5BMUA

The crystal structure of the gst-like domains complex of aimp3-eprs mutant c92sc105sc123s
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
165
Chain Sequence
HMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/ligase
molecule keywords Eukaryotic translation elongation factor 1 epsilon-1
publication title Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 165
sequence length 168
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5bmuA02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5bmuA01
5D9TA 4PURA 4OMVA 4YAPA 3TOTA 2PVQA 4MK3A 1K3YA 1GWCA 3I69A 5AN1A 2GSSA 5ELGA 1HQOA 3H1NA 1ML6A 1M0UA 6GSWA 3QAVA 5KEJA 1K0AA 3GURA 3LYKA 1LBKA 3DD3A 3NIVA 3LG6A 2WS2A 5ECNB 1GTUA 2IL3A 1K0MA 4MZWA 11GSA 4FQUA 2GSTA 1TU7A 1EV9A 2YV7A 1BX9A 5JCWA 3TGZA 5J41A 1E6BA 1GLQA 1G7OA 4CHSA 4YH2A 5ECPB 3O76A 5ECRB 2R4VA 4NHWA 2GLRA 5DAKB 2HRAA 2WJUA 2FHEA 2OA7A 1EOHA 2C3NA 5DDLA 4IELA 4IVFA 5DCGA 4Q5FA 3ISOA 2C4JA 4G0KA 5JCUA 1BYEA 2IMKA 2CAQA 4G10A 3O3TA 5D9WA 3CBUA 18GSA 1EEMA 1GSFA 3TOUA 3FY7A 2AHEA 2F3MA 3UAPA 1AXDA 3FRCA 3UBKA 1U88A 1PX7A 4GTUA 4Q5NA 2V6KA 1LJRA 3QAWA 3IK7A 5FT3A 2PGTA 1PD21 5ECIB 4HI7A 4ID0A 1RK4A 4IBPA 5BMUA 4I97A 1VF3A 2OACA 4GLTA 1IYIA 2UZ8A 3FR3A 4KGIA 4ACSA 2PMTA 2HQTA 3LSZA 3VURA 2WB9A 4ZB6A 1GUKA 3LFLA 1PX6A 1K0CA 5G5EA 4G0IA 2X64A 5AIVA 4PNGA 5GSTA 1GTIA 4YQMA 3Q18A 4MDCA 2D2ZA 4ZBDA 4GSTA 4KH7A 2HRKA 3LXZA 5ECHB 4L5LA 4L5OA 3VPTA 1OE8A 4GSNA 3VI5A 5J5NA 4G0LA 2HSMA 4QQ7A 1K0BA 1GLPA 1XW6A 6GSVA 1ZL9A 2CAIA 5J4UA 4KE3A 5ECOB 1K3OA 4JEDA 2CVDA 3IR4A 3ZFBA 1F3AA 1G6WA 3R3EA 3HJMA 4PTSA 1GSSA 3KTLA 2VCXA 4PGTA 2CZ2A 4KDUA 1M99A 1VF1A 1GSYA 1F3BA 1GTAA 4TOPA 6GSUA 4PX1A 1XWKA 1V40A 5EL8A 1USBA 3WD6A 4ECCA 1DUGA 3BBYA 5FWGA 4NHZA 6GSSA 4BL7A 3CSIA 4JZQA 5F06A 5F8BA 3W8SA 1GSUA 4GF0A 1A0FA 5D9XA 5LCZA 4RI6A 1IYHA 1GTBA 5EVOA 2FNOA 3VPQA 4MP4A 4BVYA 5DALB 4IKHA 2WRTA 3FR9A 1TDIA 5AGYA 3AY8A 2CZ3A 1BG5A 1YDKA 2VD1A 3P8WA 2OADA 1MD3A 1VF2A 4PNFA 1U3IA 4PUAA 4KAEA 2VCWA 2WDUA 1FHEA 1GUHA 3M8NA 2IMIA 5ECSA 1Y6EA 1YQ1A 2JL4A 4KX4A 1AQVA 3L0HA 1PL2A 2R5GA 5D9VA 3KJYA 1OYJA 4WR5A 2R6KA 20GSA 3GSTA 4IW9A 4DEJA 3FYGA 3CRTA 3GUSA 3CSHA 1HNCA 2YCDA 4BVXB 1HNBA 1PMTA 4YQUA 1GSEA 2F8FA 3IK9A 3C8EA 4PXOA 6GSTA 1NHYA 2R3XA 1GUMA 3GTUA 3ZFLA 3M3MA 5LD0A 22GSA 1B8XA 1AW9A 1JLWA 1YJ6A 2CA8A 3N5OA 2NTOA 1K0DA 4ZBAA 5A4UA 4KF9A 3D0ZA 4EC0A 4JBBA 3KM6A 2AAWA 19GSA 4K0GA 1OKTA 2VCVA 4Q5RA 3MAKA 1K3LA 2C80A 4F0BA 4ZB9A 3G7IA 10GSA 5DQSA 6GSXA 4O92A 5F05A 3R2QA 13GSA 1N2AA 2N5FA 4IS0A 4ECIA 4KDXA 2HSNB 5ECKB 4IQ1A 2DSAA 4E8EA 1MD4A 1YKCA 3G7JA 5F07A 1PN9A 5HFKA 4EXJA 1PGTA 5ECLB 1M9BA 2VD0A 2HRKB 4K0NA 3HKRA 5GSSA 1TU8A 3EINA 1V2AA 4O7HA 2HSMB 3LYPA 2J9HA 1AQWA 4IGJA 3MDKA 5A4WA 1KBNA 2GTUA 2PBJA 1GNWA 3VLNA 3PR8A 1B4PA 5DAKA 1B48A 3PPUA 3U6VA 4MPGA 4KDYA 4G19A 5IQYA 2ON7A 2AB6A 2HNLA 2GSRA 4J2FA 4USSA 1U87A 5A5KA 4IJIA 4F0CA 4AGSA 4YQVA 4ISDA 3ERGA 1JZRA 3IC8A 17GSA 4ECBA 4ZXGA 1C72A 4RI7A 2C3QA 1G6YA 1UA5A 5ECMB 2VCTA 4EDYA 3KXOA 4HZ4A 3WYWA 1OE7A 2DC5A 2C8UA 2VO4A 4BL7B 4PQIA 4LMWA 5GZZB 5B7CA 2VCZA 4MF7A 1Z9HA 1F2EA 1PKWA 3VWXA 4GCIA 4MF6A 5F0GA 3GH6A 1HNAA 2PERA 4EE0A 16GSA 3IBHA 14GSA 1AQXA 1EOGA 1YY7A 1K0OA 1ZGNA 2A2RA 2C3TA 3GX0A 5EY6A 4BVYB 1GNEA 3M1GA 4OFMA 4ECJA 7GSSA 1PA3A 4BVXA 3GSSA 4MF5A 3LXTA 1PL1A 2GSQA 1R5AA 4LMVA 3N9JA 3UVHA 3F6DA 4HOJA 12GSA 4MPFA 4N0VA 1Q4JA 1XWGA 4E8HA 1JLVA 5AISA 4ZBBA 4WR4A 4YAVA 3ERFA 4HZ2A 3KMNA 4L8EA 2A2SA 3LJRA 2GDRA 5ELAA 1FW1A 1PKZA 1XW5A 4HJ2A 9GSSA 3RBTA 3EE2A 1EV4A 1MTCA 1TW9A 3KMOA 4OFTA 4ZB8A 3LQ7A 3Q74A 3HJOA 4GSSA 8GSSA 1VF4A 1BAYA 3FR6A 5FHIA 3F63A 2VCQA 4OFNA 1M9AA 2YV9A 3F6FA 3I6AA 3VI7A 3CSJA 5G5FA 3IE3A 3DGQA 3QAGA 4KSMA 5ECQB 6GSYA 3VK9A 3UARA 3CRUA 3GTUB 2LJRA 1GSDA 1GSQA 4EDZA 4Q5QA 3ZMKA 3UBLA 4F03A 4IQAA 5DJMA 4NAXA 4PQHA 3QR6A 3Q19A 2ON5A 3M0FA 3PGTA 3P90A 1GULA 3ZMLA 1K0NA 4G9HA 5D73A 5A4VA 3SWLA 5DALA 5AIXA 5DJLA
chains in the Genus database with same CATH superfamily
4YKGA 2KP2A 1F9MA 1ML6A 3QAVA 1XG8A 1Z7RA 1XWCA 1UC7A 3LG6A 4XCSA 4OO5A 4I2UA 2IL3A 1OKDA 1XWBA 1K0MA 4MZWA 11GSA 1WP0A 2MYGA 5JCWA 1PN0A 1G7OA 2B5YA 5IMCA 5ECPB 1SVOA 3VFIA 2FHEA 3FHKA 2OA7A 3KTBA 3QD9A 3KIJA 2C3NA 1ERVA 1SK2A 2OE3A 4G0KA 3D6IA 5D96A 4V2MA 3TJKA 3ZREA 1BYEA 4I8BA 2CAQA 2FWHA 4NXIA 5ENUA 1GSFA 2OJLA 3TOUA 4DSSA 2EIQA 1X9MB 3UAPA 2I81A 3DXBA 4K7OA 3QDNA 1SYXA 1OVNA 3HA9A 1SD8A 1M7TA 2B1KA 5B8BA 1PD21 3TKRA 2X8CA 4ID0A 3TKSE 4K5RA 2HRFA 3H79A 4ML6A 1VF3A 3CXGA 4ACSA 3RGBC 3FR3A 3F8UA 2VLUA 4K1FA 4QL7A 3ZL5A 4ZB6A 1PX6A 1K0CA 2X64A 4PNGA 3HDCA 2HSNA 1GRXA 2D2ZA 4GSTA 3BCIA 3TB2A 1QK8A 5ECHB 2KLXA 3VPTA 2V32A 3VI5A 5DQYA 4G0LA 2HSMA 4QQ7A 3GKMA 3HVSA 4L0WA 1ZL9A 2H1DA 2X4AA 1ERTA 5G30A 2MMAA 4PTSA 1TJDA 2YZHA 3L78A 1EP7A 3EYTA 4KA0A 1DBYA 4DSRA 5CRGA 1GSYA 1QGVA 4TOPA 2VLVA 1SK0A 1V40A 5EL8A 4RQXA 3WD6A 4AJ6A 4BL7A 3CSIA 4TR1A 5F8BA 2H71A 3C73A 1O7UA 4TXOA 4Z2UA 2L59A 5J9CA 1A0FA 2GZZA 5LCZA 1Y1UA 2X49A 5INYA 2WW3A 3VPQA 2JZTA 4MP4A 2GVPA 5IM9A 1QQ2A 5J9BA 4O32A 3HVXA 5AGYA 1H4OA 1A2MA 2WVYA 4LL1B 1BG5A 2IN3A 1NM3A 4LA1A 2GT6A 3DKSA 4V1Ap 1T8EB 2QGVA 4K2DA 3P8WA 5COHA 1T00A 4PNFA 1U3IA 1UN2A 1YEPA 2VCWA 1TK8B 2HZEB 4F82A 4J56E 1M2DA 1GUHA 3GL3A 2IMIA 2K6VA 4WBJA 1Y6EA 3D5JA 1KNGA 1ZYPA 1TI1A 1YQ1A 1R7HA 2DJ2A 3GKNA 4L0UA 2VOCA 3HY2A 5D9VA 4HSCX 1XVWA 2K8VA 1YEWC 2V6OA 2O7KA 4MH3A 4TN8A 4IP1A 3A2VA 2R6KA 1G7EA 4DEJA 2TRXA 2OE0A 1TKDB 4MA9A 4N3ZA 1HNBA 4XIHA 3M9KA 4N30A 1ZYEA 5J3RA 4HEA2 4GQCA 5IMFA 2X8HA 3IXRA 1AW9A 2XBIA 4W66A 2NTOA 1K0DA 3ERWA 2YJ7A 1T4YA 4NWYA 2R0PA 4JBBA 2KP1A 3KM6A 2VCVA 3MAKA 1OC9B 5CAXA 3U5RE 3E0UA 3F0IA 3TKPA 5HR3A 4POBA 5F05A 5B6NA 1AAZA 5ID2B 4ZL9A 4KDXA 2DJ3A 4IQ1A 3H8QA 1MD4A 1YKCA 1PGTA 2VD0A 3EPTA 3S9FA 4K0NA 3HKRA 4O7HA 4AI6A 1SJIA 3IPZA 2I9HA 2GTUA 1KTEA 1Z6MA 4ZILA 3PR8A 1PFOA 3UOMA 2A4HA 5KN2A 4X0XA 3EU4A 4RQRA 3KZQA 2CX4A 2GSRA 4USSA 1U87A 1AC1A 3MNGA 1Z5YE 4YQVA 3IC8A 2F51A 17GSA 4ECBA 2HFDA 3ZITA 1C72A 4RI7A 2C3QA 4MJBA 3EC3A 4POKA 4EIPA 2C8UA 4CY6A 1J9BA 2VO4A 3APSA 4P3YB 3KCMA 4MF7A 2A2PA 2H1GA 4I5QA 3VWXA 4WF5A 2PVOC 4N0ZA 1TP9A 4MNNA 3F9UA 16GSA 3IBHA 5EY6A 1O81A 2H30A 2JACA 3O6TA 3EWLA 2DIYA 1PA3A 2FWFA 3WT1A 4MF5A 2L6CA 5H5SA 3VWUA 1XBSA 5IPHA 3UVHA 4NV5A 2OKAA 3FEUA 1WJKA 12GSA 2LTKA 1XWGA 1AUCA 