIA 3C73A 5D93A 3W6GA 1T00A 5IMDA 3HXSA 2R6KA 1TI3A 1TP9A 2R37A 4FH8A 4CW9A 3KIJA 1SD8A 2A2RA 3GSSA 1GLQA 3GA4A 2H70A 3GHAA 5HFIA 1X9SB 3D5JA 1DUGA 2J23A 2OE0A 1S3AA 5FT3A 2VCQA 1SK0A 2HE3A 1GTUA 2BTOT 4LA1A 1XW6A 3W8SA 4OCEA 4ECBA 1B4PA 1YF0A 2FD3A 3MSZA 1HYUA 2FY6A 1SYRA 1Z7PA 4I2UA 1T1VA 5IM9A 4EC0A 4HDEA 2GQKA 3M0FA 4POBA 3QOUA 2FHEA 1EV9A 1GTBA 1BEDA 1Z9HA 2L4QA 3QR6A 4KSOA 4IVFA 1YDKA 5D8IA 1TRSA 4KNDA 2CVBA 3A5WA 1TK8B 3UVHA 3GH6A 2XBQA 1X9MB 2H76A 1BJXA 1OC3A 1R5AA 1MDKA 3ZYWA 1GH2A 1JZOA 2BJXA 3FKFA 3VI5A 1NHOA 1ZL9A 4POKA 4ID0A 4ZIJA 1PSQA 3GTUB 3FK8A 5CRHA 2YJ7A 1W4VA 1XWBA 3KCMA 2BMXA 3O3TA 2GDRA 4E8EA 2B7KA 5CYYA 4ACSA 3MWHA 3NOFA 1MEKA 3TGZA 1A2MA 1U3AA 1M99A 2V6OA 1PMTA 5IO2A 3HYPA 3VI7A 3UL3A 2GS3A 1V58A 3F4TA 2N5BA 3O76A 3E9JB 1ACVA 1IYIA 4RI6A 4N0ZA 2H19A 2WZ9A 5GAND 5G31A 1MDIA 1OKDA 5D9WA 4G19A 4GTUA 2C3QA 2H1AA 2QSIA 3LYPA 2IWTA 4JRRA 4I6XA 1O85A 4ZILA 3GTUA 1FO5A 5D9VA 3BJ5A 1ZGNA 1SL2B 1ML6A 1CQHA 5E4WA 4PUFC 1XW9A 1OVNA 3GNJA 1GSDA 1EGOA 2IJYA 3H4KA 2FWEA 3DRNA 3BBYA 4ECCA 4IS0A 3IC8A 3KM6A 3L9SA 4OD7A 4ZXGA 3GFKA 4ISDA 4TXVA 5IMCA 4GQCA 4J2FA 3IHQA 1K3YA 1MD4A 1K0BA 4KAEA 1RK4A 2YZUA 3LXTA 19GSA 4PURA 4GSTA 2MZCA 3FR9A 2PVOC 2F3MA 1ERTA 3CTFA 1UN2A 4ZB8A 2QKEA 2V1MA 4HQZA 3EMXA 4L0UA 4HU9A 4MA9A 1TI1A 2LRCA 1O73A 1JZWA 4TW5A 3F6FA 2J9HA 4AJ7A 4PQ1A 4OO5A 3GL5A 3TB2A 1FW1A 3CYNA 5B8BA 4YQMA 1KBNA 22GSA 1LJRA 3PGTA 5F0GA 3WT1A 5J41A 3EMPA 5JWQB 3QAGA 4TR1B 2YP6A 2C3TA 3IA1A 3H79A 2YJHA 3TKPA 1SKRB 2DJKA 3KTLA 2H30A 2P31A 1X5EA 4K0GA 5HFKA 4CHSA 3F3RA 3FW2A 1Z3EA 5DALB 3ZVJA 5H5QA 2NDOA 3F4SA 1YJ6A 1R4WA 3FZAA 3TKSA 1G0TA 3W8JA 1MTCA 4RQRA 4ULXA 2HSHA 4QL7A 5C00A 3P8WA 3O6TA 3WGXA 4IP6A 3IK7A 4G10A 4HJ2A 2H6YA 3E3EA 4EL1A 1AQXA 3D6IA 2MYGA 4K7IA 2R2JA 2JL4A 3QFBC 3LYKA 2PBJA 4ECIA 4TR1A 2GT5A 4EO3A 5IMVA 2IIYA 3HHVA 5A4VA 1CQGA 2WDUA 2RUEA 3EVIA 3U6VA 1YKAA 3IV4A 1F6MC 4KDYA 4OO4A 2K6VA 1VF3A 3HVSA 1NHYA 2CX3A 6GSWA 5G2ZA 4YH2A 18GSA 4N10A 1YKCA 5LNKe 2LNSA 1TJDA 1I5GA 2H8LA 2VCWA 2O8VB 3HVXA 1ON4A 5DAKB 2ON5A 1S3CA 4MP4A 3L0HA 1SL0B 2H66A 4MPGA 3R3EA 4FIWA 5IMFA 3C8EA 3TJFA 4BL7B 5IIZA 2MBSA 3KP8A 2P5QA 4HI7A 1U88A 5CAXA 3HD5A 1MDJA 11GSA 2OKAA 4WF4A 4XS4A 3FZ5A 2WS2A 1QMVA 1EGRA 3BCKA 1AAZA 4HZ4A 3N9JA 5F06A 1XFLA 3ED3A 4PNGA 3G7YA 2AYTA 5DCGA 1XIYA 4N11A 3DYRA 3I43A 2REMA 3IR4A 1M2AA 2FCHA 4TR0A 4FYUA 2G0FA 2YNXA 4AF2A 5IPGA 3C1RA 1ZYQB 1TK0B 2X8HA 3APOA 4IGJA 1J9BA 2LEGA 3UOMA 1TK5B 1MD3A 2L6DA 4NXIA 4X0XA 5DAKA 4F0CA 4I8BA 2RM6A 5FWGA 1USBA 2YWIA 3S9FA 1G6YA 4BL7A 2L6CA 3DIEA 1YQ1A 5G30A 4KW6A 2IMEA 3GKKA 3HVVA 1FVKA 1DSBA 1OAZA 3ZLPA 1K0MA 4PUAA 4AJ6A 2YCDA 3L4NA 2QGVA 3WD6A 4TXOB 1IYHA 4MDCA 2DJ2A 1Z6NA 4GSSA 2NPBA 3EC3A 10GSA 1F3AA 3F9UA 2C80A 4ZL9A 5FHIA 2PGTA 3LQ7A 2H73A 4MZCA 1A23A 5COHA 2OBKA 1GLPA 4KH7A 1B48A 2IMKA 5AIVA 5DDLA 3HKRA 7GSSA 2KP1A 3TRXA 2MMAA 3Q18A 5F07A 4PXOA 4XS6A 5ECMB 2NBSA 5CP1A 4EKZA 2LKUA 1PX7A 4DVCA 1ERUA 2YWOA 5B6NA 4QQ7A 2IMDA 2JADA 4NWYA 2GVPA 5A4UA 1GSEA 1OKTA 2LQQA 3D22A 2CAIA 3LG6A 4KA0A 1FOVA 2WFCA 3ERGA 3M9JA 1SK1A 3VPQA 3FR6A 4EDYA 3KH9A 3C71A 3F63A 5ID2B 3GV1A 3CRUA 3N5OA 2B1KA 4KDXA 5ABRA 2ZCTA 4L5OA 4NV2A 2PWJA 4GWRA 3F3QA 4WBJA 4MF5A 5IQYA 1Q98A 4JR4A 3IAS2 1RQMA 3QDNA 4POLA 1SKWB 2VCZA 2LS5A 2XBIA 4G2EA 3TUEA 3FR3A 5ELGA 3TRQA 4IP1A 1AUCA 2H1GA 3QD9A 4KF9A 4NMUA 4ZBDA 3TOTA 3TJJA 5JWRB 2CA8A 4O32A 4XHMA 1XVWA 1YEXA 4F2IA 1EZKA 1A0FA 4V2MA 2HSNB 1Z6MA 2DMLA 3KP9A 3LGCA 1DBYA 1GNEA 3HJOA 3IAM2 2FUG2 4MABA 3FZ4A 3A2VA 1FB6A 3G7IA 4IQ1A 5ID2A 1YEPA 2CQ9A 4MJEA 4ML6A 2FA8A 4DSQA 5IMZA 4BVXA 2YWMA 1SL1B 2VLUA 2PVQA 1F37A 1BG5A 1J08A 1J0FA 2RIIA 3US3A 3IXRA 1K0OA 2LNTA 3I9V2 2GZPA 1Y6EA 1W89A 4BWSA 2ZUPA 4MJCA 1GUMA 1SENA 4TR3A 3GUSA 6GSUA 2G2QA 4MLYA 4ZB6A 2VM1A 4LMVA 2C0DA 4GF0A 3RBTA 4HUAA 4ZL8A 3GURA 4BA7A 3ERWA 2LQOA 2WB9A 4BWQA 1GUKA 4V2LA 4QL9A 1F2EA 2O89A 2JSZA 5ECHB 1VGLA 3D0ZA 1XXUA 6GSTA 3KH7A 4WR5A 1GUHA 4WR4A 4I5QA 2IN3A 1A8LA 4LL4B 2L4CA 2LJKA 4F9ZA 3CSJA 1KNGA 3IBHA 3PPUA 4IQAA 3WT2A 3RAZA 5GAPD 3Q74A 4MZWA 5BMUA 1NW2A 1AXDA 1XWGA 1N2AA 1GTAA 2CT6A 1SKSB 5A5KA 1X9WB 5J9CA 2HNLA 6GSVA 1TDIA 1WIKA 4IBPA 4OFNA 5B6MA 2WRTA 1FAAA 2RLIA 2WGRA 5G1LA 4XCSA 4N30A 5D9TA 1UVZA 3P2AA 2CVKA 3WGEA 1WPIA 3EE2A 1B9XC 2TRXA 4Z7XA 3QCPA 14GSA 1HNBA 4MMMA 4PQHA 1WMJA 4KDUA 1E6BA 2F9SA 3GMFA 1K0AA 4HS1A 5HR0A 3CSHA 3I6AA 4K2DA 2XPDA 5IMAA 5KN2A 1DE1A 3DVXA 2K8SA 1K3LA 1B9YC 3PINA 4PNFA 3TKQA 1ZZYA 5AN1A 2O85A 4DSRA 5ECOB 2D2ZA 1F3BA 3CSIA 2IMFA 2H74A 2VD1A 1S3DA 2C0FA 4LMWA 2LJRA 2PMTA 1LBKA 2FWGA 1SK2A 5H5SA 5C04A 4GRFA 1EEMA 2H6XA 5HR3A 4X1UA 5ELAA 4WEYA 4TVEA 3RHCA 2I3YA 5JCWA 2H01A 2CZ2A 3DD3A 2CAQA 2C3NA 3EYTA 3G7JA 1ZYEA 5LCZA 1Y25A 4WKWA 4G0LA 1V98A 2R3XA 5GSSA 4KCAA 1TU8A 1X5CA 4IHUA 4O7HA 3L9UA 4JZQA 5ECNB 2R5GA 2HLSA 2VL2C 4OWYA 5ECQB 5J9BA 3L9VA 2V32A 5CRWA 2JZRA 2DBCA 3Q19A 2HSMB 4HQSA 3SWLA 4N0VA 1XOAA 1SJZA 1V40A 3GKMA 1PL1A 2DSAA 4EUYA 1GNWA 2GTUA 2GQMA 4G0KA 1VF1A 3IRAA 3HJPA 2C4JA 1V2AA 3KTBA 2DJ0A 1PN9A 3LFLA 4KUNA 4HJMA 2M46A 4DSSA 2CVDA 1WE0A 1ZCPA 4F03A 1V9WA 4XS4B 3DKSA 3EWLA 4MH2A 4O5RA 2CX4A 1TXXA 1TW9A 1R26A 5ECRB 2KHPA 3D21A 5D9XA 4L8EA 2P0GA 1KTEA 2H72A 2YN1A 1N8JA 1EP7A 1XWAA 1O8WA 1GTIA 2DLXA 4RQXA 2HSMA 3IPZA 3J7Yk 5CREA 2MMNA 4FO5A 4LL1B 2VCTA 3CRTA 3M9KA 3KMOA 2KOKA 4PQIA 2L5LA 1QUWA 3KD0A 4GCIA 2OADA 4K8MA 2N5FA 5J4UA 3UBKA 5E59A 3E0UA 3ISOA 2P5RA 5F05A 2O87A 2YANA 2XC2A 8GSSA 1VRSD 1THOA 4L0WA 5H5RA 3VWWA 3ZIVA 1SJ6A 2JZSA 2VLTA 1FVJA 3GKNA 2F8AA 1AW9A 4O92A 5DQYA 1T3BA 4JE1A 3APQA 2PUKC 4JEDA 1GWCA 2LRNA 5ECPB 3DGQA 2A4VA 5HR1A 5G5FA 5INYA 4YQVA 3D4TA 4K7NA 4GXZA 4KB3A 2KLXA 1YY7A 1O7UA 1A2JA 5J3RA 2UZ8A 1ZMAA 1VF2A 1PKWA 3IDVA 4MJAA 2IPAA 1X5DA 3M1GA 2H1BA 2E7PA 3EINA 3CXGA 3FZ9A 2EIRA 4RUVA 1O6JA 5IO0A 3IK9A 3DXBA 4XS1A 1FB0A 3DEXA 2ALBA 1GSUA 2MMOA 2ZNMA 2OBIA 2TIRA 2OA7A 1HQOA 4IELA 1EOHA 2HZFA 2VM2A 4K9ZA 4NHZA 3Q6OA 3TCOA 5EL8A 2AUVA 1E2YA 2AAWA 4J57E 4HOJA 1G6WA 2LRTA 1BQ7A 2XHFA 5HFGA 2FGXA 2TRCP 2I81A 4D73A 3TDGA 3MNGA 4MZBA 1GSYA 1WRYA 2GSTA 1HD2A 3TKRA 3QMXA 2OACA 4EXJA 4PTSA 2C0GA 2I9HA 1GSSA 2VO4A 3HDCA 2N5AA 12GSA 2ES7A 2H0GA 2K18A 2JU5A 3UAPA 2IL3A 2NVLA 2YPMA 3LSZA 4IJIA 1NM3A 4TRXA 2V41A 3UARA 1M9BA 1TRWA 3ZRDA 1TTZA 1T8EB 6GSSA 3ZITA 4G9HA 1OC9B 1GL8A 5DJMA 1AQVA 3DVWA 3QAVA 3PH9A 5B7CA 4J56E 1M0UA 3EURA 3D4MA 1PQNA 2B3SA 1TU7A 1FG4A 4IJ3A 4BVXB 5JWOB 5ECKB 2DIZA 5KEJA 2H1DA 4ILFA 5CNWA 1UA5A 1QXHA 2X99A 2GGTA 6GSXA 5JCGA 1O81A 3IC4A 3IE3A 2B5XA 4XTSA 3FYGA 1K0DA 1G7EA 2FWFA 1K0CA 3H93A 4WETA 5IPHA 5JCUA 3UBLA 3A3TA 1GSQA 3TRPA 3APSA 4KE3A 3KGKA 2HRFA 1PGTA 1PL2A 5A4WA 4OMVA 5AGYA 3FY7A 4KSMA 4EF0A 4XIHA 1XCCA 2OJLA 1OC9A 3IOSA 5CRDA 5F8BA 1WOUA 3HA9A 3ZFBA 1WJKA 2GQLA 3ME7A 3GYKA 2VAFA 1OYJA 3NIVA 4FYCA 3JCML 3F0IA 5IOWA 2H75A 3GX8A 3FRCA 5B8AA 2H0IA 1JZRA 1M7TA 5CRGA 2GSQA 2EIQA 4OFTA 4ML1A 4ECJA 2VIMA 3C7MA 1A0RP 1AQWA 2LUSA 1ZOFA 2M72A 1O8XA 5AIXA 1ERVA 3AY8A 2E2MA 1B8XA 5KN3A 2EC4A 3QFAC 3LWAA 2MBTA 1U6TA 3VWXA 3KJYA 2ON7A 3U5RE 1GULA 3SBCA 4EE0A 5GZZB 5IOXA 2HSYA 3ZZXA 2AB6A 3UMAA 2H0HA 4H86A 5EY6A 1ST9A 4V1Ap 1XOBA 2IFQB 4EVMA 1XZOA 1GRXA 2AHEA 4K7OA 2HI7A 4JBBA 5D73A 2O7KA 1BX9A 3HCZA 2VUPA 4LLRA 3CBUA 3CTGA 3FHKA 2KP2A 1A24A 2DJ1A 3TJKA 3WYWA 1Q4JA 5KN1A 3NZNA 13GSA 3TKSC 5HQPA 2VL3A 1SD9A 3QAWA 3LXZA 4NHWA 1SU9A 2FNOA 5L71A 1PKZA 1U87A 1ERWA 1WWJA 3WGDA 3LEFA 2C8UA 17GSA 2F51A 2DMMA 2GT6A 5KN0A 1DE2A 3M3MA 1GP1A 4JR6A 2H71A 1EOGA 1PRXA 4OCFA 4K1FA 2L57A 4YAPA 4NPBA 2KUCA 4TOPA 4YAVA 2IFQA 3M8NA 3PR8A 2LSTA 3TOUA 2R4VA 1T7PB 1T4YA 4POMA 3GSTA 4ZB9A 3VURA 1U3IA 4FYBA 2RUFA 2C0EA 2K8VA 1XWKA 4HZ2A 2EIOA 2GZYA 3DWVA 2GSSA 1F9MA 4FQUA 1X0RA 3LORA 4PGTA 1Z5YE 1JLVA 2HT9A 4Q5RA 5ECIB 1THXA 4DEJA 4IN0A 2DJJA 1EV4A 1EP8A 4MCUA 3GRXA 1PD21 5DQSA 1AC1A 3RDWA 3ERFA 3ZREA 4DSSB 3RHBA 4MPFA 3UJ1A 3G9BA 4ZL7A 2FLSA 1QK8A 4TKYA 1GSFA 5ECSA 2HQTA 1H4OA 3UEMA 4ZBBA 4HEA2 2GZZA 1TKDB 4USSA 3F4RA 5D96A 1WP0A 2HFDA 1M9AA 1EWXA 1M2DA 5HR2A 2FWHA 1R7HA 4MK3A 2C1YA 2K9FA 5DJLA 2YOIA 2X8GA 3FEUA 4I2TA 2PU9C 5AISA 3EU4A 5EPFA 1UC7A 4NV5A 1ILOA 3MAKA 1SYXA 4ZBAA 2WJUA 3MDKA 2X8CA 5EVOA 3KEBA 3GKXA 4TR4A 2B7JA 1VF4A 1SJIA 4NAXA 1TRVA 1K3OA 1TRUA 3RPPA 1XWCA 2M80A 4RI7A 3ZTLA 4E8HA 1RW1A 1BAYA 2LTKA 2GLRA 2A2SA 3VLNA 4JU5A
chains in the Genus database with same CATH superfamily
