5A5KA

Atgstf2 from arabidopsis thaliana in complex with camalexin
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
210
Chain Sequence
GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 81
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5kA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a5kA01
3BOAA 2ZUPA 5F8BA 4IJ3A 1LBKA 4I6XA 4G10A 5CRHA 1H4OA 4KGIA 1EOGA 1FOVA 5AN1A 5LNKe 2EC4A 4TVEA 5A5KA 2IMFA 7GSSA 4IQAA 3TOUA 4G0IA 5J3RA 3QAVA 3S9FA 2P5QA 5ECLB 3TJFA 5F06A 2B5EA 3UBKA 4E8HA 4K0NA 1AW9A 2WS2A 1VF4A 4KAEA 2NPBA 4K2DA 2NDOA 4YQVA 4MJAA 3I9V2 2C0GA 2H73A 3BJ5A 4PURA 2B5YA 4L5LA 3VWXA 5ECPB 5IPGA 2GSSA 4GSSA 4OMVA 1J9BA 2NVLA 3IK9A 2MZCA 3G7JA 4MF5A 2FHEA 2TRXA 3C1SA 2LRTA 2I1UA 3D0ZA 2V32A 1NSWA 4AJ6A 3HVXA 2F8AA 5DBQA 1SL1B 3IOSA 2FUG2 1X5DA 4EXJA 3FEUA 3QFAC 2P31A 4V2MA 4MP4A 5F05A 1ERVA 1FB0A 3ZIJA 4O5RA 1ZYQB 4OWYA 3KMOA 1PRXA 1EWXA 2OKAA 3CSHA 2GSRA 3TJGA 1F6MC 4MZBA 3RPPA 5CYYA 2I81A 2PVQA 4BVYA 1Z7PA 4EO3A 4KW6A 5HR3A 5KN1A 2DIYA 3LFLA 4MJBA 5INYA 1G0TA 1V58A 4PUAA 4AJ7A 5E59A 1N8JA 3D21A 1FB6A 1GUKA 2OBIA 1V2AA 4NHZA 2GZYA 5DCGA 2HZEB 1TI3A 4K6XA 5L71A 3VPQA 1M9BA 2PVOC 1GTIA 5DQYA 2FA4A 3O3TA 2B6MA 5D9TA 4BL7B 3IE3A 3GTUA 1EEMA 2OACA 2HLSA 1BAYA 1MTCA 1GNEA 4GRFA 5EY6A 1OYJA 5DDLA 6GSYA 3A2XA 3ZIVA 1YKCA 2HYXA 2TRCP 4WBJA 4MF6A 2AYTA 1TRVA 1HNAA 4MMMA 1K3OA 2FGXA 3GA4A 3BBYA 5J41A 5FT3A 2HSMA 4TW5A 2XPEA 1E2YA 4HJ2A 1QK8A 2H30A 3CXGA 2H75A 2H72A 4ISDA 1K0BA 1T4YA 1B9YC 1IYIA 4FIWA 2CV4A 5IMCA 1GWCA 2AHEA 4MJCA 2OBKA 3A2WA 2DMMA 2V2GA 2VCTA 3ZVJA 1WPIA 3IDVA 1WRYA 3TKPA 2H0GA 2PUKC 1SKSB 2H6XA 4MF7A 1S3DA 4WF4A 2PPTA 1Z3EA 2RM6A 3GSTA 4GSTA 1TK0B 2C4JA 2YWOA 5C00A 4L0WA 2AV4A 2G0FA 3TGZA 3KM6A 4BPYA 4Q5FA 2CA8A 4F2IA 1EOHA 2IMEA 2H0IA 6GSUA 2L5LA 4N10A 4J57E 1OAZA 19GSA 3FR3A 1W4VA 5COHA 3TOTA 3IRAA 3QAGA 2V6OA 3TRQA 4NPBA 1GSSA 4I8BA 2FD3A 5D93A 2IIYA 1J0FA 4O32A 5KN3A 3APSA 3FKFA 2VL9A 4JRRA 1F37A 5JCWA 5G2ZA 3GKKA 2E0QA 4WR4A 4X0XA 4GSNA 5KN2A 1TK5B 1A0RP 3APQA 1RK4A 1NM3A 3DIEA 2OADA 3KH7A 2C3NA 4KX4A 3KXOA 4KDXA 3L4NA 2B7KA 1TOFA 4ULXA 5J9BA 2JZTA 4I5QA 1R26A 4MH2A 2VCZA 4RI7A 4ZB9A 4ILFA 2LTKA 5DJLA 1GSEA 5EPFA 4HJMA 1X9MB 2GDRA 2A2RA 2IMKA 1O81A 4V1Ag 2LS5A 1YKAA 4ML6A 3CTFA 3ME7A 2VM2A 1R5PA 3WGXA 3F6FA 1FVJA 4MK3A 3LGCA 2K18A 2MYGA 1F3AA 4TRXA 1NW2A 3EC3A 2R5GA 1GSFA 3FZ5A 4BA7A 1A8LA 3DD3A 4FH8A 1JHBA 5GSSA 3Q18A 3GHAA 2L59A 3HYPA 3C71A 4HI7A 3N5OA 2CX4A 4IS0A 2PGTA 2MMAA 2HNLA 4NV2A 2L4CA 3DRNA 2Z9SA 3NOFA 1THXA 5B8AA 3C8EA 2PWJA 5CAXA 2FA8A 1JFUA 1O6JA 1A8YA 3UVTA 3VPTA 1KEBA 4IP1A 5CNWA 4MA9A 3VWUA 2VOCA 3MNGA 1MDJA 5EL8A 5ECOB 2R2JA 3HZ8A 1XWBA 3US3A 3VWVA 3L9VA 2HSYA 1ZOFA 2YWIA 1EV9A 4G19A 1GSQA 2R4VA 4HUAA 2VM1A 3LSZA 1IYHA 1URMA 5G1LA 2C8UA 2OE1A 3TKSC 4K1FA 5D9VA 3EU4A 3CTGA 14GSA 2C1YA 1M7TA 1RW1A 4HOJA 4ECBA 1EZKA 3ZZXA 3ME8A 3IC4A 5CP1A 5H5SA 2LKUA 1UVZA 3GL3A 2VL3A 1ACVA 3DXBA 2N5BA 5ECQB 1K0OA 2J9HA 2YZUA 1O8XA 3GH9A 1F9MA 5HR2A 1U3AA 5HFGA 3PINA 2DBCA 1WOUA 4BL7A 4K0GA 3KP9A 3TRXA 2YOIA 4K7NA 5FHIA 3IV4A 2JADA 1OE8A 1XPVA 3FY7A 2H6ZA 1OC3A 4BVXA 1GNWA 4DSRA 1RQMA 5ELGA 2V1MA 2GTUA 1B48A 1S3CA 3DVXA 4ZIJA 4XS4B 4TXOA 1YY7A 2H1AA 3EE2A 3HVVA 1EGOA 4WEYA 5JWOB 1DSBA 4KF9A 2BJXA 4MPGA 2B7JA 3FYGA 1ON4A 1G7OA 3C1RA 2PBJA 4PQ1A 1T7PB 2E2MA 3KEBA 1M2DA 5J5NA 3M3MA 1GLPA 3F4TA 1K0DA 3QD9A 2CZ2A 3BCIA 5DALA 3FZAA 3MWHA 2ZNMA 1M2AA 5DCHA 1NHOA 1TK8B 5CRGA 1Z7RA 3QFBC 4N11A 3ZVJD 3MAKA 2FWGA 3KD0A 2CVDA 1TU7A 1GSDA 3TKRA 4O7HA 1PL1A 1TU8A 3WGDA 2BTOT 5KEJA 3FK8A 2FWFA 16GSA 3FR6A 4RI6A 2HRKB 3ERGA 2YV9A 4Z7XA 2HSHA 1X5EA 3GH6A 2P5RA 1HNCA 2V6KA 2AUVA 4F9ZA 1B9XC 5CRDA 1K3YA 4NAXA 1SJZA 5HFIA 3E0UA 5B8BA 1DBYA 3F4SA 4N0VA 1KBNA 3QCPA 3DEXA 4PUFC 3ZMKA 3F3QA 5GSTA 3N9JA 3KTBA 2GQMA 3PGTA 2KUCA 5GZZB 1AC1A 2LJRA 4GQCA 1FW1A 3M9KA 3LYKA 4EKZA 3HHVA 1AQWA 5DAKA 1SD9A 3U5RE 1O85A 1M99A 2IL3A 3GKMA 5DJMA 5ECMB 4ID0A 1MDKA 3TKSE 4GLTA 4P3YB 4ZB8A 4Q5RA 3DGQA 2GT5A 2VLTA 3IXRA 2VCQA 1WJKA 2JZSA 2DJKA 1K0MA 1G6WA 1U87A 5HR1A 3G7IA 2C0DA 1V57A 2PN8A 1F3BA 1EGRA 5G31A 1S3AA 3GX8A 6GSWA 2ON5A 3WD6A 2RM5A 2ES7A 3Q74A 4NV5A 3I6AA 1K0AA 2C3QA 4ZBDA 1XW5A 3M9JA 1YF0A 3M0FA 2OA7A 2GVPA 4KDUA 4OFMA 3UOMA 1OC9A 4IJIA 1XBSA 4JEDA 4HS1A 5IMVA 1XCCA 2WJUA 4MJEA 3D22A 4TR0A 1A23A 1TRUA 1YZXA 4TXVA 2YWNA 2DLXA 4OO4A 2H70A 2XBQA 4D73B 1U6TA 3UL3A 1OC8A 2JU5A 3LJRA 3P90A 4ZB6A 5KN0A 1YDKA 4KSOA 2R6KA 4TN8A 2VIMA 3GFKA 2VL2A 2QGVA 4EDYA 1UC7A 3GNJA 3ZMLA 1T3BA 1ZL9A 1TXXA 3VK9A 3LXZA 1PKWA 1MEKA 1TKDB 1K3LA 2YZHA 4BVXB 2JZRA 2E2GA 5GAND 1M2BA 4TXOB 3KMNA 2JACA 4I2TA 2N5FA 4ECCA 3ZYWA 3O76A 2N5AA 3F6DA 3L0HA 1T8EB 2OE3A 1VRSD 5DQSA 3FHKA 3ERFA 3VURA 2VAFA 2HQTA 1GTBA 5HQPA 4PX1A 1PD21 1ERWA 3ZFBA 4I2UA 1I5GA 3W8SA 3P8WA 3ZREA 5DALB 4JBBA 2IN3A 4XS1A 5E4WA 5B6MA 4OFTA 4XS4A 1PKZA 1M0UA 1MDIA 4X43A 2B1LA 2GT6A 4OCFA 3QR6A 4RQXA 3W8JA 2AJQB 4EDZA 2HRNA 2AB6A 4OO5A 1AQVA 5ECIB 1DE2A 4TR4A 1AQXA 4HU7A 5IO2A 5LD0A 3HY2A 4HEA2 1PGTA 4JE1A 3PR8A 1X9SB 2HT9A 4MLYA 4ECJA 2B5XA 2M46A 1DE1A 4AGSA 5IMZA 3JCML 2O8VB 2RLIA 2IMIA 1JZDA 3WGEA 4XCSA 2PERA 1N2AA 4OFNA 1BJXA 1BQ7A 22GSA 2H71A 3F4RA 2HZFA 3V1WA 1GSYA 3ZRDA 2HRKA 5JCUA 5DAKB 4FYBA 2WFCA 1SK1A 4IELA 1TRSA 2B3SA 2LRNA 2NBSA 2RUFA 1Z9HA 4V2LA 3I43A 1XVWA 3UEMA 2LNSA 5ELAA 1BYEA 2I9HA 4F82A 3CSJA 2IFQB 5H5QA 3FZ4A 3TCOA 3HD5A 2NTOA 3HA9A 4AJ8A 4FQUA 1EV4A 1SENA 2M80A 3UJ1A 1VF1A 2LJKA 1ERUA 3TKQA 2HSNB 5LCZA 2YNXA 3SBCA 5H5RA 4QL9A 3EVIA 4IW9A 3DMLA 2YV7A 2KOKA 1WIKA 2O87A 2X64A 2HRFA 2FWEA 5BMUA 2XPDA 2GGTA 1GTUA 4AF2A 5AIVA 3DVWA 1SU9A 2CVBA 1X9WB 3EMPA 3RDWA 2VCWA 1DUGA 2EIOA 4ACSA 6GSVA 3KJYA 1HYUA 3QMXA 4MABA 4BWSA 3HJOA 4GQFA 3LORA 2EIRA 4IHUA 3HDCA 1OC9B 3CRTA 2MMNA 3KTLA 4TR1B 5FWGA 4ZL9A 5IOWA 2P0GA 1TJDA 1EP8A 4IQ1A 3TJKA 2K9FA 5IIZA 4XRDA 4HZ2A 3Q6OA 2UZ8A 1XW6A 2R37A 1TDIA 4MZCA 3PPUA 1VF2A 9GSSA 4HQZA 4IP6A 3ZLPA 4EF0A 5ENUA 4PQIA 1TP9A 3UBLA 4ZBAA 1FO5A 2DC5A 3GYKA 1TI1A 4H86A 3O6TA 2FY6A 1GL8A 1GSUA 1B4QA 2X8CA 2V41A 1QFNA 5AGYA 2WGRA 12GSA 1Y25A 2LSTA 5G5EA 1V98A 4K8MA 4YQMA 2ALBA 2MMOA 2A4VA 4D73A 2E7PA 1GULA 1A2MA 2C0EA 1V9WA 2LJAA 2H8LA 4LA1A 2DJ0A 2GLRA 1Y6EA 1PSQA 5IO0A 4GTUA 3VLNA 5IMDA 3L9SA 4ML1A 4PNFA 4PNGA 2EIQA 2YJ7A 2DSAA 2H19A 20GSA 4IVFA 2WDUA 1A2JA 1TRWA 1TW9A 4YH2A 2I4AA 1X0RA 4GXZA 4KH7A 4FYUA 2MBSA 2LQQA 2F8FA 3WYWA 1O7UA 2CT6A 2LEGA 10GSA 1LU4A 3D4MA 3LXTA 2HXKA 2CAQA 3IAM2 2F51A 5CREA 4I97A 5B7CA 2HE3A 3LYPA 3MDKA 3J7Yk 2VCVA 1OE7A 3NIVA 1PA3A 3CMIA 3F9UA 4HQSA 1ERTA 2YWMA 4NMUA 2VUPA 4KDYA 2L4QA 5F0GA 1K0NA 1QGVA 1GRXA 3G7YA 4WBRD 2H0HA 4ZL7A 1NHYA 2MMZA 18GSA 2FNOA 2VD0A 5C04A 3GURA 4J56E 1PL2A 2LV3A 4NXIA 1A0FA 2HI7A 2C0FA 1FG4A 1W89A 2CQ9A 2I3YA 1VF3A 1YEXA 1G6YA 4F0BA 2K8SA 3C73A 5IMAA 4ECIA 4WETA 1SL2B 1F2EA 2A2SA 1PQNA 2KLXA 1ILOA 1XXUA 1JZOA 5A4UA 1WMJA 1J08A 3A3TA 3TUEA 2H1GA 2L6CA 3I69A 2H66A 4ZXGA 3RHCA 1LJRA 1ABAA 5GAPD 1XIYA 3KP8A 3W6GA 2GZZA 4TKYA 4N30A 1PN9A 1YF1A 1PX6A 2VD1A 3M8NA 4LMVA 2R3XA 2IFQA 1UA5A 5IPHA 2RUEA 1SK2A 1SYRA 3IC8A 3IK7A 4MCUA 3RPNA 1R7HA 3IBHA 4HU9A 3UVHA 1JZRA 1ZGNA 3D4TA 2GQKA 4IGJA 3NZNA 2M72A 1T1VA 1QQ2A 2H6YA 3IHQA 1PMTA 1TTZA 1ZZYA 5AISA 2LNTA 1SL0B 4TOPA 1O73A 2JSZA 1Q98A 1Z6NA 5J4UA 5AIXA 4E8EA 4GCIA 1OKTA 4L5OA 4CDOA 3E3EA 4POLA 3EURA 4QL7A 4G9HA 2LQOA 1XWGA 4LL1B 2TIRA 4PQHA 4TR1A 1Z5YE 5JWRB 2AAWA 3KGKA 1M9AA 4GF0A 3TKSA 2CAIA 1QMVA 4XS6A 2D2ZA 2H1BA 2WB9A 4PGTA 4RQRA 3D6IA 3IA1A 1UN2A 2IJYA 2VO4A 4QQ7A 3HXSA 3L78A 5IOXA 5JWQB 1SKWB 5CRWA 4KE3A 4NHWA 4LL4B 3G9BA 4N0ZA 1XWCA 3F0IA 1SJ6A 2OE0A 1ML6A 2L5OA 1R4WA 3DKSA 2F3MA 2VLUA 4MDCA 4IBPA 4F0CA 3U6VA 1R5AA 4HDEA 1GP1A 2QKEA 4DEJA 4YAVA 1MD4A 8GSSA 4ZBBA 2DJJA 3GV1A 4MZWA 17GSA 3VI7A 2G2QA 1BX9A 1EEJA 4KB3A 3L9UA 3ISOA 1KNGA 4O92A 2QSIA 2H01A 4KA0A 3HKRA 4K7OA 1H75A 4ZL8A 1GUHA 4BWQA 1Q4JA 4YQUA 3P7XA 4X1UA 4GWRA 4IN0A 3P2AA 1YQ1A 3GRXA 1QXHA 2B1KA 4ZILA 1JLWA 1X5CA 2RIIA 1XWKA 3F3RA 2DMLA 2GS3A 1ZCPA 5ID2B 1HQOA 3BCKA 3A5WA 4DVCA 1I9DA 4Q5NA 2JSYA 1AIUA 4KCAA 3FRCA 5CO3A 3A2VA 3GMFA 1FAAA 4EVMA 4L8EA 5ECRB 3EINA 1U88A 11GSA 3AY8A 1VGLA 1ZYEA 2O7KA 5G5FA 3C7MA 6GSTA 3CRUA 3H1NA 3QOUA 3H8QA 4DSSA 1WP0A 4V1Ap 4J2FA 4POMA 3H79A 5ECNB 3HJMA 3R3EA 2YPMA 4EL1A 4CHSA 3FW2A 5ECHB 2H74A 5D9XA 2GSQA 2J23A 3LWAA 2YANA 3HJPA 2X99A 1AXDA 3GKNA 2YN1A 3GL5A 4POBA 1SKRB 2IMDA 5F07A 1E6BA 2BMXA 5ECSA 2HFDA 4EC0A 4L0UA 1XZOA 3VI5A 3TJBA 3UMAA 5J9CA 4MH3A 4POKA 1Z6MA 1USBA 3H93A 3VFIA 1SK0A 5D8IA 4OCEA 2LUSA 13GSA 2C3TA 4WF5A 5IQYA 2K6VA 4USSA 3TB2A 2DJ3A 4CW9A 2KP2A 4NWYA 3BD2A 1HNBA 2WULA 3ZITA 2LRCA 1SYXA 5G1KA 1AUCA 2ZCTA 3DYRA 3HCZA 3UAPA 6GSXA 5D9WA 5G30A 3TRPA 1XW9A 2GZPA 3APOA 2O85A 3EU3A 3KZQA 4PTSA 3QAWA 2K8VA 1BEDA 3EWLA 1GTAA 3UIWA 3GN3A 5D73A 4K9ZA 2REMA 5EVOA 3ERWA 1B8XA 1T4ZA 1JZWA 5B6NA 2IWTA 2YJHA 4XTSA 3CBUA 2IPAA 1WWJA 3IPZA 1PX7A 2JL4A 1THOA 2XHFA 1JLVA 3GKXA 4HZ4A 1QUWA 4JR6A 1CQHA 1WE0A 3RAZA 2YP6A 3J7Yb 3IR4A 3VWWA 1KTEA 4BVYB 5ECKB 3E9JB 2XC2A 1MD3A 1YEPA 2L6DA 3TJJA 2X8GA 4KSMA 2WCIA 4F03A 3FZ9A 1G7EA 3QPMA 2DJ2A 3GX0A 5A4WA 3ZTLA 4OD7A 2ON7A 2FCHA 4WR5A 3GUSA 1AAZA 2DIZA 4FO5A 3ED3A 3EMXA 2YCDA 4KUNA 4XHMA 3EYTA 1V40A 1SD8A 3GTUB 3LQ7A 3KCMA 1XOAA 2FLSA 5A4VA 2CZ3A 3CYNA 2DJ1A 2X8HA 2WRTA 1C72A 3TDGA 3GIXA 4RUVA 1EP7A 4WXTA 2MBTA 3LEFA 4TR3A 5IM9A 1YJ6A 1OKDA 2GQLA 3UARA 3KIJA 3MSZA 1K0CA 2HSMB 4MPFA 4EUYA 2HZEA 4KCEA 5D96A 2VL2C 3HZ4A 1GUMA 2L57A 1A24A 3WT1A 3KH9A 4XIHA 3WT2A 2FWHA 2CVKA 3H4KA 1FHEA 3RBTA 1ST9A 3K8NA 3RHBA 5HR0A 5JCGA 3F63A 4G0KA 1BG5A 4EE0A 3QDNA 4Q5QA 4YAPA 2KHPA 4JZQA 2F9SA 2O89A 3LG6A 5IMFA 1T00A 1ZMAA 4IKHA 3CSIA 5DVBA 1O8WA 4DSSB 3SWLA 1HD2A 3ZL5A 1U3IA 2C80A 2CX3A 3FR9A 6GSSA 4V2NA 4JR4A 3F8UA 3DWVA 5ID2A 4FYCA 3HVSA 4KNDA 3D5JA 4XRAA 5ABRA 2HRAA 3M1GA 2XBIA 3ZFLA 3R2QA 2H1DA 1OVNA 4LLRA 2H76A 4PXOA 3PH9A 3IAS2 4G2EA 1CQGA 1FVKA 2PMTA 1A2LA 2KP1A 4LMWA 4JU5A 2GSTA 1XOBA 1GH2A 1XFLA 5HFKA 4G0LA 1XVQA 3Q19A 2PU9C 2VLVA 1XWAA 4WKWA 2WZ9A 1B4PA 3GSSA 2QC7A 4K7IA 2VCXA 2OJLA 4DSQA 1GLQA 1SJIA 3OR5A