4ZBBA 2NVLA 2H6YA 2F8AA 3KMNA 2A2SA 3LJRA 2GDRA 4AKGA 4QL9A 3MWHA 1TI3A 3RBTA 3DVWA 3ZIVA 4OCFA 3LQ7A 3RPPA 3ZZXA 1XPVA 3F63A 4YKFA 5ID2A 1JHBA 2IMFA 2YV9A 3I6AA 1TOFA 2C0FA 2CVBA 1M2BA 4FIWA 2I3YA 4Z7XA 4TKYA 3QAGA 3TRQA 1F37A 3VK9A 3GYKA 3CRUA 3ME8A 1TK5B 3GTUB 3RDWA 1XOAA 3EVIA 1A2LA 2GT5A 5J47A 4EDZA 1AIUA 5DJMA 4PQHA 3Q19A 2HXKA 1U6TA 3P90A 4XS1A 1GULA 2GS3A 2PUKC 5A4VA 5DALA 2L57A 3BD2A 5D93A 4YAPA 3TOTA 4POMA 4MK3A 1GWCA 4XHMA 1TRSA 3UEMA 5KEJA 2CQ9A 3GURA 3NIVA 4XS4A 1OC3A 5ECNB 1X5CA 2MMZA 4N10A 1H75A 3GKXA 2GQLA 4AF2A 1QMVA 1E2YA 1T4ZA 2HI7A 5J4YA 5KN0A 2C0EA 1J0FA 2HZFA 2H0IA 5ECRB 2GLRA 4XTSA 2AUVA 4Q5FA 5JCUA 2QSIA 2EIRA 3CTFA 3CBUA 4JR6A 2HRNA 3FY7A 2TIRA 2VLTA 2AHEA 1BQ7A 1M2AA 2H72A 4Q5NA 1I9DA 2V6KA 1YZXA 1LJRA 3IC4A 5FT3A 2DJKA 3DYRA 4IBPA 5BMUA 2K18A 2F9SA 2YANA 2OACA 4KGIA 1OAZA 2HQTA 1V57A 3LSZA 2WB9A 4JE1A 2B5XA 5AIVA 4MCUA 4HDEA 1T7PB 3DEXA 4ZBDA 2A4VA 4DSQA 5A34B 4KH7A 2M72A 2P5QA 4ZIJA 4L5LA 2H1BA 2RIIA 5JWOB 1CQGA 1TRVA 3FK8A 1GLPA 2WVZA 4PQ1A 1CQHA 2CAIA 2REMA 4KE3A 3F3QA 4JEDA 2O36A 3L4NA 3R3EA 3KH9A 4LLRA 1O73A 1JZWA 4PGTA 4GWRA 2MMOA 2N5AA 1SJZA 4PX1A 4WF4A 3RHCA 2H8LA 2K8SA 3ED3A 3V1WA 3UMAA 4JZQA 4A5PA 5D8IA 2PU9C 2P31A 4GF0A 5D9XA 2I4AA 3IHGA 1IYHA 1WIKA 2FNOA 5J4VA 4QMKA 2B5EA 3L9UA 1YF0A 1ACVA 2YWIA 4IKHA 1Z6NA 3FR9A 3GMFA 4ZB7A 3AY8A 2CZ3A 4HU9A 1YDKA 2VD1A 4K9ZA 3G7YA 2OADA 2DJJA 5HR0A 3I43A 2WDUA 3CHXC 1FHEA 2VUPA 1NHOA 4O5QA 5ECSA 2JL4A 1AQVA 1XXUA 2C0GA 3L0HA 2V2GA 4K7IA 1V9WA 3W6GA 4MZBA 2FY6A 1OYJA 4WR5A 2DMMA 20GSA 3TKQA 3CRTA 3IAM2 2WFCA 3CSHA 1HNCA 4BVXB 4YQUA 2LNTA 4PHZC 4V1Ag 6GSTA 1NHYA 1GUMA 3ZFLA 3M3MA 5LD0A 2CA8A 1RW1A 5CRHA 3N5OA 5A4UA 3D0ZA 2DKIA 2V41A 4PI0C 2M46A 3NOFA 4NV2A 3KH7A 2QC7A 3F4TA 2C80A 4ZB9A 2X8GA 6GSXA 4O92A 4NPBA 3R2QA 13GSA 4OWYA 4EKZA 4TR4A 4IS0A 3MIXA 4FYUA 4E8EA 2H0GA 3G7JA 4O5UA 1XIYA 5F07A 1PN9A 4EXJA 2P0GA 5ECLB 3SBCA 1M9BA 1YF1A 4FH8A 2XBQA 4I6XA 2HRKB 1FG4A 5GSSA 1RQMA 2L6DA 1WOUA 3LORA 1X5DA 3GV1A 3LYPA 4IGJA 2EFHA 5A4WA 2WULA 1GNWA 2FUG2 3CTGA 2H75A 2VM1A 1SK1A 4KDYA 4G19A 2FCHA 2IPAA 5IQYA 2ON7A 2LNSA 1FB0A 2HYXA 2EFDA 4AGSA 4ISDA 3RFRC 1N25A 4KCAA 2G2QA 2OBKA 2YOIA 5HR1A 2WVXB 4FYCA 5ECMB 2VIMA 4IHUA 3W8JA 4JU5A 1MEKA 4LMWA 5GZZB 5B7CA 5CNWA 2VCZA 2ZNMA 1O8XA 1F2EA 1PKWA 2L4CA 4GCIA 4AKXB 2OBIA 4TR0A 3GH6A 2L5OA 4EE0A 2LRCA 1NSWA 1YY7A 2E2MA 4BVYB 1WRYA 4BVXA 3GSSA 1ZZYA 3LWAA 1FAAA 3FZ9A 2VAFA 4LMVA 2LRNA 2B3SA 1EWXA 4HOJA 5CP1A 2RLIA 4MPFA 4N0VA 1PQNA 4XS6A 2LJKA 5C04A 5IMDA 3G9BA 1M3JA 5AISA 4YAVA 4TRXA 4I2TA 5IMAA 2LJAA 1FW1A 1SKRB 1XW5A 4HJ2A 9GSSA 2YZUA 3EE2A 4X43A 1TW9A 2BTOT 5CRDA 3Q74A 3HJOA 2JU5A 1VF4A 4ILFA 4WBRD 2FWEA 3IOSA 2VCQA 1ERUA 4PI2C 5B6MA 2YWNA 4FXYP 4MABA 3C7MA 1X9WB 3GL5A 4KSMA 2YWMA 2O87A 2H73A 4ICYA 2KOKA 1GSDA 1SD9A 5ABRA 4Q5QA 1JZDA 2ON5A 3M0FA 3ZMLA 5IOWA 2E0QA 5D73A 4DVCA 5AIXA 5D9TA 2LQOA 4PURA 4OMVA 5GAND 4AKIA 5ELGA 4TR3A 5L71A 1HQOA 6GSWA 4MJAA 1K0AA 3GA4A 3DD3A 3ZVJA 1B4QA 3RHBA 2WS2A 1I5GA 3ZIJA 2HZEA 1GTUA 3KP8A 1TU7A 2YV7A 2H66A 3TJBA 3TGZA 3MYDA 3ZVJD 1GLQA 2VKZG 1T3BA 2YN1A 4CHSA 4YH2A 3O76A 2VL9A 4NHWA 3QMXA 2NBSA 5DAKB 2WJUA 1SJ6A 2FA4A 3IAS2 4IVFA 3LW9A 3ISOA 2CX3A 2C4JA 5JCGA 2O8VB 3O3TA 3D4TA 4WETA 1O85A 18GSA 4EF0A 4E68A 5G2ZA 5H5RA 3HJPA 2E2GA 1AXDA 4KUNA 3FRCA 1OC8A 2LV3A 3BCKA 3QAWA 4BIKA 4D73B 2XHFA 4NMUA 1S3RA 1RK4A 4KCEA 4I97A 1OC9A 4XRAA 3RAZA 2PMTA 4GRFA 1A24A 1GUKA 3LFLA 5BRTA 3HD5A 5G5EA 3BOAA 4N11A 1GTIA 4MDCA 5DBQA 4XRDA 2ALBA 5J5NA 1K0BA 1XW6A 4V2NA 2K9FA 5IIZA 5ECOB 1ZYQB 2DJ1A 3ZFBA 4O5RA 3HJMA 3Q6OA 1LU4A 1GSSA 2R37A 4IP6A 3FZ4A 2CZ2A 4KDUA 1M99A 1S3CA 1F3BA 4TVEA 4IN0A 5IMZA 1XZOA 1ON4A 1XWKA 1DUGA 1FOVA 2FLSA 6GSSA 4NHZA 3W8SA 5KN3A 3VWVA 5DCHA 3P7XA 3DWVA 1DE2A 3WT2A 4RI6A 2DJ0A 1GTBA 5EVOA 1W89A 2G0FA 3RPNA 3HXSA 3DMLA 5J40A 3H93A 3EURA 2J23A 2AV4A 1MD3A 1VF2A 4KAEA 2JZRA 3HYPA 2GQKA 2H70A 2QA2A 3EU3A 3M8NA 5GAPD 2WW2A 1FVKA 3QPMA 3CWGA 2P5RA 4BA7A 2IMDA 4FO5A 1FB6A 3PH9A 2NDOA 3HZ8A 1B9YC 4IJ3A 3L9VA 4X1UA 3IV4A 5IO0A 4H86A 3LEFA 1GSEA 2F8FA 2XPDA 3IK9A 3C8EA 1SU9A 2H76A 3GTUA 4DSSB 4EL1A 22GSA 3GN3A 1YJ6A 4WEYA 1A0RP 4ZBAA 3J7Yk 4KF9A 3GKKA 5HFGA 4K0GA 1OKTA 3FKFA 4Q5RA 3K8NA 5JWRB 1K3LA 1FOHA 3J7Yb 3C71A 4F0BA 3GNJA 4F2IA 3GX8A 3G7IA 10GSA 5DQSA 1Q98A 1N2AA 2N5FA 2HSYA 2JSYA 2HSNB 2C0DA 5ECKB 4K2XA 3FW2A 5HFKA 2UV8G 4K6XA 3US3A 1EGRA 2C1YA 3TJGA 1ERWA 3TJFA 2WCIA 1PSQA 2NPBA 1V2AA 2HLSA 2HSMB 1SL2B 1KBNA 2QA1A 3TKSA 2V1MA 3P2AA 2YP6A 4J57E 5KOXA 1MDIA 1B48A 3U6VA 1A8LA 4MPGA 5A1NB 4K5SA 1SL0B 2B1LA 1A23A 4J2FA 5CREA 4IJIA 4WKWA 4F0CA 2YWOA 3ERGA 1JZRA 4ZXGA 1UVZA 1Y25A 3IHQA 1SVLA 4KW6A 3PINA 1G6YA 2OE1A 4JRRA 4EDYA 2VCTA 3E9JB 1QXHA 4CY8A 3KXOA 3WYWA 2MMNA 4BL7B 2B6MA 4TR1B 5G1KA 1FO5A 4MZCA 2H01A 4TXOB 1Z9HA 5IPGA 1XCCA 1R26A 5F0GA 5KOWA 3HVNA 14GSA 3ME7A 1U3AA 5IO2A 1AQXA 2L5LA 2C3TA 1ZGNA 3GX0A 1SL1B 1YVLA 3ZTLA 1GNEA 4OFMA 4ECJA 2VM2A 2WZ9A 2PWJA 3LXTA 3H4KA 4GXZA 2Z9SA 5C00A 5A5HB 4G01A 5A34A 2FGXA 1JLVA 4FYBA 3ERFA 2B7KA 3CMIA 3F4SA 5ELAA 3GFKA 1TRUA 2MBTA 1PKZA 1MDKA 1JFUA 1EV4A 4BWSA 1MTCA 4OFTA 4GSSA 8GSSA 5FHIA 3TKSC 4OFNA 3F6FA 1G0TA 1TK0B 3CSJA 2ES7A 5G5FA 1EGOA 3GRXA 3DGQA 2DKHA 4HU7A 5ECQB 4K8MA 3FZ5A 4PUFC 2LJRA 2WGRA 3TCOA 2H19A 1GSQA 1O8WA 3UBLA 4F03A 2L4QA 4TW5A 2H0HA 4AKHA 3QR6A 2IFQB 1BF5A 5A1NA 1ST9A 5CRWA 4CW9A 3A3TA 1K0NA 4G9HA 5G31A 2O85A 3SWLA 5LNKe 3VURA 5DJLA 2DBCA 1DSBA 3DRNA 1BJXA 3DVXA 2XPEA 1ABAA 2PVQA 1K3YA 3I69A 5AN1A 2GSSA 1M3IA 3H1NA 3D22A 1M0UA 2IJYA 3TJJA 2JADA 3GH9A 3LYKA 1LBKA 1I1IP 3GIXA 3ZLPA 3UIWA 2YJHA 1W4VA 1XWAA 4FQUA 2GSTA 2FA8A 1EV9A 2KHPA 1S3AA 1BX9A 2M80A 2YPMA 1GP1A 5J41A 1E6BA 3UVTA 4EVMA 1GH2A 2R4VA 5G1LA 1A2JA 2WW0A 2HRAA 1XVQA 1EOHA 5DDLA 2FD3A 4IELA 5A5HA 5DCGA 3EMXA 2WW1A 2PN8A 2IMKA 4G10A 5D9WA 1EEMA 3HCZA 1EP8A 2ZCTA 1R5PA 2F3MA 3UBKA 1U88A 1PX7A 4GTUA 3IK7A 4CDOA 2PGTA 5ECIB 3A2XA 4HI7A 5E4WA 4RUVA 4TXVA 3VWWA 3L9SA 4GLTA 1IYIA 2UZ8A 2LSTA 3A5IA 3KGKA 2LEGA 1A8YA 4G0IA 4KSOA 4Z2RA 4ZL8A 1EEJA 5GSTA 4YQMA 2RM5A 2I1UA 1HYUA 3Q18A 1TXXA 2EIOA 3I9V2 2R0CA 5DVBA 2HRKA 3LXZA 3IA1A 4L5OA 2IMEA 1OE8A 4GSNA 1R4WA 2IFQA 3E3EA 3WGDA 3TU3B 3TUEA 6GSVA 3QOUA 4KB3A 4MMMA 5J4UA 1WE0A 3APOA 1THOA 1K3OA 2CVDA 3IR4A 2LUSA 4HQZA 1QFNA 1F3AA 1G6WA 3BJ5A 2N5BA 2VL3A 3KTLA 2VCXA 5CYYA 2GQMA 2XC2A 