2B1LA 3KMNA 2LV3A 5G5EA 2LJAA 1QFNA 1A8YA 3VFIA 4CDOA 1QGVA 2YWNA 3TJBA 3ZMKA 1XW5A 4V1Ag 4AJ8A 1PA3A 4AGSA 2PN8A 4X43A 3H1NA 2HXKA 2WULA 1Z7RA 4F0BA 3DMLA 2O5VA 4IKHA 3UVTA 2VLVA 4IW9A 2DC5A 4AKHA 1XBSA 1A2LA 3P90A 1JHBA 1URMA 2JSYA 3ZMLA 4Q5FA 2WVXB 5J5NA 2DJ3A 4G01A 2E2GA 2YV7A 4PI0C 1XVQA 5CO3A 5DALA 3H8QA 1HNAA 4MJBA 2VCXA 2HRKB 4KX4A 3GH9A 2B5YA 4Z2UA 4MF6A 2Z9SA 3ZVJD 3ZIJA 3J7Yb 2NTOA 3TKSE 2F8FA 4GQFA 4Q5NA 2VCVA 3HY2A 1HNCA 3L78A 4TN8A 1OE7A 2WCIA 2QC7A 3F8UA 3BOAA 1R5PA 2DIYA 3VWUA 2I1UA 5DCHA 3EU3A 2JZTA 4MF7A 4XRAA 4D73B 1M3JA 2YV9A 4OFMA 5LD0A 3BD2A 3GL3A 3F6DA 2B5EA 4F82A 3UIWA 4GSNA 1BYEA 3C1SA 2FA4A 2HRNA 1I9DA 1KEBA 3A2XA 1V57A 2WVXA 1Y1UA 2HZEB 2VL2A 2L59A 3I69A 2RM5A 4BVYB 2OE3A 4BIKA 4XRDA 3A2WA 5DVBA 6GSYA 2HRKA 1SVLA 5ENUA 4WF5A 2PERA 2V2GA 1FHEA 4WXTA 1NSWA 1SVOA 2YZHA 4HSCX 2VL9A 20GSA 2R0GA 3HZ8A 3ME8A 4K6XA 1H75A 2AJQB 1JLWA 3RFRC 2CZ3A 3HJMA 2QA1A 1JZDA 3VK9A 2GSRA 1PX6A 1ABAA 3VWVA 4GLTA 4KCEA 3R2QA 5KOXA 2E0QA 5DBQA 4HU7A 3KXOA 4K0NA 2HRAA 3CMIA 3GIXA 5ECLB 2I4AA 2PPTA 4EDZA 3QPMA 2MMZA 3TJGA 4Q5QA 1YF1A 3RPNA 4KGIA 2L5OA 1T4ZA 1OC8A 1EEJA 2H6ZA 2OE1A 3K8NA 3ZL5A 4V2NA 1AIUA 3OR5A 3P7XA 2JACA 2HZEA 2AV4A 1LU4A 2HYXA 1M2BA 5G1KA 4L5LA 1C72A 4BVYA 3HZ4A 2IMIA 1K0NA 5GSTA 4MH3A 1XPVA 4I97A 3V1WA 1OE8A 3GN3A 4PX1A 3GX0A 2V6KA 1QQ2A 3KZQA 16GSA 1JFUA 4BPYA 2X64A 4P3YB 2CV4A 1B4QA 4CY8A 2XPEA 4G0IA 2VD0A 3VPTA 3ZFLA 4YQUA 4TXOA 2VOCA 2B6MA 4WBRD 1G7OA 9GSSA 1YZXA 3LJRA 1TOFA 3BCIA 3C73A 5D93A 3W6GA 1T00A 5IMDA 3HXSA 2R6KA 1TI3A 1TP9A 2R37A 4FH8A 4CW9A 3KIJA 1SD8A 2A2RA 3GSSA 1GLQA 3HVNA 3GA4A 2H70A 3GHAA 5HFIA 1X9SB 3D5JA 1DUGA 2J23A 2OE0A 1S3AA 5FT3A 2VCQA 1SK0A 2HE3A 1GTUA 2BTOT 4LA1A 1XW6A 3W8SA 4OCEA 4AKXB 4ECBA 1B4PA 1YF0A 2FD3A 3MSZA 1HYUA 2FY6A 1SYRA 1Z7PA 4I2UA 1T1VA 5IM9A 4EC0A 4HDEA 2GQKA 3M0FA 4POBA 3QOUA 2FHEA 1EV9A 1GTBA 1BEDA 1TXUA 1Z9HA 2L4QA 3QR6A 4KSOA 4IVFA 1YDKA 5D8IA 1TRSA 4KNDA 2CVBA 3A5WA 1TK8B 3UVHA 3GH6A 2XBQA 1X9MB 2H76A 1BJXA 1OC3A 1R5AA 1MDKA 3ZYWA 1GH2A 4AKIA 1JZOA 2BJXA 3FKFA 2WVZA 3VI5A 1NHOA 1ZL9A 4POKA 4ID0A 4ZIJA 1PSQA 3GTUB 3FK8A 5CRHA 2YJ7A 1W4VA 1XWBA 3KCMA 2BMXA 3O3TA 2GDRA 4E8EA 2B7KA 5CYYA 4ACSA 3MWHA 3NOFA 1MEKA 3TGZA 1A2MA 1U3AA 1M99A 2V6OA 1PMTA 2WW2A 5IO2A 3MIXA 3HYPA 3VI7A 3UL3A 2GS3A 1V58A 3F4TA 2N5BA 3O76A 4ZB7A 3E9JB 1ACVA 1IYIA 4RI6A 4N0ZA 2H19A 2WZ9A 5GAND 5G31A 1MDIA 1OKDA 5D9WA 4G19A 4GTUA 2C3QA 2H1AA 2QSIA 3LYPA 2IWTA 4JRRA 4I6XA 1O85A 4ZILA 3GTUA 1FO5A 5D9VA 2O3EA 3BJ5A 1ZGNA 1SL2B 1ML6A 1CQHA 5E4WA 4PUFC 1XW9A 1OVNA 3GNJA 1GSDA 1EGOA 2IJYA 3H4KA 2FWEA 3DRNA 3BBYA 4ECCA 4IS0A 3IC8A 2DKHA 3KM6A 3L9SA 4OD7A 4ZXGA 3GFKA 4ISDA 4TXVA 5IMCA 4GQCA 4J2FA 4GDFA 3IHQA 1K3YA 1MD4A 1K0BA 4KAEA 1RK4A 2YZUA 3LXTA 19GSA 4PURA 4X4JA 4GSTA 2MZCA 3FR9A 2PVOC 2F3MA 1ERTA 3CTFA 2H1LA 1UN2A 4ZB8A 2QKEA 2V1MA 4HQZA 3EMXA 4L0UA 4HU9A 4MA9A 1TI1A 2LRCA 1O73A 1JZWA 4TW5A 3F6FA 2J9HA 4AJ7A 4PQ1A 4OO5A 3GL5A 3TB2A 1FW1A 3CYNA 4Z2RA 5B8BA 4YQMA 1KBNA 22GSA 1LJRA 5J4VA 3PGTA 5F0GA 3WT1A 5J41A 3EMPA 5JWQB 3QAGA 4TR1B 2YP6A 2C3TA 3IA1A 3H79A 2YJHA 3TKPA 1SKRB 2DJKA 3KTLA 2H30A 2P31A 1X5EA 5A5HB 4K0GA 5HFKA 4CHSA 3F3RA 3FW2A 1Z3EA 5DALB 3ZVJA 5H5QA 2NDOA 3F4SA 3HMJG 1YJ6A 1R4WA 1YVLA 3FZAA 3TKSA 1G0TA 2DKIA 3W8JA 1MTCA 4RQRA 4ULXA 2HSHA 4QL7A 5C00A 3P8WA 3O6TA 3WGXA 4IP6A 3IK7A 4G10A 4HJ2A 2H6YA 3E3EA 4EL1A 1AQXA 3D6IA 2MYGA 4K7IA 2R2JA 2JL4A 3QFBC 3LYKA 2PBJA 4ECIA 4TR1A 2GT5A 4EO3A 5IMVA 2IIYA 4QMKA 3HHVA 5A4VA 1CQGA 2WDUA 2RUEA 3EVIA 3U6VA 1YKAA 3IV4A 1F6MC 4KDYA 4OO4A 1N25A 3IHGA 2K6VA 1VF3A 3HVSA 1NHYA 2CX3A 6GSWA 5G2ZA 4YH2A 5A5HA 18GSA 4N10A 1YKCA 5LNKe 2LNSA 5J4YA 1TJDA 1I5GA 2H8LA 2VCWA 2O8VB 3HVXA 1ON4A 5DAKB 2ON5A 1S3CA 4MP4A 3L0HA 1SL0B 2H66A 4MPGA 3R3EA 4FIWA 5IMFA 3C8EA 3TJFA 4BL7B 5IIZA 2MBSA 3KP8A 2P5QA 4HI7A 1U88A 5CAXA 3HD5A 1MDJA 11GSA 2OKAA 4WF4A 4XS4A 3FZ5A 2WS2A 1QMVA 1EGRA 3BCKA 1AAZA 4HZ4A 3N9JA 5F06A 1XFLA 3ED3A 4PNGA 3G7YA 2AYTA 4AKGA 5DCGA 1XIYA 4N11A 3DYRA 3I43A 1BG1A 2REMA 3IR4A 1M2AA 2FCHA 4TR0A 4FYUA 2G0FA 2YNXA 4AF2A 1YEWC 5IPGA 3C1RA 1ZYQB 1TK0B 2X8HA 3APOA 4IGJA 1J9BA 2LEGA 3UOMA 1TK5B 1MD3A 1SVMA 2L6DA 4NXIA 4X0XA 5DAKA 4F0CA 4I8BA 1S3RA 2RM6A 5FWGA 1USBA 2YWIA 3S9FA 1G6YA 4BL7A 2L6CA 3DIEA 1YQ1A 5G30A 4KW6A 2IMEA 3GKKA 3HVVA 1FVKA 1DSBA 1OAZA 3ZLPA 1K0MA 4PUAA 4AJ6A 2YCDA 3L4NA 2QGVA 3WD6A 1FOHA 4TXOB 1IYHA 4MDCA 2O36A 2DJ2A 1Z6NA 4GSSA 2NPBA 3EC3A 10GSA 1F3AA 3F9UA 2C80A 4ZL9A 5FHIA 2PGTA 3LQ7A 2H73A 4MZCA 1M3IA 1A23A 5COHA 2OBKA 1GLPA 4KH7A 1B48A 2IMKA 5AIVA 5DDLA 3HKRA 7GSSA 2KP1A 3TRXA 2MMAA 3Q18A 5F07A 4PXOA 4XS6A 5ECMB 2NBSA 5CP1A 4EKZA 2LKUA 1PX7A 4DVCA 1ERUA 2YWOA 5B6NA 4A5PA 4QQ7A 2IMDA 2JADA 4NWYA 2GVPA 5A4UA 1GSEA 1OKTA 2LQQA 3D22A 2A2PA 2CAIA 3LG6A 4KA0A 1FOVA 2WFCA 3ERGA 3M9JA 1SK1A 3VPQA 3FR6A 4EDYA 3KH9A 3C71A 3F63A 5ID2B 3CQFA 3GV1A 3CRUA 3N5OA 2B1KA 4KDXA 5ABRA 2ZCTA 4L5OA 4NV2A 2PWJA 4GWRA 3F3QA 4WBJA 4MF5A 5IQYA 1Q98A 4JR4A 3IAS2 1RQMA 3QDNA 4POLA 1SKWB 2VCZA 2LS5A 2XBIA 4G2EA 3CHXC 3TUEA 3FR3A 5ELGA 3TRQA 1AUCA 4IP1A 2H1GA 3QD9A 4KF9A 4NMUA 4ZBDA 3TOTA 3TJJA 5JWRB 2CA8A 4O32A 3EPTA 1XVWA 4XHMA 1YEXA 4CY6A 4F2IA 1EZKA 1A0FA 4V2MA 2HSNB 4O5QA 1Z6MA 2DMLA 3KP9A 3LGCA 1DBYA 1GNEA 3HJOA 3IAM2 2FUG2 4MABA 3FZ4A 3A2VA 1FB6A 3G7IA 4IQ1A 5ID2A 1YEPA 1PN0A 2CQ9A 4MJEA 4ML6A 2WW0A 2FA8A 3LW9A 4DSQA 5IMZA 4BVXA 2YWMA 2X4AA 1SL1B 2VLUA 2PVQA 1F37A 1BG5A 2OT3A 1J08A 1J0FA 2RIIA 3US3A 3IXRA 1K0OA 2LNTA 3I9V2 2GZPA 1Y6EA 1W89A 4BWSA 2ZUPA 4MJCA 1GUMA 1SENA 4TR3A 3GUSA 5BMUB 6GSUA 2G2QA 4MLYA 4ZB6A 2VM1A 4LMVA 1BF5A 2C0DA 4GF0A 3RBTA 4HUAA 2WW1A 4ZL8A 3GURA 2HSNA 4BA7A 3ERWA 2LQOA 2WB9A 4BWQA 1GUKA 4V2LA 4QL9A 1F2EA 2O89A 2JSZA 5ECHB 1VGLA 3D0ZA 1XXUA 6GSTA 3KH7A 4WR5A 1GUHA 4WR4A 4YKGA 4I5QA 2IN3A 1A8LA 4LL4B 2L4CA 5J40A 2LJKA 4F9ZA 1XG8A 3CSJA 1KNGA 3IBHA 3PPUA 4IQAA 4E68A 3WT2A 3RAZA 5GAPD 3Q74A 4MZWA 5BMUA 1NW2A 1AXDA 1XWGA 1N2AA 1GTAA 2CT6A 1SKSB 5J47A 5A5KA 1X9WB 5J9CA 2HNLA 6GSVA 1TDIA 1WIKA 4IBPA 4OFNA 5B6MA 2WRTA 1FAAA 2RLIA 2WGRA 5G1LA 4XCSA 4N30A 5D9TA 1UVZA 3P2AA 2CVKA 3WGEA 1WPIA 3EE2A 1B9XC 2TRXA 4Z7XA 3QCPA 14GSA 1HNBA 4MMMA 4PQHA 2EFHA 1WMJA 4KDUA 1E6BA 2F9SA 3GMFA 1K0AA 4HS1A 5HR0A 3CSHA 3I6AA 4K2DA 2QA2A 2XPDA 5IMAA 5KN2A 1DE1A 3DVXA 2K8SA 1K3LA 1B9YC 3PINA 4PNFA 3TKQA 1ZZYA 5AN1A 2O85A 4DSRA 5ECOB 2D2ZA 1F3BA 3CSIA 2IMFA 2H74A 2VD1A 1S3DA 2C0FA 4LMWA 2LJRA 2PMTA 1LBKA 2FWGA 1SK2A 5H5SA 5C04A 4GRFA 1EEMA 2H6XA 5HR3A 4X1UA 5ELAA 4WEYA 4TVEA 3RHCA 2I3YA 5JCWA 2H01A 2CZ2A 3DD3A 2CAQA 2C3NA 3EYTA 3G7JA 1ZYEA 5LCZA 1Y25A 4WKWA 2WZSA 4G0LA 1V98A 2R3XA 5GSSA 4KCAA 1TU8A 1X5CA 4IHUA 4O7HA 3L9UA 4JZQA 5ECNB 2R5GA 2HLSA 2VL2C 4OWYA 5ECQB 4ICYA 5J9BA 3L9VA 2V32A 5CRWA 2JZRA 2DBCA 3Q19A 2HSMB 4HQSA 3SWLA 4N0VA 1XOAA 1SJZA 1V40A 3GKMA 1PL1A 2DSAA 4EUYA 1GNWA 1I1IP 2GTUA 2GQMA 4G0KA 1VF1A 3IRAA 3HJPA 2C4JA 1V2AA 3KTBA 2DJ0A 1PN9A 3LFLA 4KUNA 4HJMA 2M46A 4DSSA 2CVDA 1WE0A 1ZCPA 4F03A 1V9WA 4XS4B 3DKSA 4MNNA 3EWLA 4MH2A 4O5RA 4EIQA 2CX4A 1TXXA 1TW9A 1R26A 5ECRB 2EFDA 4PHZC 2KHPA 3D21A 5D9XA 4L8EA 2P0GA 1KTEA 2UV8G 2H72A 2YN1A 1N8JA 1EP7A 1XWAA 1O8WA 1GTIA 2DLXA 4RQXA 2HSMA 3IPZA 3J7Yk 5CREA 2MMNA 4FO5A 4LL1B 2VCTA 3CRTA 3M9KA 3KMOA 2KOKA 4PQIA 2L5LA 1QUWA 3KD0A 2VKZG 4GCIA 2OADA 4K8MA 2N5FA 5J4UA 3UBKA 5E59A 4O5UA 3E0UA 3ISOA 2P5RA 5F05A 2O87A 2YANA 3FMWA 2A4HA 2XC2A 8GSSA 1VRSD 1THOA 4L0WA 5H5RA 3VWWA 3ZIVA 1SJ6A 2JZSA 2VLTA 1FVJA 3GKNA 5BRTA 2F8AA 1AW9A 4O92A 5DQYA 2EFEA 1T3BA 4JE1A 3APQA 4W66A 2PUKC 4JEDA 1GWCA 2LRNA 5ECPB 3DGQA 2A4VA 5HR1A 5G5FA 5INYA 4YQVA 3D4TA 4K7NA 4GXZA 4KB3A 2KLXA 2R0CA 1YY7A 1O7UA 1A2JA 5J3RA 2UZ8A 1ZMAA 1VF2A 1PKWA 3IDVA 4MJAA 4Z2TA 2IPAA 1X5DA 3M1GA 2H1BA 2E7PA 3EINA 3CXGA 3FZ9A 2EIRA 4RUVA 1O6JA 5IO0A 3IK9A 3DXBA 4XS1A 1FB0A 3DEXA 2ALBA 1GSUA 2MMOA 2ZNMA 2OBIA 2TIRA 2OA7A 1HQOA 4IELA 1EOHA 2HZFA 2VM2A 4K9ZA 4NHZA 3Q6OA 3TCOA 5EL8A 2AUVA 1E2YA 2AAWA 4J57E 1ZYNA 4HOJA 1G6WA 3CWGA 2LRTA 5A34B 1BQ7A 2XHFA 5HFGA 2FGXA 2TRCP 2I81A 4D73A 3TDGA 3MNGA 4MZBA 1GSYA 1WRYA 2GSTA 1HD2A 3TKRA 3QMXA 2OACA 4EXJA 4PTSA 2C0GA 2I9HA 1GSSA 2VO4A 3HDCA 2N5AA 12GSA 2ES7A 2H0GA 2K18A 2X49A 5KOWA 2JU5A 3UAPA 2IL3A 2NVLA 2YPMA 3LSZA 4IJIA 1NM3A 4TRXA 2V41A 3UARA 1M9BA 1TRWA 3ZRDA 1TTZA 1T8EB 6GSSA 3ZITA 4G9HA 1OC9B 1GL8A 5DJMA 1AQVA 3DVWA 3QAVA 3PH9A 5B7CA 4J56E 1M0UA 3EURA 3D4MA 1PQNA 2B3SA 1TU7A 1FG4A 4IJ3A 4BVXB 5JWOB 5ECKB 2DIZA 5KEJA 5A34A 2H1DA 4ILFA 5CNWA 1UA5A 1QXHA 2X99A 2GGTA 6GSXA 5JCGA 1O81A 3IC4A 3IE3A 2B5XA 4XTSA 5A1NB 3FYGA 1K0DA 1G7EA 2FWFA 1K0CA 3H93A 4WETA 5IPHA 5JCUA 3UBLA 3A3TA 1GSQA 3TRPA 3APSA 4KE3A 3KGKA 2HRFA 1PGTA 1PL2A 5A4WA 4OMVA 5AGYA 3FY7A 4KSMA 4EF0A 4XIHA 1XCCA 2OJLA 1OC9A 3IOSA 5CRDA 5F8BA 1WOUA 3HA9A 3ZFBA 1WJKA 2GQLA 3ME7A 3GYKA 2VAFA 1OYJA 3NIVA 4FYCA 3JCML 3F0IA 5IOWA 2H75A 3GX8A 3FRCA 4PI2C 4K5RA 5B8AA 2H0IA 1JZRA 3TU3B 1M7TA 5CRGA 2GSQA 2EIQA 4OFTA 4ML1A 4ECJA 2VIMA 3C7MA 1A0RP 1AQWA 2LUSA 1ZOFA 2M72A 5A1NA 1O8XA 5AIXA 1ERVA 3AY8A 2E2MA 1B8XA 5KN3A 2EC4A 3QFAC 3LWAA 4FXYP 2MBTA 1U6TA 3VWXA 3KJYA 2ON7A 3U5RE 1GULA 3SBCA 4EE0A 5GZZB 5IOXA 2HSYA 3ZZXA 2AB6A 3UMAA 2H0HA 4H86A 1PFOA 5EY6A 1ST9A 4V1Ap 1XOBA 2IFQB 4EVMA 1XZOA 1GRXA 2AHEA 4K7OA 2HI7A 4JBBA 5D73A 2O7KA 1BX9A 3HCZA 3RGBC 2VUPA 4LLRA 4N3ZA 3CBUA 3CTGA 2R0PA 3FHKA 2KP2A 1A24A 2DJ1A 3TJKA 3WYWA 1Q4JA 5KN1A 3NZNA 13GSA 3TKSC 5HQPA 2VL3A 1SD9A 3QAWA 3LXZA 4NHWA 1SU9A 2FNOA 4K2XA 5L71A 1PKZA 1U87A 1ERWA 1WWJA 3WGDA 3LEFA 2C8UA 17GSA 2F51A 2DMMA 2GT6A 5KN0A 1DE2A 3M3MA 1GP1A 4JR6A 2H71A 1EOGA 1PRXA 1S4BP 1ZYPA 4OCFA 4K1FA 2WVYA 2L57A 4YAPA 4NPBA 2KUCA 4TOPA 4YAVA 2IFQA 4K5SA 4YKFA 3M8NA 3PR8A 2LSTA 3TOUA 2R4VA 1T7PB 1T4YA 4POMA 3GSTA 4ZB9A 3VURA 1U3IA 4FYBA 2RUFA 2C0EA 2K8VA 2WW3A 1XWKA 4HZ2A 2EIOA 2GZYA 3DWVA 2GSSA 1F9MA 4FQUA 1X0RA 3LORA 4PGTA 1Z5YE 1JLVA 2HT9A 4Q5RA 5ECIB 4AI6A 1THXA 4DEJA 4IN0A 2DJJA 1EV4A 1EP8A 4MCUA 3GRXA 1PD21 5DQSA 1AC1A 3RDWA 3ERFA 3ZREA 4DSSB 3RHBA 4MPFA 3UJ1A 3G9BA 4ZL7A 2FLSA 1QK8A 4TKYA 1GSFA 5ECSA 2HQTA 1H4OA 3UEMA 4ZBBA 4HEA2 2GZZA 1TKDB 4USSA 3F4RA 5D96A 1WP0A 2HFDA 4EIPA 1M9AA 1EWXA 1M2DA 5HR2A 2FWHA 1R7HA 4MK3A 2C1YA 2K9FA 3A5IA 5DJLA 2YOIA 2X8GA 2EFCA 3FEUA 4I2TA 2PU9C 5AISA 3EU4A 3MYDA 5EPFA 1UC7A 4NV5A 1ILOA 3MAKA 1SYXA 4ZBAA 2WJUA 3MDKA 2X8CA 5EVOA 3KEBA 3GKXA 4TR4A 2B7JA 1VF4A 1SJIA 4NAXA 1TRVA 1K3OA 1TRUA 3RPPA 1XWCA 2M80A 4RI7A 3ZTLA 4E8HA 1RW1A 1BAYA 2LTKA 2GLRA 2A2SA 3VLNA 4JU5A