chains in the Genus database with same CATH superfamily
3BOAA 2ZUPA 5F8BA 4IJ3A 1LBKA 4I6XA 4G10A 5CRHA 1H4OA 4KGIA 1EOGA 1FOVA 5AN1A 5LNKe 2EC4A 4TVEA 5A5KA 2IMFA 7GSSA 4IQAA 3TOUA 4G0IA 5J3RA 3QAVA 3S9FA 2P5QA 5ECLB 3TJFA 5F06A 2B5EA 3UBKA 4E8HA 4K0NA 1YVLA 1AW9A 2WS2A 1VF4A 4KAEA 2NPBA 4K2DA 2NDOA 4YQVA 4MJAA 3I9V2 2C0GA 2H73A 3BJ5A 4PURA 2B5YA 4L5LA 3VWXA 5ECPB 5IPGA 2GSSA 1Y1UA 4GSSA 4OMVA 1J9BA 2NVLA 3IK9A 2MZCA 3G7JA 4MF5A 2FHEA 2TRXA 3C1SA 2LRTA 2I1UA 3D0ZA 2V32A 1NSWA 4AJ6A 3HVXA 1PN0A 2F8AA 5DBQA 1SL1B 3IOSA 2FUG2 1X5DA 4EXJA 3FEUA 3QFAC 2P31A 4V2MA 4MP4A 5F05A 1ERVA 3FMWA 1TXUA 1FB0A 3ZIJA 4O5RA 1ZYQB 4OWYA 3KMOA 1PRXA 1EWXA 2OKAA 3CSHA 2GSRA 3TJGA 1FOHA 1F6MC 4MZBA 1S4BP 3RPPA 5CYYA 2I81A 2PVQA 4BVYA 1Z7PA 4EO3A 4KW6A 5HR3A 5KN1A 2DIYA 3LFLA 4MJBA 5INYA 1G0TA 1V58A 4PUAA 4AJ7A 5E59A 1N8JA 3D21A 1FB6A 1GUKA 2OBIA 1V2AA 4NHZA 2GZYA 5DCGA 2HZEB 1TI3A 4K6XA 5L71A 3VPQA 1M9BA 2PVOC 1GTIA 5DQYA 2FA4A 3O3TA 2B6MA 5KOXA 5D9TA 4BL7B 3IE3A 3GTUA 1EEMA 2OACA 2HLSA 1BAYA 1MTCA 1GNEA 4GRFA 5EY6A 1OYJA 5DDLA 6GSYA 3A2XA 3ZIVA 1YKCA 2HYXA 2TRCP 4WBJA 4MF6A 2AYTA 1TRVA 1HNAA 4MMMA 1K3OA 2FGXA 3GA4A 3BBYA 5J41A 5FT3A 2HSMA 4TW5A 2XPEA 1E2YA 4HJ2A 1QK8A 2H30A 3CXGA 2H75A 2H72A 4ISDA 1K0BA 1T4YA 1B9YC 1IYIA 4FIWA 2CV4A 5IMCA 1GWCA 2AHEA 4MJCA 2OBKA 3A2WA 2DMMA 2V2GA 2VCTA 3ZVJA 1WPIA 3IDVA 1WRYA 3TKPA 2H0GA 2PUKC 1SKSB 2H6XA 4MF7A 1S3DA 4WF4A 2PPTA 5J40A 1Z3EA 2RM6A 3GSTA 4GSTA 1TK0B 2C4JA 2YWOA 5C00A 4L0WA 2AV4A 2G0FA 3TGZA 3KM6A 4BPYA 4Q5FA 2CA8A 4F2IA 1EOHA 2IMEA 2H0IA 3RFRC 6GSUA 2L5LA 4N10A 2R0GA 4J57E 1OAZA 19GSA 3FR3A 1W4VA 5COHA 3TOTA 3IRAA 3QAGA 2V6OA 3TRQA 4NPBA 1GSSA 4I8BA 2FD3A 5D93A 2IIYA 1J0FA 4O32A 5KN3A 3APSA 3FKFA 2VL9A 2EFCA 4JRRA 2EFEA 1F37A 4G01A 5JCWA 5G2ZA 3GKKA 2E0QA 4WR4A 4X0XA 4GSNA 5KN2A 1TK5B 1A0RP 3APQA 1RK4A 1NM3A 3DIEA 3IHGA 2OADA 1M3IA 3KH7A 2C3NA 4KX4A 3KXOA 4KDXA 3L4NA 2B7KA 1TOFA 4ULXA 5J9BA 2JZTA 2H1LA 4I5QA 1R26A 4MH2A 2VCZA 4RI7A 4ZB9A 4X4JA 4ILFA 2LTKA 5DJLA 1GSEA 5EPFA 4HJMA 1X9MB 2GDRA 2A2RA 2IMKA 1O81A 4V1Ag 2LS5A 1YKAA 4ML6A 3CTFA 3ME7A 3CWGA 2VM2A 1R5PA 1ZYNA 3WGXA 3F6FA 1FVJA 4MK3A 3LGCA 2K18A 2MYGA 1F3AA 4TRXA 1NW2A 3EC3A 2R5GA 1GSFA 3FZ5A 4BA7A 4AKGA 1A8LA 3DD3A 4FH8A 1JHBA 5GSSA 3Q18A 3GHAA 2L59A 3HYPA 3C71A 4HI7A 3N5OA 2CX4A 4IS0A 2PGTA 2MMAA 2HNLA 4NV2A 2L4CA 3DRNA 2Z9SA 3NOFA 1THXA 5B8AA 3C8EA 2PWJA 5CAXA 2FA8A 1JFUA 1O6JA 1A8YA 3UVTA 3VPTA 1KEBA 4IP1A 5CNWA 4MA9A 3VWUA 2VOCA 3MNGA 1MDJA 5EL8A 5ECOB 2R2JA 3HZ8A 1XWBA 3US3A 3VWVA 3L9VA 2HSYA 1ZOFA 2YWIA 1EV9A 4G19A 1GSQA 2R4VA 4HUAA 2VM1A 3LSZA 1IYHA 1URMA 5G1LA 2C8UA 2OE1A 2WVYA 4K1FA 3TKSC 5D9VA 3EU4A 3CTGA 14GSA 2C1YA 1M7TA 1RW1A 4HOJA 4ECBA 1EZKA 3ZZXA 3ME8A 3IC4A 5CP1A 5H5SA 2LKUA 1UVZA 3GL3A 2VL3A 1ACVA 3DXBA 2N5BA 5ECQB 1K0OA 2J9HA 2YZUA 1O8XA 3GH9A 4K5SA 1F9MA 5HR2A 1U3AA 5HFGA 3PINA 2DBCA 1WOUA 4BL7A 4K0GA 3KP9A 3TRXA 2YOIA 4E68A 4K7NA 5FHIA 3IV4A 2JADA 1OE8A 1XPVA 3FY7A 2H6ZA 1OC3A 4BVXA 1GNWA 4DSRA 1RQMA 5ELGA 2V1MA 2GTUA 1B48A 1S3CA 3DVXA 4ZIJA 4XS4B 4TXOA 1YY7A 2H1AA 3EE2A 3HVVA 1EGOA 3HMJG 4WEYA 5JWOB 1DSBA 4KF9A 2BJXA 4MPGA 2B7JA 3FYGA 1ON4A 1G7OA 3C1RA 2PBJA 4PQ1A 1T7PB 2E2MA 5A1NB 3KEBA 1M2DA 5J5NA 3M3MA 1GLPA 3F4TA 1K0DA 3QD9A 2CZ2A 3BCIA 5DALA 3FZAA 3MWHA 2ZNMA 1M2AA 4HSCX 5DCHA 1NHOA 1TK8B 5CRGA 1Z7RA 3QFBC 4N11A 3ZVJD 3MAKA 2FWGA 3KD0A 2CVDA 1TU7A 1GSDA 3TKRA 4O7HA 1PL1A 1TU8A 3WGDA 2BTOT 5KEJA 3FK8A 2WW2A 2FWFA 16GSA 3FR6A 4RI6A 2HRKB 3ERGA 2YV9A 4Z7XA 2HSHA 1X5EA 3GH6A 2P5RA 1HNCA 2V6KA 2AUVA 4F9ZA 1B9XC 5CRDA 1K3YA 4NAXA 1SJZA 5HFIA 3E0UA 5B8BA 1DBYA 3F4SA 4N0VA 1KBNA 3QCPA 3DEXA 4PUFC 3ZMKA 3F3QA 5GSTA 3N9JA 3KTBA 2EFDA 2GQMA 3PGTA 2KUCA 5GZZB 3CHXC 1AC1A 2LJRA 4GQCA 1FW1A 3M9KA 3LYKA 2R0CA 4EKZA 3HHVA 1AQWA 5DAKA 1SD9A 3U5RE 1O85A 1M99A 4N3ZA 2IL3A 3GKMA 5DJMA 5ECMB 4ID0A 1MDKA 3TKSE 4GLTA 4P3YB 4ZB8A 4Q5RA 3DGQA 2GT5A 2VLTA 3IXRA 2VCQA 1WJKA 2JZSA 2DJKA 1K0MA 1G6WA 1U87A 5HR1A 3G7IA 2C0DA 1V57A 2PN8A 1F3BA 1EGRA 5G31A 1S3AA 3GX8A 6GSWA 2ON5A 3WD6A 2RM5A 2ES7A 3Q74A 4CY8A 4NV5A 3I6AA 1K0AA 2C3QA 4ZBDA 1XW5A 3M9JA 1YF0A 3M0FA 1SVOA 2OA7A 2GVPA 4KDUA 4OFMA 3UOMA 1OC9A 4IJIA 1XBSA 4JEDA 4HS1A 5IMVA 1XCCA 1M3JA 2WJUA 4MJEA 3D22A 4TR0A 1A23A 1TRUA 1YZXA 4TXVA 2YWNA 2DLXA 4OO4A 2H70A 2XBQA 4D73B 1U6TA 3UL3A 1OC8A 2JU5A 3LJRA 3P90A 4ZB6A 4K2XA 5KN0A 1YDKA 4KSOA 3MYDA 2R6KA 4TN8A 2VIMA 3GFKA 2VL2A 2QGVA 4EDYA 1UC7A 3GNJA 3ZMLA 1T3BA 1ZL9A 1TXXA 3VK9A 3LXZA 1PKWA 1MEKA 1TKDB 1K3LA 2YZHA 4BVXB 2JZRA 2E2GA 4A5PA 5GAND 1M2BA 4TXOB 3KMNA 2JACA 2WVXA 2X49A 4I2TA 1BG1A 2N5FA 4ECCA 3ZYWA 3O76A 4PHZC 2N5AA 3F6DA 3L0HA 1T8EB 2OE3A 4K5RA 1VRSD 5DQSA 3FHKA 3ERFA 3VURA 2VAFA 2HQTA 1GTBA 2DKHA 5HQPA 4PX1A 1PD21 1ERWA 3ZFBA 4I2UA 1I5GA 3W8SA 3P8WA 3ZREA 4Z2UA 5DALB 4JBBA 2IN3A 4XS1A 5E4WA 5B6MA 4OFTA 4XS4A 1PKZA 1M0UA 1MDIA 4X43A 2B1LA 2GT6A 4OCFA 3QR6A 4RQXA 3W8JA 2AJQB 4EDZA 2HRNA 2AB6A 4OO5A 1AQVA 5ECIB 1DE2A 4TR4A 1AQXA 4O5QA 4HU7A 5IO2A 5LD0A 5A1NA 3HY2A 4HEA2 1PGTA 4JE1A 3PR8A 1X9SB 2HT9A 4MLYA 4ECJA 2B5XA 2M46A 1DE1A 4AGSA 5IMZA 3JCML 2O8VB 2RLIA 2IMIA 1JZDA 3WGEA 4XCSA 2PERA 3EPTA 1N2AA 4OFNA 1BJXA 1BQ7A 22GSA 2H71A 3F4RA 2HZFA 3V1WA 1GSYA 2EFHA 3ZRDA 2HRKA 5JCUA 5DAKB 4FYBA 2WFCA 1SK1A 4IELA 1TRSA 2B3SA 2LRNA 2NBSA 2RUFA 1Z9HA 4V2LA 4YKFA 3I43A 5J4VA 1XVWA 3UEMA 2LNSA 5ELAA 1BYEA 2I9HA 4F82A 3CSJA 2IFQB 5H5QA 3FZ4A 3TCOA 3HD5A 2NTOA 3HA9A 4AJ8A 4FQUA 1EV4A 1SENA 4CY6A 2M80A 3UJ1A 1VF1A 2LJKA 1ERUA 3TKQA 2HSNB 5LCZA 2YNXA 3SBCA 5H5RA 4QL9A 1BF5A 3EVIA 4IW9A 3DMLA 2YV7A 2KOKA 1WIKA 2O87A 2X64A 2HRFA 2FWEA 5BMUA 2XPDA 2GGTA 1GTUA 4AF2A 5AIVA 3DVWA 1SU9A 2QA2A 2CVBA 1X9WB 3EMPA 3RDWA 2VCWA 1DUGA 2EIOA 4ACSA 6GSVA 3KJYA 1XG8A 1HYUA 3QMXA 4MABA 4BWSA 3HJOA 5A5HA 4GQFA 3LORA 2EIRA 4IHUA 3HDCA 1OC9B 3CRTA 2MMNA 4EIQA 3KTLA 4TR1B 5FWGA 4ZL9A 5IOWA 2P0GA 1TJDA 1EP8A 4IQ1A 3TJKA 2K9FA 5IIZA 4XRDA 4HZ2A 3Q6OA 2WVZA 2UZ8A 1XW6A 2R37A 3CQFA 1TDIA 4MZCA 3PPUA 1VF2A 4FXYP 2UV8G 9GSSA 4HQZA 4IP6A 3ZLPA 4EF0A 4MNNA 5ENUA 4PQIA 1TP9A 3UBLA 4ZBAA 1FO5A 2DC5A 3GYKA 1TI1A 4H86A 3O6TA 2FY6A 1GL8A 1GSUA 1B4QA 2X8CA 2V41A 1QFNA 5AGYA 2WGRA 12GSA 1Y25A 2LSTA 2WVXB 5G5EA 1V98A 4K8MA 4YQMA 2ALBA 2MMOA 2A4VA 4D73A 2E7PA 1SVLA 1GULA 1A2MA 4QMKA 2C0EA 1V9WA 2LJAA 2H8LA 4LA1A 2DJ0A 2GLRA 1Y6EA 1PSQA 5IO0A 4GTUA 3VLNA 5IMDA 3L9SA 4ML1A 4YKGA 4PNFA 2WW1A 4PNGA 2EIQA 2YJ7A 2DSAA 2H19A 20GSA 4IVFA 2R0PA 2WDUA 1A2JA 1TRWA 1TW9A 4YH2A 2WW0A 2I4AA 1X0RA 4GXZA 4KH7A 4FYUA 2MBSA 2LQQA 2F8FA 3WYWA 1O7UA 2CT6A 2LEGA 10GSA 1LU4A 3D4MA 2WW3A 3LXTA 2HXKA 2CAQA 4ICYA 3IAM2 2F51A 2QA1A 5CREA 4I97A 5B7CA 2HE3A 3LYPA 3MDKA 3J7Yk 2VCVA 1OE7A 3NIVA 5J4YA 1PA3A 3CMIA 2O3EA 3F9UA 4HQSA 1ERTA 2YWMA 2VKZG 4NMUA 2VUPA 4KDYA 2L4QA 5F0GA 1K0NA 1QGVA 1GRXA 3G7YA 4WBRD 2H0HA 4ZL7A 1NHYA 2MMZA 18GSA 2FNOA 2VD0A 5C04A 3GURA 4J56E 1PL2A 4AKIA 2LV3A 4NXIA 1A0FA 2HI7A 2C0FA 1FG4A 1W89A 2CQ9A 2I3YA 1VF3A 1YEXA 1G6YA 4F0BA 2K8SA 3HVNA 3C73A 5IMAA 4ECIA 4WETA 1SL2B 1F2EA 2A2SA 1PQNA 2KLXA 1ILOA 1XXUA 1JZOA 5A4UA 1WMJA 2OT3A 4O5UA 1J08A 3A3TA 3TUEA 2H1GA 2L6CA 3I69A 2H66A 5BMUB 4ZXGA 3RHCA 1LJRA 1ABAA 5GAPD 1XIYA 3KP8A 3W6GA 2GZZA 3A5IA 4TKYA 4N30A 1PN9A 1YF1A 1PX6A 2VD1A 5A5HB 3M8NA 4LMVA 2R3XA 2IFQA 1UA5A 5IPHA 2RUEA 1SK2A 1SYRA 3IC8A 3IK7A 4MCUA 3RPNA 1N25A 1R7HA 3IBHA 2HSNA 4HU9A 3UVHA 1JZRA 1ZGNA 3D4TA 2GQKA 4IGJA 3NZNA 2M72A 1T1VA 1QQ2A 4PI0C 2H6YA 3IHQA 1PMTA 1TTZA 1ZZYA 5AISA 2LNTA 1SL0B 4TOPA 1O73A 2JSZA 1Q98A 1Z6NA 5J4UA 5AIXA 4E8EA 4GCIA 1OKTA 4L5OA 4CDOA 1I1IP 3E3EA 4POLA 3EURA 4QL7A 4G9HA 2LQOA 1XWGA 4LL1B 2TIRA 4PQHA 4TR1A 1Z5YE 5JWRB 2AAWA 3KGKA 1M9AA 4GF0A 3TKSA 3TU3B 2CAIA 1QMVA 4XS6A 2D2ZA 2H1BA 2WB9A 4PGTA 4RQRA 3D6IA 3IA1A 1UN2A 2IJYA 2VO4A 4AKHA 4QQ7A 3HXSA 4PI2C 3L78A 1ZYPA 5IOXA 5A34B 5JWQB 1SKWB 5CRWA 4KE3A 4NHWA 4LL4B 3G9BA 4N0ZA 1XWCA 3F0IA 1SJ6A 2OE0A 1ML6A 2L5OA 1R4WA 4W66A 3DKSA 2F3MA 2VLUA 4MDCA 4IBPA 4F0CA 3U6VA 5BRTA 1R5AA 4HDEA 1GP1A 2QKEA 1PFOA 4DEJA 4YAVA 1MD4A 8GSSA 4ZBBA 2DJJA 3GV1A 4MZWA 17GSA 3VI7A 2G2QA 1BX9A 1EEJA 4KB3A 3L9UA 3ISOA 1KNGA 4O92A 2QSIA 2H01A 4KA0A 3HKRA 4K7OA 1H75A 4ZL8A 1GUHA 4BWQA 1Q4JA 4YQUA 3P7XA 4X1UA 4GWRA 4IN0A 3P2AA 1YQ1A 3GRXA 1QXHA 2B1KA 4ZILA 1JLWA 1X5CA 2RIIA 1XWKA 3F3RA 2DMLA 2GS3A 1ZCPA 5ID2B 1HQOA 3BCKA 3A5WA 1YEWC 1S3RA 4DVCA 2WZSA 1I9DA 4Q5NA 2JSYA 1AIUA 4KCAA 3FRCA 5CO3A 4Z2TA 3A2VA 3GMFA 1FAAA 4EVMA 4L8EA 5ECRB 3EINA 1U88A 11GSA 3AY8A 1VGLA 1ZYEA 2O7KA 5G5FA 3C7MA 6GSTA 3CRUA 3H1NA 3QOUA 3H8QA 4DSSA 1WP0A 4V1Ap 4J2FA 4POMA 3H79A 5ECNB 3HJMA 3R3EA 2YPMA 4EL1A 4CHSA 3FW2A 5ECHB 2H74A 5D9XA 2GSQA 2J23A 3LWAA 2YANA 3HJPA 2X99A 1AXDA 3GKNA 2YN1A 3GL5A 4POBA 1SKRB 2IMDA 5F07A 1E6BA 2BMXA 5ECSA 2HFDA 4EC0A 4L0UA 1XZOA 3VI5A 3TJBA 3UMAA 3MIXA 5J9CA 4MH3A 4POKA 1Z6MA 1USBA 3H93A 4AKXB 2O36A 3VFIA 1SK0A 2DKIA 5D8IA 4OCEA 2LUSA 13GSA 2C3TA 4WF5A 4EIPA 5IQYA 2K6VA 4USSA 3TB2A 2X4AA 2DJ3A 4CW9A 2KP2A 4NWYA 3BD2A 1HNBA 2WULA 3ZITA 2LRCA 1SYXA 5G1KA 1AUCA 2ZCTA 3DYRA 3HCZA 3UAPA 5KOWA 6GSXA 5D9WA 5G30A 3TRPA 1XW9A 2GZPA 3APOA 2O85A 3EU3A 3KZQA 4PTSA 3QAWA 2K8VA 4BIKA 1BEDA 3EWLA 1GTAA 3UIWA 3GN3A 5D73A 4K9ZA 2REMA 5EVOA 3ERWA 1B8XA 1T4ZA 1JZWA 5B6NA 2IWTA 2YJHA 4XTSA 3CBUA 2IPAA 1WWJA 3IPZA 1PX7A 2JL4A 1THOA 2XHFA 1JLVA 3GKXA 4HZ4A 1QUWA 4JR6A 1CQHA 1WE0A 3RAZA 2YP6A 4GDFA 3J7Yb 3IR4A 3VWWA 1KTEA 4BVYB 5ECKB 3E9JB 2XC2A 1MD3A 1YEPA 2L6DA 3TJJA 2X8GA 4KSMA 2WCIA 4F03A 3FZ9A 1G7EA 3QPMA 2DJ2A 3GX0A 5A4WA 1SVMA 3ZTLA 4OD7A 2ON7A 4ZB7A 2FCHA 4WR5A 3GUSA 1AAZA 2DIZA 4FO5A 3ED3A 3EMXA 2YCDA 4KUNA 4XHMA 3EYTA 1V40A 1SD8A 3GTUB 3LQ7A 3KCMA 1XOAA 2FLSA 5A4VA 2CZ3A 3CYNA 2DJ1A 2X8HA 2WRTA 1C72A 3TDGA 3GIXA 4RUVA 4AI6A 1EP7A 4WXTA 2MBTA 5A34A 3LEFA 4TR3A 5IM9A 1YJ6A 1OKDA 2GQLA 3UARA 3KIJA 3MSZA 2O5VA 1K0CA 2HSMB 4MPFA 4EUYA 2HZEA 4KCEA 5D96A 2VL2C 3HZ4A 1GUMA 2L57A 1A24A 3WT1A 2A2PA 3KH9A 4XIHA 3WT2A 2FWHA 2CVKA 3H4KA 1FHEA 3RBTA 1ST9A 3K8NA 3RHBA 5HR0A 5JCGA 3F63A 4G0KA 1BG5A 4EE0A 3QDNA 4Q5QA 4YAPA 2KHPA 4JZQA 2F9SA 2O89A 3LG6A 5IMFA 1T00A 1ZMAA 3LW9A 4IKHA 3CSIA 5DVBA 1O8WA 4DSSB 3SWLA 1HD2A 3ZL5A 1U3IA 2C80A 2CX3A 3FR9A 4Z2RA 2A4HA 6GSSA 4V2NA 4JR4A 3F8UA 3DWVA 5ID2A 4FYCA 3HVSA 4KNDA 3D5JA 4XRAA 5ABRA 2HRAA 3M1GA 2XBIA 3ZFLA 3R2QA 2H1DA 1OVNA 4LLRA 2H76A 4PXOA 3PH9A 3IAS2 4G2EA 1CQGA 1FVKA 2PMTA 1A2LA 5J47A 2KP1A 4LMWA 3RGBC 4JU5A 2GSTA 1XOBA 1GH2A 1XFLA 5HFKA 4G0LA 1XVQA 3Q19A 2PU9C 2VLVA 1XWAA 4WKWA 2WZ9A 1B4PA 3GSSA 2QC7A 4K7IA 2VCXA 2OJLA 4DSQA 1GLQA 1SJIA 3OR5A