1ZCPA 1F6MC 4F9ZA 3WGEA 3KD0A 1VF1A 1SKWB 3FMWA 3JCML 1GTAA 2YNXA 1BEDA 5EPFA 6GSUA 3IDVA 2H74A 2E7PA 1XFLA 4MH2A 2WVXA 1KEBA 2KUCA 2QKEA 1USBA 2DLXA 4HJMA 4ECCA 3BBYA 4HQSA 5FWGA 1XW9A 2GZPA 5F06A 2R2JA 1X0RA 5CO3A 2HSHA 2TRCP 4ULXA 2CVKA 1GSUA 3QCPA 3M9JA 1B9XC 4OCEA 3QFBC 4BVYA 4AJ8A 2RUFA 5DALB 2HT9A 2WRTA 1TDIA 3HMJG 2EC4A 1MDJA 2CV4A 3CYNA 2B7JA 3DIEA 4PUAA 2GZYA 4XS4B 2FWGA 4OD7A 4WXTA 5H5QA 1NW2A 2O89A 3CQFA 4KX4A 4EIQA 1SENA 1PL2A 3FZAA 1EZKA 1V98A 1ZMAA 2VL2A 2R5GA 5B8AA 2AJQB 3F3RA 5HFIA 3KJYA 2H1LA 1WPIA 2LS5A 2H1AA 4HS1A 3GSTA 4IW9A 3TRXA 3FYGA 3WGXA 4GQFA 3GUSA 2YCDA 1WWJA 4X4JA 1PMTA 1T1VA 4PXOA 1PRXA 2R3XA 1B8XA 1Z7PA 2MZCA 1JLWA 4HUAA 1J08A 2JSZA 2R0GA 4EC0A 1GL8A 2DMLA 2AAWA 19GSA 2DIZA 5BMUB 3KP9A 1X9SB 2LRTA 1TTZA 4JR4A 2OT3A 3EMPA 4ZL7A 4MJCA 5HQPA 3C1SA 4ECIA 2DSAA 3TRPA 2ZUPA 3A2WA 1TRWA 1X5EA 2BJXA 3F4RA 5E59A 1WMJA 2X99A 1TU8A 3EINA 2EFEA 2J9HA 1AQWA 3MDKA 3UJ1A 2LKUA 2PBJA 3VLNA 3GHAA 3LGCA 1S4BP 1B4PA 5DAKA 3HHVA 3PPUA 1V58A 2VL2C 2AB6A 2H6XA 2HNLA 1HD2A 4V2LA 1SKSB 5A5KA 2MBSA 2WZSA 1ILOA 3ZRDA 4MJEA 2O5VA 1N8JA 1UA5A 4HZ4A 2JZSA 1OE7A 2DC5A 5HR2A 4PQIA 1VGLA 1TXUA 2PPTA 4LL4B 4D73A 1THXA 4ML1A 4BPYA 3HZ4A 1JZOA 4MF6A 2AYTA 1S3DA 1HNAA 4GDFA 1FVJA 2PERA 4AJ7A 1YKAA 3UL3A 1EOGA 2A2RA 1K0OA 4G2EA 4EUYA 3M1GA 7GSSA 5IMVA 1PL1A 2GSQA 1R5AA 3N9JA 3F6DA 2GGTA 4BWQA 3A5WA 3KEBA 1Q4JA 4E8HA 1ZOFA 1O6JA 4WR4A 4HZ2A 4MLYA 4L8EA 5IOXA 4Z2TA 2LQQA 4POLA 2BMXA 3HVVA 3KMOA 4ZB8A 2RUEA 3TDGA 2O3EA 3OR5A 3MSZA 1BAYA 3FR6A 3NZNA 1M9AA 2CT6A 2IWTA 3VI7A 3IRAA 3IE3A 3D4MA 1URMA 5KN1A 1ZYNA 3QFAC 2IIYA 6GSYA 3APQA 3UARA 3C1RA 3D21A 5JWQB 1QUWA 1BG1A 4K7NA 2RM6A 3ZYWA 4OO4A 2EFCA 3ZMKA 1XOBA 1SYRA 4IQAA 1SVMA 2H6ZA 4NAXA 1Z3EA 3PGTA 1YEXA 1DE1A 1VRSD 2HE3A 4KNDA 4EO3A
chains in the Genus database with same CATH topology
4YKGA 2KP2A 1F9MA 1ML6A 3QAVA 1Z7RA 1XWCA 1UC7A 3LG6A 4XCSA 4OO5A 4I2UA 2IL3A 1OKDA 1XWBA 1K0MA 4MZWA 11GSA 1WP0A 2MYGA 5JCWA 1PN0A 1G7OA 2B5YA 5IMCA 5ECPB 1SVOA 3VFIA 2FHEA 3FHKA 2OA7A 3KTBA 3QD9A 3KIJA 2C3NA 1ERVA 1SK2A 2OE3A 4G0KA 3D6IA 5D96A 4V2MA 3TJKA 3ZREA 1BYEA 4I8BA 2CAQA 2FWHA 4NXIA 5ENUA 1GSFA 2OJLA 3TOUA 4DSSA 2EIQA 1X9MB 3UAPA 2I81A 3DXBA 4K7OA 3QDNA 1SYXA 1OVNA 3HA9A 1SD8A 1M7TA 2B1KA 5B8BA 1PD21 3TKRA 2X8CA 4ID0A 3TKSE 4K5RA 2HRFA 3H79A 4ML6A 1VF3A 3CXGA 4ACSA 3FR3A 3F8UA 2VLUA 4K1FA 4QL7A 3ZL5A 4ZB6A 1PX6A 1K0CA 2X64A 4PNGA 3HDCA 2HSNA 1GRXA 2D2ZA 4GSTA 3BCIA 3TB2A 1QK8A 5ECHB 2KLXA 3VPTA 2V32A 3VI5A 5DQYA 4G0LA 2HSMA 4QQ7A 3GKMA 3HVSA 4L0WA 1ZL9A 2H1DA 2X4AA 1ERTA 5G30A 2MMAA 4PTSA 1TJDA 2YZHA 3L78A 1EP7A 3EYTA 4KA0A 1DBYA 4DSRA 5CRGA 1GSYA 1QGVA 4TOPA 2VLVA 1SK0A 1V40A 5EL8A 4RQXA 3WD6A 4AJ6A 4BL7A 3CSIA 4TR1A 5F8BA 2H71A 3C73A 1O7UA 4TXOA 4Z2UA 2L59A 5J9CA 1A0FA 2GZZA 5LCZA 1Y1UA 2X49A 5INYA 3VPQA 2JZTA 4MP4A 2GVPA 5IM9A 1QQ2A 5J9BA 4O32A 3HVXA 5AGYA 1H4OA 1A2MA 4LL1B 1BG5A 2IN3A 1NM3A 4LA1A 2GT6A 3DKSA 4V1Ap 1T8EB 2QGVA 4K2DA 3P8WA 5COHA 1T00A 4PNFA 1U3IA 1UN2A 1YEPA 2VCWA 1TK8B 2HZEB 4F82A 4J56E 1M2DA 1GUHA 3GL3A 2IMIA 2K6VA 4WBJA 1Y6EA 3D5JA 1KNGA 1ZYPA 1TI1A 1YQ1A 1R7HA 2DJ2A 3GKNA 4L0UA 2VOCA 3HY2A 5D9VA 1XVWA 2K8VA 2V6OA 2O7KA 4MH3A 4TN8A 4IP1A 3A2VA 2R6KA 1G7EA 4DEJA 2TRXA 2OE0A 1TKDB 4MA9A 4N3ZA 1HNBA 4XIHA 3M9KA 4N30A 1ZYEA 5J3RA 4HEA2 4GQCA 5IMFA 2X8HA 3IXRA 1AW9A 2XBIA 4W66A 2NTOA 1K0DA 3ERWA 2YJ7A 1T4YA 4NWYA 2R0PA 4JBBA 2KP1A 3KM6A 2VCVA 3MAKA 1OC9B 5CAXA 3U5RE 3E0UA 3F0IA 3TKPA 5HR3A 4POBA 5F05A 5B6NA 1AAZA 5ID2B 4ZL9A 4KDXA 2DJ3A 4IQ1A 3H8QA 1MD4A 1YKCA 1PGTA 2VD0A 3EPTA 3S9FA 4K0NA 3HKRA 4O7HA 4AI6A 1SJIA 3IPZA 2I9HA 2GTUA 1KTEA 1Z6MA 4ZILA 3PR8A 3UOMA 2A4HA 5KN2A 4X0XA 3EU4A 4RQRA 3KZQA 2CX4A 2GSRA 4USSA 1U87A 1AC1A 3MNGA 1Z5YE 4YQVA 3IC8A 2F51A 17GSA 4ECBA 2HFDA 3ZITA 1C72A 4RI7A 2C3QA 4MJBA 3EC3A 4POKA 4EIPA 2C8UA 4CY6A 1J9BA 2VO4A 3APSA 4P3YB 3KCMA 4MF7A 2A2PA 2H1GA 4I5QA 3VWXA 4WF5A 2PVOC 4N0ZA 1TP9A 4MNNA 3F9UA 16GSA 3IBHA 5EY6A 1O81A 2H30A 2JACA 3O6TA 3EWLA 2DIYA 1PA3A 2FWFA 3WT1A 4MF5A 2L6CA 5H5SA 3VWUA 1XBSA 5IPHA 3UVHA 4NV5A 2OKAA 3FEUA 1WJKA 12GSA 2LTKA 1XWGA 1AUCA 4ZBBA 2NVLA 2H6YA 2F8AA 3KMNA 2A2SA 3LJRA 2GDRA 4AKGA 4QL9A 3MWHA 1TI3A 3RBTA 3DVWA 3ZIVA 4OCFA 3LQ7A 3RPPA 3ZZXA 1XPVA 3F63A 4YKFA 5ID2A 1JHBA 2IMFA 2YV9A 3I6AA 1TOFA 2C0FA 2CVBA 1M2BA 4FIWA 2I3YA 4Z7XA 4TKYA 3QAGA 3TRQA 1F37A 3VK9A 3GYKA 3CRUA 3ME8A 1TK5B 3GTUB 3RDWA 1XOAA 3EVIA 1A2LA 2GT5A 5J47A 4EDZA 1AIUA 5DJMA 4PQHA 3Q19A 2HXKA 1U6TA 3P90A 4XS1A 1GULA 2GS3A 2PUKC 5A4VA 5DALA 2L57A 3BD2A 5D93A 4YAPA 3TOTA 4POMA 4MK3A 1GWCA 4XHMA 1TRSA 3UEMA 5KEJA 2CQ9A 3GURA 3NIVA 4XS4A 1OC3A 5ECNB 1X5CA 2MMZA 4N10A 1H75A 3GKXA 2GQLA 4AF2A 1QMVA 1E2YA 1T4ZA 2HI7A 5J4YA 5KN0A 2C0EA 1J0FA 2HZFA 2H0IA 5ECRB 2GLRA 4XTSA 2AUVA 4Q5FA 5JCUA 2QSIA 2EIRA 3CTFA 3CBUA 4JR6A 2HRNA 3FY7A 2TIRA 2VLTA 2AHEA 1BQ7A 1M2AA 2H72A 4Q5NA 1I9DA 2V6KA 1YZXA 1LJRA 3IC4A 5FT3A 2DJKA 3DYRA 4IBPA 5BMUA 2K18A 2F9SA 2YANA 2OACA 4KGIA 1OAZA 2HQTA 1V57A 3LSZA 2WB9A 4JE1A 2B5XA 5AIVA 4MCUA 4HDEA 1T7PB 3DEXA 4ZBDA 2A4VA 4DSQA 5A34B 4KH7A 2M72A 2P5QA 4ZIJA 4L5LA 2H1BA 2RIIA 5JWOB 1CQGA 1TRVA 3FK8A 1GLPA 4PQ1A 1CQHA 2CAIA 2REMA 4KE3A 3F3QA 4JEDA 3L4NA 3R3EA 3KH9A 4LLRA 1O73A 1JZWA 4PGTA 4GWRA 2MMOA 2N5AA 1SJZA 4PX1A 4WF4A 3RHCA 2H8LA 2K8SA 3ED3A 3V1WA 3UMAA 4JZQA 4A5PA 5D8IA 2PU9C 2P31A 4GF0A 5D9XA 2I4AA 3IHGA 1IYHA 1WIKA 2FNOA 5J4VA 4QMKA 2B5EA 3L9UA 1YF0A 1ACVA 2YWIA 4IKHA 1Z6NA 3FR9A 3GMFA 4ZB7A 3AY8A 2CZ3A 4HU9A 1YDKA 2VD1A 4K9ZA 3G7YA 2OADA 2DJJA 5HR0A 3I43A 2WDUA 1FHEA 2VUPA 1NHOA 4O5QA 5ECSA 2JL4A 1AQVA 1XXUA 2C0GA 3L0HA 2V2GA 4K7IA 1V9WA 3W6GA 4MZBA 2FY6A 1OYJA 4WR5A 2DMMA 20GSA 3TKQA 3CRTA 3IAM2 2WFCA 3CSHA 1HNCA 4BVXB 4YQUA 2LNTA 4V1Ag 6GSTA 1NHYA 1GUMA 3ZFLA 3M3MA 5LD0A 2CA8A 1RW1A 5CRHA 3N5OA 5A4UA 3D0ZA 2DKIA 2V41A 2M46A 3NOFA 4NV2A 3KH7A 2QC7A 3F4TA 2C80A 4ZB9A 2X8GA 6GSXA 4O92A 4NPBA 3R2QA 13GSA 4OWYA 4EKZA 4TR4A 4IS0A 3MIXA 4FYUA 4E8EA 2H0GA 3G7JA 4O5UA 1XIYA 5F07A 1PN9A 4EXJA 2P0GA 5ECLB 3SBCA 1M9BA 1YF1A 4FH8A 2XBQA 4I6XA 2HRKB 1FG4A 5GSSA 1RQMA 2L6DA 1WOUA 3LORA 1X5DA 3GV1A 3LYPA 4IGJA 2EFHA 5A4WA 2WULA 1GNWA 2FUG2 3CTGA 2H75A 2VM1A 1SK1A 4KDYA 4G19A 2FCHA 2IPAA 5IQYA 2ON7A 2LNSA 1FB0A 2HYXA 2EFDA 4AGSA 4ISDA 1N25A 4KCAA 2G2QA 2OBKA 2YOIA 5HR1A 4FYCA 5ECMB 2VIMA 4IHUA 3W8JA 4JU5A 