chains in the Genus database with same CATH topology
2B1LA 3KMNA 2LV3A 5G5EA 2LJAA 1QFNA 1A8YA 3VFIA 4CDOA 1QGVA 2YWNA 3TJBA 3ZMKA 1XW5A 4V1Ag 4AJ8A 1PA3A 4AGSA 2PN8A 4X43A 3H1NA 2HXKA 2WULA 1Z7RA 4F0BA 3DMLA 2O5VA 4IKHA 3UVTA 2VLVA 4IW9A 2DC5A 4AKHA 1XBSA 1A2LA 3P90A 1JHBA 1URMA 2JSYA 3ZMLA 4Q5FA 5J5NA 2DJ3A 4G01A 2E2GA 2YV7A 1XVQA 5CO3A 5DALA 3H8QA 1HNAA 4MJBA 2VCXA 2HRKB 4KX4A 3GH9A 2B5YA 4Z2UA 4MF6A 2Z9SA 3ZVJD 3ZIJA 3J7Yb 2NTOA 3TKSE 2F8FA 4GQFA 4Q5NA 2VCVA 3HY2A 1HNCA 3L78A 4TN8A 1OE7A 2WCIA 2QC7A 3F8UA 3BOAA 1R5PA 2DIYA 3VWUA 2I1UA 5DCHA 3EU3A 2JZTA 4MF7A 4XRAA 4D73B 2YV9A 4OFMA 5LD0A 3BD2A 3GL3A 3F6DA 2B5EA 4F82A 3UIWA 4GSNA 1BYEA 3C1SA 2FA4A 2HRNA 1I9DA 1KEBA 3A2XA 1V57A 2VL2A 1Y1UA 2HZEB 2L59A 3I69A 2RM5A 4BVYB 2OE3A 4XRDA 3A2WA 5DVBA 6GSYA 2HRKA 1SVLA 5ENUA 4WF5A 2PERA 2V2GA 1FHEA 4WXTA 1NSWA 1SVOA 2YZHA 2VL9A 20GSA 2R0GA 3HZ8A 3ME8A 4K6XA 1H75A 2AJQB 1JLWA 2CZ3A 3HJMA 2QA1A 1JZDA 3VK9A 2GSRA 1PX6A 1ABAA 3VWVA 4GLTA 4KCEA 3R2QA 5KOXA 2E0QA 5DBQA 4HU7A 3KXOA 4K0NA 2HRAA 3CMIA 3GIXA 5ECLB 2I4AA 2PPTA 4EDZA 3QPMA 2MMZA 3TJGA 4Q5QA 1YF1A 3RPNA 4KGIA 2L5OA 1T4ZA 1OC8A 1EEJA 2H6ZA 2OE1A 3K8NA 3ZL5A 4V2NA 1AIUA 3OR5A 3P7XA 2JACA 2HZEA 2AV4A 1LU4A 2HYXA 1M2BA 5G1KA 4L5LA 1C72A 4BVYA 3HZ4A 2IMIA 1K0NA 5GSTA 4MH3A 1XPVA 4I97A 3V1WA 1OE8A 3GN3A 4PX1A 3GX0A 2V6KA 1QQ2A 3KZQA 16GSA 1JFUA 4BPYA 2X64A 4P3YB 2CV4A 1B4QA 4CY8A 2XPEA 4G0IA 2VD0A 3VPTA 3ZFLA 4YQUA 4TXOA 2VOCA 2B6MA 4WBRD 1G7OA 9GSSA 1YZXA 3LJRA 1TOFA 3BCIA 3C73A 5D93A 3W6GA 1T00A 5IMDA 3HXSA 2R6KA 1TI3A 1TP9A 2R37A 4FH8A 4CW9A 3KIJA 1SD8A 2A2RA 3GSSA 1GLQA 3GA4A 2H70A 3GHAA 5HFIA 1X9SB 3D5JA 1DUGA 2J23A 2OE0A 1S3AA 5FT3A 2VCQA 1SK0A 2HE3A 1GTUA 2BTOT 4LA1A 1XW6A 3W8SA 4OCEA 4AKXB 4ECBA 1B4PA 1YF0A 2FD3A 3MSZA 1HYUA 2FY6A 1SYRA 1Z7PA 4I2UA 1T1VA 5IM9A 4EC0A 4HDEA 2GQKA 3M0FA 4POBA 3QOUA 2FHEA 1EV9A 1GTBA 1BEDA 1TXUA 1Z9HA 2L4QA 3QR6A 4KSOA 4IVFA 1YDKA 5D8IA 1TRSA 4KNDA 2CVBA 3A5WA 1TK8B 3UVHA 3GH6A 2XBQA 1X9MB 2H76A 1BJXA 1OC3A 1R5AA 1MDKA 3ZYWA 1GH2A 4AKIA 1JZOA 2BJXA 3FKFA 3VI5A 1NHOA 1ZL9A 4POKA 4ID0A 4ZIJA 1PSQA 3GTUB 3FK8A 5CRHA 2YJ7A 1W4VA 1XWBA 3KCMA 2BMXA 3O3TA 2GDRA 4E8EA 2B7KA 5CYYA 4ACSA 3MWHA 3NOFA 1MEKA 3TGZA 1A2MA 1U3AA 1M99A 2V6OA 1PMTA 5IO2A 3MIXA 3HYPA 3VI7A 3UL3A 2GS3A 1V58A 3F4TA 2N5BA 3O76A 4ZB7A 3E9JB 1ACVA 1IYIA 4RI6A 4N0ZA 2H19A 2WZ9A 5GAND 5G31A 1MDIA 1OKDA 5D9WA 4G19A 4GTUA 2C3QA 2H1AA 2QSIA 3LYPA 2IWTA 4JRRA 4I6XA 1O85A 4ZILA 3GTUA 1FO5A 5D9VA 3BJ5A 1ZGNA 1SL2B 1ML6A 1CQHA 5E4WA 4PUFC 1XW9A 1OVNA 3GNJA 1GSDA 1EGOA 2IJYA 3H4KA 2FWEA 3DRNA 3BBYA 4ECCA 4IS0A 3IC8A 2DKHA 3KM6A 3L9SA 4OD7A 4ZXGA 3GFKA 4ISDA 4TXVA 5IMCA 4GQCA 4J2FA 4GDFA 3IHQA 1K3YA 1MD4A 1K0BA 4KAEA 1RK4A 2YZUA 3LXTA 19GSA 4PURA 4X4JA 4GSTA 2MZCA 3FR9A 2PVOC 2F3MA 1ERTA 3CTFA 2H1LA 1UN2A 4ZB8A 2QKEA 2V1MA 4HQZA 3EMXA 4L0UA 4HU9A 4MA9A 1TI1A 2LRCA 1O73A 1JZWA 4TW5A 3F6FA 2J9HA 4AJ7A 4PQ1A 4OO5A 3GL5A 3TB2A 1FW1A 3CYNA 4Z2RA 5B8BA 4YQMA 1KBNA 22GSA 1LJRA 5J4VA 3PGTA 5F0GA 3WT1A 5J41A 3EMPA 5JWQB 3QAGA 4TR1B 2YP6A 2C3TA 3IA1A 3H79A 2YJHA 3TKPA 1SKRB 2DJKA 3KTLA 2H30A 2P31A 1X5EA 5A5HB 4K0GA 5HFKA 4CHSA 3F3RA 3FW2A 1Z3EA 5DALB 3ZVJA 5H5QA 2NDOA 3F4SA 3HMJG 1YJ6A 1R4WA 1YVLA 3FZAA 3TKSA 1G0TA 2DKIA 3W8JA 1MTCA 4RQRA 4ULXA 2HSHA 4QL7A 5C00A 3P8WA 3O6TA 3WGXA 4IP6A 3IK7A 4G10A 4HJ2A 2H6YA 3E3EA 4EL1A 1AQXA 3D6IA 2MYGA 4K7IA 2R2JA 2JL4A 3QFBC 3LYKA 2PBJA 4ECIA 4TR1A 2GT5A 4EO3A 5IMVA 2IIYA 4QMKA 3HHVA 5A4VA 1CQGA 2WDUA 2RUEA 3EVIA 3U6VA 1YKAA 3IV4A 1F6MC 4KDYA 4OO4A 1N25A 3IHGA 2K6VA 1VF3A 3HVSA 1NHYA 2CX3A 6GSWA 5G2ZA 4YH2A 5A5HA 18GSA 4N10A 1YKCA 5LNKe 2LNSA 5J4YA 1TJDA 1I5GA 2H8LA 2VCWA 2O8VB 3HVXA 1ON4A 5DAKB 2ON5A 1S3CA 4MP4A 3L0HA 1SL0B 2H66A 4MPGA 3R3EA 4FIWA 5IMFA 3C8EA 3TJFA 4BL7B 5IIZA 2MBSA 3KP8A 2P5QA 4HI7A 1U88A 5CAXA 3HD5A 1MDJA 11GSA 2OKAA 4WF4A 4XS4A 3FZ5A 2WS2A 1QMVA 1EGRA 3BCKA 1AAZA 4HZ4A 3N9JA 5F06A 1XFLA 3ED3A 4PNGA 3G7YA 2AYTA 4AKGA 5DCGA 1XIYA 4N11A 3DYRA 3I43A 1BG1A 2REMA 3IR4A 1M2AA 2FCHA 4TR0A 4FYUA 2G0FA 2YNXA 4AF2A 5IPGA 3C1RA 1ZYQB 1TK0B 2X8HA 3APOA 4IGJA 1J9BA 2LEGA 3UOMA 1TK5B 1MD3A 1SVMA 2L6DA 4NXIA 4X0XA 5DAKA 4F0CA 4I8BA 2RM6A 5FWGA 1USBA 2YWIA 3S9FA 1G6YA 4BL7A 2L6CA 3DIEA 1YQ1A 5G30A 4KW6A 2IMEA 3GKKA 3HVVA 1FVKA 1DSBA 1OAZA 3ZLPA 1K0MA 4PUAA 4AJ6A 2YCDA 3L4NA 2QGVA 3WD6A 1FOHA 4TXOB 1IYHA 4MDCA 2DJ2A 1Z6NA 4GSSA 2NPBA 3EC3A 10GSA 1F3AA 3F9UA 2C80A 4ZL9A 5FHIA 2PGTA 3LQ7A 2H73A 4MZCA 1A23A 5COHA 2OBKA 1GLPA 4KH7A 1B48A 2IMKA 5AIVA 5DDLA 3HKRA 7GSSA 2KP1A 3TRXA 2MMAA 3Q18A 5F07A 4PXOA 4XS6A 5ECMB 2NBSA 5CP1A 4EKZA 2LKUA 1PX7A 4DVCA 1ERUA 2YWOA 5B6NA 4A5PA 4QQ7A 2IMDA 2JADA 4NWYA 2GVPA 5A4UA 1GSEA 1OKTA 2LQQA 3D22A 2A2PA 2CAIA 3LG6A 4KA0A 1FOVA 2WFCA 3ERGA 3M9JA 1SK1A 3VPQA 3FR6A 4EDYA 3KH9A 3C71A 3F63A 5ID2B 3GV1A 3CRUA 3N5OA 2B1KA 4KDXA 5ABRA 2ZCTA 4L5OA 4NV2A 2PWJA 4GWRA 3F3QA 4WBJA 4MF5A 5IQYA 1Q98A 4JR4A 3IAS2 1RQMA 3QDNA 4POLA 1SKWB 2VCZA 2LS5A 2XBIA 4G2EA 3TUEA 3FR3A 5ELGA 3TRQA 1AUCA 4IP1A 2H1GA 3QD9A 4KF9A 4NMUA 4ZBDA 3TOTA 3TJJA 5JWRB 2CA8A 4O32A 3EPTA 1XVWA 4XHMA 1YEXA 4CY6A 4F2IA 1EZKA 1A0FA 4V2MA 2HSNB 4O5QA 1Z6MA 2DMLA 3KP9A 3LGCA 1DBYA 1GNEA 3HJOA 3IAM2 2FUG2 4MABA 3FZ4A 3A2VA 1FB6A 3G7IA 4IQ1A 5ID2A 1YEPA 1PN0A 2CQ9A 4MJEA 4ML6A 2FA8A 3LW9A 4DSQA 5IMZA 4BVXA 2YWMA 2X4AA 1SL1B 2VLUA 2PVQA 1F37A 1BG5A 2OT3A 1J08A 1J0FA 2RIIA 3US3A 3IXRA 1K0OA 2LNTA 3I9V2 2GZPA 1Y6EA 1W89A 4BWSA 2ZUPA 4MJCA 1GUMA 1SENA 4TR3A 3GUSA 5BMUB 6GSUA 2G2QA 4MLYA 4ZB6A 2VM1A 4LMVA 1BF5A 2C0DA 4GF0A 3RBTA 4HUAA 4ZL8A 3GURA 2HSNA 4BA7A 3ERWA 2LQOA 2WB9A 4BWQA 1GUKA 4V2LA 4QL9A 1F2EA 2O89A 2JSZA 5ECHB 1VGLA 3D0ZA 1XXUA 6GSTA 3KH7A 4WR5A 1GUHA 4WR4A 4YKGA 4I5QA 2IN3A 1A8LA 4LL4B 2L4CA 5J40A 2LJKA 4F9ZA 3CSJA 1KNGA 3IBHA 3PPUA 4IQAA 4E68A 3WT2A 3RAZA 5GAPD 3Q74A 4MZWA 5BMUA 1NW2A 1AXDA 1XWGA 1N2AA 1GTAA 2CT6A 1SKSB 5J47A 5A5KA 1X9WB 5J9CA 2HNLA 6GSVA 1TDIA 1WIKA 4IBPA 4OFNA 5B6MA 2WRTA 1FAAA 2RLIA 2WGRA 5G1LA 4XCSA 4N30A 5D9TA 1UVZA 3P2AA 2CVKA 3WGEA 1WPIA 3EE2A 1B9XC 2TRXA 4Z7XA 3QCPA 14GSA 1HNBA 4MMMA 4PQHA 2EFHA 1WMJA 4KDUA 1E6BA 2F9SA 3GMFA 1K0AA 4HS1A 5HR0A 3CSHA 3I6AA 4K2DA 2QA2A 2XPDA 5IMAA 5KN2A 1DE1A 3DVXA 2K8SA 1K3LA 1B9YC 3PINA 4PNFA 3TKQA 1ZZYA 5AN1A 2O85A 4DSRA 5ECOB 2D2ZA 1F3BA 3CSIA 2IMFA 2H74A 2VD1A 1S3DA 2C0FA 4LMWA 2LJRA 2PMTA 1LBKA 2FWGA 1SK2A 5H5SA 5C04A 4GRFA 1EEMA 2H6XA 5HR3A 4X1UA 5ELAA 4WEYA 4TVEA 3RHCA 2I3YA 5JCWA 2H01A 2CZ2A 3DD3A 2CAQA 2C3NA 3EYTA 3G7JA 1ZYEA 5LCZA 1Y25A 4WKWA 4G0LA 1V98A 2R3XA 5GSSA 4KCAA 1TU8A 1X5CA 4IHUA 4O7HA 3L9UA 4JZQA 5ECNB 2R5GA 2HLSA 2VL2C 4OWYA 5ECQB 4ICYA 5J9BA 3L9VA 2V32A 5CRWA 2JZRA 2DBCA 3Q19A 2HSMB 4HQSA 3SWLA 4N0VA 1XOAA 1SJZA 1V40A 3GKMA 1PL1A 2DSAA 4EUYA 1GNWA 2GTUA 2GQMA 4G0KA 1VF1A 3IRAA 3HJPA 2C4JA 1V2AA 3KTBA 2DJ0A 1PN9A 3LFLA 4KUNA 4HJMA 2M46A 4DSSA 2CVDA 1WE0A 1ZCPA 4F03A 1V9WA 4XS4B 3DKSA 4MNNA 3EWLA 4MH2A 4O5RA 4EIQA 2CX4A 1TXXA 1TW9A 1R26A 5ECRB 2EFDA 2KHPA 3D21A 5D9XA 4L8EA 2P0GA 1KTEA 2UV8G 2H72A 2YN1A 1N8JA 1EP7A 1XWAA 1O8WA 1GTIA 2DLXA 4RQXA 2HSMA 3IPZA 3J7Yk 5CREA 2MMNA 4FO5A 4LL1B 2VCTA 3CRTA 3M9KA 3KMOA 2KOKA 4PQIA 2L5LA 1QUWA 3KD0A 2VKZG 4GCIA 2OADA 4K8MA 2N5FA 5J4UA 3UBKA 5E59A 4O5UA 3E0UA 3ISOA 2P5RA 5F05A 2O87A 2YANA 3FMWA 2A4HA 2XC2A 8GSSA 1VRSD 1THOA 4L0WA 5H5RA 3VWWA 3ZIVA 1SJ6A 2JZSA 2VLTA 1FVJA 3GKNA 5BRTA 2F8AA 1AW9A 4O92A 5DQYA 2EFEA 1T3BA 4JE1A 3APQA 4W66A 2PUKC 4JEDA 1GWCA 2LRNA 5ECPB 3DGQA 2A4VA 5HR1A 5G5FA 5INYA 4YQVA 3D4TA 4K7NA 4GXZA 4KB3A 2KLXA 2R0CA 1YY7A 1O7UA 1A2JA 5J3RA 2UZ8A 1ZMAA 1VF2A 1PKWA 3IDVA 4MJAA 4Z2TA 2IPAA 1X5DA 3M1GA 2H1BA 2E7PA 3EINA 3CXGA 3FZ9A 2EIRA 4RUVA 1O6JA 5IO0A 3IK9A 3DXBA 4XS1A 1FB0A 3DEXA 2ALBA 1GSUA 2MMOA 2ZNMA 2OBIA 2TIRA 2OA7A 1HQOA 4IELA 1EOHA 2HZFA 2VM2A 4K9ZA 4NHZA 3Q6OA 3TCOA 5EL8A 2AUVA 1E2YA 2AAWA 4J57E 1ZYNA 4HOJA 1G6WA 3CWGA 2LRTA 5A34B 1BQ7A 2XHFA 5HFGA 2FGXA 2TRCP 2I81A 4D73A 3TDGA 3MNGA 4MZBA 1GSYA 1WRYA 2GSTA 1HD2A 3TKRA 3QMXA 2OACA 4EXJA 4PTSA 2C0GA 2I9HA 1GSSA 2VO4A 3HDCA 2N5AA 12GSA 2ES7A 2H0GA 2K18A 2X49A 5KOWA 2JU5A 3UAPA 2IL3A 2NVLA 2YPMA 3LSZA 4IJIA 1NM3A 4TRXA 2V41A 3UARA 1M9BA 1TRWA 3ZRDA 1TTZA 1T8EB 6GSSA 3ZITA 4G9HA 1OC9B 1GL8A 5DJMA 1AQVA 3DVWA 3QAVA 3PH9A 5B7CA 4J56E 1M0UA 3EURA 3D4MA 1PQNA 2B3SA 1TU7A 1FG4A 4IJ3A 4BVXB 5JWOB 5ECKB 2DIZA 5KEJA 5A34A 2H1DA 4ILFA 5CNWA 1UA5A 1QXHA 2X99A 2GGTA 6GSXA 5JCGA 1O81A 3IC4A 3IE3A 2B5XA 4XTSA 5A1NB 3FYGA 1K0DA 1G7EA 2FWFA 1K0CA 3H93A 4WETA 5IPHA 5JCUA 3UBLA 3A3TA 1GSQA 3TRPA 3APSA 4KE3A 3KGKA 2HRFA 1PGTA 1PL2A 5A4WA 4OMVA 5AGYA 3FY7A 4KSMA 4EF0A 4XIHA 1XCCA 2OJLA 1OC9A 3IOSA 5CRDA 5F8BA 1WOUA 3HA9A 3ZFBA 1WJKA 2GQLA 3ME7A 3GYKA 2VAFA 1OYJA 3NIVA 4FYCA 3JCML 3F0IA 5IOWA 2H75A 3GX8A 3FRCA 5B8AA 4K5RA 2H0IA 1JZRA 3TU3B 1M7TA 5CRGA 2GSQA 2EIQA 4OFTA 4ML1A 4ECJA 2VIMA 3C7MA 1A0RP 1AQWA 2LUSA 1ZOFA 2M72A 5A1NA 1O8XA 5AIXA 1ERVA 3AY8A 2E2MA 1B8XA 5KN3A 2EC4A 3QFAC 3LWAA 2MBTA 1U6TA 3VWXA 3KJYA 2ON7A 3U5RE 1GULA 3SBCA 4EE0A 5GZZB 5IOXA 2HSYA 3ZZXA 2AB6A 3UMAA 2H0HA 4H86A 5EY6A 1ST9A 4V1Ap 1XOBA 2IFQB 4EVMA 1XZOA 1GRXA 2AHEA 4K7OA 2HI7A 4JBBA 5D73A 2O7KA 1BX9A 3HCZA 2VUPA 4LLRA 4N3ZA 3CBUA 3CTGA 2R0PA 3FHKA 2KP2A 1A24A 2DJ1A 3TJKA 3WYWA 1Q4JA 5KN1A 3NZNA 13GSA 3TKSC 5HQPA 2VL3A 1SD9A 3QAWA 3LXZA 