chains in the Genus database with same CATH topology
3BOAA 2ZUPA 5F8BA 4IJ3A 1LBKA 4I6XA 4G10A 5CRHA 1H4OA 4KGIA 1EOGA 1FOVA 5AN1A 5LNKe 2EC4A 4TVEA 5A5KA 2IMFA 7GSSA 4IQAA 3TOUA 4G0IA 5J3RA 3QAVA 3S9FA 2P5QA 5ECLB 3TJFA 5F06A 2B5EA 3UBKA 4E8HA 4K0NA 1YVLA 1AW9A 2WS2A 1VF4A 4KAEA 2NPBA 4K2DA 2NDOA 4YQVA 4MJAA 3I9V2 2C0GA 2H73A 3BJ5A 4PURA 2B5YA 4L5LA 3VWXA 5ECPB 5IPGA 2GSSA 1Y1UA 4GSSA 4OMVA 1J9BA 2NVLA 3IK9A 2MZCA 3G7JA 4MF5A 2FHEA 2TRXA 3C1SA 2LRTA 2I1UA 3D0ZA 2V32A 1NSWA 4AJ6A 3HVXA 1PN0A 2F8AA 5DBQA 1SL1B 3IOSA 2FUG2 1X5DA 4EXJA 3FEUA 3QFAC 2P31A 4V2MA 4MP4A 5F05A 1ERVA 3FMWA 1TXUA 1FB0A 3ZIJA 4O5RA 1ZYQB 4OWYA 3KMOA 1PRXA 1EWXA 2OKAA 3CSHA 2GSRA 3TJGA 1FOHA 1F6MC 4MZBA 3RPPA 5CYYA 2I81A 2PVQA 4BVYA 1Z7PA 4EO3A 4KW6A 5HR3A 5KN1A 2DIYA 3LFLA 4MJBA 5INYA 1G0TA 1V58A 4PUAA 4AJ7A 5E59A 1N8JA 3D21A 1FB6A 1GUKA 2OBIA 1V2AA 4NHZA 2GZYA 5DCGA 2HZEB 1TI3A 4K6XA 5L71A 3VPQA 1M9BA 2PVOC 1GTIA 5DQYA 2FA4A 3O3TA 2B6MA 5KOXA 5D9TA 4BL7B 3IE3A 3GTUA 1EEMA 2OACA 2HLSA 1BAYA 1MTCA 1GNEA 4GRFA 5EY6A 1OYJA 5DDLA 6GSYA 3A2XA 3ZIVA 1YKCA 2HYXA 2TRCP 4WBJA 4MF6A 2AYTA 1TRVA 1HNAA 4MMMA 1K3OA 2FGXA 3GA4A 3BBYA 5J41A 5FT3A 2HSMA 4TW5A 2XPEA 1E2YA 4HJ2A 1QK8A 2H30A 3CXGA 2H75A 2H72A 4ISDA 1K0BA 1T4YA 1B9YC 1IYIA 4FIWA 2CV4A 5IMCA 1GWCA 2AHEA 4MJCA 2OBKA 3A2WA 2DMMA 2V2GA 2VCTA 3ZVJA 1WPIA 3IDVA 1WRYA 3TKPA 2H0GA 2PUKC 1SKSB 2H6XA 4MF7A 1S3DA 4WF4A 2PPTA 5J40A 1Z3EA 2RM6A 3GSTA 4GSTA 1TK0B 2C4JA 2YWOA 5C00A 4L0WA 2AV4A 2G0FA 3TGZA 3KM6A 4BPYA 4Q5FA 2CA8A 4F2IA 1EOHA 2IMEA 2H0IA 6GSUA 2L5LA 4N10A 2R0GA 4J57E 1OAZA 19GSA 3FR3A 1W4VA 5COHA 3TOTA 3IRAA 3QAGA 2V6OA 3TRQA 4NPBA 1GSSA 4I8BA 2FD3A 5D93A 2IIYA 1J0FA 4O32A 5KN3A 3APSA 3FKFA 2VL9A 2EFCA 4JRRA 2EFEA 1F37A 4G01A 5JCWA 5G2ZA 3GKKA 2E0QA 4WR4A 4X0XA 4GSNA 5KN2A 1TK5B 1A0RP 3APQA 1RK4A 1NM3A 3DIEA 3IHGA 2OADA 3KH7A 2C3NA 4KX4A 3KXOA 4KDXA 3L4NA 2B7KA 1TOFA 4ULXA 5J9BA 2JZTA 2H1LA 4I5QA 1R26A 4MH2A 2VCZA 4RI7A 4ZB9A 4X4JA 4ILFA 2LTKA 5DJLA 1GSEA 5EPFA 4HJMA 1X9MB 2GDRA 2A2RA 2IMKA 1O81A 4V1Ag 2LS5A 1YKAA 4ML6A 3CTFA 3ME7A 3CWGA 2VM2A 1R5PA 1ZYNA 3WGXA 3F6FA 1FVJA 4MK3A 3LGCA 2K18A 2MYGA 1F3AA 4TRXA 1NW2A 3EC3A 2R5GA 1GSFA 3FZ5A 4BA7A 4AKGA 1A8LA 3DD3A 4FH8A 1JHBA 5GSSA 3Q18A 3GHAA 2L59A 3HYPA 3C71A 4HI7A 3N5OA 2CX4A 4IS0A 2PGTA 2MMAA 2HNLA 4NV2A 2L4CA 3DRNA 2Z9SA 3NOFA 1THXA 5B8AA 3C8EA 2PWJA 5CAXA 2FA8A 1JFUA 1O6JA 1A8YA 3UVTA 3VPTA 1KEBA 4IP1A 5CNWA 4MA9A 3VWUA 2VOCA 3MNGA 1MDJA 5EL8A 5ECOB 2R2JA 3HZ8A 1XWBA 3US3A 3VWVA 3L9VA 2HSYA 1ZOFA 2YWIA 1EV9A 4G19A 1GSQA 2R4VA 4HUAA 2VM1A 3LSZA 1IYHA 1URMA 5G1LA 2C8UA 2OE1A 3TKSC 4K1FA 5D9VA 3EU4A 3CTGA 14GSA 2C1YA 1M7TA 1RW1A 4HOJA 4ECBA 1EZKA 3ZZXA 3ME8A 3IC4A 5CP1A 5H5SA 2LKUA 1UVZA 3GL3A 2VL3A 1ACVA 3DXBA 2N5BA 5ECQB 1K0OA 2J9HA 2YZUA 1O8XA 3GH9A 4K5SA 1F9MA 5HR2A 1U3AA 5HFGA 3PINA 2DBCA 1WOUA 4BL7A 4K0GA 3KP9A 3TRXA 2YOIA 4E68A 4K7NA 5FHIA 3IV4A 2JADA 1OE8A 1XPVA 3FY7A 2H6ZA 1OC3A 4BVXA 1GNWA 4DSRA 1RQMA 5ELGA 2V1MA 2GTUA 1B48A 1S3CA 3DVXA 4ZIJA 4XS4B 4TXOA 1YY7A 2H1AA 3EE2A 3HVVA 1EGOA 3HMJG 4WEYA 5JWOB 1DSBA 4KF9A 2BJXA 4MPGA 2B7JA 3FYGA 1ON4A 1G7OA 3C1RA 2PBJA 4PQ1A 1T7PB 2E2MA 5A1NB 3KEBA 1M2DA 5J5NA 3M3MA 1GLPA 3F4TA 1K0DA 3QD9A 2CZ2A 3BCIA 5DALA 3FZAA 3MWHA 2ZNMA 1M2AA 5DCHA 1NHOA 1TK8B 5CRGA 1Z7RA 3QFBC 4N11A 3ZVJD 3MAKA 2FWGA 3KD0A 2CVDA 1TU7A 1GSDA 3TKRA 4O7HA 1PL1A 1TU8A 3WGDA 2BTOT 5KEJA 3FK8A 2FWFA 16GSA 3FR6A 4RI6A 2HRKB 3ERGA 2YV9A 4Z7XA 2HSHA 1X5EA 3GH6A 2P5RA 1HNCA 2V6KA 2AUVA 4F9ZA 1B9XC 5CRDA 1K3YA 4NAXA 1SJZA 5HFIA 3E0UA 5B8BA 1DBYA 3F4SA 4N0VA 1KBNA 3QCPA 3DEXA 4PUFC 3ZMKA 3F3QA 5GSTA 3N9JA 3KTBA 2EFDA 2GQMA 3PGTA 2KUCA 5GZZB 1AC1A 2LJRA 4GQCA 1FW1A 3M9KA 3LYKA 2R0CA 4EKZA 3HHVA 1AQWA 5DAKA 1SD9A 3U5RE 1O85A 1M99A 4N3ZA 2IL3A 3GKMA 5DJMA 5ECMB 4ID0A 1MDKA 3TKSE 4GLTA 4P3YB 4ZB8A 4Q5RA 3DGQA 2GT5A 2VLTA 3IXRA 2VCQA 1WJKA 2JZSA 2DJKA 1K0MA 1G6WA 1U87A 5HR1A 3G7IA 2C0DA 1V57A 2PN8A 1F3BA 1EGRA 5G31A 1S3AA 3GX8A 6GSWA 2ON5A 3WD6A 2RM5A 2ES7A 3Q74A 4CY8A 4NV5A 3I6AA 1K0AA 2C3QA 4ZBDA 1XW5A 3M9JA 1YF0A 3M0FA 1SVOA 2OA7A 2GVPA 4KDUA 4OFMA 3UOMA 1OC9A 4IJIA 1XBSA 4JEDA 4HS1A 5IMVA 1XCCA 2WJUA 4MJEA 3D22A 4TR0A 1A23A 1TRUA 1YZXA 4TXVA 2YWNA 2DLXA 4OO4A 2H70A 2XBQA 4D73B 1U6TA 3UL3A 1OC8A 2JU5A 3LJRA 3P90A 4ZB6A 4K2XA 5KN0A 1YDKA 4KSOA 3MYDA 2R6KA 4TN8A 2VIMA 3GFKA 2VL2A 2QGVA 4EDYA 1UC7A 3GNJA 3ZMLA 1T3BA 1ZL9A 1TXXA 3VK9A 3LXZA 1PKWA 1MEKA 1TKDB 1K3LA 2YZHA 4BVXB 2JZRA 2E2GA 4A5PA 5GAND 1M2BA 4TXOB 3KMNA 2JACA 2X49A 4I2TA 1BG1A 2N5FA 4ECCA 3ZYWA 3O76A 2N5AA 3F6DA 3L0HA 1T8EB 2OE3A 4K5RA 1VRSD 5DQSA 3FHKA 3ERFA 3VURA 2VAFA 2HQTA 1GTBA 2DKHA 5HQPA 4PX1A 1PD21 1ERWA 3ZFBA 4I2UA 1I5GA 3W8SA 3P8WA 3ZREA 4Z2UA 5DALB 4JBBA 2IN3A 4XS1A 5E4WA 5B6MA 4OFTA 4XS4A 1PKZA 1M0UA 1MDIA 4X43A 2B1LA 2GT6A 4OCFA 3QR6A 4RQXA 3W8JA 2AJQB 4EDZA 2HRNA 2AB6A 4OO5A 1AQVA 5ECIB 1DE2A 4TR4A 1AQXA 4O5QA 4HU7A 5IO2A 5LD0A 5A1NA 3HY2A 4HEA2 1PGTA 4JE1A 3PR8A 1X9SB 2HT9A 4MLYA 4ECJA 2B5XA 2M46A 1DE1A 4AGSA 5IMZA 3JCML 2O8VB 2RLIA 2IMIA 1JZDA 3WGEA 4XCSA 2PERA 3EPTA 1N2AA 4OFNA 1BJXA 1BQ7A 22GSA 2H71A 3F4RA 2HZFA 3V1WA 1GSYA 2EFHA 3ZRDA 2HRKA 5JCUA 5DAKB 4FYBA 2WFCA 1SK1A 4IELA 1TRSA 2B3SA 2LRNA 2NBSA 2RUFA 1Z9HA 4V2LA 4YKFA 3I43A 5J4VA 1XVWA 3UEMA 2LNSA 5ELAA 1BYEA 2I9HA 4F82A 3CSJA 2IFQB 5H5QA 3FZ4A 3TCOA 3HD5A 2NTOA 3HA9A 4AJ8A 4FQUA 1EV4A 1SENA 4CY6A 2M80A 3UJ1A 1VF1A 2LJKA 1ERUA 3TKQA 2HSNB 5LCZA 2YNXA 3SBCA 5H5RA 4QL9A 1BF5A 3EVIA 4IW9A 3DMLA 2YV7A 2KOKA 1WIKA 2O87A 2X64A 2HRFA 2FWEA 5BMUA 2XPDA 2GGTA 1GTUA 4AF2A 5AIVA 3DVWA 1SU9A 2QA2A 2CVBA 1X9WB 3EMPA 3RDWA 2VCWA 1DUGA 2EIOA 4ACSA 6GSVA 3KJYA 1HYUA 3QMXA 4MABA 4BWSA 3HJOA 5A5HA 4GQFA 3LORA 2EIRA 4IHUA 3HDCA 1OC9B 3CRTA 2MMNA 4EIQA 3KTLA 4TR1B 5FWGA 4ZL9A 5IOWA 2P0GA 1TJDA 1EP8A 4IQ1A 3TJKA 2K9FA 5IIZA 4XRDA 4HZ2A 3Q6OA 2UZ8A 1XW6A 2R37A 1TDIA 4MZCA 3PPUA 1VF2A 2UV8G 9GSSA 4HQZA 4IP6A 3ZLPA 4EF0A 4MNNA 5ENUA 4PQIA 1TP9A 3UBLA 4ZBAA 1FO5A 2DC5A 3GYKA 1TI1A 4H86A 3O6TA 2FY6A 1GL8A 1GSUA 1B4QA 2X8CA 2V41A 1QFNA 5AGYA 2WGRA 12GSA 1Y25A 2LSTA 5G5EA 1V98A 4K8MA 4YQMA 2ALBA 2MMOA 2A4VA 4D73A 2E7PA 1SVLA 1GULA 1A2MA 4QMKA 2C0EA 1V9WA 2LJAA 2H8LA 4LA1A 2DJ0A 2GLRA 1Y6EA 1PSQA 5IO0A 4GTUA 3VLNA 5IMDA 3L9SA 4ML1A 4YKGA 4PNFA 4PNGA 2EIQA 2YJ7A 2DSAA 2H19A 20GSA 4IVFA 2R0PA 2WDUA 1A2JA 1TRWA 1TW9A 4YH2A 2I4AA 1X0RA 4GXZA 4KH7A 4FYUA 2MBSA 2LQQA 2F8FA 3WYWA 1O7UA 2CT6A 2LEGA 10GSA 1LU4A 3D4MA 3LXTA 2HXKA 2CAQA 4ICYA 3IAM2 2F51A 2QA1A 5CREA 4I97A 5B7CA 2HE3A 3LYPA 3MDKA 3J7Yk 2VCVA 1OE7A 3NIVA 5J4YA 1PA3A 3CMIA 3F9UA 4HQSA 1ERTA 2YWMA 2VKZG 4NMUA 2VUPA 4KDYA 2L4QA 5F0GA 1K0NA 1QGVA 1GRXA 3G7YA 4WBRD 2H0HA 4ZL7A 1NHYA 2MMZA 18GSA 2FNOA 2VD0A 5C04A 3GURA 4J56E 1PL2A 4AKIA 2LV3A 4NXIA 1A0FA 2HI7A 2C0FA 1FG4A 1W89A 2CQ9A 2I3YA 1VF3A 1YEXA 1G6YA 4F0BA 2K8SA 3C73A 5IMAA 4ECIA 4WETA 1SL2B 1F2EA 2A2SA 1PQNA 2KLXA 1ILOA 1XXUA 1JZOA 5A4UA 1WMJA 2OT3A 4O5UA 1J08A 3A3TA 3TUEA 2H1GA 2L6CA 3I69A 2H66A 5BMUB 4ZXGA 3RHCA 1LJRA 1ABAA 5GAPD 1XIYA 3KP8A 3W6GA 2GZZA 3A5IA 4TKYA 4N30A 1PN9A 1YF1A 1PX6A 2VD1A 5A5HB 3M8NA 4LMVA 2R3XA 2IFQA 1UA5A 5IPHA 2RUEA 1SK2A 1SYRA 3IC8A 3IK7A 4MCUA 3RPNA 1N25A 1R7HA 3IBHA 2HSNA 4HU9A 3UVHA 1JZRA 1ZGNA 3D4TA 2GQKA 4IGJA 3NZNA 2M72A 1T1VA 1QQ2A 2H6YA 3IHQA 1PMTA 1TTZA 1ZZYA 5AISA 2LNTA 1SL0B 4TOPA 1O73A 2JSZA 1Q98A 1Z6NA 5J4UA 5AIXA 4E8EA 4GCIA 1OKTA 4L5OA 4CDOA 3E3EA 4POLA 3EURA 4QL7A 4G9HA 2LQOA 1XWGA 4LL1B 2TIRA 4PQHA 4TR1A 1Z5YE 5JWRB 2AAWA 3KGKA 1M9AA 4GF0A 3TKSA 3TU3B 2CAIA 1QMVA 4XS6A 2D2ZA 2H1BA 2WB9A 4PGTA 4RQRA 3D6IA 3IA1A 1UN2A 2IJYA 2VO4A 4AKHA 4QQ7A 3HXSA 3L78A 1ZYPA 5IOXA 5A34B 5JWQB 1SKWB 5CRWA 4KE3A 4NHWA 4LL4B 3G9BA 4N0ZA 1XWCA 3F0IA 1SJ6A 2OE0A 1ML6A 2L5OA 1R4WA 4W66A 3DKSA 2F3MA 2VLUA 4MDCA 4IBPA 4F0CA 3U6VA 5BRTA 1R5AA 4HDEA 1GP1A 2QKEA 4DEJA 4YAVA 1MD4A 8GSSA 4ZBBA 2DJJA 3GV1A 4MZWA 17GSA 3VI7A 2G2QA 1BX9A 1EEJA 4KB3A 3L9UA 3ISOA 1KNGA 4O92A 2QSIA 2H01A 4KA0A 3HKRA 4K7OA 1H75A 4ZL8A 1GUHA 4BWQA 1Q4JA 4YQUA 3P7XA 4X1UA 4GWRA 4IN0A 3P2AA 1YQ1A 3GRXA 1QXHA 2B1KA 4ZILA 1JLWA 1X5CA 2RIIA 1XWKA 3F3RA 2DMLA 2GS3A 1ZCPA 5ID2B 1HQOA 3BCKA 3A5WA 4DVCA 1I9DA 4Q5NA 2JSYA 1AIUA 4KCAA 3FRCA 5CO3A 4Z2TA 3A2VA 