1MEKA 4LMWA 5GZZB 5B7CA 5CNWA 2VCZA 2ZNMA 1O8XA 1F2EA 1PKWA 2L4CA 4GCIA 4AKXB 2OBIA 4TR0A 3GH6A 2L5OA 4EE0A 2LRCA 1NSWA 1YY7A 2E2MA 4BVYB 1WRYA 4BVXA 3GSSA 1ZZYA 3LWAA 1FAAA 3FZ9A 2VAFA 4LMVA 2LRNA 2B3SA 1EWXA 4HOJA 5CP1A 2RLIA 4MPFA 4N0VA 1PQNA 4XS6A 2LJKA 5C04A 5IMDA 3G9BA 5AISA 4YAVA 4TRXA 4I2TA 5IMAA 2LJAA 1FW1A 1SKRB 1XW5A 4HJ2A 9GSSA 2YZUA 3EE2A 4X43A 1TW9A 2BTOT 5CRDA 3Q74A 3HJOA 2JU5A 1VF4A 4ILFA 4WBRD 2FWEA 3IOSA 2VCQA 1ERUA 5B6MA 2YWNA 4MABA 3C7MA 1X9WB 3GL5A 4KSMA 2YWMA 2O87A 2H73A 4ICYA 2KOKA 1GSDA 1SD9A 5ABRA 4Q5QA 1JZDA 2ON5A 3M0FA 3ZMLA 5IOWA 2E0QA 5D73A 4DVCA 5AIXA 5D9TA 2LQOA 4PURA 4OMVA 5GAND 4AKIA 5ELGA 4TR3A 5L71A 1HQOA 6GSWA 4MJAA 1K0AA 3GA4A 3DD3A 3ZVJA 1B4QA 3RHBA 2WS2A 1I5GA 3ZIJA 2HZEA 1GTUA 3KP8A 1TU7A 2YV7A 2H66A 3TJBA 3TGZA 3MYDA 3ZVJD 1GLQA 2VKZG 1T3BA 2YN1A 4CHSA 4YH2A 3O76A 2VL9A 4NHWA 3QMXA 2NBSA 5DAKB 2WJUA 1SJ6A 2FA4A 3IAS2 4IVFA 3LW9A 3ISOA 2CX3A 2C4JA 5JCGA 2O8VB 3O3TA 3D4TA 4WETA 1O85A 18GSA 4EF0A 4E68A 5G2ZA 5H5RA 3HJPA 2E2GA 1AXDA 4KUNA 3FRCA 1OC8A 2LV3A 3BCKA 3QAWA 4D73B 2XHFA 4NMUA 1RK4A 4KCEA 4I97A 1OC9A 4XRAA 3RAZA 2PMTA 4GRFA 1A24A 1GUKA 3LFLA 5BRTA 3HD5A 5G5EA 3BOAA 4N11A 1GTIA 4MDCA 5DBQA 4XRDA 2ALBA 5J5NA 1K0BA 1XW6A 4V2NA 2K9FA 5IIZA 5ECOB 1ZYQB 2DJ1A 3ZFBA 4O5RA 3HJMA 3Q6OA 1LU4A 1GSSA 2R37A 4IP6A 3FZ4A 2CZ2A 4KDUA 1M99A 1S3CA 1F3BA 4TVEA 4IN0A 5IMZA 1XZOA 1ON4A 1XWKA 1DUGA 1FOVA 2FLSA 6GSSA 4NHZA 3W8SA 5KN3A 3VWVA 5DCHA 3P7XA 3DWVA 1DE2A 3WT2A 4RI6A 2DJ0A 1GTBA 5EVOA 1W89A 2G0FA 3RPNA 3HXSA 3DMLA 5J40A 3H93A 3EURA 2J23A 2AV4A 1MD3A 1VF2A 4KAEA 2JZRA 3HYPA 2GQKA 2H70A 2QA2A 3EU3A 3M8NA 5GAPD 1FVKA 3QPMA 3CWGA 2P5RA 4BA7A 2IMDA 4FO5A 1FB6A 3PH9A 2NDOA 3HZ8A 1B9YC 4IJ3A 3L9VA 4X1UA 3IV4A 5IO0A 4H86A 3LEFA 1GSEA 2F8FA 2XPDA 3IK9A 3C8EA 1SU9A 2H76A 3GTUA 4DSSB 4EL1A 22GSA 3GN3A 1YJ6A 4WEYA 1A0RP 4ZBAA 3J7Yk 4KF9A 3GKKA 5HFGA 4K0GA 1OKTA 3FKFA 4Q5RA 3K8NA 5JWRB 1K3LA 1FOHA 3J7Yb 3C71A 4F0BA 3GNJA 4F2IA 3GX8A 3G7IA 10GSA 5DQSA 1Q98A 1N2AA 2N5FA 2HSYA 2JSYA 2HSNB 2C0DA 5ECKB 4K2XA 3FW2A 5HFKA 2UV8G 4K6XA 3US3A 1EGRA 2C1YA 3TJGA 1ERWA 3TJFA 2WCIA 1PSQA 2NPBA 1V2AA 2HLSA 2HSMB 1SL2B 1KBNA 2QA1A 3TKSA 2V1MA 3P2AA 2YP6A 4J57E 5KOXA 1MDIA 1B48A 3U6VA 1A8LA 4MPGA 5A1NB 4K5SA 1SL0B 2B1LA 1A23A 4J2FA 5CREA 4IJIA 4WKWA 4F0CA 2YWOA 3ERGA 1JZRA 4ZXGA 1UVZA 1Y25A 3IHQA 1SVLA 4KW6A 3PINA 1G6YA 2OE1A 4JRRA 4EDYA 2VCTA 3E9JB 1QXHA 4CY8A 3KXOA 3WYWA 2MMNA 4BL7B 2B6MA 4TR1B 5G1KA 1FO5A 4MZCA 2H01A 4TXOB 1Z9HA 5IPGA 1XCCA 1R26A 5F0GA 5KOWA 14GSA 3ME7A 1U3AA 5IO2A 1AQXA 2L5LA 2C3TA 1ZGNA 3GX0A 1SL1B 1YVLA 3ZTLA 1GNEA 4OFMA 4ECJA 2VM2A 2WZ9A 2PWJA 3LXTA 3H4KA 4GXZA 2Z9SA 5C00A 5A5HB 4G01A 5A34A 2FGXA 1JLVA 4FYBA 3ERFA 2B7KA 3CMIA 3F4SA 5ELAA 3GFKA 1TRUA 2MBTA 1PKZA 1MDKA 1JFUA 1EV4A 4BWSA 1MTCA 4OFTA 4GSSA 8GSSA 5FHIA 3TKSC 4OFNA 3F6FA 1G0TA 1TK0B 3CSJA 2ES7A 5G5FA 1EGOA 3GRXA 3DGQA 2DKHA 4HU7A 5ECQB 4K8MA 3FZ5A 4PUFC 2LJRA 2WGRA 3TCOA 2H19A 1GSQA 1O8WA 3UBLA 4F03A 2L4QA 4TW5A 2H0HA 4AKHA 3QR6A 2IFQB 1BF5A 5A1NA 1ST9A 5CRWA 4CW9A 3A3TA 1K0NA 4G9HA 5G31A 2O85A 3SWLA 5LNKe 3VURA 5DJLA 2DBCA 1DSBA 3DRNA 1BJXA 3DVXA 2XPEA 1ABAA 2PVQA 1K3YA 3I69A 5AN1A 2GSSA 3H1NA 3D22A 1M0UA 2IJYA 3TJJA 2JADA 3GH9A 3LYKA 1LBKA 3GIXA 3ZLPA 3UIWA 2YJHA 1W4VA 1XWAA 4FQUA 2GSTA 2FA8A 1EV9A 2KHPA 1S3AA 1BX9A 2M80A 2YPMA 1GP1A 5J41A 1E6BA 3UVTA 4EVMA 1GH2A 2R4VA 5G1LA 1A2JA 2HRAA 1XVQA 1EOHA 5DDLA 2FD3A 4IELA 5A5HA 5DCGA 3EMXA 2PN8A 2IMKA 4G10A 5D9WA 1EEMA 3HCZA 1EP8A 2ZCTA 1R5PA 2F3MA 3UBKA 1U88A 1PX7A 4GTUA 3IK7A 4CDOA 2PGTA 5ECIB 3A2XA 4HI7A 5E4WA 4RUVA 4TXVA 3VWWA 3L9SA 4GLTA 1IYIA 2UZ8A 2LSTA 3A5IA 3KGKA 2LEGA 1A8YA 4G0IA 4KSOA 4Z2RA 4ZL8A 1EEJA 5GSTA 4YQMA 2RM5A 2I1UA 1HYUA 3Q18A 1TXXA 2EIOA 3I9V2 2R0CA 5DVBA 2HRKA 3LXZA 3IA1A 4L5OA 2IMEA 1OE8A 4GSNA 1R4WA 2IFQA 3E3EA 3WGDA 3TU3B 3TUEA 6GSVA 3QOUA 4KB3A 4MMMA 5J4UA 1WE0A 3APOA 1THOA 1K3OA 2CVDA 3IR4A 2LUSA 4HQZA 1QFNA 1F3AA 1G6WA 3BJ5A 2N5BA 2VL3A 3KTLA 2VCXA 5CYYA 2GQMA 2XC2A 1ZCPA 1F6MC 4F9ZA 3WGEA 3KD0A 1VF1A 1SKWB 3FMWA 3JCML 1GTAA 2YNXA 1BEDA 5EPFA 6GSUA 3IDVA 2H74A 2E7PA 1XFLA 4MH2A 1KEBA 2KUCA 2QKEA 1USBA 2DLXA 4HJMA 4ECCA 3BBYA 4HQSA 5FWGA 1XW9A 2GZPA 5F06A 2R2JA 1X0RA 5CO3A 2HSHA 2TRCP 4ULXA 2CVKA 1GSUA 3QCPA 3M9JA 1B9XC 4OCEA 3QFBC 4BVYA 4AJ8A 2RUFA 5DALB 2HT9A 2WRTA 1TDIA 3HMJG 2EC4A 1MDJA 2CV4A 3CYNA 2B7JA 3DIEA 4PUAA 2GZYA 4XS4B 2FWGA 4OD7A 4WXTA 5H5QA 1NW2A 2O89A 4KX4A 4EIQA 1SENA 1PL2A 3FZAA 1EZKA 1V98A 1ZMAA 2VL2A 2R5GA 5B8AA 2AJQB 3F3RA 5HFIA 3KJYA 2H1LA 1WPIA 2LS5A 2H1AA 4HS1A 3GSTA 4IW9A 3TRXA 3FYGA 3WGXA 4GQFA 3GUSA 2YCDA 1WWJA 4X4JA 1PMTA 1T1VA 4PXOA 1PRXA 2R3XA 1B8XA 1Z7PA 2MZCA 1JLWA 4HUAA 1J08A 2JSZA 2R0GA 4EC0A 1GL8A 2DMLA 2AAWA 19GSA 2DIZA 5BMUB 3KP9A 1X9SB 2LRTA 1TTZA 4JR4A 2OT3A 3EMPA 4ZL7A 4MJCA 5HQPA 3C1SA 4ECIA 2DSAA 3TRPA 2ZUPA 3A2WA 1TRWA 1X5EA 2BJXA 3F4RA 5E59A 1WMJA 2X99A 1TU8A 3EINA 2EFEA 2J9HA 1AQWA 3MDKA 3UJ1A 2LKUA 2PBJA 3VLNA 3GHAA 3LGCA 1B4PA 5DAKA 3HHVA 3PPUA 1V58A 2VL2C 2AB6A 2H6XA 2HNLA 1HD2A 4V2LA 1SKSB 5A5KA 2MBSA 1ILOA 3ZRDA 4MJEA 2O5VA 1N8JA 1UA5A 4HZ4A 2JZSA 1OE7A 2DC5A 5HR2A 4PQIA 1VGLA 1TXUA 2PPTA 4LL4B 4D73A 1THXA 4ML1A 4BPYA 3HZ4A 1JZOA 4MF6A 2AYTA 1S3DA 1HNAA 4GDFA 1FVJA 2PERA 4AJ7A 1YKAA 3UL3A 1EOGA 2A2RA 1K0OA 4G2EA 4EUYA 3M1GA 7GSSA 5IMVA 1PL1A 2GSQA 1R5AA 3N9JA 3F6DA 2GGTA 4BWQA 3A5WA 3KEBA 1Q4JA 4E8HA 1ZOFA 1O6JA 4WR4A 4HZ2A 4MLYA 4L8EA 5IOXA 4Z2TA 2LQQA 4POLA 2BMXA 3HVVA 3KMOA 4ZB8A 2RUEA 3TDGA 3OR5A 3MSZA 1BAYA 3FR6A 3NZNA 1M9AA 2CT6A 2IWTA 3VI7A 3IRAA 3IE3A 3D4MA 1URMA 5KN1A 1ZYNA 3QFAC 2IIYA 6GSYA 3APQA 3UARA 3C1RA 3D21A 5JWQB 1QUWA 1BG1A 4K7NA 2RM6A 3ZYWA 4OO4A 2EFCA 3ZMKA 1XOBA 1SYRA 4IQAA 1SVMA 2H6ZA 4NAXA 1Z3EA 3PGTA 1YEXA 1DE1A 1VRSD 2HE3A 4KNDA 4EO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9T A;  4PUR A;  4OMV A;  4YAP A;  3TOT A;  2PVQ A;  4MK3 A;  1K3Y A;  1GWC A;  3I69 A;  5AN1 A;  2GSS A;  5ELG A;  1HQO A;  3H1N A;  1ML6 A;  1M0U A;  6GSW A;  3QAV A;  5KEJ A;  1K0A A;  3GUR A;  3LYK A;  1LBK A;  3DD3 A;  3NIV A;  3LG6 A;  2WS2 A;  5ECN B;  1GTU A;  2IL3 A;  1K0M A;  4MZW A;  11GS A;  4FQU A;  2GST A;  1TU7 A;  1EV9 A;  2YV7 A;  1BX9 A;  5JCW A;  3TGZ A;  5J41 A;  1E6B A;  1GLQ A;  1G7O A;  4CHS A;  4YH2 A;  5ECP B;  3O76 A;  5ECR B;  2R4V A;  