4NHWA 1SU9A 2FNOA 4K2XA 5L71A 1PKZA 1U87A 1ERWA 1WWJA 3WGDA 3LEFA 2C8UA 17GSA 2F51A 2DMMA 2GT6A 5KN0A 1DE2A 3M3MA 1GP1A 4JR6A 2H71A 1EOGA 1PRXA 1ZYPA 4OCFA 4K1FA 2L57A 4YAPA 4NPBA 2KUCA 4TOPA 4YAVA 2IFQA 4K5SA 4YKFA 3M8NA 3PR8A 2LSTA 3TOUA 2R4VA 1T7PB 1T4YA 4POMA 3GSTA 4ZB9A 3VURA 1U3IA 4FYBA 2RUFA 2C0EA 2K8VA 1XWKA 4HZ2A 2EIOA 2GZYA 3DWVA 2GSSA 1F9MA 4FQUA 1X0RA 3LORA 4PGTA 1Z5YE 1JLVA 2HT9A 4Q5RA 5ECIB 4AI6A 1THXA 4DEJA 4IN0A 2DJJA 1EV4A 1EP8A 4MCUA 3GRXA 1PD21 5DQSA 1AC1A 3RDWA 3ERFA 3ZREA 4DSSB 3RHBA 4MPFA 3UJ1A 3G9BA 4ZL7A 2FLSA 1QK8A 4TKYA 1GSFA 5ECSA 2HQTA 1H4OA 3UEMA 4ZBBA 4HEA2 2GZZA 1TKDB 4USSA 3F4RA 5D96A 1WP0A 2HFDA 4EIPA 1M9AA 1EWXA 1M2DA 5HR2A 2FWHA 1R7HA 4MK3A 2C1YA 2K9FA 3A5IA 5DJLA 2YOIA 2X8GA 2EFCA 3FEUA 4I2TA 2PU9C 5AISA 3EU4A 3MYDA 5EPFA 1UC7A 4NV5A 1ILOA 3MAKA 1SYXA 4ZBAA 2WJUA 3MDKA 2X8CA 5EVOA 3KEBA 3GKXA 4TR4A 2B7JA 1VF4A 1SJIA 4NAXA 1TRVA 1K3OA 1TRUA 3RPPA 1XWCA 2M80A 4RI7A 3ZTLA 4E8HA 1RW1A 1BAYA 2LTKA 2GLRA 2A2SA 3VLNA 4JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1L A;  3KMN A;  2LV3 A;  5G5E A;  2LJA A;  1QFN A;  1A8Y A;  3VFI A;  4CDO A;  1QGV A;  2YWN A;  3TJB A;  3ZMK A;  1XW5 A;  4V1A g;  4AJ8 A;  1PA3 A;  4AGS A;  2PN8 A;  4X43 A;  3H1N A;  2HXK A;  2WUL A;  1Z7R A;  4F0B A;  3DML A;  4IKH A;  3UVT A;  2VLV A;  4IW9 A;  2DC5 A;  1XBS A;  1A2L A;  3P90 A;  1JHB A;  1URM A;  2JSY A;  3ZML A;  4Q5F A;  5J5N A;  2DJ3 A;  2E2G A;  2YV7 A;  1XVQ A;  5CO3 A;  5DAL A;  3H8Q A;  1HNA A;  4MJB A;  2VCX A;  2HRK B;  4KX4 A;  3GH9 A;  2B5Y A;  4MF6 A;  2Z9S A;  3ZVJ D;  3ZIJ A;  3J7Y b;  2NTO A;  3TKS E;  2F8F A;  4GQF A;  4Q5N A;  2VCV A;  3HY2 A;  1HNC A;  3L78 A;  4TN8 A;  1OE7 A;  2WCI A;  2QC7 A;  3F8U A;  3BOA A;  1R5P A;  2DIY A;  3VWU A;  2I1U A;  5DCH A;  3EU3 A;  2JZT A;  4MF7 A;  4XRA A;  4D73 B;  2YV9 A;  4OFM A;  5LD0 A;  3BD2 A;  3GL3 A;  3F6D A;  2B5E A;  4F82 A;  3UIW A;  4GSN A;  1BYE A;  3C1S A;  2FA4 A;  2HRN A;  1I9D A;  1KEB A;  3A2X A;  1V57 A;  2VL2 A;  2HZE B;  2L59 A;  3I69 A;  2RM5 A;  4BVY B;  2OE3 A;  4XRD A;  3A2W A;  5DVB A;  6GSY A;  2HRK A;  5ENU A;  4WF5 A;  2PER A;  2V2G A;  1FHE A;  4WXT A;  1NSW A;  2YZH A;  2VL9 A;  20GS A;  3HZ8 A;  3ME8 A;  4K6X A;  1H75 A;  2AJQ B;  1JLW A;  2CZ3 A;  3HJM A;  1JZD A;  3VK9 A;  2GSR A;  1PX6 A;  1ABA A;  3VWV A;  4GLT A;  4KCE A;  3R2Q A;  2E0Q A;  5DBQ A;  4HU7 A;  3KXO A;  4K0N A;  2HRA A;  3CMI A;  3GIX A;  5ECL B;  2I4A A;  2PPT A;  4EDZ A;  3QPM A;  2MMZ A;  3TJG A;  4Q5Q A;  1YF1 A;  3RPN A;  4KGI A;  2L5O A;  1T4Z A;  1OC8 A;  1EEJ A;  2H6Z A;  2OE1 A;  3K8N A;  3ZL5 A;  4V2N A;  1AIU A;  3OR5 A;  3P7X A;  2JAC A;  2HZE A;  2AV4 A;  1LU4 A;  2HYX A;  1M2B A;  5G1K A;  4L5L A;  1C72 A;  4BVY A;  3HZ4 A;  2IMI A;  1K0N A;  5GST A;  4MH3 A;  1XPV A;  4I97 A;  3V1W A;  1OE8 A;  3GN3 A;  4PX1 A;  3GX0 A;  2V6K A;  1QQ2 A;  3KZQ A;  16GS A;  1JFU A;  4BPY A;  2X64 A;  4P3Y B;  2CV4 A;  1B4Q A;  2XPE A;  4G0I A;  2VD0 A;  3VPT A;  3ZFL A;  4YQU A;  4TXO A;  2VOC A;  2B6M A;  4WBR D;  1G7O A;  9GSS A;  1YZX A;  3LJR A;  1TOF A;  3BCI A;  3C73 A;  5D93 A;  3W6G A;  1T00 A;  5IMD A;  3HXS A;  2R6K A;  1TI3 A;  1TP9 A;  2R37 A;  4FH8 A;  4CW9 A;  3KIJ A;  1SD8 A;  2A2R A;  3GSS A;  1GLQ A;  3GA4 A;  2H70 A;  3GHA A;  5HFI A;  1X9S B;  3D5J A;  1DUG A;  2J23 A;  2OE0 A;  1S3A A;  5FT3 A;  2VCQ A;  1SK0 A;  2HE3 A;  1GTU A;  2BTO T;  4LA1 A;  1XW6 A;  3W8S A;  4OCE A;  4ECB A;  1B4P A;  1YF0 A;  2FD3 A;  3MSZ A;  1HYU A;  2FY6 A;  1SYR A;  1Z7P A;  4I2U A;  1T1V A;  5IM9 A;  4EC0 A;  4HDE A;  2GQK A;  3M0F A;  4POB A;  3QOU A;  2FHE A;  1EV9 A;  1GTB A;  1BED A;  1Z9H A;  2L4Q A;  3QR6 A;  4KSO A;  4IVF A;  1YDK A;  5D8I A;  1TRS A;  4KND A;  2CVB A;  3A5W A;  1TK8 B;  3UVH A;  3GH6 A;  2XBQ A;  1X9M B;  2H76 A;  1BJX A;  1OC3 A;  1R5A A;  1MDK A;  3ZYW A;  1GH2 A;  1JZO A;  2BJX A;  3FKF A;  3VI5 A;  1NHO A;  1ZL9 A;  4POK A;  4ID0 A;  4ZIJ A;  1PSQ A;  3GTU B;  3FK8 A;  5CRH A;  2YJ7 A;  1W4V A;  1XWB A;  3KCM A;  2BMX A;  3O3T A;  2GDR A;  4E8E A;  2B7K A;  5CYY A;  4ACS A;  3MWH A;  3NOF A;  1MEK A;  3TGZ A;  1A2M A;  1U3A A;  1M99 A;  2V6O A;  1PMT A;  5IO2 A;  3HYP A;  3VI7 A;  3UL3 A;  2GS3 A;  1V58 A;  3F4T A;  2N5B A;  3O76 A;  3E9J B;  1ACV A;  1IYI A;  4RI6 A;  4N0Z A;  2H19 A;  2WZ9 A;  5GAN D;  5G31 A;  1MDI A;  1OKD A;  5D9W A;  4G19 A;  4GTU A;  2C3Q A;  2H1A A;  2QSI A;  3LYP A;  2IWT A;  4JRR A;  4I6X A;  1O85 A;  4ZIL A;  3GTU A;  1FO5 A;  5D9V A;  3BJ5 A;  1ZGN A;  1SL2 B;  1ML6 A;  1CQH A;  5E4W A;  4PUF C;  1XW9 A;  1OVN A;  3GNJ A;  1GSD A;  1EGO A;  2IJY A;  3H4K A;  2FWE A;  3DRN A;  3BBY A;  4ECC A;  4IS0 A;  3IC8 A;  3KM6 A;  3L9S A;  4OD7 A;  4ZXG A;  3GFK A;  4ISD A;  4TXV A;  5IMC A;  4GQC A;  4J2F A;  3IHQ A;  1K3Y A;  1MD4 A;  1K0B A;  4KAE A;  1RK4 A;  2YZU A;  3LXT A;  19GS A;  4PUR A;  4GST A;  2MZC A;  3FR9 A;  2PVO C;  2F3M A;  1ERT A;  3CTF A;  1UN2 A;  4ZB8 A;  2QKE A;  2V1M A;  4HQZ A;  3EMX A;  4L0U A;  4HU9 A;  4MA9 A;  1TI1 A;  2LRC A;  1O73 A;  1JZW A;  4TW5 A;  3F6F A;  2J9H A;  4AJ7 A;  4PQ1 A;  4OO5 A;  3GL5 A;  3TB2 A;  1FW1 A;  3CYN A;  5B8B A;  4YQM A;  1KBN A;  22GS A;  1LJR A;  3PGT A;  5F0G A;  3WT1 A;  5J41 A;  3EMP A;  5JWQ B;  3QAG A;  4TR1 B;  2YP6 A;  2C3T A;  3IA1 A;  3H79 A;  2YJH A;  3TKP A;  1SKR B;  2DJK A;  3KTL A;  2H30 A;  2P31 A;  1X5E A;  4K0G A;  5HFK A;  4CHS A;  3F3R A;  3FW2 A;  1Z3E A;  5DAL B;  3ZVJ A;  5H5Q A;  2NDO A;  3F4S A;  1YJ6 A;  1R4W A;  3FZA A;  3TKS A;  1G0T A;  3W8J A;  1MTC A;  4RQR A;  4ULX A;  2HSH A;  4QL7 A;  5C00 A;  3P8W A;  3O6T A;  3WGX A;  4IP6 A;  3IK7 A;  4G10 A;  4HJ2 A;  2H6Y A;  3E3E A;  4EL1 A;  1AQX A;  3D6I A;  2MYG A;  4K7I A;  2R2J A;  2JL4 A;  3QFB C;  3LYK A;  2PBJ A;  4ECI A;  4TR1 A;  2GT5 A;  4EO3 A;  5IMV A;  2IIY A;  3HHV A;  5A4V A;  1CQG A;  2WDU A;  2RUE A;  3EVI A;  3U6V A;  1YKA A;  3IV4 A;  1F6M C;  4KDY A;  4OO4 A;  2K6V A;  1VF3 A;  3HVS A;  1NHY A;  2CX3 A;  6GSW A;  5G2Z A;  4YH2 A;  18GS A;  4N10 A;  1YKC A;  5LNK e;  2LNS A;  1TJD A;  1I5G A;  2H8L A;  2VCW A;  2O8V B;  3HVX A;  1ON4 A;  5DAK B;  2ON5 A;  1S3C A;  4MP4 A;  3L0H A;  1SL0 B;  2H66 A;  4MPG A;  3R3E A;  4FIW A;  5IMF A;  3C8E A;  3TJF A;  4BL7 B;  5IIZ A;  2MBS A;  3KP8 A;  2P5Q A;  4HI7 A;  1U88 A;  5CAX A;  3HD5 A;  1MDJ A;  11GS A;  2OKA A;  4WF4 A;  4XS4 A;  3FZ5 A;  2WS2 A;  1QMV A;  1EGR A;  3BCK A;  1AAZ A;  4HZ4 A;  3N9J A;  5F06 A;  1XFL A;  3ED3 A;  4PNG A;  3G7Y A;  2AYT A;  5DCG A;  1XIY A;  4N11 A;  3DYR A;  3I43 A;  2REM A;  3IR4 A;  1M2A A;  2FCH A;  4TR0 A;  4FYU A;  2G0F A;  2YNX A;  4AF2 A;  5IPG A;  3C1R A;  1ZYQ B;  1TK0 B;  2X8H A;  3APO A;  4IGJ A;  1J9B A;  2LEG A;  3UOM A;  1TK5 B;  1MD3 A;  2L6D A;  4NXI A;  4X0X A;  5DAK A;  4F0C A;  4I8B A;  2RM6 A;  5FWG A;  1USB A;  2YWI A;  3S9F A;  1G6Y A;  4BL7 A;  2L6C A;  3DIE A;  1YQ1 A;  5G30 A;  4KW6 A;  2IME A;  3GKK A;  3HVV A;  1FVK A;  1DSB A;  1OAZ A;  3ZLP A;  1K0M A;  4PUA A;  4AJ6 A;  2YCD A;  3L4N A;  2QGV A;  3WD6 A;  4TXO B;  1IYH A;  4MDC A;  2DJ2 A;  1Z6N A;  4GSS A;  2NPB A;  3EC3 A;  10GS A;  1F3A A;  3F9U A;  2C80 A;  4ZL9 A;  5FHI A;  2PGT A;  3LQ7 A;  2H73 A;  4MZC A;  1A23 A;  5COH A;  2OBK A;  1GLP A;  4KH7 A;  1B48 A;  2IMK A;  5AIV A;  5DDL A;  3HKR A;  7GSS A;  2KP1 A;  3TRX A;  2MMA A;  3Q18 A;  5F07 A;  4PXO A;  4XS6 A;  5ECM B;  2NBS A;  5CP1 A;  4EKZ A;  2LKU A;  1PX7 A;  4DVC A;  1ERU A;  2YWO A;  5B6N A;  4QQ7 A;  2IMD A;  2JAD A;  4NWY A;  2GVP A;  5A4U A;  1GSE A;  1OKT A;  2LQQ A;  3D22 A;  2CAI A;  3LG6 A;  4KA0 A;  1FOV A;  2WFC A;  3ERG A;  3M9J A;  1SK1 A;  3VPQ A;  3FR6 A;  4EDY A;  3KH9 A;  3C71 A;  3F63 A;  5ID2 B;  3GV1 A;  3CRU A;  3N5O A;  2B1K A;  4KDX A;  5ABR A;  2ZCT A;  4L5O A;  4NV2 A;  2PWJ A;  4GWR A;  3F3Q A;  4WBJ A;  4MF5 A;  5IQY A;  1Q98 A;  4JR4 A;  3IAS 2;  1RQM A;  3QDN A;  4POL A;  1SKW B;  2VCZ A;  2LS5 A;  2XBI A;  4G2E A;  3TUE A;  3FR3 A;  5ELG A;  3TRQ A;  4IP1 A;  1AUC A;  2H1G A;  3QD9 A;  4KF9 A;  4NMU A;  4ZBD A;  3TOT A;  3TJJ A;  5JWR B;  2CA8 A;  4O32 A;  4XHM A;  1XVW A;  1YEX A;  4F2I A;  1EZK A;  1A0F A;  4V2M A;  2HSN B;  1Z6M A;  2DML A;  3KP9 A;  3LGC A;  1DBY A;  1GNE A;  3HJO A;  3IAM 2;  2FUG 2;  4MAB A;  3FZ4 A;  3A2V A;  1FB6 A;  3G7I A;  4IQ1 A;  5ID2 A;  1YEP A;  2CQ9 A;  4MJE A;  4ML6 A;  2FA8 A;  4DSQ A;  5IMZ A;  4BVX A;  2YWM A;  1SL1 B;  2VLU A;  2PVQ A;  1F37 A;  1BG5 A;  1J08 A;  1J0F A;  2RII A;  3US3 A;  3IXR A;  1K0O A;  2LNT A;  3I9V 2;  2GZP A;  1Y6E A;  1W89 A;  4BWS A;  2ZUP A;  4MJC A;  1GUM A;  1SEN A;  4TR3 A;  3GUS A;  6GSU A;  2G2Q A;  4MLY A;  4ZB6 A;  2VM1 A;  4LMV A;  2C0D A;  4GF0 A;  3RBT A;  4HUA A;  4ZL8 A;  3GUR A;  4BA7 A;  3ERW A;  2LQO A;  2WB9 A;  4BWQ A;  1GUK A;  4V2L A;  4QL9 A;  1F2E A;  2O89 A;  2JSZ A;  5ECH B;  1VGL A;  3D0Z A;  1XXU A;  6GST A;  3KH7 A;  4WR5 A;  1GUH A;  4WR4 A;  4I5Q A;  2IN3 A;  1A8L A;  4LL4 B;  2L4C A;  2LJK A;  4F9Z A;  3CSJ A;  1KNG A;  3IBH A;  3PPU A;  4IQA A;  3WT2 A;  3RAZ A;  5GAP D;  3Q74 A;  4MZW A;  5BMU A;  1NW2 A;  1AXD A;  1XWG A;  1N2A A;  1GTA A;  2CT6 A;  1SKS B;  5A5K A;  1X9W B;  5J9C