3GMFA 1FAAA 4EVMA 4L8EA 5ECRB 3EINA 1U88A 11GSA 3AY8A 1VGLA 1ZYEA 2O7KA 5G5FA 3C7MA 6GSTA 3CRUA 3H1NA 3QOUA 3H8QA 4DSSA 1WP0A 4V1Ap 4J2FA 4POMA 3H79A 5ECNB 3HJMA 3R3EA 2YPMA 4EL1A 4CHSA 3FW2A 5ECHB 2H74A 5D9XA 2GSQA 2J23A 3LWAA 2YANA 3HJPA 2X99A 1AXDA 3GKNA 2YN1A 3GL5A 4POBA 1SKRB 2IMDA 5F07A 1E6BA 2BMXA 5ECSA 2HFDA 4EC0A 4L0UA 1XZOA 3VI5A 3TJBA 3UMAA 3MIXA 5J9CA 4MH3A 4POKA 1Z6MA 1USBA 3H93A 4AKXB 3VFIA 1SK0A 2DKIA 5D8IA 4OCEA 2LUSA 13GSA 2C3TA 4WF5A 4EIPA 5IQYA 2K6VA 4USSA 3TB2A 2X4AA 2DJ3A 4CW9A 2KP2A 4NWYA 3BD2A 1HNBA 2WULA 3ZITA 2LRCA 1SYXA 5G1KA 1AUCA 2ZCTA 3DYRA 3HCZA 3UAPA 5KOWA 6GSXA 5D9WA 5G30A 3TRPA 1XW9A 2GZPA 3APOA 2O85A 3EU3A 3KZQA 4PTSA 3QAWA 2K8VA 1BEDA 3EWLA 1GTAA 3UIWA 3GN3A 5D73A 4K9ZA 2REMA 5EVOA 3ERWA 1B8XA 1T4ZA 1JZWA 5B6NA 2IWTA 2YJHA 4XTSA 3CBUA 2IPAA 1WWJA 3IPZA 1PX7A 2JL4A 1THOA 2XHFA 1JLVA 3GKXA 4HZ4A 1QUWA 4JR6A 1CQHA 1WE0A 3RAZA 2YP6A 4GDFA 3J7Yb 3IR4A 3VWWA 1KTEA 4BVYB 5ECKB 3E9JB 2XC2A 1MD3A 1YEPA 2L6DA 3TJJA 2X8GA 4KSMA 2WCIA 4F03A 3FZ9A 1G7EA 3QPMA 2DJ2A 3GX0A 5A4WA 1SVMA 3ZTLA 4OD7A 2ON7A 4ZB7A 2FCHA 4WR5A 3GUSA 1AAZA 2DIZA 4FO5A 3ED3A 3EMXA 2YCDA 4KUNA 4XHMA 3EYTA 1V40A 1SD8A 3GTUB 3LQ7A 3KCMA 1XOAA 2FLSA 5A4VA 2CZ3A 3CYNA 2DJ1A 2X8HA 2WRTA 1C72A 3TDGA 3GIXA 4RUVA 4AI6A 1EP7A 4WXTA 2MBTA 5A34A 3LEFA 4TR3A 5IM9A 1YJ6A 1OKDA 2GQLA 3UARA 3KIJA 3MSZA 2O5VA 1K0CA 2HSMB 4MPFA 4EUYA 2HZEA 4KCEA 5D96A 2VL2C 3HZ4A 1GUMA 2L57A 1A24A 3WT1A 2A2PA 3KH9A 4XIHA 3WT2A 2FWHA 2CVKA 3H4KA 1FHEA 3RBTA 1ST9A 3K8NA 3RHBA 5HR0A 5JCGA 3F63A 4G0KA 1BG5A 4EE0A 3QDNA 4Q5QA 4YAPA 2KHPA 4JZQA 2F9SA 2O89A 3LG6A 5IMFA 1T00A 1ZMAA 3LW9A 4IKHA 3CSIA 5DVBA 1O8WA 4DSSB 3SWLA 1HD2A 3ZL5A 1U3IA 2C80A 2CX3A 3FR9A 4Z2RA 2A4HA 6GSSA 4V2NA 4JR4A 3F8UA 3DWVA 5ID2A 4FYCA 3HVSA 4KNDA 3D5JA 4XRAA 5ABRA 2HRAA 3M1GA 2XBIA 3ZFLA 3R2QA 2H1DA 1OVNA 4LLRA 2H76A 4PXOA 3PH9A 3IAS2 4G2EA 1CQGA 1FVKA 2PMTA 1A2LA 5J47A 2KP1A 4LMWA 4JU5A 2GSTA 1XOBA 1GH2A 1XFLA 5HFKA 4G0LA 1XVQA 3Q19A 2PU9C 2VLVA 1XWAA 4WKWA 2WZ9A 1B4PA 3GSSA 2QC7A 4K7IA 2VCXA 2OJLA 4DSQA 1GLQA 1SJIA 3OR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BOA A;  2ZUP A;  5F8B A;  4IJ3 A;  1LBK A;  4I6X A;  4G10 A;  5CRH A;  1H4O A;  4KGI A;  1EOG A;  1FOV A;  5AN1 A;  5LNK e;  2EC4 A;  4TVE A;  5A5K A;  2IMF A;  7GSS A;  4IQA A;  3TOU A;  4G0I A;  5J3R A;  3QAV A;  3S9F A;  2P5Q A;  5ECL B;  3TJF A;  5F06 A;  2B5E A;  3UBK A;  4E8H A;  4K0N A;  1AW9 A;  2WS2 A;  1VF4 A;  4KAE A;  2NPB A;  4K2D A;  2NDO A;  4YQV A;  4MJA A;  3I9V 2;  2C0G A;  2H73 A;  3BJ5 A;  4PUR A;  2B5Y A;  4L5L A;  3VWX A;  5ECP B;  5IPG A;  2GSS A;  4GSS A;  4OMV A;  1J9B A;  2NVL A;  3IK9 A;  2MZC A;  3G7J A;  4MF5 A;  2FHE A;  2TRX A;  3C1S A;  2LRT A;  2I1U A;  3D0Z A;  2V32 A;  1NSW A;  4AJ6 A;  3HVX A;  2F8A A;  5DBQ A;  1SL1 B;  3IOS A;  2FUG 2;  1X5D A;  4EXJ A;  3FEU A;  3QFA C;  2P31 A;  4V2M A;  4MP4 A;  5F05 A;  1ERV A;  1FB0 A;  3ZIJ A;  4O5R A;  1ZYQ B;  4OWY A;  3KMO A;  1PRX A;  1EWX A;  2OKA A;  3CSH A;  2GSR A;  3TJG A;  1F6M C;  4MZB A;  3RPP A;  5CYY A;  2I81 A;  2PVQ A;  4BVY A;  1Z7P A;  4EO3 A;  4KW6 A;  5HR3 A;  5KN1 A;  2DIY A;  3LFL A;  4MJB A;  5INY A;  1G0T A;  1V58 A;  4PUA A;  4AJ7 A;  5E59 A;  1N8J A;  3D21 A;  1FB6 A;  1GUK A;  2OBI A;  1V2A A;  4NHZ A;  2GZY A;  5DCG A;  2HZE B;  1TI3 A;  4K6X A;  5L71 A;  3VPQ A;  1M9B A;  2PVO C;  1GTI A;  5DQY A;  2FA4 A;  3O3T A;  2B6M A;  5D9T A;  4BL7 B;  3IE3 A;  3GTU A;  1EEM A;  2OAC A;  2HLS A;  1BAY A;  1MTC A;  1GNE A;  4GRF A;  5EY6 A;  1OYJ A;  5DDL A;  6GSY A;  3A2X A;  3ZIV A;  1YKC A;  2HYX A;  2TRC P;  4WBJ A;  4MF6 A;  2AYT A;  1TRV A;  1HNA A;  4MMM A;  1K3O A;  2FGX A;  3GA4 A;  3BBY A;  5J41 A;  5FT3 A;  2HSM A;  4TW5 A;  2XPE A;  1E2Y A;  4HJ2 A;  1QK8 A;  2H30 A;  3CXG A;  2H75 A;  2H72 A;  4ISD A;  1K0B A;  1T4Y A;  1B9Y C;  1IYI A;  4FIW A;  2CV4 A;  5IMC A;  1GWC A;  2AHE A;  4MJC A;  2OBK A;  3A2W A;  2DMM A;  2V2G A;  2VCT A;  3ZVJ A;  1WPI A;  3IDV A;  1WRY A;  3TKP A;  2H0G A;  2PUK C;  1SKS B;  2H6X A;  4MF7 A;  1S3D A;  4WF4 A;  2PPT A;  1Z3E A;  2RM6 A;  3GST A;  4GST A;  1TK0 B;  2C4J A;  2YWO A;  5C00 A;  4L0W A;  2AV4 A;  2G0F A;  3TGZ A;  3KM6 A;  4BPY A;  4Q5F A;  2CA8 A;  4F2I A;  1EOH A;  2IME A;  2H0I A;  6GSU A;  2L5L A;  4N10 A;  4J57 E;  1OAZ A;  19GS A;  3FR3 A;  1W4V A;  5COH A;  3TOT A;  3IRA A;  3QAG A;  2V6O A;  3TRQ A;  4NPB A;  1GSS A;  4I8B A;  2FD3 A;  5D93 A;  2IIY A;  1J0F A;  4O32 A;  5KN3 A;  3APS A;  3FKF A;  2VL9 A;  4JRR A;  1F37 A;  5JCW A;  5G2Z A;  3GKK A;  2E0Q A;  4WR4 A;  4X0X A;  4GSN A;  5KN2 A;  1TK5 B;  1A0R P;  3APQ A;  1RK4 A;  1NM3 A;  3DIE A;  2OAD A;  3KH7 A;  2C3N A;  4KX4 A;  3KXO A;  4KDX A;  3L4N A;  2B7K A;  1TOF A;  4ULX A;  5J9B A;  2JZT A;  4I5Q A;  1R26 A;  4MH2 A;  2VCZ A;  4RI7 A;  4ZB9 A;  4ILF A;  2LTK A;  5DJL A;  1GSE A;  5EPF A;  4HJM A;  1X9M B;  2GDR A;  2A2R A;  2IMK A;  1O81 A;  4V1A g;  2LS5 A;  1YKA A;  4ML6 A;  3CTF A;  3ME7 A;  2VM2 A;  1R5P A;  3WGX A;  3F6F A;  1FVJ A;  4MK3 A;  3LGC A;  2K18 A;  2MYG A;  1F3A A;  4TRX A;  1NW2 A;  3EC3 A;  2R5G A;  1GSF A;  3FZ5 A;  4BA7 A;  1A8L A;  3DD3 A;  4FH8 A;  1JHB A;  5GSS A;  3Q18 A;  3GHA A;  2L59 A;  3HYP A;  3C71 A;  4HI7 A;  3N5O A;  2CX4 A;  4IS0 A;  2PGT A;  2MMA A;  2HNL A;  4NV2 A;  2L4C A;  3DRN A;  2Z9S A;  3NOF A;  1THX A;  5B8A A;  3C8E A;  2PWJ A;  5CAX A;  2FA8 A;  1JFU A;  1O6J A;  1A8Y A;  3UVT A;  3VPT A;  1KEB A;  4IP1 A;  5CNW A;  4MA9 A;  3VWU A;  2VOC A;  3MNG A;  1MDJ A;  5EL8 A;  5ECO B;  2R2J A;  3HZ8 A;  1XWB A;  3US3 A;  3VWV A;  3L9V A;  2HSY A;  1ZOF A;  2YWI A;  1EV9 A;  4G19 A;  1GSQ A;  2R4V A;  4HUA A;  2VM1 A;  3LSZ A;  1IYH A;  1URM A;  5G1L A;  2C8U A;  2OE1 A;  3TKS C;  4K1F A;  5D9V A;  3EU4 A;  3CTG A;  14GS A;  2C1Y A;  1M7T A;  1RW1 A;  4HOJ A;  4ECB A;  1EZK A;  3ZZX A;  3ME8 A;  3IC4 A;  5CP1 A;  5H5S A;  2LKU A;  1UVZ A;  3GL3 A;  2VL3 A;  1ACV A;  3DXB A;  2N5B A;  5ECQ B;  1K0O A;  2J9H A;  2YZU A;  1O8X A;  3GH9 A;  1F9M A;  5HR2 A;  1U3A A;  5HFG A;  3PIN A;  2DBC A;  1WOU A;  4BL7 A;  4K0G A;  3KP9 A;  3TRX A;  2YOI A;  4K7N A;  5FHI A;  3IV4 A;  2JAD A;  1OE8 A;  1XPV A;  3FY7 A;  2H6Z A;  1OC3 A;  4BVX A;  1GNW A;  4DSR A;  1RQM A;  5ELG A;  2V1M A;  2GTU A;  1B48 A;  1S3C A;  3DVX A;  4ZIJ A;  4XS4 B;  4TXO A;  1YY7 A;  2H1A A;  3EE2 A;  3HVV A;  1EGO A;  4WEY A;  5JWO B;  1DSB A;  4KF9 A;  2BJX A;  4MPG A;  2B7J A;  3FYG A;  1ON4 A;  1G7O A;  3C1R A;  2PBJ A;  4PQ1 A;  1T7P B;  2E2M A;  3KEB A;  1M2D A;  5J5N A;  3M3M A;  1GLP A;  3F4T A;  1K0D A;  3QD9 A;  2CZ2 A;  3BCI A;  5DAL A;  3FZA A;  3MWH A;  2ZNM A;  1M2A A;  5DCH A;  1NHO A;  1TK8 B;  5CRG A;  1Z7R A;  3QFB C;  4N11 A;  3ZVJ D;  3MAK A;  2FWG A;  3KD0 A;  2CVD A;  1TU7 A;  1GSD A;  3TKR A;  4O7H A;  1PL1 A;  1TU8 A;  3WGD A;  2BTO T;  5KEJ A;  3FK8 A;  2FWF A;  16GS A;  3FR6 A;  4RI6 A;  2HRK B;  3ERG A;  2YV9 A;  4Z7X A;  2HSH A;  1X5E A;  3GH6 A;  2P5R A;  1HNC A;  2V6K A;  2AUV A;  4F9Z A;  1B9X C;  5CRD A;  1K3Y A;  4NAX A;  1SJZ A;  5HFI A;  3E0U A;  5B8B A;  1DBY A;  3F4S A;  4N0V A;  1KBN A;  3QCP A;  3DEX A;  4PUF C;  3ZMK A;  3F3Q A;  5GST A;  3N9J A;  3KTB A;  2GQM A;  3PGT A;  2KUC A;  5GZZ B;  1AC1 A;  2LJR A;  4GQC A;  1FW1 A;  3M9K A;  3LYK A;  4EKZ A;  3HHV A;  1AQW A;  5DAK A;  1SD9 A;  3U5R E;  1O85 A;  1M99 A;  2IL3 A;  3GKM A;  5DJM A;  5ECM B;  4ID0 A;  1MDK A;  3TKS E;  4GLT A;  4P3Y B;  4ZB8 A;  4Q5R A;  3DGQ A;  2GT5 A;  2VLT A;  3IXR A;  2VCQ A;  1WJK A;  2JZS A;  2DJK A;  1K0M A;  1G6W A;  1U87 A;  5HR1 A;  3G7I A;  2C0D A;  1V57 A;  2PN8 A;  1F3B A;  1EGR A;  5G31 A;  1S3A A;  3GX8 A;  6GSW A;  2ON5 A;  3WD6 A;  2RM5 A;  2ES7 A;  3Q74 A;  4NV5 A;  3I6A A;  1K0A A;  2C3Q A;  4ZBD A;  1XW5 A;  3M9J A;  1YF0 A;  3M0F A;  2OA7 A;  2GVP A;  4KDU A;  4OFM A;  3UOM A;  1OC9 A;  4IJI A;  1XBS A;  4JED A;  4HS1 A;  5IMV A;  1XCC A;  2WJU A;  4MJE A;  3D22 A;  4TR0 A;  1A23 A;  1TRU A;  1YZX A;  4TXV A;  2YWN A;  2DLX A;  4OO4 A;  2H70 A;  2XBQ A;  4D73 B;  1U6T A;  3UL3 A;  1OC8 A;  2JU5 A;  3LJR A;  3P90 A;  4ZB6 A;  5KN0 A;  1YDK A;  4KSO A;  2R6K A;  4TN8 A;  2VIM A;  3GFK A;  2VL2 A;  2QGV A;  4EDY A;  1UC7 A;  3GNJ A;  3ZML A;  1T3B A;  1ZL9 A;  1TXX A;  3VK9 A;  3LXZ A;  1PKW A;  1MEK A;  1TKD B;  1K3L A;  2YZH A;  4BVX B;  2JZR A;  2E2G A;  5GAN D;  1M2B A;  4TXO B;  3KMN A;  2JAC A;  4I2T A;  2N5F A;  4ECC A;  3ZYW A;  3O76 A;  2N5A A;  3F6D A;  3L0H A;  1T8E B;  2OE3 A;  1VRS D;  5DQS A;  3FHK A;  3ERF A;  3VUR A;  2VAF A;  2HQT A;  1GTB A;  5HQP A;  4PX1 A;  1PD2 1;  1ERW A;  3ZFB A;  4I2U A;  1I5G A;  3W8S A;  3P8W A;  3ZRE A;  5DAL B;  4JBB A;  2IN3 A;  4XS1 A;  5E4W A;  5B6M A;  4OFT A;  4XS4 A;  1PKZ A;  1M0U A;  1MDI A;  4X43 A;  2B1L A;  2GT6 A;  4OCF A;  3QR6 A;  4RQX A;  3W8J A;  2AJQ B;  4EDZ A;  2HRN A;  2AB6 A;  4OO5 A;  1AQV A;  5ECI B;  1DE2 A;  4TR4 A;  1AQX A;  4HU7 A;  5IO2 A;  5LD0 A;  3HY2 A;  4HEA 2;  1PGT A;  4JE1 A;  3PR8 A;  1X9S B;  2HT9 A;  4MLY A;  4ECJ A;  2B5X A;  2M46 A;  1DE1 A;  4AGS A;  5IMZ A;  3JCM L;  2O8V B;  2RLI A;  2IMI A;  1JZD A;  3WGE A;  4XCS A;  2PER A;  1N2A A;  4OFN A;  1BJX A;  1BQ7 A;  22GS A;  2H71 A;  3F4R A;  2HZF A;  3V1W A;  1GSY A;  3ZRD A;  2HRK A;  5JCU A;  5DAK B;  4FYB A;  2WFC A;  1SK1 A;  4IEL A;  1TRS A;  2B3S A;  2LRN A;  2NBS A;  2RUF A;  1Z9H A;  4V2L A;  3I43 A;  1XVW A;  