4NHW A;  2GLR A;  5DAK B;  2HRA A;  2WJU A;  2FHE A;  2OA7 A;  1EOH A;  2C3N A;  5DDL A;  4IEL A;  4IVF A;  5DCG A;  4Q5F A;  3ISO A;  2C4J A;  4G0K A;  5JCU A;  1BYE A;  2IMK A;  2CAQ A;  4G10 A;  3O3T A;  5D9W A;  3CBU A;  18GS A;  1EEM A;  1GSF A;  3TOU A;  3FY7 A;  2AHE A;  2F3M A;  3UAP A;  1AXD A;  3FRC A;  3UBK A;  1U88 A;  1PX7 A;  4GTU A;  4Q5N A;  2V6K A;  1LJR A;  3QAW A;  3IK7 A;  5FT3 A;  2PGT A;  1PD2 1;  5ECI B;  4HI7 A;  4ID0 A;  1RK4 A;  4IBP A;  5BMU A;  4I97 A;  1VF3 A;  2OAC A;  4GLT A;  1IYI A;  2UZ8 A;  3FR3 A;  4KGI A;  4ACS A;  2PMT A;  2HQT A;  3LSZ A;  3VUR A;  2WB9 A;  4ZB6 A;  1GUK A;  3LFL A;  1PX6 A;  1K0C A;  5G5E A;  4G0I A;  2X64 A;  5AIV A;  4PNG A;  5GST A;  1GTI A;  4YQM A;  3Q18 A;  4MDC A;  2D2Z A;  4ZBD A;  4GST A;  4KH7 A;  2HRK A;  3LXZ A;  5ECH B;  4L5L A;  4L5O A;  3VPT A;  1OE8 A;  4GSN A;  3VI5 A;  5J5N A;  4G0L A;  2HSM A;  4QQ7 A;  1K0B A;  1GLP A;  1XW6 A;  6GSV A;  1ZL9 A;  2CAI A;  5J4U A;  4KE3 A;  5ECO B;  1K3O A;  4JED A;  2CVD A;  3IR4 A;  3ZFB A;  1F3A A;  1G6W A;  3R3E A;  3HJM A;  4PTS A;  1GSS A;  3KTL A;  2VCX A;  4PGT A;  2CZ2 A;  4KDU A;  1M99 A;  1VF1 A;  1GSY A;  1F3B A;  1GTA A;  4TOP A;  6GSU A;  4PX1 A;  1XWK A;  1V40 A;  5EL8 A;  1USB A;  3WD6 A;  4ECC A;  1DUG A;  3BBY A;  5FWG A;  4NHZ A;  6GSS A;  4BL7 A;  3CSI A;  4JZQ A;  5F06 A;  5F8B A;  3W8S A;  1GSU A;  4GF0 A;  1A0F A;  5D9X A;  5LCZ A;  4RI6 A;  1IYH A;  1GTB A;  5EVO A;  2FNO A;  3VPQ A;  4MP4 A;  4BVY A;  5DAL B;  4IKH A;  2WRT A;  3FR9 A;  1TDI A;  5AGY A;  3AY8 A;  2CZ3 A;  1BG5 A;  1YDK A;  2VD1 A;  3P8W A;  2OAD A;  1MD3 A;  1VF2 A;  4PNF A;  1U3I A;  4PUA A;  4KAE A;  2VCW A;  2WDU A;  1FHE A;  1GUH A;  3M8N A;  2IMI A;  5ECS A;  1Y6E A;  1YQ1 A;  2JL4 A;  4KX4 A;  1AQV A;  3L0H A;  1PL2 A;  2R5G A;  5D9V A;  3KJY A;  1OYJ A;  4WR5 A;  2R6K A;  20GS A;  3GST A;  4IW9 A;  4DEJ A;  3FYG A;  3CRT A;  3GUS A;  3CSH A;  1HNC A;  2YCD A;  4BVX B;  1HNB A;  1PMT A;  4YQU A;  1GSE A;  2F8F A;  3IK9 A;  3C8E A;  4PXO A;  6GST A;  1NHY A;  2R3X A;  1GUM A;  3GTU A;  3ZFL A;  3M3M A;  5LD0 A;  22GS A;  1B8X A;  1AW9 A;  1JLW A;  1YJ6 A;  2CA8 A;  3N5O A;  2NTO A;  1K0D A;  4ZBA A;  5A4U A;  4KF9 A;  3D0Z A;  4EC0 A;  4JBB A;  3KM6 A;  2AAW A;  19GS A;  4K0G A;  1OKT A;  2VCV A;  4Q5R A;  3MAK A;  1K3L A;  2C80 A;  4F0B A;  4ZB9 A;  3G7I A;  10GS A;  5DQS A;  6GSX A;  4O92 A;  5F05 A;  3R2Q A;  13GS A;  1N2A A;  2N5F A;  4IS0 A;  4ECI A;  4KDX A;  2HSN B;  5ECK B;  4IQ1 A;  2DSA A;  4E8E A;  1MD4 A;  1YKC A;  3G7J A;  5F07 A;  1PN9 A;  5HFK A;  4EXJ A;  1PGT A;  5ECL B;  1M9B A;  2VD0 A;  2HRK B;  4K0N A;  3HKR A;  5GSS A;  1TU8 A;  3EIN A;  1V2A A;  4O7H A;  2HSM B;  3LYP A;  2J9H A;  1AQW A;  4IGJ A;  3MDK A;  5A4W A;  1KBN A;  2GTU A;  2PBJ A;  1GNW A;  3VLN A;  3PR8 A;  1B4P A;  5DAK A;  1B48 A;  3PPU A;  3U6V A;  4MPG A;  4KDY A;  4G19 A;  5IQY A;  2ON7 A;  2AB6 A;  2HNL A;  2GSR A;  4J2F A;  4USS A;  1U87 A;  5A5K A;  4IJI A;  4F0C A;  4AGS A;  4YQV A;  4ISD A;  3ERG A;  1JZR A;  3IC8 A;  17GS A;  4ECB A;  4ZXG A;  1C72 A;  4RI7 A;  2C3Q A;  1G6Y A;  1UA5 A;  5ECM B;  2VCT A;  4EDY A;  3KXO A;  4HZ4 A;  3WYW A;  1OE7 A;  2DC5 A;  2C8U A;  2VO4 A;  4BL7 B;  4PQI A;  4LMW A;  5GZZ B;  5B7C A;  2VCZ A;  4MF7 A;  1Z9H A;  1F2E A;  1PKW A;  3VWX A;  4GCI A;  4MF6 A;  5F0G A;  3GH6 A;  1HNA A;  2PER A;  4EE0 A;  16GS A;  3IBH A;  14GS A;  1AQX A;  1EOG A;  1YY7 A;  1K0O A;  1ZGN A;  2A2R A;  2C3T A;  3GX0 A;  5EY6 A;  4BVY B;  1GNE A;  3M1G A;  4OFM A;  4ECJ A;  7GSS A;  1PA3 A;  4BVX A;  3GSS A;  4MF5 A;  3LXT A;  1PL1 A;  2GSQ A;  1R5A A;  4LMV A;  3N9J A;  3UVH A;  3F6D A;  4HOJ A;  12GS A;  4MPF A;  4N0V A;  1Q4J A;  1XWG A;  4E8H A;  1JLV A;  5AIS A;  4ZBB A;  4WR4 A;  4YAV A;  3ERF A;  4HZ2 A;  3KMN A;  4L8E A;  2A2S A;  3LJR A;  2GDR A;  5ELA A;  1FW1 A;  1PKZ A;  1XW5 A;  4HJ2 A;  9GSS A;  3RBT A;  3EE2 A;  1EV4 A;  1MTC A;  1TW9 A;  3KMO A;  4OFT A;  4ZB8 A;  3LQ7 A;  3Q74 A;  3HJO A;  4GSS A;  8GSS A;  1VF4 A;  1BAY A;  3FR6 A;  5FHI A;  3F63 A;  2VCQ A;  4OFN A;  1M9A A;  2YV9 A;  3F6F A;  3I6A A;  3VI7 A;  3CSJ A;  5G5F A;  3IE3 A;  3DGQ A;  3QAG A;  4KSM A;  5ECQ B;  6GSY A;  3VK9 A;  3UAR A;  3CRU A;  3GTU B;  2LJR A;  1GSD A;  1GSQ A;  4EDZ A;  4Q5Q A;  3ZMK A;  3UBL A;  4F03 A;  4IQA A;  5DJM A;  4NAX A;  4PQH A;  3QR6 A;  3Q19 A;  2ON5 A;  3M0F A;  3PGT A;  3P90 A;  1GUL A;  3ZML A;  1K0N A;  4G9H A;  5D73 A;  5A4V A;  3SWL A;  5DAL A;  5AIX A;  5DJL A; 
#chains in the Genus database with same CATH topology
 4YKG A;  2KP2 A;  1F9M A;  1ML6 A;  3QAV A;  1XG8 A;  1Z7R A;  1XWC A;  1UC7 A;  3LG6 A;  4XCS A;  4OO5 A;  4I2U A;  2IL3 A;  1OKD A;  1XWB A;  1K0M A;  4MZW A;  11GS A;  1WP0 A;  2MYG A;  5JCW A;  1PN0 A;  1G7O A;  2B5Y A;  5IMC A;  5ECP B;  1SVO A;  3VFI A;  2FHE A;  3FHK A;  2OA7 A;  3KTB A;  3QD9 A;  3KIJ A;  2C3N A;  1ERV A;  1SK2 A;  2OE3 A;  4G0K A;  3D6I A;  5D96 A;  4V2M A;  3TJK A;  3ZRE A;  1BYE A;  4I8B A;  2CAQ A;  2FWH A;  4NXI A;  5ENU A;  1GSF A;  2OJL A;  3TOU A;  4DSS A;  2EIQ A;  1X9M B;  3UAP A;  2I81 A;  3DXB A;  4K7O A;  3QDN A;  1SYX A;  1OVN A;  3HA9 A;  1SD8 A;  1M7T A;  2B1K A;  5B8B A;  1PD2 1;  3TKR A;  2X8C A;  4ID0 A;  3TKS E;  4K5R A;  2HRF A;  3H79 A;  4ML6 A;  1VF3 A;  3CXG A;  4ACS A;  3RGB C;  3FR3 A;  3F8U A;  2VLU A;  4K1F A;  4QL7 A;  3ZL5 A;  4ZB6 A;  1PX6 A;  1K0C A;  2X64 A;  4PNG A;  3HDC A;  2HSN A;  1GRX A;  2D2Z A;  4GST A;  3BCI A;  3TB2 A;  1QK8 A;  5ECH B;  2KLX A;  3VPT A;  2V32 A;  3VI5 A;  5DQY A;  4G0L A;  2HSM A;  4QQ7 A;  3GKM A;  3HVS A;  4L0W A;  1ZL9 A;  2H1D A;  2X4A A;  1ERT A;  5G30 A;  2MMA A;  4PTS A;  1TJD A;  2YZH A;  3L78 A;  1EP7 A;  3EYT A;  4KA0 A;  1DBY A;  4DSR A;  5CRG A;  1GSY A;  1QGV A;  4TOP A;  2VLV A;  1SK0 A;  1V40 A;  5EL8 A;  4RQX A;  3WD6 A;  4AJ6 A;  4BL7 A;  3CSI A;  4TR1 A;  5F8B A;  2H71 A;  3C73 A;  1O7U A;  4TXO A;  4Z2U A;  2L59 A;  5J9C A;  1A0F A;  2GZZ A;  5LCZ A;  1Y1U A;  2X49 A;  5INY A;  2WW3 A;  3VPQ A;  2JZT A;  4MP4 A;  2GVP A;  5IM9 A;  1QQ2 A;  5J9B A;  4O32 A;  3HVX A;  5AGY A;  1H4O A;  1A2M A;  2WVY A;  4LL1 B;  1BG5 A;  2IN3 A;  1NM3 A;  