A;  2HNL A;  6GSV A;  1TDI A;  1WIK A;  4IBP A;  4OFN A;  5B6M A;  2WRT A;  1FAA A;  2RLI A;  2WGR A;  5G1L A;  4XCS A;  4N30 A;  5D9T A;  1UVZ A;  3P2A A;  2CVK A;  3WGE A;  1WPI A;  3EE2 A;  1B9X C;  2TRX A;  4Z7X A;  3QCP A;  14GS A;  1HNB A;  4MMM A;  4PQH A;  1WMJ A;  4KDU A;  1E6B A;  2F9S A;  3GMF A;  1K0A A;  4HS1 A;  5HR0 A;  3CSH A;  3I6A A;  4K2D A;  2XPD A;  5IMA A;  5KN2 A;  1DE1 A;  3DVX A;  2K8S A;  1K3L A;  1B9Y C;  3PIN A;  4PNF A;  3TKQ A;  1ZZY A;  5AN1 A;  2O85 A;  4DSR A;  5ECO B;  2D2Z A;  1F3B A;  3CSI A;  2IMF A;  2H74 A;  2VD1 A;  1S3D A;  2C0F A;  4LMW A;  2LJR A;  2PMT A;  1LBK A;  2FWG A;  1SK2 A;  5H5S A;  5C04 A;  4GRF A;  1EEM A;  2H6X A;  5HR3 A;  4X1U A;  5ELA A;  4WEY A;  4TVE A;  3RHC A;  2I3Y A;  5JCW A;  2H01 A;  2CZ2 A;  3DD3 A;  2CAQ A;  2C3N A;  3EYT A;  3G7J A;  1ZYE A;  5LCZ A;  1Y25 A;  4WKW A;  4G0L A;  1V98 A;  2R3X A;  5GSS A;  4KCA A;  1TU8 A;  1X5C A;  4IHU A;  4O7H A;  3L9U A;  4JZQ A;  5ECN B;  2R5G A;  2HLS A;  2VL2 C;  4OWY A;  5ECQ B;  5J9B A;  3L9V A;  2V32 A;  5CRW A;  2JZR A;  2DBC A;  3Q19 A;  2HSM B;  4HQS A;  3SWL A;  4N0V A;  1XOA A;  1SJZ A;  1V40 A;  3GKM A;  1PL1 A;  2DSA A;  4EUY A;  1GNW A;  2GTU A;  2GQM A;  4G0K A;  1VF1 A;  3IRA A;  3HJP A;  2C4J A;  1V2A A;  3KTB A;  2DJ0 A;  1PN9 A;  3LFL A;  4KUN A;  4HJM A;  2M46 A;  4DSS A;  2CVD A;  1WE0 A;  1ZCP A;  4F03 A;  1V9W A;  4XS4 B;  3DKS A;  3EWL A;  4MH2 A;  4O5R A;  2CX4 A;  1TXX A;  1TW9 A;  1R26 A;  5ECR B;  2KHP A;  3D21 A;  5D9X A;  4L8E A;  2P0G A;  1KTE A;  2H72 A;  2YN1 A;  1N8J A;  1EP7 A;  1XWA A;  1O8W A;  1GTI A;  2DLX A;  4RQX A;  2HSM A;  3IPZ A;  3J7Y k;  5CRE A;  2MMN A;  4FO5 A;  4LL1 B;  2VCT A;  3CRT A;  3M9K A;  3KMO A;  2KOK A;  4PQI A;  2L5L A;  1QUW A;  3KD0 A;  4GCI A;  2OAD A;  4K8M A;  2N5F A;  5J4U A;  3UBK A;  5E59 A;  3E0U A;  3ISO A;  2P5R A;  5F05 A;  2O87 A;  2YAN A;  2XC2 A;  8GSS A;  1VRS D;  1THO A;  4L0W A;  5H5R A;  3VWW A;  3ZIV A;  1SJ6 A;  2JZS A;  2VLT A;  1FVJ A;  3GKN A;  2F8A A;  1AW9 A;  4O92 A;  5DQY A;  1T3B A;  4JE1 A;  3APQ A;  2PUK C;  4JED A;  1GWC A;  2LRN A;  5ECP B;  3DGQ A;  2A4V A;  5HR1 A;  5G5F A;  5INY A;  4YQV A;  3D4T A;  4K7N A;  4GXZ A;  4KB3 A;  2KLX A;  1YY7 A;  1O7U A;  1A2J A;  5J3R A;  2UZ8 A;  1ZMA A;  1VF2 A;  1PKW A;  3IDV A;  4MJA A;  2IPA A;  1X5D A;  3M1G A;  2H1B A;  2E7P A;  3EIN A;  3CXG A;  3FZ9 A;  2EIR A;  4RUV A;  1O6J A;  5IO0 A;  3IK9 A;  3DXB A;  4XS1 A;  1FB0 A;  3DEX A;  2ALB A;  1GSU A;  2MMO A;  2ZNM A;  2OBI A;  2TIR A;  2OA7 A;  1HQO A;  4IEL A;  1EOH A;  2HZF A;  2VM2 A;  4K9Z A;  4NHZ A;  3Q6O A;  3TCO A;  5EL8 A;  2AUV A;  1E2Y A;  2AAW A;  4J57 E;  4HOJ A;  1G6W A;  2LRT A;  1BQ7 A;  2XHF A;  5HFG A;  2FGX A;  2TRC P;  2I81 A;  4D73 A;  3TDG A;  3MNG A;  4MZB A;  1GSY A;  1WRY A;  2GST A;  1HD2 A;  3TKR A;  3QMX A;  2OAC A;  4EXJ A;  4PTS A;  2C0G A;  2I9H A;  1GSS A;  2VO4 A;  3HDC A;  2N5A A;  12GS A;  2ES7 A;  2H0G A;  2K18 A;  2JU5 A;  3UAP A;  2IL3 A;  2NVL A;  2YPM A;  3LSZ A;  4IJI A;  1NM3 A;  4TRX A;  2V41 A;  3UAR A;  1M9B A;  1TRW A;  3ZRD A;  1TTZ A;  1T8E B;  6GSS A;  3ZIT A;  4G9H A;  1OC9 B;  1GL8 A;  5DJM A;  1AQV A;  3DVW A;  3QAV A;  3PH9 A;  5B7C A;  4J56 E;  1M0U A;  3EUR A;  3D4M A;  1PQN A;  2B3S A;  1TU7 A;  1FG4 A;  4IJ3 A;  4BVX B;  5JWO B;  5ECK B;  2DIZ A;  5KEJ A;  2H1D A;  4ILF A;  5CNW A;  1UA5 A;  1QXH A;  2X99 A;  2GGT A;  6GSX A;  5JCG A;  1O81 A;  3IC4 A;  3IE3 A;  2B5X A;  4XTS A;  3FYG A;  1K0D A;  1G7E A;  2FWF A;  1K0C A;  3H93 A;  4WET A;  5IPH A;  5JCU A;  3UBL A;  3A3T A;  1GSQ A;  3TRP A;  3APS A;  4KE3 A;  3KGK A;  2HRF A;  1PGT A;  1PL2 A;  5A4W A;  4OMV A;  5AGY A;  3FY7 A;  4KSM A;  4EF0 A;  4XIH A;  1XCC A;  2OJL A;  1OC9 A;  3IOS A;  5CRD A;  5F8B A;  1WOU A;  3HA9 A;  3ZFB A;  1WJK A;  2GQL A;  3ME7 A;  3GYK A;  2VAF A;  1OYJ A;  3NIV A;  4FYC A;  3JCM L;  3F0I A;  5IOW A;  2H75 A;  3GX8 A;  3FRC A;  5B8A A;  2H0I A;  1JZR A;  1M7T A;  5CRG A;  2GSQ A;  2EIQ A;  4OFT A;  4ML1 A;  4ECJ A;  2VIM A;  3C7M A;  1A0R P;  1AQW A;  2LUS A;  1ZOF A;  2M72 A;  1O8X A;  5AIX A;  1ERV A;  3AY8 A;  2E2M A;  1B8X A;  5KN3 A;  2EC4 A;  3QFA C;  3LWA A;  2MBT A;  1U6T A;  3VWX A;  3KJY A;  2ON7 A;  3U5R E;  1GUL A;  3SBC A;  4EE0 A;  5GZZ B;  5IOX A;  2HSY A;  3ZZX A;  2AB6 A;  3UMA A;  2H0H A;  4H86 A;  5EY6 A;  1ST9 A;  4V1A p;  1XOB A;  2IFQ B;  4EVM A;  1XZO A;  1GRX A;  2AHE A;  4K7O A;  2HI7 A;  4JBB A;  5D73 A;  2O7K A;  1BX9 A;  3HCZ A;  2VUP A;  4LLR A;  3CBU A;  3CTG A;  3FHK A;  2KP2 A;  1A24 A;  2DJ1 A;  3TJK A;  3WYW A;  1Q4J A;  5KN1 A;  3NZN A;  13GS A;  3TKS C;  5HQP A;  2VL3 A;  1SD9 A;  3QAW A;  3LXZ A;  4NHW A;  1SU9 A;  2FNO A;  5L71 A;  1PKZ A;  1U87 A;  1ERW A;  1WWJ A;  3WGD A;  3LEF A;  2C8U A;  17GS A;  2F51 A;  2DMM A;  2GT6 A;  5KN0 A;  1DE2 A;  3M3M A;  1GP1 A;  4JR6 A;  2H71 A;  1EOG A;  1PRX A;  4OCF A;  4K1F A;  2L57 A;  4YAP A;  4NPB A;  2KUC A;  4TOP A;  4YAV A;  2IFQ A;  3M8N A;  3PR8 A;  2LST A;  3TOU A;  2R4V A;  1T7P B;  1T4Y A;  4POM A;  3GST A;  4ZB9 A;  3VUR A;  1U3I A;  4FYB A;  2RUF A;  2C0E A;  2K8V A;  1XWK A;  4HZ2 A;  2EIO A;  2GZY A;  3DWV A;  2GSS A;  1F9M A;  4FQU A;  1X0R A;  3LOR A;  4PGT A;  1Z5Y E;  1JLV A;  2HT9 A;  4Q5R A;  5ECI B;  1THX A;  4DEJ A;  4IN0 A;  2DJJ A;  1EV4 A;  1EP8 A;  4MCU A;  3GRX A;  1PD2 1;  5DQS A;  1AC1 A;  3RDW A;  3ERF A;  3ZRE A;  4DSS B;  3RHB A;  4MPF A;  3UJ1 A;  3G9B A;  4ZL7 A;  2FLS A;  1QK8 A;  4TKY A;  1GSF A;  5ECS A;  2HQT A;  1H4O A;  3UEM A;  4ZBB A;  4HEA 2;  2GZZ A;  1TKD B;  4USS A;  3F4R A;  5D96 A;  1WP0 A;  2HFD A;  1M9A A;  1EWX A;  1M2D A;  5HR2 A;  2FWH A;  1R7H A;  4MK3 A;  2C1Y A;  2K9F A;  5DJL A;  2YOI A;  2X8G A;  3FEU A;  4I2T A;  2PU9 C;  5AIS A;  3EU4 A;  5EPF A;  1UC7 A;  4NV5 A;  1ILO A;  3MAK A;  1SYX A;  4ZBA A;  2WJU A;  3MDK A;  2X8C A;  5EVO A;  3KEB A;  3GKX A;  4TR4 A;  2B7J A;  1VF4 A;  1SJI A;  4NAX A;  1TRV A;  1K3O A;  1TRU A;  3RPP A;  1XWC A;  2M80 A;  4RI7 A;  3ZTL A;  4E8H A;  1RW1 A;  1BAY A;  2LTK A;  2GLR A;  2A2S A;  3VLN A;  4JU5 A; 
#chains in the Genus database with same CATH topology
 2B1L A;  3KMN A;  2LV3 A;  5G5E A;  2LJA A;  1QFN A;  1A8Y A;  3VFI A;  4CDO A;  1QGV A;  2YWN A;  3TJB A;  3ZMK A;  1XW5 A;  4V1A g;  4AJ8 A;  1PA3 A;  4AGS A;  2PN8 A;  4X43 A;  3H1N A;  2HXK A;  2WUL A;  1Z7R A;  4F0B A;  3DML A;  2O5V A;  4IKH A;  3UVT A;  2VLV A;  4IW9 A;  2DC5 A;  4AKH A;  1XBS A;  1A2L A;  3P90 A;  1JHB A;  1URM A;  2JSY A;  3ZML A;  4Q5F A;  2WVX B;  5J5N A;  2DJ3 A;  4G01 A;  2E2G A;  2YV7 A;  4PI0 C;  1XVQ A;  5CO3 A;  5DAL A;  3H8Q A;  1HNA A;  4MJB A;  2VCX A;  2HRK B;  4KX4 A;  3GH9 A;  2B5Y A;  4Z2U A;  4MF6 A;  2Z9S A;  3ZVJ D;  3ZIJ A;  3J7Y b;  2NTO A;  3TKS E;  2F8F A;  4GQF A;  4Q5N A;  2VCV A;  3HY2 A;  1HNC A;  3L78 A;  4TN8 A;  1OE7 A;  2WCI A;  2QC7 A;  3F8U A;  3BOA A;  1R5P A;  2DIY A;  3VWU A;  2I1U A;  5DCH A;  3EU3 A;  2JZT A;  4MF7 A;  4XRA A;  4D73 B;  1M3J A;  2YV9 A;  4OFM A;  5LD0 A;  3BD2 A;  3GL3 A;  3F6D A;  2B5E A;  4F82 A;  3UIW A;  4GSN A;  1BYE A;  3C1S A;  2FA4 A;  2HRN A;  1I9D A;  1KEB A;  3A2X A;  1V57 A;  2WVX A;  1Y1U A;  2HZE B;  2VL2 A;  2L59 A;  3I69 A;  2RM5 A;  4BVY B;  2OE3 A;  4BIK A;  4XRD A;  3A2W A;  5DVB A;  6GSY A;  2HRK A;  1SVL A;  5ENU A;  4WF5 A;  2PER A;  2V2G A;  1FHE A;  4WXT A;  1NSW A;  1SVO A;  2YZH A;  4HSC X;  2VL9 A;  20GS A;  2R0G A;  3HZ8 A;  3ME8 A;  4K6X A;  1H75 A;  2AJQ B;  1JLW A;  3RFR C;  2CZ3 A;  3HJM A;  2QA1 A;  1JZD A;  3VK9 A;  2GSR A;  1PX6 A;  1ABA A;  3VWV A;  4GLT A;  4KCE A;  3R2Q A;  5KOX A;  2E0Q A;  5DBQ A;  4HU7 A;  3KXO A;  4K0N A;  2HRA A;  3CMI A;  3GIX A;  5ECL B;  2I4A A;  2PPT A;  4EDZ A;  3QPM A;  2MMZ A;  3TJG A;  4Q5Q A;  1YF1 A;  3RPN A;  4KGI A;  2L5O A;  1T4Z A;  1OC8 A;  1EEJ A;  2H6Z A;  2OE1 A;  3K8N A;  3ZL5 A;  4V2N A;  1AIU A;  3OR5 A;  3P7X A;  2JAC A;  2HZE A;  2AV4 A;  1LU4 A;  2HYX A;  1M2B A;  5G1K A;  4L5L A;  1C72 A;  4BVY A;  3HZ4 A;  2IMI A;  1K0N A;  5GST A;  4MH3 A;  1XPV A;  4I97 A;  3V1W A;  1OE8 A;  3GN3 A;  4PX1 A;  3GX0 A;  2V6K A;  1QQ2 A;  3KZQ A;  16GS A;  1JFU A;  4BPY A;  2X64 A;  4P3Y B;  2CV4 A;  1B4Q A;  4CY8 A;  2XPE A;  4G0I A;  2VD0 A;  3VPT A;  3ZFL A;  4YQU A;  4TXO A;  2VOC A;  2B6M A;  4WBR D;  1G7O A;  9GSS A;  1YZX A;  3LJR A;  1TOF A;  3BCI A;  3C73 A;  5D93 A;  3W6G A;  1T00 A;  5IMD A;  3HXS A;  2R6K A;  1TI3 A;  1TP9 A;  2R37 A;  4FH8 A;  4CW9 A;  3KIJ A;  1SD8 A;  2A2R A;  3GSS A;  1GLQ A;  3HVN A;  3GA4 A;  2H70 A;  3GHA A;  5HFI A;  1X9S B;  3D5J A;  1DUG A;  2J23 A;  2OE0 A;  1S3A A;  5FT3 A;  2VCQ A;  1SK0 A;  2HE3 A;  1GTU A;  2BTO T;  4LA1 A;  1XW6 A;  3W8S A;  4OCE A;  4AKX B;  4ECB A;  1B4P A;  1YF0 A;  2FD3 A;  3MSZ A;  1HYU A;  2FY6 A;  1SYR A;  1Z7P A;  4I2U A;  1T1V A;  5IM9 A;  4EC0 A;  4HDE A;  2GQK A;  3M0F A;  4POB A;  3QOU A;  2FHE A;  1EV9 A;  1GTB A;  1BED A;  1TXU A;  1Z9H A;  2L4Q A;  3QR6 A;  4KSO A;  4IVF A;  1YDK A;  5D8I A;  1TRS A;  4KND A;  2CVB A;  3A5W A;  1TK8 B;  3UVH A;  3GH6 A;  2XBQ A;  1X9M B;  2H76 A;  1BJX A;  1OC3 A;  1R5A A;  1MDK A;  3ZYW A;  