3UEM A;  2LNS A;  5ELA A;  1BYE A;  2I9H A;  4F82 A;  3CSJ A;  2IFQ B;  5H5Q A;  3FZ4 A;  3TCO A;  3HD5 A;  2NTO A;  3HA9 A;  4AJ8 A;  4FQU A;  1EV4 A;  1SEN A;  2M80 A;  3UJ1 A;  1VF1 A;  2LJK A;  1ERU A;  3TKQ A;  2HSN B;  5LCZ A;  2YNX A;  3SBC A;  5H5R A;  4QL9 A;  3EVI A;  4IW9 A;  3DML A;  2YV7 A;  2KOK A;  1WIK A;  2O87 A;  2X64 A;  2HRF A;  2FWE A;  5BMU A;  2XPD A;  2GGT A;  1GTU A;  4AF2 A;  5AIV A;  3DVW A;  1SU9 A;  2CVB A;  1X9W B;  3EMP A;  3RDW A;  2VCW A;  1DUG A;  2EIO A;  4ACS A;  6GSV A;  3KJY A;  1HYU A;  3QMX A;  4MAB A;  4BWS A;  3HJO A;  4GQF A;  3LOR A;  2EIR A;  4IHU A;  3HDC A;  1OC9 B;  3CRT A;  2MMN A;  3KTL A;  4TR1 B;  5FWG A;  4ZL9 A;  5IOW A;  2P0G A;  1TJD A;  1EP8 A;  4IQ1 A;  3TJK A;  2K9F A;  5IIZ A;  4XRD A;  4HZ2 A;  3Q6O A;  2UZ8 A;  1XW6 A;  2R37 A;  1TDI A;  4MZC A;  3PPU A;  1VF2 A;  9GSS A;  4HQZ A;  4IP6 A;  3ZLP A;  4EF0 A;  5ENU A;  4PQI A;  1TP9 A;  3UBL A;  4ZBA A;  1FO5 A;  2DC5 A;  3GYK A;  1TI1 A;  4H86 A;  3O6T A;  2FY6 A;  1GL8 A;  1GSU A;  1B4Q A;  2X8C A;  2V41 A;  1QFN A;  5AGY A;  2WGR A;  12GS A;  1Y25 A;  2LST A;  5G5E A;  1V98 A;  4K8M A;  4YQM A;  2ALB A;  2MMO A;  2A4V A;  4D73 A;  2E7P A;  1GUL A;  1A2M A;  2C0E A;  1V9W A;  2LJA A;  2H8L A;  4LA1 A;  2DJ0 A;  2GLR A;  1Y6E A;  1PSQ A;  5IO0 A;  4GTU A;  3VLN A;  5IMD A;  3L9S A;  4ML1 A;  4PNF A;  4PNG A;  2EIQ A;  2YJ7 A;  2DSA A;  2H19 A;  20GS A;  4IVF A;  2WDU A;  1A2J A;  1TRW A;  1TW9 A;  4YH2 A;  2I4A A;  1X0R A;  4GXZ A;  4KH7 A;  4FYU A;  2MBS A;  2LQQ A;  2F8F A;  3WYW A;  1O7U A;  2CT6 A;  2LEG A;  10GS A;  1LU4 A;  3D4M A;  3LXT A;  2HXK A;  2CAQ A;  3IAM 2;  2F51 A;  5CRE A;  4I97 A;  5B7C A;  2HE3 A;  3LYP A;  3MDK A;  3J7Y k;  2VCV A;  1OE7 A;  3NIV A;  1PA3 A;  3CMI A;  3F9U A;  4HQS A;  1ERT A;  2YWM A;  4NMU A;  2VUP A;  4KDY A;  2L4Q A;  5F0G A;  1K0N A;  1QGV A;  1GRX A;  3G7Y A;  4WBR D;  2H0H A;  4ZL7 A;  1NHY A;  2MMZ A;  18GS A;  2FNO A;  2VD0 A;  5C04 A;  3GUR A;  4J56 E;  1PL2 A;  2LV3 A;  4NXI A;  1A0F A;  2HI7 A;  2C0F A;  1FG4 A;  1W89 A;  2CQ9 A;  2I3Y A;  1VF3 A;  1YEX A;  1G6Y A;  4F0B A;  2K8S A;  3C73 A;  5IMA A;  4ECI A;  4WET A;  1SL2 B;  1F2E A;  2A2S A;  1PQN A;  2KLX A;  1ILO A;  1XXU A;  1JZO A;  5A4U A;  1WMJ A;  1J08 A;  3A3T A;  3TUE A;  2H1G A;  2L6C A;  3I69 A;  2H66 A;  4ZXG A;  3RHC A;  1LJR A;  1ABA A;  5GAP D;  1XIY A;  3KP8 A;  3W6G A;  2GZZ A;  4TKY A;  4N30 A;  1PN9 A;  1YF1 A;  1PX6 A;  2VD1 A;  3M8N A;  4LMV A;  2R3X A;  2IFQ A;  1UA5 A;  5IPH A;  2RUE A;  1SK2 A;  1SYR A;  3IC8 A;  3IK7 A;  4MCU A;  3RPN A;  1R7H A;  3IBH A;  4HU9 A;  3UVH A;  1JZR A;  1ZGN A;  3D4T A;  2GQK A;  4IGJ A;  3NZN A;  2M72 A;  1T1V A;  1QQ2 A;  2H6Y A;  3IHQ A;  1PMT A;  1TTZ A;  1ZZY A;  5AIS A;  2LNT A;  1SL0 B;  4TOP A;  1O73 A;  2JSZ A;  1Q98 A;  1Z6N A;  5J4U A;  5AIX A;  4E8E A;  4GCI A;  1OKT A;  4L5O A;  4CDO A;  3E3E A;  4POL A;  3EUR A;  4QL7 A;  4G9H A;  2LQO A;  1XWG A;  4LL1 B;  2TIR A;  4PQH A;  4TR1 A;  1Z5Y E;  5JWR B;  2AAW A;  3KGK A;  1M9A A;  4GF0 A;  3TKS A;  2CAI A;  1QMV A;  4XS6 A;  2D2Z A;  2H1B A;  2WB9 A;  4PGT A;  4RQR A;  3D6I A;  3IA1 A;  1UN2 A;  2IJY A;  2VO4 A;  4QQ7 A;  3HXS A;  3L78 A;  5IOX A;  5JWQ B;  1SKW B;  5CRW A;  4KE3 A;  4NHW A;  4LL4 B;  3G9B A;  4N0Z A;  1XWC A;  3F0I A;  1SJ6 A;  2OE0 A;  1ML6 A;  2L5O A;  1R4W A;  3DKS A;  2F3M A;  2VLU A;  4MDC A;  4IBP A;  4F0C A;  3U6V A;  1R5A A;  4HDE A;  1GP1 A;  2QKE A;  4DEJ A;  4YAV A;  1MD4 A;  8GSS A;  4ZBB A;  2DJJ A;  3GV1 A;  4MZW A;  17GS A;  3VI7 A;  2G2Q A;  1BX9 A;  1EEJ A;  4KB3 A;  3L9U A;  3ISO A;  1KNG A;  4O92 A;  2QSI A;  2H01 A;  4KA0 A;  3HKR A;  4K7O A;  1H75 A;  4ZL8 A;  1GUH A;  4BWQ A;  1Q4J A;  4YQU A;  3P7X A;  4X1U A;  4GWR A;  4IN0 A;  3P2A A;  1YQ1 A;  3GRX A;  1QXH A;  2B1K A;  4ZIL A;  1JLW A;  1X5C A;  2RII A;  1XWK A;  3F3R A;  2DML A;  2GS3 A;  1ZCP A;  5ID2 B;  1HQO A;  3BCK A;  3A5W A;  4DVC A;  1I9D A;  4Q5N A;  2JSY A;  1AIU A;  4KCA A;  3FRC A;  5CO3 A;  3A2V A;  3GMF A;  1FAA A;  4EVM A;  4L8E A;  5ECR B;  3EIN A;  1U88 A;  11GS A;  3AY8 A;  1VGL A;  1ZYE A;  2O7K A;  5G5F A;  3C7M A;  6GST A;  3CRU A;  3H1N A;  3QOU A;  3H8Q A;  4DSS A;  1WP0 A;  4V1A p;  4J2F A;  4POM A;  3H79 A;  5ECN B;  3HJM A;  3R3E A;  2YPM A;  4EL1 A;  4CHS A;  3FW2 A;  5ECH B;  2H74 A;  5D9X A;  2GSQ A;  2J23 A;  3LWA A;  2YAN A;  3HJP A;  2X99 A;  1AXD A;  3GKN A;  2YN1 A;  3GL5 A;  4POB A;  1SKR B;  2IMD A;  5F07 A;  1E6B A;  2BMX A;  5ECS A;  2HFD A;  4EC0 A;  4L0U A;  1XZO A;  3VI5 A;  3TJB A;  3UMA A;  5J9C A;  4MH3 A;  4POK A;  1Z6M A;  1USB A;  3H93 A;  3VFI A;  1SK0 A;  5D8I A;  4OCE A;  2LUS A;  13GS A;  2C3T A;  4WF5 A;  5IQY A;  2K6V A;  4USS A;  3TB2 A;  2DJ3 A;  4CW9 A;  2KP2 A;  4NWY A;  3BD2 A;  1HNB A;  2WUL A;  3ZIT A;  2LRC A;  1SYX A;  5G1K A;  1AUC A;  2ZCT A;  3DYR A;  3HCZ A;  3UAP A;  6GSX A;  5D9W A;  5G30 A;  3TRP A;  1XW9 A;  2GZP A;  3APO A;  2O85 A;  3EU3 A;  3KZQ A;  4PTS A;  3QAW A;  2K8V A;  1BED A;  3EWL A;  1GTA A;  3UIW A;  3GN3 A;  5D73 A;  4K9Z A;  2REM A;  5EVO A;  3ERW A;  1B8X A;  1T4Z A;  1JZW A;  5B6N A;  2IWT A;  2YJH A;  4XTS A;  3CBU A;  2IPA A;  1WWJ A;  3IPZ A;  1PX7 A;  2JL4 A;  1THO A;  2XHF A;  1JLV A;  3GKX A;  4HZ4 A;  1QUW A;  4JR6 A;  1CQH A;  1WE0 A;  3RAZ A;  2YP6 A;  3J7Y b;  3IR4 A;  3VWW A;  1KTE A;  4BVY B;  5ECK B;  3E9J B;  2XC2 A;  1MD3 A;  1YEP A;  2L6D A;  3TJJ A;  2X8G A;  4KSM A;  2WCI A;  4F03 A;  3FZ9 A;  1G7E A;  3QPM A;  2DJ2 A;  3GX0 A;  5A4W A;  3ZTL A;  4OD7 A;  2ON7 A;  2FCH A;  4WR5 A;  3GUS A;  1AAZ A;  2DIZ A;  4FO5 A;  3ED3 A;  3EMX A;  2YCD A;  4KUN A;  4XHM A;  3EYT A;  1V40 A;  1SD8 A;  3GTU B;  3LQ7 A;  3KCM A;  1XOA A;  2FLS A;  5A4V A;  2CZ3 A;  3CYN A;  2DJ1 A;  2X8H A;  2WRT A;  1C72 A;  3TDG A;  3GIX A;  4RUV A;  1EP7 A;  4WXT A;  2MBT A;  3LEF A;  4TR3 A;  5IM9 A;  1YJ6 A;  1OKD A;  2GQL A;  3UAR A;  3KIJ A;  3MSZ A;  1K0C A;  2HSM B;  4MPF A;  4EUY A;  2HZE A;  4KCE A;  5D96 A;  2VL2 C;  3HZ4 A;  1GUM A;  2L57 A;  1A24 A;  3WT1 A;  3KH9 A;  4XIH A;  3WT2 A;  2FWH A;  2CVK A;  3H4K A;  1FHE A;  3RBT A;  1ST9 A;  3K8N A;  3RHB A;  5HR0 A;  5JCG A;  3F63 A;  4G0K A;  1BG5 A;  4EE0 A;  3QDN A;  4Q5Q A;  4YAP A;  2KHP A;  4JZQ A;  2F9S A;  2O89 A;  3LG6 A;  5IMF A;  1T00 A;  1ZMA A;  4IKH A;  3CSI A;  5DVB A;  1O8W A;  4DSS B;  3SWL A;  1HD2 A;  3ZL5 A;  1U3I A;  2C80 A;  2CX3 A;  3FR9 A;  6GSS A;  4V2N A;  4JR4 A;  3F8U A;  3DWV A;  5ID2 A;  4FYC A;  3HVS A;  4KND A;  3D5J A;  4XRA A;  5ABR A;  2HRA A;  3M1G A;  2XBI A;  3ZFL A;  3R2Q A;  2H1D A;  1OVN A;  4LLR A;  2H76 A;  4PXO A;  3PH9 A;  3IAS 2;  4G2E A;  1CQG A;  1FVK A;  2PMT A;  1A2L A;  2KP1 A;  4LMW A;  4JU5 A;  2GST A;  1XOB A;  1GH2 A;  1XFL A;  5HFK A;  4G0L A;  1XVQ A;  3Q19 A;  2PU9 C;  2VLV A;  1XWA A;  4WKW A;  2WZ9 A;  1B4P A;  3GSS A;  2QC7 A;  4K7I A;  2VCX A;  2OJL A;  4DSQ A;  1GLQ A;  1SJI A;  3OR5 A; 
#chains in the Genus database with same CATH topology
 3BOA A;  2ZUP A;  5F8B A;  4IJ3 A;  1LBK A;  4I6X A;  4G10 A;  5CRH A;  1H4O A;  4KGI A;  1EOG A;  1FOV A;  5AN1 A;  5LNK e;  2EC4 A;  4TVE A;  5A5K A;  2IMF A;  7GSS A;  4IQA A;  3TOU A;  4G0I A;  5J3R A;  3QAV A;  3S9F A;  2P5Q A;  5ECL B;  3TJF A;  5F06 A;  2B5E A;  3UBK A;  4E8H A;  4K0N A;  1YVL A;  1AW9 A;  2WS2 A;  1VF4 A;  4KAE A;  2NPB A;  4K2D A;  2NDO A;  4YQV A;  4MJA A;  3I9V 2;  2C0G A;  2H73 A;  3BJ5 A;  4PUR A;  2B5Y A;  4L5L A;  3VWX A;  5ECP B;  5IPG A;  2GSS A;  1Y1U A;  4GSS A;  4OMV A;  1J9B A;  2NVL A;  3IK9 A;  2MZC A;  3G7J A;  4MF5 A;  2FHE A;  2TRX A;  3C1S A;  2LRT A;  2I1U A;  3D0Z A;  2V32 A;  1NSW A;  4AJ6 A;  3HVX A;  1PN0 A;  2F8A A;  5DBQ A;  1SL1 B;  3IOS A;  2FUG 2;  1X5D A;  4EXJ A;  3FEU A;  3QFA C;  2P31 A;  4V2M A;  4MP4 A;  5F05 A;  1ERV A;  3FMW A;  1TXU A;  1FB0 A;  3ZIJ A;  4O5R A;  1ZYQ B;  4OWY A;  3KMO A;  1PRX A;  1EWX A;  2OKA A;  3CSH A;  2GSR A;  3TJG A;  1FOH A;  1F6M C;  4MZB A;  1S4B P;  3RPP A;  5CYY A;  2I81 A;  2PVQ A;  4BVY A;  1Z7P A;  4EO3 A;  4KW6 A;  5HR3 A;  5KN1 A;  2DIY A;  3LFL A;  4MJB A;  5INY A;  1G0T A;  1V58 A;  4PUA A;  4AJ7 A;  5E59 A;  1N8J A;  3D21 A;  1FB6 A;  1GUK A;  2OBI A;  1V2A A;  4NHZ A;  2GZY A;  5DCG A;  2HZE B;  1TI3 A;  4K6X A;  5L71 A;  3VPQ A;  1M9B A;  2PVO C;  1GTI A;  5DQY A;  2FA4 A;  3O3T A;  2B6M A;  5KOX A;  5D9T A;  4BL7 B;  3IE3 A;  3GTU A;  1EEM A;  2OAC A;  2HLS A;  1BAY A;  1MTC A;  1GNE A;  4GRF A;  5EY6 A;  1OYJ A;  5DDL A;  6GSY A;  3A2X A;  3ZIV A;  1YKC A;  2HYX A;  2TRC P;  4WBJ A;  4MF6 A;  2AYT A;  1TRV A;  1HNA A;  4MMM A;  1K3O A;  2FGX A;  3GA4 A;  3BBY A;  5J41 A;  5FT3 A;  2HSM A;  4TW5 A;  2XPE A;  1E2Y A;  4HJ2 A;  1QK8 A;  2H30 A;  3CXG A;  2H75 A;  2H72 A;  4ISD A;  1K0B A;  1T4Y A;  1B9Y C;  1IYI A;  4FIW A;  2CV4 A;  5IMC A;  1GWC A;  2AHE A;  4MJC A;  2OBK A;  3A2W A;  2DMM A;  2V2G A;  2VCT A;  3ZVJ A;  1WPI A;  3IDV A;  1WRY A;  3TKP A;  2H0G A;  2PUK C;  1SKS B;  2H6X A;  4MF7 A;  1S3D A;  4WF4 A;  2PPT A;  5J40 A;  1Z3E A;  2RM6 A;  3GST A;  4GST A;  1TK0 B;  2C4J A;  2YWO A;  5C00 A;  4L0W A;  2AV4 A;  2G0F A;  3TGZ A;  3KM6 A;  4BPY A;  4Q5F A;  2CA8 A;  4F2I A;  1EOH A;  2IME A;  2H0I A;  3RFR C;  6GSU A;  2L5L A;  4N10 A;  2R0G A;  4J57 E;  1OAZ A;  19GS A;  3FR3 A;  1W4V A;  5COH A;  3TOT A;  3IRA A;  3QAG A;  2V6O A;  