4LA1 A;  2GT6 A;  3DKS A;  4V1A p;  1T8E B;  2QGV A;  4K2D A;  3P8W A;  5COH A;  1T00 A;  4PNF A;  1U3I A;  1UN2 A;  1YEP A;  2VCW A;  1TK8 B;  2HZE B;  4F82 A;  4J56 E;  1M2D A;  1GUH A;  3GL3 A;  2IMI A;  2K6V A;  4WBJ A;  1Y6E A;  3D5J A;  1KNG A;  1ZYP A;  1TI1 A;  1YQ1 A;  1R7H A;  2DJ2 A;  3GKN A;  4L0U A;  2VOC A;  3HY2 A;  5D9V A;  4HSC X;  1XVW A;  2K8V A;  1YEW C;  2V6O A;  2O7K A;  4MH3 A;  4TN8 A;  4IP1 A;  3A2V A;  2R6K A;  1G7E A;  4DEJ A;  2TRX A;  2OE0 A;  1TKD B;  4MA9 A;  4N3Z A;  1HNB A;  4XIH A;  3M9K A;  4N30 A;  1ZYE A;  5J3R A;  4HEA 2;  4GQC A;  5IMF A;  2X8H A;  3IXR A;  1AW9 A;  2XBI A;  4W66 A;  2NTO A;  1K0D A;  3ERW A;  2YJ7 A;  1T4Y A;  4NWY A;  2R0P A;  4JBB A;  2KP1 A;  3KM6 A;  2VCV A;  3MAK A;  1OC9 B;  5CAX A;  3U5R E;  3E0U A;  3F0I A;  3TKP A;  5HR3 A;  4POB A;  5F05 A;  5B6N A;  1AAZ A;  5ID2 B;  4ZL9 A;  4KDX A;  2DJ3 A;  4IQ1 A;  3H8Q A;  1MD4 A;  1YKC A;  1PGT A;  2VD0 A;  3EPT A;  3S9F A;  4K0N A;  3HKR A;  4O7H A;  4AI6 A;  1SJI A;  3IPZ A;  2I9H A;  2GTU A;  1KTE A;  1Z6M A;  4ZIL A;  3PR8 A;  1PFO A;  3UOM A;  2A4H A;  5KN2 A;  4X0X A;  3EU4 A;  4RQR A;  3KZQ A;  2CX4 A;  2GSR A;  4USS A;  1U87 A;  1AC1 A;  3MNG A;  1Z5Y E;  4YQV A;  3IC8 A;  2F51 A;  17GS A;  4ECB A;  2HFD A;  3ZIT A;  1C72 A;  4RI7 A;  2C3Q A;  4MJB A;  3EC3 A;  4POK A;  4EIP A;  2C8U A;  4CY6 A;  1J9B A;  2VO4 A;  3APS A;  4P3Y B;  3KCM A;  4MF7 A;  2A2P A;  2H1G A;  4I5Q A;  3VWX A;  4WF5 A;  2PVO C;  4N0Z A;  1TP9 A;  4MNN A;  3F9U A;  16GS A;  3IBH A;  5EY6 A;  1O81 A;  2H30 A;  2JAC A;  3O6T A;  3EWL A;  2DIY A;  1PA3 A;  2FWF A;  3WT1 A;  4MF5 A;  2L6C A;  5H5S A;  3VWU A;  1XBS A;  5IPH A;  3UVH A;  4NV5 A;  2OKA A;  3FEU A;  1WJK A;  12GS A;  2LTK A;  1XWG A;  1AUC A;  4ZBB A;  2NVL A;  2H6Y A;  2F8A A;  3KMN A;  2A2S A;  3LJR A;  2GDR A;  4AKG A;  4QL9 A;  3MWH A;  1TI3 A;  3RBT A;  3DVW A;  3ZIV A;  4OCF A;  3LQ7 A;  3RPP A;  3ZZX A;  1XPV A;  3F63 A;  4YKF A;  5ID2 A;  1JHB A;  2IMF A;  2YV9 A;  3I6A A;  1TOF A;  2C0F A;  2CVB A;  1M2B A;  4FIW A;  2I3Y A;  4Z7X A;  4TKY A;  3QAG A;  3TRQ A;  1F37 A;  3VK9 A;  3GYK A;  3CRU A;  3ME8 A;  1TK5 B;  3GTU B;  3RDW A;  1XOA A;  3EVI A;  1A2L A;  2GT5 A;  5J47 A;  4EDZ A;  1AIU A;  5DJM A;  4PQH A;  3Q19 A;  2HXK A;  1U6T A;  3P90 A;  4XS1 A;  1GUL A;  2GS3 A;  2PUK C;  5A4V A;  5DAL A;  2L57 A;  3BD2 A;  5D93 A;  4YAP A;  3TOT A;  4POM A;  4MK3 A;  1GWC A;  4XHM A;  1TRS A;  3UEM A;  5KEJ A;  2CQ9 A;  3GUR A;  3NIV A;  4XS4 A;  1OC3 A;  5ECN B;  1X5C A;  2MMZ A;  4N10 A;  1H75 A;  3GKX A;  2GQL A;  4AF2 A;  1QMV A;  1E2Y A;  1T4Z A;  2HI7 A;  5J4Y A;  5KN0 A;  2C0E A;  1J0F A;  2HZF A;  2H0I A;  5ECR B;  2GLR A;  4XTS A;  2AUV A;  4Q5F A;  5JCU A;  2QSI A;  2EIR A;  3CTF A;  3CBU A;  4JR6 A;  2HRN A;  3FY7 A;  2TIR A;  2VLT A;  2AHE A;  1BQ7 A;  1M2A A;  2H72 A;  4Q5N A;  1I9D A;  2V6K A;  1YZX A;  1LJR A;  3IC4 A;  5FT3 A;  2DJK A;  3DYR A;  4IBP A;  5BMU A;  2K18 A;  2F9S A;  2YAN A;  2OAC A;  4KGI A;  1OAZ A;  2HQT A;  1V57 A;  3LSZ A;  2WB9 A;  4JE1 A;  2B5X A;  5AIV A;  4MCU A;  4HDE A;  1T7P B;  3DEX A;  4ZBD A;  2A4V A;  4DSQ A;  5A34 B;  4KH7 A;  2M72 A;  2P5Q A;  4ZIJ A;  4L5L A;  2H1B A;  2RII A;  5JWO B;  1CQG A;  1TRV A;  3FK8 A;  1GLP A;  2WVZ A;  4PQ1 A;  1CQH A;  2CAI A;  2REM A;  4KE3 A;  3F3Q A;  4JED A;  2O36 A;  3L4N A;  3R3E A;  3KH9 A;  4LLR A;  1O73 A;  1JZW A;  4PGT A;  4GWR A;  2MMO A;  2N5A A;  1SJZ A;  4PX1 A;  4WF4 A;  3RHC A;  2H8L A;  2K8S A;  3ED3 A;  3V1W A;  3UMA A;  4JZQ A;  4A5P A;  5D8I A;  2PU9 C;  2P31 A;  4GF0 A;  5D9X A;  2I4A A;  3IHG A;  1IYH A;  1WIK A;  2FNO A;  5J4V A;  4QMK A;  2B5E A;  3L9U A;  1YF0 A;  1ACV A;  2YWI A;  4IKH A;  1Z6N A;  3FR9 A;  3GMF A;  4ZB7 A;  3AY8 A;  2CZ3 A;  4HU9 A;  1YDK A;  2VD1 A;  4K9Z A;  3G7Y A;  2OAD A;  2DJJ A;  5HR0 A;  3I43 A;  2WDU A;  3CHX C;  1FHE A;  2VUP A;  1NHO A;  4O5Q A;  5ECS A;  2JL4 A;  1AQV A;  1XXU A;  2C0G A;  3L0H A;  2V2G A;  4K7I A;  1V9W A;  3W6G A;  4MZB A;  2FY6 A;  1OYJ A;  4WR5 A;  2DMM A;  20GS A;  3TKQ A;  3CRT A;  3IAM 2;  2WFC A;  3CSH A;  1HNC A;  4BVX B;  4YQU A;  2LNT A;  4PHZ C;  4V1A g;  6GST A;  1NHY A;  1GUM A;  3ZFL A;  3M3M A;  5LD0 A;  2CA8 A;  1RW1 A;  5CRH A;  3N5O A;  5A4U A;  3D0Z A;  2DKI A;  2V41 A;  4PI0 C;  2M46 A;  3NOF A;  4NV2 A;  3KH7 A;  2QC7 A;  3F4T A;  2C80 A;  4ZB9 A;  2X8G A;  6GSX A;  4O92 A;  4NPB A;  3R2Q A;  13GS A;  4OWY A;  4EKZ A;  4TR4 A;  4IS0 A;  3MIX A;  4FYU A;  4E8E A;  2H0G A;  3G7J A;  4O5U A;  1XIY A;  5F07 A;  1PN9 A;  4EXJ A;  2P0G A;  5ECL B;  3SBC A;  1M9B A;  1YF1 A;  4FH8 A;  2XBQ A;  4I6X A;  2HRK B;  1FG4 A;  5GSS A;  1RQM A;  2L6D A;  1WOU A;  3LOR A;  1X5D A;  3GV1 A;  3LYP A;  4IGJ A;  2EFH A;  5A4W A;  2WUL A;  1GNW A;  2FUG 2;  3CTG A;  2H75 A;  2VM1 A;  1SK1 A;  4KDY A;  4G19 A;  2FCH A;  2IPA A;  5IQY A;  2ON7 A;  2LNS A;  1FB0 A;  2HYX A;  2EFD A;  4AGS A;  4ISD A;  3RFR C;  1N25 A;  4KCA A;  2G2Q A;  2OBK A;  2YOI A;  5HR1 A;  2WVX B;  4FYC A;  5ECM B;  2VIM A;  4IHU A;  3W8J A;  4JU5 A;  1MEK A;  4LMW A;  5GZZ B;  5B7C A;  5CNW A;  2VCZ A;  2ZNM A;  1O8X A;  1F2E A;  1PKW A;  2L4C A;  4GCI A;  4AKX B;  2OBI A;  4TR0 A;  3GH6 A;  2L5O A;  4EE0 A;  2LRC A;  1NSW A;  1YY7 A;  2E2M A;  4BVY B;  1WRY A;  4BVX A;  3GSS A;  1ZZY A;  3LWA A;  1FAA A;  3FZ9 A;  2VAF A;  4LMV A;  2LRN A;  2B3S A;  1EWX A;  4HOJ A;  5CP1 A;  2RLI A;  4MPF A;  4N0V A;  1PQN A;  4XS6 A;  2LJK A;  5C04 A;  5IMD A;  3G9B A;  1M3J A;  5AIS A;  4YAV A;  4TRX A;  4I2T A;  5IMA A;  2LJA A;  1FW1 A;  1SKR B;  1XW5 A;  4HJ2 A;  9GSS A;  2YZU A;  3EE2 A;  4X43 A;  1TW9 A;  2BTO T;  5CRD A;  3Q74 A;  3HJO A;  2JU5 A;  1VF4 A;  4ILF A;  4WBR D;  2FWE A;  3IOS A;  2VCQ A;  1ERU A;  4PI2 C;  5B6M A;  2YWN A;  4FXY P;  4MAB A;  3C7M A;  1X9W B;  3GL5 A;  4KSM A;  2YWM A;  2O87 A;  2H73 A;  4ICY A;  2KOK A;  1GSD A;  1SD9 A;  5ABR A;  4Q5Q A;  1JZD A;  2ON5 A;  3M0F A;  3ZML A;  5IOW A;  2E0Q A;  5D73 A;  4DVC A;  5AIX A;  5D9T A;  2LQO A;  4PUR A;  4OMV A;  5GAN D;  4AKI A;  5ELG A;  4TR3 A;  5L71 A;  1HQO A;  6GSW A;  4MJA A;  1K0A A;  3GA4 A;  3DD3 A;  3ZVJ A;  1B4Q A;  3RHB A;  2WS2 A;  