1GH2 A;  4AKI A;  1JZO A;  2BJX A;  3FKF A;  2WVZ A;  3VI5 A;  1NHO A;  1ZL9 A;  4POK A;  4ID0 A;  4ZIJ A;  1PSQ A;  3GTU B;  3FK8 A;  5CRH A;  2YJ7 A;  1W4V A;  1XWB A;  3KCM A;  2BMX A;  3O3T A;  2GDR A;  4E8E A;  2B7K A;  5CYY A;  4ACS A;  3MWH A;  3NOF A;  1MEK A;  3TGZ A;  1A2M A;  1U3A A;  1M99 A;  2V6O A;  1PMT A;  2WW2 A;  5IO2 A;  3MIX A;  3HYP A;  3VI7 A;  3UL3 A;  2GS3 A;  1V58 A;  3F4T A;  2N5B A;  3O76 A;  4ZB7 A;  3E9J B;  1ACV A;  1IYI A;  4RI6 A;  4N0Z A;  2H19 A;  2WZ9 A;  5GAN D;  5G31 A;  1MDI A;  1OKD A;  5D9W A;  4G19 A;  4GTU A;  2C3Q A;  2H1A A;  2QSI A;  3LYP A;  2IWT A;  4JRR A;  4I6X A;  1O85 A;  4ZIL A;  3GTU A;  1FO5 A;  5D9V A;  2O3E A;  3BJ5 A;  1ZGN A;  1SL2 B;  1ML6 A;  1CQH A;  5E4W A;  4PUF C;  1XW9 A;  1OVN A;  3GNJ A;  1GSD A;  1EGO A;  2IJY A;  3H4K A;  2FWE A;  3DRN A;  3BBY A;  4ECC A;  4IS0 A;  3IC8 A;  2DKH A;  3KM6 A;  3L9S A;  4OD7 A;  4ZXG A;  3GFK A;  4ISD A;  4TXV A;  5IMC A;  4GQC A;  4J2F A;  4GDF A;  3IHQ A;  1K3Y A;  1MD4 A;  1K0B A;  4KAE A;  1RK4 A;  2YZU A;  3LXT A;  19GS A;  4PUR A;  4X4J A;  4GST A;  2MZC A;  3FR9 A;  2PVO C;  2F3M A;  1ERT A;  3CTF A;  2H1L A;  1UN2 A;  4ZB8 A;  2QKE A;  2V1M A;  4HQZ A;  3EMX A;  4L0U A;  4HU9 A;  4MA9 A;  1TI1 A;  2LRC A;  1O73 A;  1JZW A;  4TW5 A;  3F6F A;  2J9H A;  4AJ7 A;  4PQ1 A;  4OO5 A;  3GL5 A;  3TB2 A;  1FW1 A;  3CYN A;  4Z2R A;  5B8B A;  4YQM A;  1KBN A;  22GS A;  1LJR A;  5J4V A;  3PGT A;  5F0G A;  3WT1 A;  5J41 A;  3EMP A;  5JWQ B;  3QAG A;  4TR1 B;  2YP6 A;  2C3T A;  3IA1 A;  3H79 A;  2YJH A;  3TKP A;  1SKR B;  2DJK A;  3KTL A;  2H30 A;  2P31 A;  1X5E A;  5A5H B;  4K0G A;  5HFK A;  4CHS A;  3F3R A;  3FW2 A;  1Z3E A;  5DAL B;  3ZVJ A;  5H5Q A;  2NDO A;  3F4S A;  3HMJ G;  1YJ6 A;  1R4W A;  1YVL A;  3FZA A;  3TKS A;  1G0T A;  2DKI A;  3W8J A;  1MTC A;  4RQR A;  4ULX A;  2HSH A;  4QL7 A;  5C00 A;  3P8W A;  3O6T A;  3WGX A;  4IP6 A;  3IK7 A;  4G10 A;  4HJ2 A;  2H6Y A;  3E3E A;  4EL1 A;  1AQX A;  3D6I A;  2MYG A;  4K7I A;  2R2J A;  2JL4 A;  3QFB C;  3LYK A;  2PBJ A;  4ECI A;  4TR1 A;  2GT5 A;  4EO3 A;  5IMV A;  2IIY A;  4QMK A;  3HHV A;  5A4V A;  1CQG A;  2WDU A;  2RUE A;  3EVI A;  3U6V A;  1YKA A;  3IV4 A;  1F6M C;  4KDY A;  4OO4 A;  1N25 A;  3IHG A;  2K6V A;  1VF3 A;  3HVS A;  1NHY A;  2CX3 A;  6GSW A;  5G2Z A;  4YH2 A;  5A5H A;  18GS A;  4N10 A;  1YKC A;  5LNK e;  2LNS A;  5J4Y A;  1TJD A;  1I5G A;  2H8L A;  2VCW A;  2O8V B;  3HVX A;  1ON4 A;  5DAK B;  2ON5 A;  1S3C A;  4MP4 A;  3L0H A;  1SL0 B;  2H66 A;  4MPG A;  3R3E A;  4FIW A;  5IMF A;  3C8E A;  3TJF A;  4BL7 B;  5IIZ A;  2MBS A;  3KP8 A;  2P5Q A;  4HI7 A;  1U88 A;  5CAX A;  3HD5 A;  1MDJ A;  11GS A;  2OKA A;  4WF4 A;  4XS4 A;  3FZ5 A;  2WS2 A;  1QMV A;  1EGR A;  3BCK A;  1AAZ A;  4HZ4 A;  3N9J A;  5F06 A;  1XFL A;  3ED3 A;  4PNG A;  3G7Y A;  2AYT A;  4AKG A;  5DCG A;  1XIY A;  4N11 A;  3DYR A;  3I43 A;  1BG1 A;  2REM A;  3IR4 A;  1M2A A;  2FCH A;  4TR0 A;  4FYU A;  2G0F A;  2YNX A;  4AF2 A;  1YEW C;  5IPG A;  3C1R A;  1ZYQ B;  1TK0 B;  2X8H A;  3APO A;  4IGJ A;  1J9B A;  2LEG A;  3UOM A;  1TK5 B;  1MD3 A;  1SVM A;  2L6D A;  4NXI A;  4X0X A;  5DAK A;  4F0C A;  4I8B A;  1S3R A;  2RM6 A;  5FWG A;  1USB A;  2YWI A;  3S9F A;  1G6Y A;  4BL7 A;  2L6C A;  3DIE A;  1YQ1 A;  5G30 A;  4KW6 A;  2IME A;  3GKK A;  3HVV A;  1FVK A;  1DSB A;  1OAZ A;  3ZLP A;  1K0M A;  4PUA A;  4AJ6 A;  2YCD A;  3L4N A;  2QGV A;  3WD6 A;  1FOH A;  4TXO B;  1IYH A;  4MDC A;  2O36 A;  2DJ2 A;  1Z6N A;  4GSS A;  2NPB A;  3EC3 A;  10GS A;  1F3A A;  3F9U A;  2C80 A;  4ZL9 A;  5FHI A;  2PGT A;  3LQ7 A;  2H73 A;  4MZC A;  1M3I A;  1A23 A;  5COH A;  2OBK A;  1GLP A;  4KH7 A;  1B48 A;  2IMK A;  5AIV A;  5DDL A;  3HKR A;  7GSS A;  2KP1 A;  3TRX A;  2MMA A;  3Q18 A;  5F07 A;  4PXO A;  4XS6 A;  5ECM B;  2NBS A;  5CP1 A;  4EKZ A;  2LKU A;  1PX7 A;  4DVC A;  1ERU A;  2YWO A;  5B6N A;  4A5P A;  4QQ7 A;  2IMD A;  2JAD A;  4NWY A;  2GVP A;  5A4U A;  1GSE A;  1OKT A;  2LQQ A;  3D22 A;  2A2P A;  2CAI A;  3LG6 A;  4KA0 A;  1FOV A;  2WFC A;  3ERG A;  3M9J A;  1SK1 A;  3VPQ A;  3FR6 A;  4EDY A;  3KH9 A;  3C71 A;  3F63 A;  5ID2 B;  3CQF A;  3GV1 A;  3CRU A;  3N5O A;  2B1K A;  4KDX A;  5ABR A;  2ZCT A;  4L5O A;  4NV2 A;  2PWJ A;  4GWR A;  3F3Q A;  4WBJ A;  4MF5 A;  5IQY A;  1Q98 A;  4JR4 A;  3IAS 2;  1RQM A;  3QDN A;  4POL A;  1SKW B;  2VCZ A;  2LS5 A;  2XBI A;  4G2E A;  3CHX C;  3TUE A;  3FR3 A;  5ELG A;  3TRQ A;  1AUC A;  4IP1 A;  2H1G A;  3QD9 A;  4KF9 A;  4NMU A;  4ZBD A;  3TOT A;  3TJJ A;  5JWR B;  2CA8 A;  4O32 A;  3EPT A;  1XVW A;  4XHM A;  1YEX A;  4CY6 A;  4F2I A;  1EZK A;  1A0F A;  4V2M A;  2HSN B;  4O5Q A;  1Z6M A;  2DML A;  3KP9 A;  3LGC A;  1DBY A;  1GNE A;  3HJO A;  3IAM 2;  2FUG 2;  4MAB A;  3FZ4 A;  3A2V A;  1FB6 A;  3G7I A;  4IQ1 A;  5ID2 A;  1YEP A;  1PN0 A;  2CQ9 A;  4MJE A;  4ML6 A;  2WW0 A;  2FA8 A;  3LW9 A;  4DSQ A;  5IMZ A;  4BVX A;  2YWM A;  2X4A A;  1SL1 B;  2VLU A;  2PVQ A;  1F37 A;  1BG5 A;  2OT3 A;  1J08 A;  1J0F A;  2RII A;  3US3 A;  3IXR A;  1K0O A;  2LNT A;  3I9V 2;  2GZP A;  1Y6E A;  1W89 A;  4BWS A;  2ZUP A;  4MJC A;  1GUM A;  1SEN A;  4TR3 A;  3GUS A;  5BMU B;  6GSU A;  2G2Q A;  4MLY A;  4ZB6 A;  2VM1 A;  4LMV A;  1BF5 A;  2C0D A;  4GF0 A;  3RBT A;  4HUA A;  2WW1 A;  4ZL8 A;  3GUR A;  2HSN A;  4BA7 A;  3ERW A;  2LQO A;  2WB9 A;  4BWQ A;  1GUK A;  4V2L A;  4QL9 A;  1F2E A;  2O89 A;  2JSZ A;  5ECH B;  1VGL A;  3D0Z A;  1XXU A;  6GST A;  3KH7 A;  4WR5 A;  1GUH A;  4WR4 A;  4YKG A;  4I5Q A;  2IN3 A;  1A8L A;  4LL4 B;  2L4C A;  5J40 A;  2LJK A;  4F9Z A;  1XG8 A;  3CSJ A;  1KNG A;  3IBH A;  3PPU A;  4IQA A;  4E68 A;  3WT2 A;  3RAZ A;  5GAP D;  3Q74 A;  4MZW A;  5BMU A;  1NW2 A;  1AXD A;  1XWG A;  1N2A A;  1GTA A;  2CT6 A;  1SKS B;  5J47 A;  5A5K A;  1X9W B;  5J9C A;  2HNL A;  6GSV A;  1TDI A;  1WIK A;  4IBP A;  4OFN A;  5B6M A;  2WRT A;  1FAA A;  2RLI A;  2WGR A;  5G1L A;  4XCS A;  4N30 A;  5D9T A;  1UVZ A;  3P2A A;  2CVK A;  3WGE A;  1WPI A;  3EE2 A;  1B9X C;  2TRX A;  4Z7X A;  3QCP A;  14GS A;  1HNB A;  4MMM A;  4PQH A;  2EFH A;  1WMJ A;  4KDU A;  1E6B A;  2F9S A;  3GMF A;  1K0A A;  4HS1 A;  5HR0 A;  3CSH A;  3I6A A;  4K2D A;  2QA2 A;  2XPD A;  5IMA A;  5KN2 A;  1DE1 A;  3DVX A;  2K8S A;  1K3L A;  1B9Y C;  3PIN A;  4PNF A;  3TKQ A;  1ZZY A;  5AN1 A;  2O85 A;  4DSR A;  5ECO B;  2D2Z A;  1F3B A;  3CSI A;  2IMF A;  2H74 A;  2VD1 A;  1S3D A;  2C0F A;  4LMW A;  2LJR A;  2PMT A;  1LBK A;  2FWG A;  1SK2 A;  5H5S A;  5C04 A;  4GRF A;  1EEM A;  2H6X A;  5HR3 A;  4X1U A;  5ELA A;  4WEY A;  4TVE A;  3RHC A;  2I3Y A;  5JCW A;  2H01 A;  2CZ2 A;  3DD3 A;  2CAQ A;  2C3N A;  3EYT A;  3G7J A;  1ZYE A;  5LCZ A;  1Y25 A;  4WKW A;  2WZS A;  4G0L A;  1V98 A;  2R3X A;  5GSS A;  4KCA A;  1TU8 A;  1X5C A;  4IHU A;  4O7H A;  3L9U A;  4JZQ A;  5ECN B;  2R5G A;  2HLS A;  2VL2 C;  4OWY A;  5ECQ B;  4ICY A;  5J9B A;  3L9V A;  2V32 A;  5CRW A;  2JZR A;  2DBC A;  3Q19 A;  2HSM B;  4HQS A;  3SWL A;  4N0V A;  1XOA A;  1SJZ A;  1V40 A;  3GKM A;  1PL1 A;  2DSA A;  4EUY A;  1GNW A;  1I1I P;  2GTU A;  2GQM A;  4G0K A;  1VF1 A;  3IRA A;  3HJP A;  2C4J A;  1V2A A;  3KTB A;  2DJ0 A;  1PN9 A;  3LFL A;  4KUN A;  4HJM A;  2M46 A;  4DSS A;  2CVD A;  1WE0 A;  1ZCP A;  4F03 A;  1V9W A;  4XS4 B;  3DKS A;  4MNN A;  3EWL A;  4MH2 A;  4O5R A;  4EIQ A;  2CX4 A;  1TXX A;  1TW9 A;  1R26 A;  5ECR B;  2EFD A;  4PHZ C;  2KHP A;  3D21 A;  5D9X A;  4L8E A;  2P0G A;  1KTE A;  2UV8 G;  2H72 A;  2YN1 A;  1N8J A;  1EP7 A;  1XWA A;  1O8W A;  1GTI A;  2DLX A;  4RQX A;  2HSM A;  3IPZ A;  3J7Y k;  5CRE A;  2MMN A;  4FO5 A;  4LL1 B;  2VCT A;  3CRT A;  3M9K A;  3KMO A;  2KOK A;  4PQI A;  2L5L A;  1QUW A;  3KD0 A;  2VKZ G;  4GCI A;  2OAD A;  4K8M A;  2N5F A;  5J4U A;  3UBK A;  5E59 A;  4O5U A;  3E0U A;  3ISO A;  2P5R A;  5F05 A;  2O87 A;  2YAN A;  3FMW A;  2A4H A;  2XC2 A;  8GSS A;  1VRS D;  1THO A;  4L0W A;  5H5R A;  3VWW A;  3ZIV A;  1SJ6 A;  2JZS A;  2VLT A;  1FVJ A;  3GKN A;  5BRT A;  2F8A A;  1AW9 A;  4O92 A;  5DQY A;  2EFE A;  1T3B A;  4JE1 A;  3APQ A;  4W66 A;  2PUK C;  4JED A;  1GWC A;  2LRN A;  5ECP B;  3DGQ A;  2A4V A;  5HR1 A;  5G5F A;  5INY A;  4YQV A;  3D4T A;  4K7N A;  4GXZ A;  4KB3 A;  2KLX A;  2R0C A;  1YY7 A;  1O7U A;  1A2J A;  5J3R A;  2UZ8 A;  1ZMA A;  1VF2 A;  1PKW A;  3IDV A;  4MJA A;  4Z2T A;  2IPA A;  1X5D A;  3M1G A;  2H1B A;  2E7P A;  3EIN A;  3CXG A;  3FZ9 A;  2EIR A;  4RUV A;  1O6J A;  5IO0 A;  3IK9 A;  3DXB A;  4XS1 A;  1FB0 A;  3DEX A;  2ALB A;  1GSU A;  2MMO A;  2ZNM A;  2OBI A;  2TIR A;  2OA7 A;  1HQO A;  4IEL A;  1EOH A;  2HZF A;  2VM2 A;  4K9Z A;  4NHZ A;  3Q6O A;  3TCO A;  5EL8 A;  2AUV A;  1E2Y A;  2AAW A;  4J57 E;  1ZYN A;  4HOJ A;  1G6W A;  3CWG A;  2LRT A;  5A34 B;  1BQ7 A;  2XHF A;  5HFG A;  2FGX A;  2TRC P;  2I81 A;  4D73 A;  3TDG A;  3MNG A;  4MZB A;  1GSY A;  1WRY A;  2GST A;  1HD2 A;  3TKR A;  3QMX A;  2OAC A;  4EXJ A;  4PTS A;  2C0G A;  2I9H A;  1GSS A;  2VO4 A;  3HDC A;  2N5A A;  12GS A;  2ES7 A;  2H0G A;  2K18 A;  2X49 A;  5KOW A;  2JU5 A;  3UAP A;  2IL3 A;  2NVL A;  2YPM A;  3LSZ A;  4IJI A;  1NM3 A;  4TRX A;  2V41 A;  3UAR A;  1M9B A;  1TRW A;  3ZRD A;  1TTZ A;  1T8E B;  6GSS A;  3ZIT A;  