3TRQ A;  4NPB A;  1GSS A;  4I8B A;  2FD3 A;  5D93 A;  2IIY A;  1J0F A;  4O32 A;  5KN3 A;  3APS A;  3FKF A;  2VL9 A;  2EFC A;  4JRR A;  2EFE A;  1F37 A;  4G01 A;  5JCW A;  5G2Z A;  3GKK A;  2E0Q A;  4WR4 A;  4X0X A;  4GSN A;  5KN2 A;  1TK5 B;  1A0R P;  3APQ A;  1RK4 A;  1NM3 A;  3DIE A;  3IHG A;  2OAD A;  1M3I A;  3KH7 A;  2C3N A;  4KX4 A;  3KXO A;  4KDX A;  3L4N A;  2B7K A;  1TOF A;  4ULX A;  5J9B A;  2JZT A;  2H1L A;  4I5Q A;  1R26 A;  4MH2 A;  2VCZ A;  4RI7 A;  4ZB9 A;  4X4J A;  4ILF A;  2LTK A;  5DJL A;  1GSE A;  5EPF A;  4HJM A;  1X9M B;  2GDR A;  2A2R A;  2IMK A;  1O81 A;  4V1A g;  2LS5 A;  1YKA A;  4ML6 A;  3CTF A;  3ME7 A;  3CWG A;  2VM2 A;  1R5P A;  1ZYN A;  3WGX A;  3F6F A;  1FVJ A;  4MK3 A;  3LGC A;  2K18 A;  2MYG A;  1F3A A;  4TRX A;  1NW2 A;  3EC3 A;  2R5G A;  1GSF A;  3FZ5 A;  4BA7 A;  4AKG A;  1A8L A;  3DD3 A;  4FH8 A;  1JHB A;  5GSS A;  3Q18 A;  3GHA A;  2L59 A;  3HYP A;  3C71 A;  4HI7 A;  3N5O A;  2CX4 A;  4IS0 A;  2PGT A;  2MMA A;  2HNL A;  4NV2 A;  2L4C A;  3DRN A;  2Z9S A;  3NOF A;  1THX A;  5B8A A;  3C8E A;  2PWJ A;  5CAX A;  2FA8 A;  1JFU A;  1O6J A;  1A8Y A;  3UVT A;  3VPT A;  1KEB A;  4IP1 A;  5CNW A;  4MA9 A;  3VWU A;  2VOC A;  3MNG A;  1MDJ A;  5EL8 A;  5ECO B;  2R2J A;  3HZ8 A;  1XWB A;  3US3 A;  3VWV A;  3L9V A;  2HSY A;  1ZOF A;  2YWI A;  1EV9 A;  4G19 A;  1GSQ A;  2R4V A;  4HUA A;  2VM1 A;  3LSZ A;  1IYH A;  1URM A;  5G1L A;  2C8U A;  2OE1 A;  2WVY A;  4K1F A;  3TKS C;  5D9V A;  3EU4 A;  3CTG A;  14GS A;  2C1Y A;  1M7T A;  1RW1 A;  4HOJ A;  4ECB A;  1EZK A;  3ZZX A;  3ME8 A;  3IC4 A;  5CP1 A;  5H5S A;  2LKU A;  1UVZ A;  3GL3 A;  2VL3 A;  1ACV A;  3DXB A;  2N5B A;  5ECQ B;  1K0O A;  2J9H A;  2YZU A;  1O8X A;  3GH9 A;  4K5S A;  1F9M A;  5HR2 A;  1U3A A;  5HFG A;  3PIN A;  2DBC A;  1WOU A;  4BL7 A;  4K0G A;  3KP9 A;  3TRX A;  2YOI A;  4E68 A;  4K7N A;  5FHI A;  3IV4 A;  2JAD A;  1OE8 A;  1XPV A;  3FY7 A;  2H6Z A;  1OC3 A;  4BVX A;  1GNW A;  4DSR A;  1RQM A;  5ELG A;  2V1M A;  2GTU A;  1B48 A;  1S3C A;  3DVX A;  4ZIJ A;  4XS4 B;  4TXO A;  1YY7 A;  2H1A A;  3EE2 A;  3HVV A;  1EGO A;  3HMJ G;  4WEY A;  5JWO B;  1DSB A;  4KF9 A;  2BJX A;  4MPG A;  2B7J A;  3FYG A;  1ON4 A;  1G7O A;  3C1R A;  2PBJ A;  4PQ1 A;  1T7P B;  2E2M A;  5A1N B;  3KEB A;  1M2D A;  5J5N A;  3M3M A;  1GLP A;  3F4T A;  1K0D A;  3QD9 A;  2CZ2 A;  3BCI A;  5DAL A;  3FZA A;  3MWH A;  2ZNM A;  1M2A A;  4HSC X;  5DCH A;  1NHO A;  1TK8 B;  5CRG A;  1Z7R A;  3QFB C;  4N11 A;  3ZVJ D;  3MAK A;  2FWG A;  3KD0 A;  2CVD A;  1TU7 A;  1GSD A;  3TKR A;  4O7H A;  1PL1 A;  1TU8 A;  3WGD A;  2BTO T;  5KEJ A;  3FK8 A;  2WW2 A;  2FWF A;  16GS A;  3FR6 A;  4RI6 A;  2HRK B;  3ERG A;  2YV9 A;  4Z7X A;  2HSH A;  1X5E A;  3GH6 A;  2P5R A;  1HNC A;  2V6K A;  2AUV A;  4F9Z A;  1B9X C;  5CRD A;  1K3Y A;  4NAX A;  1SJZ A;  5HFI A;  3E0U A;  5B8B A;  1DBY A;  3F4S A;  4N0V A;  1KBN A;  3QCP A;  3DEX A;  4PUF C;  3ZMK A;  3F3Q A;  5GST A;  3N9J A;  3KTB A;  2EFD A;  2GQM A;  3PGT A;  2KUC A;  5GZZ B;  3CHX C;  1AC1 A;  2LJR A;  4GQC A;  1FW1 A;  3M9K A;  3LYK A;  2R0C A;  4EKZ A;  3HHV A;  1AQW A;  5DAK A;  1SD9 A;  3U5R E;  1O85 A;  1M99 A;  4N3Z A;  2IL3 A;  3GKM A;  5DJM A;  5ECM B;  4ID0 A;  1MDK A;  3TKS E;  4GLT A;  4P3Y B;  4ZB8 A;  4Q5R A;  3DGQ A;  2GT5 A;  2VLT A;  3IXR A;  2VCQ A;  1WJK A;  2JZS A;  2DJK A;  1K0M A;  1G6W A;  1U87 A;  5HR1 A;  3G7I A;  2C0D A;  1V57 A;  2PN8 A;  1F3B A;  1EGR A;  5G31 A;  1S3A A;  3GX8 A;  6GSW A;  2ON5 A;  3WD6 A;  2RM5 A;  2ES7 A;  3Q74 A;  4CY8 A;  4NV5 A;  3I6A A;  1K0A A;  2C3Q A;  4ZBD A;  1XW5 A;  3M9J A;  1YF0 A;  3M0F A;  1SVO A;  2OA7 A;  2GVP A;  4KDU A;  4OFM A;  3UOM A;  1OC9 A;  4IJI A;  1XBS A;  4JED A;  4HS1 A;  5IMV A;  1XCC A;  1M3J A;  2WJU A;  4MJE A;  3D22 A;  4TR0 A;  1A23 A;  1TRU A;  1YZX A;  4TXV A;  2YWN A;  2DLX A;  4OO4 A;  2H70 A;  2XBQ A;  4D73 B;  1U6T A;  3UL3 A;  1OC8 A;  2JU5 A;  3LJR A;  3P90 A;  4ZB6 A;  4K2X A;  5KN0 A;  1YDK A;  4KSO A;  3MYD A;  2R6K A;  4TN8 A;  2VIM A;  3GFK A;  2VL2 A;  2QGV A;  4EDY A;  1UC7 A;  3GNJ A;  3ZML A;  1T3B A;  1ZL9 A;  1TXX A;  3VK9 A;  3LXZ A;  1PKW A;  1MEK A;  1TKD B;  1K3L A;  2YZH A;  4BVX B;  2JZR A;  2E2G A;  4A5P A;  5GAN D;  1M2B A;  4TXO B;  3KMN A;  2JAC A;  2WVX A;  2X49 A;  4I2T A;  1BG1 A;  2N5F A;  4ECC A;  3ZYW A;  3O76 A;  4PHZ C;  2N5A A;  3F6D A;  3L0H A;  1T8E B;  2OE3 A;  4K5R A;  1VRS D;  5DQS A;  3FHK A;  3ERF A;  3VUR A;  2VAF A;  2HQT A;  1GTB A;  2DKH A;  5HQP A;  4PX1 A;  1PD2 1;  1ERW A;  3ZFB A;  4I2U A;  1I5G A;  3W8S A;  3P8W A;  3ZRE A;  4Z2U A;  5DAL B;  4JBB A;  2IN3 A;  4XS1 A;  5E4W A;  5B6M A;  4OFT A;  4XS4 A;  1PKZ A;  1M0U A;  1MDI A;  4X43 A;  2B1L A;  2GT6 A;  4OCF A;  3QR6 A;  4RQX A;  3W8J A;  2AJQ B;  4EDZ A;  2HRN A;  2AB6 A;  4OO5 A;  1AQV A;  5ECI B;  1DE2 A;  4TR4 A;  1AQX A;  4O5Q A;  4HU7 A;  5IO2 A;  5LD0 A;  5A1N A;  3HY2 A;  4HEA 2;  1PGT A;  4JE1 A;  3PR8 A;  1X9S B;  2HT9 A;  4MLY A;  4ECJ A;  2B5X A;  2M46 A;  1DE1 A;  4AGS A;  5IMZ A;  3JCM L;  2O8V B;  2RLI A;  2IMI A;  1JZD A;  3WGE A;  4XCS A;  2PER A;  3EPT A;  1N2A A;  4OFN A;  1BJX A;  1BQ7 A;  22GS A;  2H71 A;  3F4R A;  2HZF A;  3V1W A;  1GSY A;  2EFH A;  3ZRD A;  2HRK A;  5JCU A;  5DAK B;  4FYB A;  2WFC A;  1SK1 A;  4IEL A;  1TRS A;  2B3S A;  2LRN A;  2NBS A;  2RUF A;  1Z9H A;  4V2L A;  4YKF A;  3I43 A;  5J4V A;  1XVW A;  3UEM A;  2LNS A;  5ELA A;  1BYE A;  2I9H A;  4F82 A;  3CSJ A;  2IFQ B;  5H5Q A;  3FZ4 A;  3TCO A;  3HD5 A;  2NTO A;  3HA9 A;  4AJ8 A;  4FQU A;  1EV4 A;  1SEN A;  4CY6 A;  2M80 A;  3UJ1 A;  1VF1 A;  2LJK A;  1ERU A;  3TKQ A;  2HSN B;  5LCZ A;  2YNX A;  3SBC A;  5H5R A;  4QL9 A;  1BF5 A;  3EVI A;  4IW9 A;  3DML A;  2YV7 A;  2KOK A;  1WIK A;  2O87 A;  2X64 A;  2HRF A;  2FWE A;  5BMU A;  2XPD A;  2GGT A;  1GTU A;  4AF2 A;  5AIV A;  3DVW A;  1SU9 A;  2QA2 A;  2CVB A;  1X9W B;  3EMP A;  3RDW A;  2VCW A;  1DUG A;  2EIO A;  4ACS A;  6GSV A;  3KJY A;  1XG8 A;  1HYU A;  3QMX A;  4MAB A;  4BWS A;  3HJO A;  5A5H A;  4GQF A;  3LOR A;  2EIR A;  4IHU A;  3HDC A;  1OC9 B;  3CRT A;  2MMN A;  4EIQ A;  3KTL A;  4TR1 B;  5FWG A;  4ZL9 A;  5IOW A;  2P0G A;  1TJD A;  1EP8 A;  4IQ1 A;  3TJK A;  2K9F A;  5IIZ A;  4XRD A;  4HZ2 A;  3Q6O A;  2WVZ A;  2UZ8 A;  1XW6 A;  2R37 A;  3CQF A;  1TDI A;  4MZC A;  3PPU A;  1VF2 A;  4FXY P;  2UV8 G;  9GSS A;  4HQZ A;  4IP6 A;  3ZLP A;  4EF0 A;  4MNN A;  5ENU A;  4PQI A;  1TP9 A;  3UBL A;  4ZBA A;  1FO5 A;  2DC5 A;  3GYK A;  1TI1 A;  4H86 A;  3O6T A;  2FY6 A;  1GL8 A;  1GSU A;  1B4Q A;  2X8C A;  2V41 A;  1QFN A;  5AGY A;  2WGR A;  12GS A;  1Y25 A;  2LST A;  2WVX B;  5G5E A;  1V98 A;  4K8M A;  4YQM A;  2ALB A;  2MMO A;  2A4V A;  4D73 A;  2E7P A;  1SVL A;  1GUL A;  1A2M A;  4QMK A;  2C0E A;  1V9W A;  2LJA A;  2H8L A;  4LA1 A;  2DJ0 A;  2GLR A;  1Y6E A;  1PSQ A;  5IO0 A;  4GTU A;  3VLN A;  5IMD A;  3L9S A;  4ML1 A;  4YKG A;  4PNF A;  2WW1 A;  4PNG A;  2EIQ A;  2YJ7 A;  2DSA A;  2H19 A;  20GS A;  4IVF A;  2R0P A;  2WDU A;  1A2J A;  1TRW A;  1TW9 A;  4YH2 A;  2WW0 A;  2I4A A;  1X0R A;  4GXZ A;  4KH7 A;  4FYU A;  2MBS A;  2LQQ A;  2F8F A;  3WYW A;  1O7U A;  2CT6 A;  2LEG A;  10GS A;  1LU4 A;  3D4M A;  2WW3 A;  3LXT A;  2HXK A;  2CAQ A;  4ICY A;  3IAM 2;  2F51 A;  2QA1 A;  5CRE A;  4I97 A;  5B7C A;  2HE3 A;  3LYP A;  3MDK A;  3J7Y k;  2VCV A;  1OE7 A;  3NIV A;  5J4Y A;  1PA3 A;  3CMI A;  2O3E A;  3F9U A;  4HQS A;  1ERT A;  2YWM A;  2VKZ G;  4NMU A;  2VUP A;  4KDY A;  2L4Q A;  5F0G A;  1K0N A;  1QGV A;  1GRX A;  3G7Y A;  4WBR D;  2H0H A;  4ZL7 A;  1NHY A;  2MMZ A;  18GS A;  2FNO A;  2VD0 A;  5C04 A;  3GUR A;  4J56 E;  1PL2 A;  4AKI A;  2LV3 A;  4NXI A;  1A0F A;  2HI7 A;  2C0F A;  1FG4 A;  1W89 A;  2CQ9 A;  2I3Y A;  1VF3 A;  1YEX A;  1G6Y A;  4F0B A;  2K8S A;  3HVN A;  3C73 A;  5IMA A;  4ECI A;  4WET A;  1SL2 B;  1F2E A;  2A2S A;  1PQN A;  2KLX A;  1ILO A;  1XXU A;  1JZO A;  5A4U A;  1WMJ A;  2OT3 A;  4O5U A;  1J08 A;  3A3T A;  3TUE A;  2H1G A;  2L6C A;  3I69 A;  2H66 A;  5BMU B;  4ZXG A;  3RHC A;  1LJR A;  1ABA A;  5GAP D;  1XIY A;  3KP8 A;  3W6G A;  2GZZ A;  3A5I A;  4TKY A;  4N30 A;  1PN9 A;  1YF1 A;  1PX6 A;  2VD1 A;  5A5H B;  3M8N A;  4LMV A;  2R3X A;  2IFQ A;  1UA5 A;  5IPH A;  2RUE A;  1SK2 A;  1SYR A;  3IC8 A;  3IK7 A;  4MCU A;  3RPN A;  1N25 A;  1R7H A;  3IBH A;  2HSN A;  4HU9 A;  3UVH A;  1JZR A;  1ZGN A;  3D4T A;  2GQK A;  4IGJ A;  3NZN A;  2M72 A;  1T1V A;  1QQ2 A;  4PI0 C;  2H6Y A;  3IHQ A;  1PMT A;  1TTZ A;  1ZZY A;  5AIS A;  2LNT A;  1SL0 B;  4TOP A;  1O73 A;  2JSZ A;  1Q98 A;  1Z6N A;  5J4U A;  5AIX A;  4E8E A;  4GCI A;  1OKT A;  4L5O A;  4CDO A;  1I1I P;  3E3E A;  4POL A;  3EUR A;  4QL7 A;  4G9H A;  2LQO A;  1XWG A;  4LL1 B;  2TIR A;  4PQH A;  4TR1 A;  1Z5Y E;  5JWR B;  2AAW A;  3KGK A;  1M9A A;  4GF0 A;  3TKS A;  3TU3 B;  2CAI A;  1QMV A;  4XS6 A;  2D2Z A;  2H1B A;  2WB9 A;  4PGT A;  4RQR A;  3D6I A;  3IA1 A;  1UN2 A;  2IJY A;  2VO4 A;  4AKH A;  4QQ7 A;  3HXS A;  4PI2 C;  3L78 A;  1ZYP A;  5IOX A;  5A34 B;  5JWQ B;  1SKW B;  5CRW A;  4KE3 A;  4NHW A;  4LL4 B;  3G9B A;  4N0Z A;  1XWC A;  3F0I A;  1SJ6 A;  2OE0 A;  1ML6 A;  2L5O A;  1R4W A;  4W66 A;  3DKS A;  2F3M A;  2VLU A;  4MDC A;  4IBP A;  4F0C A;  3U6V A;  5BRT A;  1R5A A;  4HDE A;  1GP1 A;  2QKE A;  1PFO A;  4DEJ A;  4YAV A;  1MD4 A;  8GSS A;  4ZBB A;  2DJJ A;  3GV1 A;  4MZW A;  17GS A;  3VI7 A;  2G2Q A;  1BX9 