4G9H A;  1OC9 B;  1GL8 A;  5DJM A;  1AQV A;  3DVW A;  3QAV A;  3PH9 A;  5B7C A;  4J56 E;  1M0U A;  3EUR A;  3D4M A;  1PQN A;  2B3S A;  1TU7 A;  1FG4 A;  4IJ3 A;  4BVX B;  5JWO B;  5ECK B;  2DIZ A;  5KEJ A;  5A34 A;  2H1D A;  4ILF A;  5CNW A;  1UA5 A;  1QXH A;  2X99 A;  2GGT A;  6GSX A;  5JCG A;  1O81 A;  3IC4 A;  3IE3 A;  2B5X A;  4XTS A;  5A1N B;  3FYG A;  1K0D A;  1G7E A;  2FWF A;  1K0C A;  3H93 A;  4WET A;  5IPH A;  5JCU A;  3UBL A;  3A3T A;  1GSQ A;  3TRP A;  3APS A;  4KE3 A;  3KGK A;  2HRF A;  1PGT A;  1PL2 A;  5A4W A;  4OMV A;  5AGY A;  3FY7 A;  4KSM A;  4EF0 A;  4XIH A;  1XCC A;  2OJL A;  1OC9 A;  3IOS A;  5CRD A;  5F8B A;  1WOU A;  3HA9 A;  3ZFB A;  1WJK A;  2GQL A;  3ME7 A;  3GYK A;  2VAF A;  1OYJ A;  3NIV A;  4FYC A;  3JCM L;  3F0I A;  5IOW A;  2H75 A;  3GX8 A;  3FRC A;  4PI2 C;  4K5R A;  5B8A A;  2H0I A;  1JZR A;  3TU3 B;  1M7T A;  5CRG A;  2GSQ A;  2EIQ A;  4OFT A;  4ML1 A;  4ECJ A;  2VIM A;  3C7M A;  1A0R P;  1AQW A;  2LUS A;  1ZOF A;  2M72 A;  5A1N A;  1O8X A;  5AIX A;  1ERV A;  3AY8 A;  2E2M A;  1B8X A;  5KN3 A;  2EC4 A;  3QFA C;  3LWA A;  4FXY P;  2MBT A;  1U6T A;  3VWX A;  3KJY A;  2ON7 A;  3U5R E;  1GUL A;  3SBC A;  4EE0 A;  5GZZ B;  5IOX A;  2HSY A;  3ZZX A;  2AB6 A;  3UMA A;  2H0H A;  4H86 A;  1PFO A;  5EY6 A;  1ST9 A;  4V1A p;  1XOB A;  2IFQ B;  4EVM A;  1XZO A;  1GRX A;  2AHE A;  4K7O A;  2HI7 A;  4JBB A;  5D73 A;  2O7K A;  1BX9 A;  3HCZ A;  3RGB C;  2VUP A;  4LLR A;  4N3Z A;  3CBU A;  3CTG A;  2R0P A;  3FHK A;  2KP2 A;  1A24 A;  2DJ1 A;  3TJK A;  3WYW A;  1Q4J A;  5KN1 A;  3NZN A;  13GS A;  3TKS C;  5HQP A;  2VL3 A;  1SD9 A;  3QAW A;  3LXZ A;  4NHW A;  1SU9 A;  2FNO A;  4K2X A;  5L71 A;  1PKZ A;  1U87 A;  1ERW A;  1WWJ A;  3WGD A;  3LEF A;  2C8U A;  17GS A;  2F51 A;  2DMM A;  2GT6 A;  5KN0 A;  1DE2 A;  3M3M A;  1GP1 A;  4JR6 A;  2H71 A;  1EOG A;  1PRX A;  1S4B P;  1ZYP A;  4OCF A;  4K1F A;  2WVY A;  2L57 A;  4YAP A;  4NPB A;  2KUC A;  4TOP A;  4YAV A;  2IFQ A;  4K5S A;  4YKF A;  3M8N A;  3PR8 A;  2LST A;  3TOU A;  2R4V A;  1T7P B;  1T4Y A;  4POM A;  3GST A;  4ZB9 A;  3VUR A;  1U3I A;  4FYB A;  2RUF A;  2C0E A;  2K8V A;  2WW3 A;  1XWK A;  4HZ2 A;  2EIO A;  2GZY A;  3DWV A;  2GSS A;  1F9M A;  4FQU A;  1X0R A;  3LOR A;  4PGT A;  1Z5Y E;  1JLV A;  2HT9 A;  4Q5R A;  5ECI B;  4AI6 A;  1THX A;  4DEJ A;  4IN0 A;  2DJJ A;  1EV4 A;  1EP8 A;  4MCU A;  3GRX A;  1PD2 1;  5DQS A;  1AC1 A;  3RDW A;  3ERF A;  3ZRE A;  4DSS B;  3RHB A;  4MPF A;  3UJ1 A;  3G9B A;  4ZL7 A;  2FLS A;  1QK8 A;  4TKY A;  1GSF A;  5ECS A;  2HQT A;  1H4O A;  3UEM A;  4ZBB A;  4HEA 2;  2GZZ A;  1TKD B;  4USS A;  3F4R A;  5D96 A;  1WP0 A;  2HFD A;  4EIP A;  1M9A A;  1EWX A;  1M2D A;  5HR2 A;  2FWH A;  1R7H A;  4MK3 A;  2C1Y A;  2K9F A;  3A5I A;  5DJL A;  2YOI A;  2X8G A;  2EFC A;  3FEU A;  4I2T A;  2PU9 C;  5AIS A;  3EU4 A;  3MYD A;  5EPF A;  1UC7 A;  4NV5 A;  1ILO A;  3MAK A;  1SYX A;  4ZBA A;  2WJU A;  3MDK A;  2X8C A;  5EVO A;  3KEB A;  3GKX A;  4TR4 A;  2B7J A;  1VF4 A;  1SJI A;  4NAX A;  1TRV A;  1K3O A;  1TRU A;  3RPP A;  1XWC A;  2M80 A;  4RI7 A;  3ZTL A;  4E8H A;  1RW1 A;  1BAY A;  2LTK A;  2GLR A;  2A2S A;  3VLN A;  4JU5 A; 
#chains in the Genus database with same CATH homology
 2B1L A;  3KMN A;  2LV3 A;  5G5E A;  2LJA A;  1QFN A;  1A8Y A;  3VFI A;  4CDO A;  1QGV A;  2YWN A;  3TJB A;  3ZMK A;  1XW5 A;  4V1A g;  4AJ8 A;  1PA3 A;  4AGS A;  2PN8 A;  4X43 A;  3H1N A;  2HXK A;  2WUL A;  1Z7R A;  4F0B A;  3DML A;  2O5V A;  4IKH A;  3UVT A;  2VLV A;  4IW9 A;  2DC5 A;  4AKH A;  1XBS A;  1A2L A;  3P90 A;  1JHB A;  1URM A;  2JSY A;  3ZML A;  4Q5F A;  5J5N A;  2DJ3 A;  4G01 A;  2E2G A;  2YV7 A;  1XVQ A;  5CO3 A;  5DAL A;  3H8Q A;  1HNA A;  4MJB A;  2VCX A;  2HRK B;  4KX4 A;  3GH9 A;  2B5Y A;  4Z2U A;  4MF6 A;  2Z9S A;  3ZVJ D;  3ZIJ A;  3J7Y b;  2NTO A;  3TKS E;  2F8F A;  4GQF A;  4Q5N A;  2VCV A;  3HY2 A;  1HNC A;  3L78 A;  4TN8 A;  1OE7 A;  2WCI A;  2QC7 A;  3F8U A;  3BOA A;  1R5P A;  2DIY A;  3VWU A;  2I1U A;  5DCH A;  3EU3 A;  2JZT A;  4MF7 A;  4XRA A;  4D73 B;  2YV9 A;  4OFM A;  5LD0 A;  3BD2 A;  3GL3 A;  3F6D A;  2B5E A;  4F82 A;  3UIW A;  4GSN A;  1BYE A;  3C1S A;  2FA4 A;  2HRN A;  1I9D A;  1KEB A;  3A2X A;  1V57 A;  2VL2 A;  1Y1U A;  2HZE B;  2L59 A;  3I69 A;  2RM5 A;  4BVY B;  2OE3 A;  4XRD A;  3A2W A;  5DVB A;  6GSY A;  2HRK A;  1SVL A;  5ENU A;  4WF5 A;  2PER A;  2V2G A;  1FHE A;  4WXT A;  1NSW A;  1SVO A;  2YZH A;  2VL9 A;  20GS A;  2R0G A;  3HZ8 A;  3ME8 A;  4K6X A;  1H75 A;  2AJQ B;  1JLW A;  2CZ3 A;  3HJM A;  2QA1 A;  1JZD A;  3VK9 A;  2GSR A;  1PX6 A;  1ABA A;  3VWV A;  4GLT A;  4KCE A;  3R2Q A;  5KOX A;  2E0Q A;  5DBQ A;  4HU7 A;  3KXO A;  4K0N A;  2HRA A;  3CMI A;  3GIX A;  5ECL B;  2I4A A;  2PPT A;  4EDZ A;  3QPM A;  2MMZ A;  3TJG A;  4Q5Q A;  1YF1 A;  3RPN A;  4KGI A;  2L5O A;  1T4Z A;  1OC8 A;  1EEJ A;  2H6Z A;  2OE1 A;  3K8N A;  3ZL5 A;  4V2N A;  1AIU A;  3OR5 A;  3P7X A;  2JAC A;  2HZE A;  2AV4 A;  1LU4 A;  2HYX A;  1M2B A;  5G1K A;  4L5L A;  1C72 A;  4BVY A;  3HZ4 A;  2IMI A;  1K0N A;  5GST A;  4MH3 A;  1XPV A;  4I97 A;  3V1W A;  1OE8 A;  3GN3 A;  4PX1 A;  3GX0 A;  2V6K A;  1QQ2 A;  3KZQ A;  16GS A;  1JFU A;  4BPY A;  2X64 A;  4P3Y B;  2CV4 A;  1B4Q A;  4CY8 A;  2XPE A;  4G0I A;  2VD0 A;  3VPT A;  3ZFL A;  4YQU A;  4TXO A;  2VOC A;  2B6M A;  4WBR D;  1G7O A;  9GSS A;  1YZX A;  3LJR A;  1TOF A;  3BCI A;  3C73 A;  5D93 A;  3W6G A;  1T00 A;  5IMD A;  3HXS A;  2R6K A;  1TI3 A;  1TP9 A;  2R37 A;  4FH8 A;  4CW9 A;  3KIJ A;  1SD8 A;  2A2R A;  3GSS A;  1GLQ A;  3GA4 A;  2H70 A;  3GHA A;  5HFI A;  1X9S B;  3D5J A;  1DUG A;  2J23 A;  2OE0 A;  1S3A A;  5FT3 A;  2VCQ A;  1SK0 A;  2HE3 A;  1GTU A;  2BTO T;  4LA1 A;  1XW6 A;  3W8S A;  4OCE A;  4AKX B;  4ECB A;  1B4P A;  1YF0 A;  2FD3 A;  3MSZ A;  1HYU A;  2FY6 A;  1SYR A;  1Z7P A;  4I2U A;  1T1V A;  5IM9 A;  4EC0 A;  4HDE A;  2GQK A;  3M0F A;  4POB A;  3QOU A;  2FHE A;  1EV9 A;  1GTB A;  1BED A;  1TXU A;  1Z9H A;  2L4Q A;  3QR6 A;  4KSO A;  4IVF A;  1YDK A;  5D8I A;  1TRS A;  4KND A;  2CVB A;  3A5W A;  1TK8 B;  3UVH A;  3GH6 A;  2XBQ A;  1X9M B;  2H76 A;  1BJX A;  1OC3 A;  1R5A A;  1MDK A;  3ZYW A;  1GH2 A;  4AKI A;  1JZO A;  2BJX A;  3FKF A;  3VI5 A;  1NHO A;  1ZL9 A;  4POK A;  4ID0 A;  4ZIJ A;  1PSQ A;  3GTU B;  3FK8 A;  5CRH A;  2YJ7 A;  1W4V A;  1XWB A;  3KCM A;  2BMX A;  3O3T A;  2GDR A;  4E8E A;  2B7K A;  5CYY A;  4ACS A;  3MWH A;  3NOF A;  1MEK A;  3TGZ A;  1A2M A;  1U3A A;  1M99 A;  2V6O A;  1PMT A;  5IO2 A;  3MIX A;  3HYP A;  3VI7 A;  3UL3 A;  2GS3 A;  1V58 A;  3F4T A;  2N5B A;  3O76 A;  4ZB7 A;  3E9J B;  1ACV A;  1IYI A;  4RI6 A;  4N0Z A;  2H19 A;  2WZ9 A;  5GAN D;  5G31 A;  1MDI A;  1OKD A;  5D9W A;  4G19 A;  4GTU A;  2C3Q A;  2H1A A;  2QSI A;  3LYP A;  2IWT A;  4JRR A;  4I6X A;  1O85 A;  4ZIL A;  3GTU A;  1FO5 A;  5D9V A;  3BJ5 A;  1ZGN A;  1SL2 B;  1ML6 A;  1CQH A;  5E4W A;  4PUF C;  1XW9 A;  1OVN A;  3GNJ A;  1GSD A;  1EGO A;  2IJY A;  3H4K A;  2FWE A;  3DRN A;  3BBY A;  4ECC A;  4IS0 A;  3IC8 A;  2DKH A;  3KM6 A;  3L9S A;  4OD7 A;  4ZXG A;  3GFK A;  4ISD A;  4TXV A;  5IMC A;  4GQC A;  4J2F A;  4GDF A;  3IHQ A;  1K3Y A;  1MD4 A;  1K0B A;  4KAE A;  1RK4 A;  2YZU A;  3LXT A;  19GS A;  4PUR A;  4X4J A;  4GST A;  2MZC A;  3FR9 A;  2PVO C;  2F3M A;  1ERT A;  3CTF A;  2H1L A;  1UN2 A;  4ZB8 A;  2QKE A;  2V1M A;  4HQZ A;  3EMX A;  4L0U A;  4HU9 A;  4MA9 A;  1TI1 A;  2LRC A;  1O73 A;  1JZW A;  4TW5 A;  3F6F A;  2J9H A;  4AJ7 A;  4PQ1 A;  4OO5 A;  3GL5 A;  3TB2 A;  1FW1 A;  3CYN A;  4Z2R A;  5B8B A;  4YQM A;  1KBN A;  22GS A;  1LJR A;  5J4V A;  3PGT A;  5F0G A;  3WT1 A;  5J41 A;  3EMP A;  5JWQ B;  3QAG A;  4TR1 B;  2YP6 A;  2C3T A;  3IA1 A;  3H79 A;  2YJH A;  3TKP A;  1SKR B;  2DJK A;  3KTL A;  2H30 A;  2P31 A;  1X5E A;  5A5H B;  4K0G A;  5HFK A;  4CHS A;  3F3R A;  3FW2 A;  1Z3E A;  5DAL B;  3ZVJ A;  5H5Q A;  2NDO A;  3F4S A;  3HMJ G;  1YJ6 A;  1R4W A;  1YVL A;  3FZA A;  3TKS A;  1G0T A;  2DKI A;  3W8J A;  1MTC A;  4RQR A;  4ULX A;  2HSH A;  4QL7 A;  5C00 A;  3P8W A;  3O6T A;  3WGX A;  4IP6 A;  3IK7 A;  4G10 A;  4HJ2 A;  2H6Y A;  3E3E A;  4EL1 A;  1AQX A;  3D6I A;  2MYG A;  4K7I A;  2R2J A;  2JL4 A;  3QFB C;  3LYK A;  2PBJ A;  4ECI A;  4TR1 A;  2GT5 A;  4EO3 A;  5IMV A;  2IIY A;  4QMK A;  3HHV A;  5A4V A;  1CQG A;  2WDU A;  2RUE A;  3EVI A;  3U6V A;  1YKA A;  3IV4 A;  1F6M C;  4KDY A;  4OO4 A;  1N25 A;  3IHG A;  2K6V A;  1VF3 A;  3HVS A;  1NHY A;  2CX3 A;  6GSW A;  5G2Z A;  4YH2 A;  5A5H A;  18GS A;  4N10 A;  1YKC A;  5LNK e;  2LNS A;  5J4Y A;  1TJD A;  1I5G A;  2H8L A;  2VCW A;  2O8V B;  3HVX A;  1ON4 A;  5DAK B;  2ON5 A;  1S3C A;  4MP4 A;  3L0H A;  1SL0 B;  2H66 A;  4MPG A;  3R3E A;  4FIW A;  5IMF A;  3C8E A;  3TJF A;  4BL7 B;  5IIZ A;  2MBS A;  3KP8 A;  2P5Q A;  4HI7 A;  1U88 A;  5CAX A;  3HD5 A;  1MDJ A;  11GS A;  2OKA A;  4WF4 A;  4XS4 A;  3FZ5 A;  2WS2 A;  1QMV A;  1EGR A;  3BCK A;  1AAZ A;  4HZ4 A;  3N9J A;  5F06 A;  1XFL A;  3ED3 A;  4PNG A;  3G7Y A;  2AYT A;  4AKG A;  5DCG A;  1XIY A;  4N11 A;  3DYR A;  3I43 A;  1BG1 A;  2REM A;  3IR4 A;  1M2A A;  2FCH A;  4TR0 A;  4FYU A;  2G0F A;  2YNX A;  4AF2 A;  5IPG A;  3C1R A;  1ZYQ B;  1TK0 B;  2X8H A;  3APO A;  4IGJ A;  1J9B A;  2LEG A;  3UOM A;  1TK5 B;  1MD3 A;  1SVM A;  2L6D A;  4NXI A;  4X0X A;  5DAK A;  4F0C A;  4I8B A;  2RM6 A;  5FWG A;  1USB A;  2YWI A;  3S9F A;  1G6Y A;  4BL7 A;  2L6C A;  3DIE A;  1YQ1 A;  5G30 A;  4KW6 A;  2IME A;  3GKK A;  3HVV A;  1FVK A;  1DSB A;  1OAZ A;  3ZLP A;  1K0M A;  4PUA A;  4AJ6 A;  2YCD A;  3L4N A;  2QGV A;  3WD6 A;  1FOH A;  4TXO B;  1IYH A;  4MDC A;  2DJ2 A;  1Z6N A;  4GSS A;  2NPB A;  3EC3 A;  10GS A;  1F3A A;  3F9U A;  2C80 A;  4ZL9 A;  5FHI A;  2PGT A;  3LQ7 A;  2H73 A;  4MZC A;  1A23 A;  5COH A;  2OBK A;  1GLP A;  4KH7 A;  1B48 A;  2IMK A;  5AIV A;  5DDL A;  3HKR A;  7GSS A;  2KP1 A;  3TRX A;  2MMA A;  3Q18 A;  5F07 A;  4PXO A;  4XS6 A;  5ECM B;  2NBS A;  5CP1 A;  4EKZ A;  2LKU A;  1PX7 A;  4DVC A;  1ERU A;  2YWO A;  5B6N A;  4A5P A;  4QQ7 A;  2IMD A;  2JAD A;  4NWY A;  2GVP A;  5A4U A;  1GSE A;  1OKT A;  2LQQ A;  3D22 A;  2A2P A;  2CAI A;  3LG6 A;  4KA0 A;  1FOV A;  2WFC A;  3ERG A;  3M9J A;  1SK1 A;  3VPQ A;  3FR6 A;  4EDY A;  3KH9 A;  3C71 A;  3F63 A;  5ID2 B;  3GV1 A;  3CRU A;  3N5O A;  2B1K A;  4KDX A;  5ABR A;  2ZCT A;  4L5O A;  4NV2 A;  2PWJ A;  4GWR A;  3F3Q A;  4WBJ A;  4MF5 A;  5IQY A;  1Q98 A;  4JR4 A;  3IAS 2;  1RQM A;  3QDN A;  4POL A;  1SKW B;  2VCZ A;  2LS5 A;  2XBI A;  4G2E A;  3TUE A;  3FR3 A;  5ELG A;  3TRQ A;  1AUC A;  4IP1 A;  2H1G A;  3QD9 A;  4KF9 A;  4NMU A;  4ZBD A;  3TOT A;  3TJJ A;  5JWR B;  2CA8 A;  4O32 A;  3EPT A;  1XVW A;  4XHM A;  1YEX A;  4CY6 A;  4F2I A;  1EZK A;  1A0F A;  4V2M A;  2HSN B;  4O5Q A;  1Z6M A;  2DML A;  3KP9 A;  3LGC A;  1DBY A;  1GNE A;  3HJO A;  3IAM 2;  2FUG 2;  4MAB A;  3FZ4 A;  3A2V A;  1FB6 A;  3G7I A;  4IQ1 A;  5ID2 A;  1YEP A;  1PN0 A;  2CQ9 A;  4MJE A;  4ML6 A;  2FA8 A;  3LW9 A;  4DSQ A;  5IMZ A;  4BVX A;  2YWM A;  2X4A A;  1SL1 B;  2VLU A;  2PVQ A;  1F37 A;  1BG5 A;  2OT3 A;  1J08 A;  1J0F A;  2RII A;  3US3 A;  3IXR A;  1K0O A;  2LNT A;  3I9V 2;  2GZP A;  1Y6E A;  1W89 A;  4BWS A;  2ZUP A;  4MJC A;  1GUM A;  1SEN A;  4TR3 A;  3GUS A;  5BMU B;  6GSU A;  2G2Q A;  4MLY A;  4ZB6 A;  2VM1 A;  4LMV A;  1BF5 A;  2C0D A;  4GF0 A;  3RBT A;  4HUA A;  4ZL8 A;  3GUR A;  2HSN A;  4BA7 A;  3ERW A;  2LQO A;  2WB9 A;  4BWQ A;  1GUK A;  4V2L A;  4QL9 A;  1F2E A;  2O89 A;  2JSZ A;  5ECH B;  1VGL A;  3D0Z A;  1XXU A;  6GST A;  3KH7 A;  4WR5 A;  1GUH A;  4WR4 A;  4YKG A;  4I5Q A;  2IN3 A;  1A8L A;  4LL4 B;  2L4C A;  5J40 A;  2LJK A;  4F9Z A;  3CSJ A;  1KNG A;  3IBH A;  3PPU A;  4IQA A;  4E68 A;  3WT2 A;  3RAZ A;  5GAP D;  3Q74 A;  4MZW A;  5BMU A;  1NW2 A;  1AXD A;  1XWG A;  1N2A A;  1GTA A;  2CT6 A;  1SKS B;  5J47 A;  5A5K A;  1X9W B;  5J9C A;  2HNL A;  6GSV A;  1TDI A;  1WIK A;  4IBP A;  4OFN A;  5B6M A;  2WRT A;  1FAA A;  2RLI A;  2WGR A;  5G1L A;  4XCS A;  4N30 A;  5D9T A;  1UVZ A;  3P2A A;  2CVK A;  3WGE A;  1WPI A;  3EE2 A;  1B9X C;  2TRX A;  4Z7X A;  3QCP A;  14GS A;  1HNB A;  4MMM A;  4PQH A;  2EFH A;  1WMJ A;  4KDU A;  1E6B A;  2F9S A;  3GMF A;  1K0A A;  4HS1 A;  5HR0 A;  3CSH A;  3I6A A;  4K2D A;  2QA2 A;  2XPD A;  5IMA A;  5KN2 A;  1DE1 A;  3DVX A;  2K8S A;  1K3L A;  1B9Y C;  3PIN A;  4PNF A;  3TKQ A;  1ZZY A;  5AN1 A;  2O85 A;  4DSR A;  5ECO B;  2D2Z A;  1F3B A;  3CSI A;  2IMF A;  2H74 A;  2VD1 A;  1S3D A;  2C0F A;  4LMW A;  2LJR A;  2PMT A;  1LBK A;  2FWG A;  1SK2 A;  5H5S A;  5C04 A;  4GRF A;  1EEM A;  2H6X A;  5HR3 A;  4X1U A;  5ELA A;  4WEY A;  4TVE A;  3RHC A;  2I3Y A;  5JCW A;  2H01 A;  2CZ2 A;  3DD3 A;  2CAQ A;  2C3N A;  3EYT A;  3G7J A;  1ZYE A;  5LCZ A;  1Y25 A;  4WKW A;  4G0L A;  1V98 A;  2R3X A;  5GSS A;  4KCA A;  1TU8 A;  1X5C A;  4IHU A;  4O7H A;  3L9U A;  4JZQ A;  5ECN B;  2R5G A;  2HLS A;  2VL2 C;  4OWY A;  5ECQ B;  4ICY A;  5J9B A;  3L9V A;  2V32 A;  5CRW A;  2JZR A;  2DBC A;  3Q19 A;  2HSM B;  4HQS A;  3SWL A;  4N0V A;  1XOA A;  1SJZ A;  1V40 A;  3GKM A;  1PL1 A;  2DSA A;  4EUY A;  1GNW A;  2GTU A;  2GQM A;  4G0K A;  1VF1 A;  3IRA A;  3HJP A;  2C4J A;  1V2A A;  3KTB A;  2DJ0 A;  1PN9 A;  3LFL A;  4KUN A;  4HJM A;  2M46 A;  4DSS A;  2CVD A;  1WE0 A;  1ZCP A;  4F03 A;  1V9W A;  4XS4 B;  3DKS A;  4MNN A;  3EWL A;  4MH2 A;  4O5R A;  4EIQ A;  2CX4 A;  1TXX A;  1TW9 A;  1R26 A;  5ECR B;  2EFD A;  2KHP A;  3D21 A;  5D9X A;  4L8E A;  2P0G A;  1KTE A;  2UV8 G;  2H72 A;  2YN1 A;  1N8J A;  1EP7 A;  1XWA A;  1O8W A;  1GTI A;  2DLX A;  4RQX A;  2HSM A;  3IPZ A;  3J7Y k;  5CRE A;  2MMN A;  4FO5 A;  4LL1 B;  2VCT A;  3CRT A;  3M9K A;  3KMO A;  2KOK A;  4PQI A;  2L5L A;  1QUW A;  3KD0 A;  2VKZ G;  4GCI A;  2OAD A;  4K8M A;  2N5F A;  5J4U A;  3UBK A;  5E59 A;  4O5U A;  3E0U A;  3ISO A;  2P5R A;  5F05 A;  2O87 A;  2YAN A;  3FMW A;  2A4H A;  2XC2 A;  8GSS A;  1VRS D;  1THO A;  4L0W A;  5H5R A;  3VWW A;  3ZIV A;  1SJ6 A;  2JZS A;  2VLT A;  1FVJ A;  3GKN A;  5BRT A;  2F8A A;  1AW9 A;  4O92 A;  5DQY A;  2EFE A;  1T3B A;  4JE1 A;  3APQ A;  4W66 A;  2PUK C;  4JED A;  1GWC A;  2LRN A;  5ECP B;  3DGQ A;  2A4V A;  5HR1 A;  5G5F A;  5INY A;  4YQV A;  3D4T A;  4K7N A;  4GXZ A;  4KB3 A;  2KLX A;  2R0C A;  1YY7 A;  1O7U A;  1A2J A;  5J3R A;  2UZ8 A;  1ZMA A;  1VF2 A;  1PKW A;  3IDV A;  4MJA A;  4Z2T A;  2IPA A;  1X5D A;  3M1G A;  2H1B A;  2E7P A;  3EIN A;  3CXG A;  3FZ9 A;  2EIR A;  4RUV A;  1O6J A;  5IO0 A;  3IK9 A;  3DXB A;  4XS1 A;  1FB0 A;  3DEX A;  2ALB A;  1GSU A;  2MMO A;  2ZNM A;  2OBI A;  2TIR A;  2OA7 A;  1HQO A;  4IEL A;  1EOH A;  2HZF A;  2VM2 A;  4K9Z A;  4NHZ A;  3Q6O A;  3TCO A;  5EL8 A;  2AUV A;  1E2Y A;  2AAW A;  4J57 E;  1ZYN A;  4HOJ A;  1G6W A;  3CWG A;  2LRT A;  5A34 B;  1BQ7 A;  2XHF A;  5HFG A;  2FGX A;  2TRC P;  2I81 A;  4D73 A;  3TDG A;  3MNG A;  4MZB A;  1GSY A;  1WRY A;  2GST A;  1HD2 A;  3TKR A;  3QMX A;  2OAC A;  4EXJ A;  4PTS A;  2C0G A;  2I9H A;  1GSS A;  2VO4 A;  3HDC A;  2N5A A;  12GS A;  2ES7 A;  2H0G A;  2K18 A;  2X49 A;  5KOW A;  2JU5 A;  3UAP A;  2IL3 A;  2NVL A;  2YPM A;  3LSZ A;  4IJI A;  1NM3 A;  4TRX A;  2V41 A;  3UAR A;  1M9B A;  1TRW A;  3ZRD A;  1TTZ A;  1T8E B;  6GSS A;  3ZIT A;  4G9H A;  1OC9 B;  1GL8 A;  5DJM A;  1AQV A;  3DVW A;  3QAV A;  3PH9 A;  5B7C A;  4J56 E;  1M0U A;  3EUR A;  3D4M A;  1PQN A;  2B3S A;  1TU7 A;  1FG4 A;  4IJ3 A;  4BVX B;  5JWO B;  5ECK B;  2DIZ A;  5KEJ A;  5A34 A;  2H1D A;  4ILF A;  5CNW A;  1UA5 A;  1QXH A;  2X99 A;  2GGT A;  6GSX A;  5JCG A;  1O81 A;  3IC4 A;  3IE3 A;  2B5X A;  4XTS A;  5A1N B;  3FYG A;  1K0D A;  1G7E A;  2FWF A;  1K0C A;  3H93 A;  4WET A;  5IPH A;  5JCU A;  3UBL A;  3A3T A;  1GSQ A;  3TRP A;  3APS A;  4KE3 A;  3KGK A;  2HRF A;  1PGT A;  1PL2 A;  5A4W A;  4OMV A;  5AGY A;  3FY7 A;  4KSM A;  4EF0 A;  4XIH A;  1XCC A;  2OJL A;  1OC9 A;  3IOS A;  5CRD A;  5F8B A;  1WOU A;  3HA9 A;  3ZFB A;  1WJK A;  2GQL A;  3ME7 A;  3GYK A;  2VAF A;  1OYJ A;  3NIV A;  4FYC A;  3JCM L;  3F0I A;  5IOW A;  2H75 A;  3GX8 A;  3FRC A;  5B8A A;  4K5R A;  2H0I A;  1JZR A;  3TU3 B;  1M7T A;  5CRG A;  2GSQ A;  2EIQ A;  4OFT A;  4ML1 A;  4ECJ A;  2VIM A;  3C7M A;  1A0R P;  1AQW A;  2LUS A;  1ZOF A;  2M72 A;  5A1N A;  1O8X A;  5AIX A;  1ERV A;  3AY8 A;  2E2M A;  1B8X A;  5KN3 A;  2EC4 A;  3QFA C;  3LWA A;  2MBT A;  1U6T A;  3VWX A;  3KJY A;  2ON7 A;  3U5R E;  1GUL A;  3SBC A;  4EE0 A;  5GZZ B;  5IOX A;  2HSY A;  3ZZX A;  2AB6 A;  3UMA A;  2H0H A;  4H86 A;  5EY6 A;  1ST9 A;  4V1A p;  1XOB A;  2IFQ B;  4EVM A;  1XZO A;  1GRX A;  2AHE A;  4K7O A;  2HI7 A;  4JBB A;  5D73 A;  2O7K A;  1BX9 A;  3HCZ A;  2VUP A;  4LLR A;  4N3Z A;  3CBU A;  3CTG A;  2R0P A;  3FHK A;  2KP2 A;  1A24 A;  2DJ1 A;  3TJK A;  3WYW A;  1Q4J A;  5KN1 A;  3NZN A;  13GS A;  3TKS C;  5HQP A;  2VL3 A;  1SD9 A;  3QAW A;  3LXZ A;  4NHW A;  1SU9 A;  2FNO A;  4K2X A;  5L71 A;  1PKZ A;  1U87 A;  1ERW A;  1WWJ A;  3WGD A;  3LEF A;  2C8U A;  17GS A;  2F51 A;  2DMM A;  2GT6 A;  5KN0 A;  1DE2 A;  3M3M A;  1GP1 A;  4JR6 A;  2H71 A;  1EOG A;  1PRX A;  1ZYP A;  4OCF A;  4K1F A;  2L57 A;  4YAP A;  4NPB A;  2KUC A;  4TOP A;  4YAV A;  2IFQ A;  4K5S A;  4YKF A;  3M8N A;  3PR8 A;  2LST A;  3TOU A;  2R4V A;  1T7P B;  1T4Y A;  4POM A;  3GST A;  4ZB9 A;  3VUR A;  1U3I A;  4FYB A;  2RUF A;  2C0E A;  2K8V A;  1XWK A;  4HZ2 A;  2EIO A;  2GZY A;  3DWV A;  2GSS A;  1F9M A;  4FQU A;  1X0R A;  3LOR A;  4PGT A;  1Z5Y E;  1JLV A;  2HT9 A;  4Q5R A;  5ECI B;  4AI6 A;  1THX A;  4DEJ A;  4IN0 A;  2DJJ A;  1EV4 A;  1EP8 A;  4MCU A;  3GRX A;  1PD2 1;  5DQS A;  1AC1 A;  3RDW A;  3ERF A;  3ZRE A;  4DSS B;  3RHB A;  4MPF A;  3UJ1 A;  3G9B A;  4ZL7 A;  2FLS A;  1QK8 A;  4TKY A;  1GSF A;  5ECS A;  2HQT A;  1H4O A;  3UEM A;  4ZBB A;  4HEA 2;  2GZZ A;  1TKD B;  4USS A;  3F4R A;  5D96 A;  1WP0 A;  2HFD A;  4EIP A;  1M9A A;  1EWX A;  1M2D A;  5HR2 A;  2FWH A;  1R7H A;  4MK3 A;  2C1Y A;  2K9F A;  3A5I A;  5DJL A;  2YOI A;  2X8G A;  2EFC A;  3FEU A;  4I2T A;  2PU9 C;  5AIS A;  3EU4 A;  3MYD A;  5EPF A;  1UC7 A;  4NV5 A;  1ILO A;  3MAK A;  1SYX A;  4ZBA A;  2WJU A;  3MDK A;  2X8C A;  5EVO A;  3KEB A;  3GKX A;  4TR4 A;  2B7J A;  1VF4 A;  1SJI A;  4NAX A;  1TRV A;  1K3O A;  1TRU A;  3RPP A;  1XWC A;  2M80 A;  4RI7 A;  3ZTL A;  4E8H A;  1RW1 A;  1BAY A;  2LTK A;  2GLR A;  2A2S A;  3VLN A;  4JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...