A;  1EEJ A;  4KB3 A;  3L9U A;  3ISO A;  1KNG A;  4O92 A;  2QSI A;  2H01 A;  4KA0 A;  3HKR A;  4K7O A;  1H75 A;  4ZL8 A;  1GUH A;  4BWQ A;  1Q4J A;  4YQU A;  3P7X A;  4X1U A;  4GWR A;  4IN0 A;  3P2A A;  1YQ1 A;  3GRX A;  1QXH A;  2B1K A;  4ZIL A;  1JLW A;  1X5C A;  2RII A;  1XWK A;  3F3R A;  2DML A;  2GS3 A;  1ZCP A;  5ID2 B;  1HQO A;  3BCK A;  3A5W A;  1YEW C;  1S3R A;  4DVC A;  2WZS A;  1I9D A;  4Q5N A;  2JSY A;  1AIU A;  4KCA A;  3FRC A;  5CO3 A;  4Z2T A;  3A2V A;  3GMF A;  1FAA A;  4EVM A;  4L8E A;  5ECR B;  3EIN A;  1U88 A;  11GS A;  3AY8 A;  1VGL A;  1ZYE A;  2O7K A;  5G5F A;  3C7M A;  6GST A;  3CRU A;  3H1N A;  3QOU A;  3H8Q A;  4DSS A;  1WP0 A;  4V1A p;  4J2F A;  4POM A;  3H79 A;  5ECN B;  3HJM A;  3R3E A;  2YPM A;  4EL1 A;  4CHS A;  3FW2 A;  5ECH B;  2H74 A;  5D9X A;  2GSQ A;  2J23 A;  3LWA A;  2YAN A;  3HJP A;  2X99 A;  1AXD A;  3GKN A;  2YN1 A;  3GL5 A;  4POB A;  1SKR B;  2IMD A;  5F07 A;  1E6B A;  2BMX A;  5ECS A;  2HFD A;  4EC0 A;  4L0U A;  1XZO A;  3VI5 A;  3TJB A;  3UMA A;  3MIX A;  5J9C A;  4MH3 A;  4POK A;  1Z6M A;  1USB A;  3H93 A;  4AKX B;  2O36 A;  3VFI A;  1SK0 A;  2DKI A;  5D8I A;  4OCE A;  2LUS A;  13GS A;  2C3T A;  4WF5 A;  4EIP A;  5IQY A;  2K6V A;  4USS A;  3TB2 A;  2X4A A;  2DJ3 A;  4CW9 A;  2KP2 A;  4NWY A;  3BD2 A;  1HNB A;  2WUL A;  3ZIT A;  2LRC A;  1SYX A;  5G1K A;  1AUC A;  2ZCT A;  3DYR A;  3HCZ A;  3UAP A;  5KOW A;  6GSX A;  5D9W A;  5G30 A;  3TRP A;  1XW9 A;  2GZP A;  3APO A;  2O85 A;  3EU3 A;  3KZQ A;  4PTS A;  3QAW A;  2K8V A;  4BIK A;  1BED A;  3EWL A;  1GTA A;  3UIW A;  3GN3 A;  5D73 A;  4K9Z A;  2REM A;  5EVO A;  3ERW A;  1B8X A;  1T4Z A;  1JZW A;  5B6N A;  2IWT A;  2YJH A;  4XTS A;  3CBU A;  2IPA A;  1WWJ A;  3IPZ A;  1PX7 A;  2JL4 A;  1THO A;  2XHF A;  1JLV A;  3GKX A;  4HZ4 A;  1QUW A;  4JR6 A;  1CQH A;  1WE0 A;  3RAZ A;  2YP6 A;  4GDF A;  3J7Y b;  3IR4 A;  3VWW A;  1KTE A;  4BVY B;  5ECK B;  3E9J B;  2XC2 A;  1MD3 A;  1YEP A;  2L6D A;  3TJJ A;  2X8G A;  4KSM A;  2WCI A;  4F03 A;  3FZ9 A;  1G7E A;  3QPM A;  2DJ2 A;  3GX0 A;  5A4W A;  1SVM A;  3ZTL A;  4OD7 A;  2ON7 A;  4ZB7 A;  2FCH A;  4WR5 A;  3GUS A;  1AAZ A;  2DIZ A;  4FO5 A;  3ED3 A;  3EMX A;  2YCD A;  4KUN A;  4XHM A;  3EYT A;  1V40 A;  1SD8 A;  3GTU B;  3LQ7 A;  3KCM A;  1XOA A;  2FLS A;  5A4V A;  2CZ3 A;  3CYN A;  2DJ1 A;  2X8H A;  2WRT A;  1C72 A;  3TDG A;  3GIX A;  4RUV A;  4AI6 A;  1EP7 A;  4WXT A;  2MBT A;  5A34 A;  3LEF A;  4TR3 A;  5IM9 A;  1YJ6 A;  1OKD A;  2GQL A;  3UAR A;  3KIJ A;  3MSZ A;  2O5V A;  1K0C A;  2HSM B;  4MPF A;  4EUY A;  2HZE A;  4KCE A;  5D96 A;  2VL2 C;  3HZ4 A;  1GUM A;  2L57 A;  1A24 A;  3WT1 A;  2A2P A;  3KH9 A;  4XIH A;  3WT2 A;  2FWH A;  2CVK A;  3H4K A;  1FHE A;  3RBT A;  1ST9 A;  3K8N A;  3RHB A;  5HR0 A;  5JCG A;  3F63 A;  4G0K A;  1BG5 A;  4EE0 A;  3QDN A;  4Q5Q A;  4YAP A;  2KHP A;  4JZQ A;  2F9S A;  2O89 A;  3LG6 A;  5IMF A;  1T00 A;  1ZMA A;  3LW9 A;  4IKH A;  3CSI A;  5DVB A;  1O8W A;  4DSS B;  3SWL A;  1HD2 A;  3ZL5 A;  1U3I A;  2C80 A;  2CX3 A;  3FR9 A;  4Z2R A;  2A4H A;  6GSS A;  4V2N A;  4JR4 A;  3F8U A;  3DWV A;  5ID2 A;  4FYC A;  3HVS A;  4KND A;  3D5J A;  4XRA A;  5ABR A;  2HRA A;  3M1G A;  2XBI A;  3ZFL A;  3R2Q A;  2H1D A;  1OVN A;  4LLR A;  2H76 A;  4PXO A;  3PH9 A;  3IAS 2;  4G2E A;  1CQG A;  1FVK A;  2PMT A;  1A2L A;  5J47 A;  2KP1 A;  4LMW A;  3RGB C;  4JU5 A;  2GST A;  1XOB A;  1GH2 A;  1XFL A;  5HFK A;  4G0L A;  1XVQ A;  3Q19 A;  2PU9 C;  2VLV A;  1XWA A;  4WKW A;  2WZ9 A;  1B4P A;  3GSS A;  2QC7 A;  4K7I A;  2VCX A;  2OJL A;  4DSQ A;  1GLQ A;  1SJI A;  3OR5 A; 
#chains in the Genus database with same CATH homology
 3BOA A;  2ZUP A;  5F8B A;  4IJ3 A;  1LBK A;  4I6X A;  4G10 A;  5CRH A;  1H4O A;  4KGI A;  1EOG A;  1FOV A;  5AN1 A;  5LNK e;  2EC4 A;  4TVE A;  5A5K A;  2IMF A;  7GSS A;  4IQA A;  3TOU A;  4G0I A;  5J3R A;  3QAV A;  3S9F A;  2P5Q A;  5ECL B;  3TJF A;  5F06 A;  2B5E A;  3UBK A;  4E8H A;  4K0N A;  1YVL A;  1AW9 A;  2WS2 A;  1VF4 A;  4KAE A;  2NPB A;  4K2D A;  2NDO A;  4YQV A;  4MJA A;  3I9V 2;  2C0G A;  2H73 A;  3BJ5 A;  4PUR A;  2B5Y A;  4L5L A;  3VWX A;  5ECP B;  5IPG A;  2GSS A;  1Y1U A;  4GSS A;  4OMV A;  1J9B A;  2NVL A;  3IK9 A;  2MZC A;  3G7J A;  4MF5 A;  2FHE A;  2TRX A;  3C1S A;  2LRT A;  2I1U A;  3D0Z A;  2V32 A;  1NSW A;  4AJ6 A;  3HVX A;  1PN0 A;  2F8A A;  5DBQ A;  1SL1 B;  3IOS A;  2FUG 2;  1X5D A;  4EXJ A;  3FEU A;  3QFA C;  2P31 A;  4V2M A;  4MP4 A;  5F05 A;  1ERV A;  3FMW A;  1TXU A;  1FB0 A;  3ZIJ A;  4O5R A;  1ZYQ B;  4OWY A;  3KMO A;  1PRX A;  1EWX A;  2OKA A;  3CSH A;  2GSR A;  3TJG A;  1FOH A;  1F6M C;  4MZB A;  3RPP A;  5CYY A;  2I81 A;  2PVQ A;  4BVY A;  1Z7P A;  4EO3 A;  4KW6 A;  5HR3 A;  5KN1 A;  2DIY A;  3LFL A;  4MJB A;  5INY A;  1G0T A;  1V58 A;  4PUA A;  4AJ7 A;  5E59 A;  1N8J A;  3D21 A;  1FB6 A;  1GUK A;  2OBI A;  1V2A A;  4NHZ A;  2GZY A;  5DCG A;  2HZE B;  1TI3 A;  4K6X A;  5L71 A;  3VPQ A;  1M9B A;  2PVO C;  1GTI A;  5DQY A;  2FA4 A;  3O3T A;  2B6M A;  5KOX A;  5D9T A;  4BL7 B;  3IE3 A;  3GTU A;  1EEM A;  2OAC A;  2HLS A;  1BAY A;  1MTC A;  1GNE A;  4GRF A;  5EY6 A;  1OYJ A;  5DDL A;  6GSY A;  3A2X A;  3ZIV A;  1YKC A;  2HYX A;  2TRC P;  4WBJ A;  4MF6 A;  2AYT A;  1TRV A;  1HNA A;  4MMM A;  1K3O A;  2FGX A;  3GA4 A;  3BBY A;  5J41 A;  5FT3 A;  2HSM A;  4TW5 A;  2XPE A;  1E2Y A;  4HJ2 A;  1QK8 A;  2H30 A;  3CXG A;  2H75 A;  2H72 A;  4ISD A;  1K0B A;  1T4Y A;  1B9Y C;  1IYI A;  4FIW A;  2CV4 A;  5IMC A;  1GWC A;  2AHE A;  4MJC A;  2OBK A;  3A2W A;  2DMM A;  2V2G A;  2VCT A;  3ZVJ A;  1WPI A;  3IDV A;  1WRY A;  3TKP A;  2H0G A;  2PUK C;  1SKS B;  2H6X A;  4MF7 A;  1S3D A;  4WF4 A;  2PPT A;  5J40 A;  1Z3E A;  2RM6 A;  3GST A;  4GST A;  1TK0 B;  2C4J A;  2YWO A;  5C00 A;  4L0W A;  2AV4 A;  2G0F A;  3TGZ A;  3KM6 A;  4BPY A;  4Q5F A;  2CA8 A;  4F2I A;  1EOH A;  2IME A;  2H0I A;  6GSU A;  2L5L A;  4N10 A;  2R0G A;  4J57 E;  1OAZ A;  19GS A;  3FR3 A;  1W4V A;  5COH A;  3TOT A;  3IRA A;  3QAG A;  2V6O A;  3TRQ A;  4NPB A;  1GSS A;  4I8B A;  2FD3 A;  5D93 A;  2IIY A;  1J0F A;  4O32 A;  5KN3 A;  3APS A;  3FKF A;  2VL9 A;  2EFC A;  4JRR A;  2EFE A;  1F37 A;  4G01 A;  5JCW A;  5G2Z A;  3GKK A;  2E0Q A;  4WR4 A;  4X0X A;  4GSN A;  5KN2 A;  1TK5 B;  1A0R P;  3APQ A;  1RK4 A;  1NM3 A;  3DIE A;  3IHG A;  2OAD A;  3KH7 A;  2C3N A;  4KX4 A;  3KXO A;  4KDX A;  3L4N A;  2B7K A;  1TOF A;  4ULX A;  5J9B A;  2JZT A;  2H1L A;  4I5Q A;  1R26 A;  4MH2 A;  2VCZ A;  4RI7 A;  4ZB9 A;  4X4J A;  4ILF A;  2LTK A;  5DJL A;  1GSE A;  5EPF A;  4HJM A;  1X9M B;  2GDR A;  2A2R A;  2IMK A;  1O81 A;  4V1A g;  2LS5 A;  1YKA A;  4ML6 A;  3CTF A;  3ME7 A;  3CWG A;  2VM2 A;  1R5P A;  1ZYN A;  3WGX A;  3F6F A;  1FVJ A;  4MK3 A;  3LGC A;  2K18 A;  2MYG A;  1F3A A;  4TRX A;  1NW2 A;  3EC3 A;  2R5G A;  1GSF A;  3FZ5 A;  4BA7 A;  4AKG A;  1A8L A;  3DD3 A;  4FH8 A;  1JHB A;  5GSS A;  3Q18 A;  3GHA A;  2L59 A;  3HYP A;  3C71 A;  4HI7 A;  3N5O A;  2CX4 A;  4IS0 A;  2PGT A;  2MMA A;  2HNL A;  4NV2 A;  2L4C A;  3DRN A;  2Z9S A;  3NOF A;  1THX A;  5B8A A;  3C8E A;  2PWJ A;  5CAX A;  2FA8 A;  1JFU A;  1O6J A;  1A8Y A;  3UVT A;  3VPT A;  1KEB A;  4IP1 A;  5CNW A;  4MA9 A;  3VWU A;  2VOC A;  3MNG A;  1MDJ A;  5EL8 A;  5ECO B;  2R2J A;  3HZ8 A;  1XWB A;  3US3 A;  3VWV A;  3L9V A;  2HSY A;  1ZOF A;  2YWI A;  1EV9 A;  4G19 A;  1GSQ A;  2R4V A;  4HUA A;  2VM1 A;  3LSZ A;  1IYH A;  1URM A;  5G1L A;  2C8U A;  2OE1 A;  3TKS C;  4K1F A;  5D9V A;  3EU4 A;  3CTG A;  14GS A;  2C1Y A;  1M7T A;  1RW1 A;  4HOJ A;  4ECB A;  1EZK A;  3ZZX A;  3ME8 A;  3IC4 A;  5CP1 A;  5H5S A;  2LKU A;  1UVZ A;  3GL3 A;  2VL3 A;  1ACV A;  3DXB A;  2N5B A;  5ECQ B;  1K0O A;  2J9H A;  2YZU A;  1O8X A;  3GH9 A;  4K5S A;  1F9M A;  5HR2 A;  1U3A A;  5HFG A;  3PIN A;  2DBC A;  1WOU A;  4BL7 A;  4K0G A;  3KP9 A;  3TRX A;  2YOI A;  4E68 A;  4K7N A;  5FHI A;  3IV4 A;  2JAD A;  1OE8 A;  1XPV A;  3FY7 A;  2H6Z A;  1OC3 A;  4BVX A;  1GNW A;  4DSR A;  1RQM A;  5ELG A;  2V1M A;  2GTU A;  1B48 A;  1S3C A;  3DVX A;  4ZIJ A;  4XS4 B;  4TXO A;  1YY7 A;  2H1A A;  3EE2 A;  3HVV A;  1EGO A;  3HMJ G;  4WEY A;  5JWO B;  1DSB A;  4KF9 A;  2BJX A;  4MPG A;  2B7J A;  3FYG A;  1ON4 A;  1G7O A;  3C1R A;  2PBJ A;  4PQ1 A;  1T7P B;  2E2M A;  5A1N B;  3KEB A;  1M2D A;  5J5N A;  3M3M A;  1GLP A;  3F4T A;  1K0D A;  3QD9 A;  2CZ2 A;  3BCI A;  5DAL A;  3FZA A;  3MWH A;  2ZNM A;  1M2A A;  5DCH A;  1NHO A;  1TK8 B;  5CRG A;  1Z7R A;  3QFB C;  4N11 A;  3ZVJ D;  3MAK A;  2FWG A;  3KD0 A;  2CVD A;  1TU7 A;  1GSD A;  3TKR A;  4O7H A;  1PL1 A;  1TU8 A;  3WGD A;  2BTO T;  5KEJ A;  3FK8 A;  2FWF A;  16GS A;  3FR6 A;  4RI6 A;  2HRK B;  3ERG A;  2YV9 A;  4Z7X A;  2HSH A;  1X5E A;  3GH6 A;  2P5R A;  1HNC A;  2V6K A;  2AUV A;  4F9Z A;  1B9X C;  5CRD A;  1K3Y A;  4NAX A;  1SJZ A;  5HFI A;  3E0U A;  5B8B A;  1DBY A;  3F4S A;  4N0V A;  1KBN A;  3QCP A;  3DEX A;  4PUF C;  3ZMK A;  3F3Q A;  5GST A;  3N9J A;  3KTB A;  2EFD A;  2GQM A;  3PGT A;  2KUC A;  5GZZ B;  1AC1 A;  2LJR A;  4GQC A;  1FW1 A;  3M9K A;  3LYK A;  2R0C A;  4EKZ A;  3HHV A;  1AQW A;  5DAK A;  1SD9 A;  3U5R E;  1O85 A;  1M99 A;  4N3Z A;  2IL3 A;  3GKM A;  5DJM A;  5ECM B;  4ID0 A;  1MDK A;  3TKS E;  4GLT A;  4P3Y B;  4ZB8 A;  4Q5R A;  3DGQ A;  2GT5 A;  2VLT A;  3IXR A;  2VCQ A;  1WJK A;  2JZS A;  2DJK A;  1K0M A;  1G6W A;  1U87 A;  5HR1 A;  3G7I A;  2C0D A;  1V57 A;  2PN8 A;  1F3B A;  1EGR A;  5G31 A;  1S3A A;  3GX8 A;  6GSW A;  2ON5 A;  3WD6 A;  2RM5 A;  2ES7 A;  3Q74 A;  4CY8 A;  4NV5 A;  3I6A A;  1K0A A;  2C3Q A;  4ZBD A;  1XW5 A;  3M9J A;  1YF0 A;  3M0F A;  1SVO A;  2OA7 A;  2GVP A;  4KDU A;  4OFM A;  3UOM A;  1OC9 A;  4IJI A;  1XBS A;  4JED A;  4HS1 A;  5IMV A;  1XCC A;  2WJU A;  4MJE A;  3D22 A;  4TR0 A;  1A23 A;  1TRU A;  1YZX A;  4TXV A;  2YWN A;  2DLX A;  4OO4 A;  2H70 A;  2XBQ A;  4D73 B;  1U6T A;  3UL3 A;  1OC8 A;  2JU5 A;  3LJR A;  3P90 A;  4ZB6 A;  4K2X A;  5KN0 A;  1YDK A;  4KSO A;  3MYD A;  2R6K A;  4TN8 A;  2VIM A;  3GFK A;  2VL2 A;  2QGV A;  4EDY A;  1UC7 A;  3GNJ A;  3ZML A;  1T3B A;  1ZL9 A;  1TXX A;  3VK9 A;  3LXZ A;  1PKW A;  1MEK A;  1TKD B;  1K3L A;  2YZH A;  4BVX B;  2JZR A;  2E2G A;  4A5P A;  5GAN D;  1M2B A;  4TXO B;  3KMN A;  2JAC A;  2X49 A;  4I2T A;  1BG1 A;  2N5F A;  4ECC A;  3ZYW A;  3O76 A;  2N5A A;  3F6D A;  3L0H A;  1T8E B;  2OE3 A;  4K5R A;  1VRS D;  5DQS A;  3FHK A;  3ERF A;  3VUR A;  2VAF A;  2HQT A;  1GTB A;  2DKH A;  5HQP A;  4PX1 A;  1PD2 1;  1ERW A;  3ZFB A;  4I2U A;  1I5G A;  3W8S A;  3P8W A;  3ZRE A;  4Z2U A;  5DAL B;  4JBB A;  2IN3 A;  4XS1 A;  5E4W A;  5B6M A;  4OFT A;  4XS4 A;  1PKZ A;  1M0U A;  1MDI A;  4X43 A;  2B1L A;  2GT6 A;  4OCF A;  3QR6 A;  4RQX A;  3W8J A;  2AJQ B;  4EDZ A;  2HRN A;  2AB6 A;  4OO5 A;  1AQV A;  5ECI B;  1DE2 A;  4TR4 A;  1AQX A;  4O5Q A;  4HU7 A;  5IO2 A;  5LD0 A;  5A1N A;  3HY2 A;  4HEA 2;  1PGT A;  4JE1 A;  3PR8 A;  1X9S B;  2HT9 A;  4MLY A;  4ECJ A;  2B5X A;  2M46 A;  1DE1 A;  4AGS A;  5IMZ A;  3JCM L;  2O8V B;  2RLI A;  2IMI A;  1JZD A;  3WGE A;  4XCS A;  2PER A;  3EPT A;  1N2A A;  4OFN A;  1BJX A;  1BQ7 A;  22GS A;  2H71 A;  3F4R A;  2HZF A;  3V1W A;  1GSY A;  2EFH A;  3ZRD A;  2HRK A;  5JCU A;  5DAK B;  4FYB A;  2WFC A;  1SK1 A;  4IEL A;  1TRS A;  2B3S A;  2LRN A;  2NBS A;  2RUF A;  1Z9H A;  4V2L A;  4YKF A;  3I43 A;  5J4V A;  1XVW A;  3UEM A;  2LNS A;  5ELA A;  1BYE A;  2I9H A;  4F82 A;  3CSJ A;  2IFQ B;  5H5Q A;  3FZ4 A;  3TCO A;  3HD5 A;  2NTO A;  3HA9 A;  4AJ8 A;  4FQU A;  1EV4 A;  1SEN A;  4CY6 A;  2M80 A;  3UJ1 A;  1VF1 A;  2LJK A;  1ERU A;  3TKQ A;  2HSN B;  5LCZ A;  2YNX A;  3SBC A;  5H5R A;  4QL9 A;  1BF5 A;  3EVI A;  4IW9 A;  3DML A;  2YV7 A;  2KOK A;  1WIK A;  2O87 A;  2X64 A;  2HRF A;  2FWE A;  5BMU A;  2XPD A;  2GGT A;  1GTU A;  4AF2 A;  5AIV A;  3DVW A;  1SU9 A;  2QA2 A;  2CVB A;  1X9W B;  3EMP A;  3RDW A;  2VCW A;  1DUG A;  2EIO A;  4ACS A;  6GSV A;  3KJY A;  1HYU A;  3QMX A;  4MAB A;  4BWS A;  3HJO A;  5A5H A;  4GQF A;  3LOR A;  2EIR A;  4IHU A;  3HDC A;  1OC9 B;  3CRT A;  2MMN A;  4EIQ A;  3KTL A;  4TR1 B;  5FWG A;  4ZL9 A;  5IOW A;  2P0G A;  1TJD A;  1EP8 A;  4IQ1 A;  3TJK A;  2K9F A;  5IIZ A;  4XRD A;  4HZ2 A;  3Q6O A;  2UZ8 A;  1XW6 A;  2R37 A;  1TDI A;  4MZC A;  3PPU A;  1VF2 A;  2UV8 G;  9GSS A;  4HQZ A;  4IP6 A;  3ZLP A;  4EF0 A;  4MNN A;  5ENU A;  4PQI A;  1TP9 A;  3UBL A;  4ZBA A;  1FO5 A;  2DC5 A;  3GYK A;  1TI1 A;  4H86 A;  3O6T A;  2FY6 A;  1GL8 A;  1GSU A;  1B4Q A;  2X8C A;  2V41 A;  1QFN A;  5AGY A;  2WGR A;  12GS A;  1Y25 A;  2LST A;  5G5E A;  1V98 A;  4K8M A;  4YQM A;  2ALB A;  2MMO A;  2A4V A;  4D73 A;  2E7P A;  1SVL A;  1GUL A;  1A2M A;  4QMK A;  2C0E A;  1V9W A;  2LJA A;  2H8L A;  4LA1 A;  2DJ0 A;  2GLR A;  1Y6E A;  1PSQ A;  5IO0 A;  4GTU A;  3VLN A;  5IMD A;  3L9S A;  4ML1 A;  4YKG A;  4PNF A;  4PNG A;  2EIQ A;  2YJ7 A;  2DSA A;  2H19 A;  20GS A;  4IVF A;  2R0P A;  2WDU A;  1A2J A;  1TRW A;  1TW9 A;  4YH2 A;  2I4A A;  1X0R A;  4GXZ A;  4KH7 A;  4FYU A;  2MBS A;  2LQQ A;  2F8F A;  3WYW A;  1O7U A;  2CT6 A;  2LEG A;  10GS A;  1LU4 A;  3D4M A;  3LXT A;  2HXK A;  2CAQ A;  4ICY A;  3IAM 2;  2F51 A;  2QA1 A;  5CRE A;  4I97 A;  5B7C A;  2HE3 A;  3LYP A;  3MDK A;  3J7Y k;  2VCV A;  1OE7 A;  3NIV A;  5J4Y A;  1PA3 A;  3CMI A;  3F9U A;  4HQS A;  1ERT A;  2YWM A;  2VKZ G;  4NMU A;  2VUP A;  4KDY A;  2L4Q A;  5F0G A;  1K0N A;  1QGV A;  1GRX A;  3G7Y A;  4WBR D;  2H0H A;  4ZL7 A;  1NHY A;  2MMZ A;  18GS A;  2FNO A;  2VD0 A;  5C04 A;  3GUR A;  4J56 E;  1PL2 A;  4AKI A;  2LV3 A;  4NXI A;  1A0F A;  2HI7 A;  2C0F A;  1FG4 A;  1W89 A;  2CQ9 A;  2I3Y A;  1VF3 A;  1YEX A;  1G6Y A;  4F0B A;  2K8S A;  3C73 A;  5IMA A;  4ECI A;  4WET A;  1SL2 B;  1F2E A;  2A2S A;  1PQN A;  2KLX A;  1ILO A;  1XXU A;  1JZO A;  5A4U A;  1WMJ A;  2OT3 A;  4O5U A;  1J08 A;  3A3T A;  3TUE A;  2H1G A;  2L6C A;  3I69 A;  2H66 A;  5BMU B;  4ZXG A;  3RHC A;  1LJR A;  1ABA A;  5GAP D;  1XIY A;  3KP8 A;  3W6G A;  2GZZ A;  3A5I A;  4TKY A;  4N30 A;  1PN9 A;  1YF1 A;  1PX6 A;  2VD1 A;  5A5H B;  3M8N A;  4LMV A;  2R3X A;  2IFQ A;  1UA5 A;  5IPH A;  2RUE A;  1SK2 A;  1SYR A;  3IC8 A;  3IK7 A;  4MCU A;  3RPN A;  1N25 A;  1R7H A;  3IBH A;  2HSN A;  4HU9 A;  3UVH A;  1JZR A;  1ZGN A;  3D4T A;  2GQK A;  4IGJ A;  3NZN A;  2M72 A;  1T1V A;  1QQ2 A;  2H6Y A;  3IHQ A;  1PMT A;  1TTZ A;  1ZZY A;  5AIS A;  2LNT A;  1SL0 B;  4TOP A;  1O73 A;  2JSZ A;  1Q98 A;  1Z6N A;  5J4U A;  5AIX A;  4E8E A;  4GCI A;  1OKT A;  4L5O A;  4CDO A;  3E3E A;  4POL A;  3EUR A;  4QL7 A;  4G9H A;  2LQO A;  1XWG A;  4LL1 B;  2TIR A;  4PQH A;  4TR1 A;  1Z5Y E;  5JWR B;  2AAW A;  3KGK A;  1M9A A;  4GF0 A;  3TKS A;  3TU3 B;  2CAI A;  1QMV A;  4XS6 A;  2D2Z A;  2H1B A;  2WB9 A;  4PGT A;  4RQR A;  3D6I A;  3IA1 A;  1UN2 A;  2IJY A;  2VO4 A;  4AKH A;  4QQ7 A;  3HXS A;  3L78 A;  1ZYP A;  5IOX A;  5A34 B;  5JWQ B;  1SKW B;  5CRW A;  4KE3 A;  4NHW A;  4LL4 B;  3G9B A;  4N0Z A;  1XWC A;  3F0I A;  1SJ6 A;  2OE0 A;  1ML6 A;  2L5O A;  1R4W A;  4W66 A;  3DKS A;  2F3M A;  2VLU A;  4MDC A;  4IBP A;  4F0C A;  3U6V A;  5BRT A;  1R5A A;  4HDE A;  1GP1 A;  2QKE A;  4DEJ A;  4YAV A;  1MD4 A;  8GSS A;  4ZBB A;  2DJJ A;  3GV1 A;  4MZW A;  17GS A;  3VI7 A;  2G2Q A;  1BX9 A;  1EEJ A;  4KB3 A;  3L9U A;  3ISO A;  1KNG A;  4O92 A;  2QSI A;  2H01 A;  4KA0 A;  3HKR A;  4K7O A;  1H75 A;  4ZL8 A;  1GUH A;  4BWQ A;  1Q4J A;  4YQU A;  3P7X A;  4X1U A;  4GWR A;  4IN0 A;  3P2A A;  1YQ1 A;  3GRX A;  1QXH A;  2B1K A;  4ZIL A;  1JLW A;  1X5C A;  2RII A;  1XWK A;  3F3R A;  2DML A;  2GS3 A;  1ZCP A;  5ID2 B;  1HQO A;  3BCK A;  3A5W A;  4DVC A;  1I9D A;  4Q5N A;  2JSY A;  1AIU A;  4KCA A;  3FRC A;  5CO3 A;  4Z2T A;  3A2V A;  3GMF A;  1FAA A;  4EVM A;  4L8E A;  5ECR B;  3EIN A;  1U88 A;  11GS A;  3AY8 A;  1VGL A;  1ZYE A;  2O7K A;  5G5F A;  3C7M A;  6GST A;  3CRU A;  3H1N A;  3QOU A;  3H8Q A;  4DSS A;  1WP0 A;  4V1A p;  4J2F A;  4POM A;  3H79 A;  5ECN B;  3HJM A;  3R3E A;  2YPM A;  4EL1 A;  4CHS A;  3FW2 A;  5ECH B;  2H74 A;  5D9X A;  2GSQ A;  2J23 A;  3LWA A;  2YAN A;  3HJP A;  2X99 A;  1AXD A;  3GKN A;  2YN1 A;  3GL5 A;  4POB A;  1SKR B;  2IMD A;  5F07 A;  1E6B A;  2BMX A;  5ECS A;  2HFD A;  4EC0 A;  4L0U A;  1XZO A;  3VI5 A;  3TJB A;  3UMA A;  3MIX A;  5J9C A;  4MH3 A;  4POK A;  1Z6M A;  1USB A;  3H93 A;  4AKX B;  3VFI A;  1SK0 A;  2DKI A;  5D8I A;  4OCE A;  2LUS A;  13GS A;  2C3T A;  4WF5 A;  4EIP A;  5IQY A;  2K6V A;  4USS A;  3TB2 A;  2X4A A;  2DJ3 A;  4CW9 A;  2KP2 A;  4NWY A;  3BD2 A;  1HNB A;  2WUL A;  3ZIT A;  2LRC A;  1SYX A;  5G1K A;  1AUC A;  2ZCT A;  3DYR A;  3HCZ A;  3UAP A;  5KOW A;  6GSX A;  5D9W A;  5G30 A;  3TRP A;  1XW9 A;  2GZP A;  3APO A;  2O85 A;  3EU3 A;  3KZQ A;  4PTS A;  3QAW A;  2K8V A;  1BED A;  3EWL A;  1GTA A;  3UIW A;  3GN3 A;  5D73 A;  4K9Z A;  2REM A;  5EVO A;  3ERW A;  1B8X A;  1T4Z A;  1JZW A;  5B6N A;  2IWT A;  2YJH A;  4XTS A;  3CBU A;  2IPA A;  1WWJ A;  3IPZ A;  1PX7 A;  2JL4 A;  1THO A;  2XHF A;  1JLV A;  3GKX A;  4HZ4 A;  1QUW A;  4JR6 A;  1CQH A;  1WE0 A;  3RAZ A;  2YP6 A;  4GDF A;  3J7Y b;  3IR4 A;  3VWW A;  1KTE A;  4BVY B;  5ECK B;  3E9J B;  2XC2 A;  1MD3 A;  1YEP A;  2L6D A;  3TJJ A;  2X8G A;  4KSM A;  2WCI A;  4F03 A;  3FZ9 A;  1G7E A;  3QPM A;  2DJ2 A;  3GX0 A;  5A4W A;  1SVM A;  3ZTL A;  4OD7 A;  2ON7 A;  4ZB7 A;  2FCH A;  4WR5 A;  3GUS A;  1AAZ A;  2DIZ A;  4FO5 A;  3ED3 A;  3EMX A;  2YCD A;  4KUN A;  4XHM A;  3EYT A;  1V40 A;  1SD8 A;  3GTU B;  3LQ7 A;  3KCM A;  1XOA A;  2FLS A;  5A4V A;  2CZ3 A;  3CYN A;  2DJ1 A;  2X8H A;  2WRT A;  1C72 A;  3TDG A;  3GIX A;  4RUV A;  4AI6 A;  1EP7 A;  4WXT A;  2MBT A;  5A34 A;  3LEF A;  4TR3 A;  5IM9 A;  1YJ6 A;  1OKD A;  2GQL A;  3UAR A;  3KIJ A;  3MSZ A;  2O5V A;  1K0C A;  2HSM B;  4MPF A;  4EUY A;  2HZE A;  4KCE A;  5D96 A;  2VL2 C;  3HZ4 A;  1GUM A;  2L57 A;  1A24 A;  3WT1 A;  2A2P A;  3KH9 A;  4XIH A;  3WT2 A;  2FWH A;  2CVK A;  3H4K A;  1FHE A;  3RBT A;  1ST9 A;  3K8N A;  3RHB A;  5HR0 A;  5JCG A;  3F63 A;  4G0K A;  1BG5 A;  4EE0 A;  3QDN A;  4Q5Q A;  4YAP A;  2KHP A;  4JZQ A;  2F9S A;  2O89 A;  3LG6 A;  5IMF A;  1T00 A;  1ZMA A;  3LW9 A;  4IKH A;  3CSI A;  5DVB A;  1O8W A;  4DSS B;  3SWL A;  1HD2 A;  3ZL5 A;  1U3I A;  2C80 A;  2CX3 A;  3FR9 A;  4Z2R A;  2A4H A;  6GSS A;  4V2N A;  4JR4 A;  3F8U A;  3DWV A;  5ID2 A;  4FYC A;  3HVS A;  4KND A;  3D5J A;  4XRA A;  5ABR A;  2HRA A;  3M1G A;  2XBI A;  3ZFL A;  3R2Q A;  2H1D A;  1OVN A;  4LLR A;  2H76 A;  4PXO A;  3PH9 A;  3IAS 2;  4G2E A;  1CQG A;  1FVK A;  2PMT A;  1A2L A;  5J47 A;  2KP1 A;  4LMW A;  4JU5 A;  2GST A;  1XOB A;  1GH2 A;  1XFL A;  5HFK A;  4G0L A;  1XVQ A;  3Q19 A;  2PU9 C;  2VLV A;  1XWA A;  4WKW A;  2WZ9 A;  1B4P A;  3GSS A;  2QC7 A;  4K7I A;  2VCX A;  2OJL A;  4DSQ A;  1GLQ A;  1SJI A;  3OR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...