1I5G A;  3ZIJ A;  2HZE A;  1GTU A;  3KP8 A;  1TU7 A;  2YV7 A;  2H66 A;  3TJB A;  3TGZ A;  3MYD A;  3ZVJ D;  1GLQ A;  2VKZ G;  1T3B A;  2YN1 A;  4CHS A;  4YH2 A;  3O76 A;  2VL9 A;  4NHW A;  3QMX A;  2NBS A;  5DAK B;  2WJU A;  1SJ6 A;  2FA4 A;  3IAS 2;  4IVF A;  3LW9 A;  3ISO A;  2CX3 A;  2C4J A;  5JCG A;  2O8V B;  3O3T A;  3D4T A;  4WET A;  1O85 A;  18GS A;  4EF0 A;  4E68 A;  5G2Z A;  5H5R A;  3HJP A;  2E2G A;  1AXD A;  4KUN A;  3FRC A;  1OC8 A;  2LV3 A;  3BCK A;  3QAW A;  4BIK A;  4D73 B;  2XHF A;  4NMU A;  1S3R A;  1RK4 A;  4KCE A;  4I97 A;  1OC9 A;  4XRA A;  3RAZ A;  2PMT A;  4GRF A;  1A24 A;  1GUK A;  3LFL A;  5BRT A;  3HD5 A;  5G5E A;  3BOA A;  4N11 A;  1GTI A;  4MDC A;  5DBQ A;  4XRD A;  2ALB A;  5J5N A;  1K0B A;  1XW6 A;  4V2N A;  2K9F A;  5IIZ A;  5ECO B;  1ZYQ B;  2DJ1 A;  3ZFB A;  4O5R A;  3HJM A;  3Q6O A;  1LU4 A;  1GSS A;  2R37 A;  4IP6 A;  3FZ4 A;  2CZ2 A;  4KDU A;  1M99 A;  1S3C A;  1F3B A;  4TVE A;  4IN0 A;  5IMZ A;  1XZO A;  1ON4 A;  1XWK A;  1DUG A;  1FOV A;  2FLS A;  6GSS A;  4NHZ A;  3W8S A;  5KN3 A;  3VWV A;  5DCH A;  3P7X A;  3DWV A;  1DE2 A;  3WT2 A;  4RI6 A;  2DJ0 A;  1GTB A;  5EVO A;  1W89 A;  2G0F A;  3RPN A;  3HXS A;  3DML A;  5J40 A;  3H93 A;  3EUR A;  2J23 A;  2AV4 A;  1MD3 A;  1VF2 A;  4KAE A;  2JZR A;  3HYP A;  2GQK A;  2H70 A;  2QA2 A;  3EU3 A;  3M8N A;  5GAP D;  2WW2 A;  1FVK A;  3QPM A;  3CWG A;  2P5R A;  4BA7 A;  2IMD A;  4FO5 A;  1FB6 A;  3PH9 A;  2NDO A;  3HZ8 A;  1B9Y C;  4IJ3 A;  3L9V A;  4X1U A;  3IV4 A;  5IO0 A;  4H86 A;  3LEF A;  1GSE A;  2F8F A;  2XPD A;  3IK9 A;  3C8E A;  1SU9 A;  2H76 A;  3GTU A;  4DSS B;  4EL1 A;  22GS A;  3GN3 A;  1YJ6 A;  4WEY A;  1A0R P;  4ZBA A;  3J7Y k;  4KF9 A;  3GKK A;  5HFG A;  4K0G A;  1OKT A;  3FKF A;  4Q5R A;  3K8N A;  5JWR B;  1K3L A;  1FOH A;  3J7Y b;  3C71 A;  4F0B A;  3GNJ A;  4F2I A;  3GX8 A;  3G7I A;  10GS A;  5DQS A;  1Q98 A;  1N2A A;  2N5F A;  2HSY A;  2JSY A;  2HSN B;  2C0D A;  5ECK B;  4K2X A;  3FW2 A;  5HFK A;  2UV8 G;  4K6X A;  3US3 A;  1EGR A;  2C1Y A;  3TJG A;  1ERW A;  3TJF A;  2WCI A;  1PSQ A;  2NPB A;  1V2A A;  2HLS A;  2HSM B;  1SL2 B;  1KBN A;  2QA1 A;  3TKS A;  2V1M A;  3P2A A;  2YP6 A;  4J57 E;  5KOX A;  1MDI A;  1B48 A;  3U6V A;  1A8L A;  4MPG A;  5A1N B;  4K5S A;  1SL0 B;  2B1L A;  1A23 A;  4J2F A;  5CRE A;  4IJI A;  4WKW A;  4F0C A;  2YWO A;  3ERG A;  1JZR A;  4ZXG A;  1UVZ A;  1Y25 A;  3IHQ A;  1SVL A;  4KW6 A;  3PIN A;  1G6Y A;  2OE1 A;  4JRR A;  4EDY A;  2VCT A;  3E9J B;  1QXH A;  4CY8 A;  3KXO A;  3WYW A;  2MMN A;  4BL7 B;  2B6M A;  4TR1 B;  5G1K A;  1FO5 A;  4MZC A;  2H01 A;  4TXO B;  1Z9H A;  5IPG A;  1XCC A;  1R26 A;  5F0G A;  5KOW A;  3HVN A;  14GS A;  3ME7 A;  1U3A A;  5IO2 A;  1AQX A;  2L5L A;  2C3T A;  1ZGN A;  3GX0 A;  1SL1 B;  1YVL A;  3ZTL A;  1GNE A;  4OFM A;  4ECJ A;  2VM2 A;  2WZ9 A;  2PWJ A;  3LXT A;  3H4K A;  4GXZ A;  2Z9S A;  5C00 A;  5A5H B;  4G01 A;  5A34 A;  2FGX A;  1JLV A;  4FYB A;  3ERF A;  2B7K A;  3CMI A;  3F4S A;  5ELA A;  3GFK A;  1TRU A;  2MBT A;  1PKZ A;  1MDK A;  1JFU A;  1EV4 A;  4BWS A;  1MTC A;  4OFT A;  4GSS A;  8GSS A;  5FHI A;  3TKS C;  4OFN A;  3F6F A;  1G0T A;  1TK0 B;  3CSJ A;  2ES7 A;  5G5F A;  1EGO A;  3GRX A;  3DGQ A;  2DKH A;  4HU7 A;  5ECQ B;  4K8M A;  3FZ5 A;  4PUF C;  2LJR A;  2WGR A;  3TCO A;  2H19 A;  1GSQ A;  1O8W A;  3UBL A;  4F03 A;  2L4Q A;  4TW5 A;  2H0H A;  4AKH A;  3QR6 A;  2IFQ B;  1BF5 A;  5A1N A;  1ST9 A;  5CRW A;  4CW9 A;  3A3T A;  1K0N A;  4G9H A;  5G31 A;  2O85 A;  3SWL A;  5LNK e;  3VUR A;  5DJL A;  2DBC A;  1DSB A;  3DRN A;  1BJX A;  3DVX A;  2XPE A;  1ABA A;  2PVQ A;  1K3Y A;  3I69 A;  5AN1 A;  2GSS A;  1M3I A;  3H1N A;  3D22 A;  1M0U A;  2IJY A;  3TJJ A;  2JAD A;  3GH9 A;  3LYK A;  1LBK A;  1I1I P;  3GIX A;  3ZLP A;  3UIW A;  2YJH A;  1W4V A;  1XWA A;  4FQU A;  2GST A;  2FA8 A;  1EV9 A;  2KHP A;  1S3A A;  1BX9 A;  2M80 A;  2YPM A;  1GP1 A;  5J41 A;  1E6B A;  3UVT A;  4EVM A;  1GH2 A;  2R4V A;  5G1L A;  1A2J A;  2WW0 A;  2HRA A;  1XVQ A;  1EOH A;  5DDL A;  2FD3 A;  4IEL A;  5A5H A;  5DCG A;  3EMX A;  2WW1 A;  2PN8 A;  2IMK A;  4G10 A;  5D9W A;  1EEM A;  3HCZ A;  1EP8 A;  2ZCT A;  1R5P A;  2F3M A;  3UBK A;  1U88 A;  1PX7 A;  4GTU A;  3IK7 A;  4CDO A;  2PGT A;  5ECI B;  3A2X A;  4HI7 A;  5E4W A;  4RUV A;  4TXV A;  3VWW A;  3L9S A;  4GLT A;  1IYI A;  2UZ8 A;  2LST A;  3A5I A;  3KGK A;  2LEG A;  1A8Y A;  4G0I A;  4KSO A;  4Z2R A;  4ZL8 A;  1EEJ A;  5GST A;  4YQM A;  2RM5 A;  2I1U A;  1HYU A;  3Q18 A;  1TXX A;  2EIO A;  3I9V 2;  2R0C A;  5DVB A;  2HRK A;  3LXZ A;  3IA1 A;  4L5O A;  2IME A;  1OE8 A;  4GSN A;  1R4W A;  2IFQ A;  3E3E A;  3WGD A;  3TU3 B;  3TUE A;  6GSV A;  3QOU A;  4KB3 A;  4MMM A;  5J4U A;  1WE0 A;  3APO A;  1THO A;  1K3O A;  2CVD A;  3IR4 A;  2LUS A;  4HQZ A;  1QFN A;  1F3A A;  1G6W A;  3BJ5 A;  2N5B A;  2VL3 A;  3KTL A;  2VCX A;  5CYY A;  2GQM A;  2XC2 A;  1ZCP A;  1F6M C;  4F9Z A;  3WGE A;  3KD0 A;  1VF1 A;  1SKW B;  3FMW A;  3JCM L;  1GTA A;  2YNX A;  1BED A;  5EPF A;  6GSU A;  3IDV A;  2H74 A;  2E7P A;  1XFL A;  4MH2 A;  2WVX A;  1KEB A;  2KUC A;  2QKE A;  1USB A;  2DLX A;  4HJM A;  4ECC A;  3BBY A;  4HQS A;  5FWG A;  1XW9 A;  2GZP A;  5F06 A;  2R2J A;  1X0R A;  5CO3 A;  2HSH A;  2TRC P;  4ULX A;  2CVK A;  1GSU A;  3QCP A;  3M9J A;  1B9X C;  4OCE A;  3QFB C;  4BVY A;  4AJ8 A;  2RUF A;  5DAL B;  2HT9 A;  2WRT A;  1TDI A;  3HMJ G;  2EC4 A;  1MDJ A;  2CV4 A;  3CYN A;  2B7J A;  3DIE A;  4PUA A;  2GZY A;  4XS4 B;  2FWG A;  4OD7 A;  4WXT A;  5H5Q A;  1NW2 A;  2O89 A;  3CQF A;  4KX4 A;  4EIQ A;  1SEN A;  1PL2 A;  3FZA A;  1EZK A;  1V98 A;  1ZMA A;  2VL2 A;  2R5G A;  5B8A A;  2AJQ B;  3F3R A;  5HFI A;  3KJY A;  2H1L A;  1WPI A;  2LS5 A;  2H1A A;  4HS1 A;  3GST A;  4IW9 A;  3TRX A;  3FYG A;  3WGX A;  4GQF A;  3GUS A;  2YCD A;  1WWJ A;  4X4J A;  1PMT A;  1T1V A;  4PXO A;  1PRX A;  2R3X A;  1B8X A;  1Z7P A;  2MZC A;  1JLW A;  4HUA A;  1J08 A;  2JSZ A;  2R0G A;  4EC0 A;  1GL8 A;  2DML A;  2AAW A;  19GS A;  2DIZ A;  5BMU B;  3KP9 A;  1X9S B;  2LRT A;  1TTZ A;  4JR4 A;  2OT3 A;  3EMP A;  4ZL7 A;  4MJC A;  5HQP A;  3C1S A;  4ECI A;  2DSA A;  3TRP A;  2ZUP A;  3A2W A;  1TRW A;  1X5E A;  2BJX A;  3F4R A;  5E59 A;  1WMJ A;  2X99 A;  1TU8 A;  3EIN A;  2EFE A;  2J9H A;  1AQW A;  3MDK A;  3UJ1 A;  2LKU A;  2PBJ A;  3VLN A;  3GHA A;  3LGC A;  1S4B P;  1B4P A;  5DAK A;  3HHV A;  3PPU A;  1V58 A;  2VL2 C;  2AB6 A;  2H6X A;  2HNL A;  1HD2 A;  4V2L A;  1SKS B;  5A5K A;  2MBS A;  2WZS A;  1ILO A;  3ZRD A;  4MJE A;  2O5V A;  1N8J A;  1UA5 A;  4HZ4 A;  2JZS A;  1OE7 A;  2DC5 A;  5HR2 A;  4PQI A;  1VGL A;  1TXU A;  2PPT A;  4LL4 B;  4D73 A;  1THX A;  4ML1 A;  4BPY A;  3HZ4 A;  1JZO A;  4MF6 A;  2AYT A;  1S3D A;  1HNA A;  4GDF A;  1FVJ A;  2PER A;  4AJ7 A;  1YKA A;  3UL3 A;  1EOG A;  2A2R A;  1K0O A;  4G2E A;  4EUY A;  3M1G A;  7GSS A;  5IMV A;  1PL1 A;  2GSQ A;  1R5A A;  3N9J A;  3F6D A;  2GGT A;  4BWQ A;  3A5W A;  3KEB A;  1Q4J A;  4E8H A;  1ZOF A;  1O6J A;  4WR4 A;  4HZ2 A;  4MLY A;  4L8E A;  5IOX A;  4Z2T A;  2LQQ A;  4POL A;  2BMX A;  3HVV A;  3KMO A;  4ZB8 A;  2RUE A;  3TDG A;  2O3E A;  3OR5 A;  3MSZ A;  1BAY A;  3FR6 A;  3NZN A;  1M9A A;  2CT6 A;  2IWT A;  3VI7 A;  3IRA A;  3IE3 A;  3D4M A;  1URM A;  5KN1 A;  1ZYN A;  3QFA C;  2IIY A;  6GSY A;  3APQ A;  3UAR A;  3C1R A;  3D21 A;  5JWQ B;  1QUW A;  1BG1 A;  4K7N A;  2RM6 A;  3ZYW A;  4OO4 A;  2EFC A;  3ZMK A;  1XOB A;  1SYR A;  4IQA A;  1SVM A;  2H6Z A;  4NAX A;  1Z3E A;  3PGT A;  1YEX A;  1DE1 A;  1VRS D;  2HE3 A;  4KND A;  4EO3 A; 
#chains in the Genus database with same CATH homology
 4YKG A;  2KP2 A;  1F9M A;  1ML6 A;  3QAV A;  1Z7R A;  1XWC A;  1UC7 A;  3LG6 A;  4XCS A;  4OO5 A;  4I2U A;  2IL3 A;  1OKD A;  1XWB A;  1K0M A;  4MZW A;  11GS A;  1WP0 A;  2MYG A;  5JCW A;  1PN0 A;  1G7O A;  2B5Y A;  5IMC A;  5ECP B;  1SVO A;  3VFI A;  2FHE A;  3FHK A;  2OA7 A;  3KTB A;  3QD9 A;  3KIJ A;  2C3N A;  1ERV A;  1SK2 A;  2OE3 A;  4G0K A;  3D6I A;  5D96 A;  4V2M A;  3TJK A;  3ZRE A;  1BYE A;  4I8B A;  2CAQ A;  2FWH A;  4NXI A;  5ENU A;  1GSF A;  2OJL A;  3TOU A;  4DSS A;  2EIQ A;  1X9M B;  3UAP A;  2I81 A;  3DXB A;  4K7O A;  3QDN A;  1SYX A;  1OVN A;  3HA9 A;  1SD8 A;  1M7T A;  2B1K A;  5B8B A;  1PD2 1;  3TKR A;  2X8C A;  4ID0 A;  3TKS E;  4K5R A;  2HRF A;  3H79 A;  4ML6 A;  1VF3 A;  3CXG A;  4ACS A;  3FR3 A;  3F8U A;  2VLU A;  4K1F A;  4QL7 A;  3ZL5 A;  4ZB6 A;  1PX6 A;  1K0C A;  2X64 A;  4PNG A;  3HDC A;  2HSN A;  1GRX A;  2D2Z A;  4GST A;  3BCI A;  3TB2 A;  1QK8 A;  5ECH B;  2KLX A;  3VPT A;  2V32 A;  3VI5 A;  5DQY A;  4G0L A;  2HSM A;  4QQ7 A;  3GKM A;  3HVS A;  4L0W A;  1ZL9 A;  2H1D A;  2X4A A;  1ERT A;  5G30 A;  2MMA A;  4PTS A;  1TJD A;  2YZH A;  3L78 A;  1EP7 A;  3EYT A;  4KA0 A;  1DBY A;  4DSR A;  5CRG A;  1GSY A;  1QGV A;  4TOP A;  2VLV A;  1SK0 A;  1V40 A;  5EL8 A;  4RQX A;  3WD6 A;  4AJ6 A;  4BL7 A;  3CSI A;  4TR1 A;  5F8B A;  2H71 A;  3C73 A;  1O7U A;  4TXO A;  4Z2U A;  2L59 A;  5J9C A;  1A0F A;  2GZZ A;  5LCZ A;  1Y1U A;  2X49 A;  5INY A;  3VPQ A;  2JZT A;  4MP4 A;  2GVP A;  5IM9 A;  1QQ2 A;  5J9B A;  4O32 A;  3HVX A;  5AGY A;  1H4O A;  1A2M A;  4LL1 B;  1BG5 A;  2IN3 A;  1NM3 A;  4LA1 A;  2GT6 A;  3DKS A;  4V1A p;  1T8E B;  2QGV A;  4K2D A;  3P8W A;  5COH A;  1T00 A;  4PNF A;  1U3I A;  1UN2 A;  1YEP A;  2VCW A;  1TK8 B;  2HZE B;  4F82 A;  4J56 E;  1M2D A;  1GUH A;  3GL3 A;  2IMI A;  2K6V A;  4WBJ A;  1Y6E A;  3D5J A;  1KNG A;  1ZYP A;  1TI1 A;  1YQ1 A;  1R7H A;  2DJ2 A;  3GKN A;  4L0U A;  2VOC A;  3HY2 A;  5D9V A;  1XVW A;  2K8V A;  2V6O A;  2O7K A;  4MH3 A;  4TN8 A;  4IP1 A;  3A2V A;  2R6K A;  1G7E A;  4DEJ A;  2TRX A;  2OE0 A;  1TKD B;  4MA9 A;  4N3Z A;  1HNB A;  4XIH A;  3M9K A;  4N30 A;  1ZYE A;  5J3R A;  4HEA 2;  4GQC A;  5IMF A;  2X8H A;  3IXR A;  1AW9 A;  2XBI A;  4W66 A;  2NTO A;  1K0D A;  3ERW A;  2YJ7 A;  1T4Y A;  4NWY A;  2R0P A;  4JBB A;  2KP1 A;  3KM6 A;  2VCV A;  3MAK A;  1OC9 B;  5CAX A;  3U5R E;  3E0U A;  3F0I A;  3TKP A;  5HR3 A;  4POB A;  5F05 A;  5B6N A;  1AAZ A;  5ID2 B;  4ZL9 A;  4KDX A;  2DJ3 A;  4IQ1 A;  3H8Q A;  1MD4 A;  1YKC A;  1PGT A;  2VD0 A;  3EPT A;  3S9F A;  4K0N A;  3HKR A;  4O7H A;  4AI6 A;  1SJI A;  3IPZ A;  2I9H A;  2GTU A;  1KTE A;  1Z6M A;  4ZIL A;  3PR8 A;  3UOM A;  2A4H A;  5KN2 A;  4X0X A;  3EU4 A;  4RQR A;  3KZQ A;  2CX4 A;  2GSR A;  4USS A;  1U87 A;  1AC1 A;  3MNG A;  1Z5Y E;  4YQV A;  3IC8 A;  2F51 A;  17GS A;  4ECB A;  2HFD A;  3ZIT A;  1C72 A;  4RI7 A;  2C3Q A;  4MJB A;  3EC3 A;  4POK A;  4EIP A;  2C8U A;  4CY6 A;  1J9B A;  2VO4 A;  3APS A;  4P3Y B;  3KCM A;  4MF7 A;  2A2P A;  2H1G A;  4I5Q A;  3VWX A;  4WF5 A;  2PVO C;  4N0Z A;  1TP9 A;  4MNN A;  3F9U A;  16GS A;  3IBH A;  5EY6 A;  1O81 A;  2H30 A;  2JAC A;  3O6T A;  3EWL A;  2DIY A;  1PA3 A;  2FWF A;  3WT1 A;  4MF5 A;  2L6C A;  5H5S A;  3VWU A;  1XBS A;  5IPH A;  3UVH A;  4NV5 A;  2OKA A;  3FEU A;  1WJK A;  12GS A;  2LTK A;  1XWG A;  1AUC A;  4ZBB A;  2NVL A;  2H6Y A;  2F8A A;  3KMN A;  2A2S A;  3LJR A;  2GDR A;  4AKG A;  4QL9 A;  3MWH A;  1TI3 A;  3RBT A;  3DVW A;  3ZIV A;  4OCF A;  3LQ7 A;  3RPP A;  3ZZX A;  1XPV A;  3F63 A;  4YKF A;  5ID2 A;  1JHB A;  2IMF A;  2YV9 A;  3I6A A;  1TOF A;  2C0F A;  2CVB A;  1M2B A;  4FIW A;  2I3Y A;  4Z7X A;  4TKY A;  3QAG A;  3TRQ A;  1F37 A;  3VK9 A;  3GYK A;  3CRU A;  3ME8 A;  1TK5 B;  3GTU B;  3RDW A;  1XOA A;  3EVI A;  1A2L A;  2GT5 A;  5J47 A;  4EDZ A;  1AIU A;  5DJM A;  4PQH A;  3Q19 A;  2HXK A;  1U6T A;  3P90 A;  4XS1 A;  1GUL A;  2GS3 A;  2PUK C;  5A4V A;  5DAL A;  2L57 A;  3BD2 A;  5D93 A;  4YAP A;  3TOT A;  4POM A;  4MK3 A;  1GWC A;  4XHM A;  1TRS A;  3UEM A;  5KEJ A;  2CQ9 A;  3GUR A;  3NIV A;  4XS4 A;  1OC3 A;  5ECN B;  1X5C A;  2MMZ A;  4N10 A;  1H75 A;  3GKX A;  2GQL A;  4AF2 A;  1QMV A;  1E2Y A;  1T4Z A;  2HI7 A;  5J4Y A;  5KN0 A;  2C0E A;  1J0F A;  2HZF A;  2H0I A;  5ECR B;  2GLR A;  4XTS A;  2AUV A;  4Q5F A;  5JCU A;  2QSI A;  2EIR A;  3CTF A;  3CBU A;  4JR6 A;  2HRN A;  3FY7 A;  2TIR A;  2VLT A;  2AHE A;  1BQ7 A;  1M2A A;  2H72 A;  4Q5N A;  1I9D A;  2V6K A;  1YZX A;  1LJR A;  3IC4 A;  5FT3 A;  2DJK A;  3DYR A;  4IBP A;  5BMU A;  2K18 A;  2F9S A;  2YAN A;  2OAC A;  4KGI A;  1OAZ A;  2HQT A;  1V57 A;  3LSZ A;  2WB9 A;  4JE1 A;  2B5X A;  5AIV A;  4MCU A;  4HDE A;  1T7P B;  3DEX A;  4ZBD A;  2A4V A;  4DSQ A;  5A34 B;  4KH7 A;  2M72 A;  2P5Q A;  4ZIJ A;  4L5L A;  2H1B A;  2RII A;  5JWO B;  1CQG A;  1TRV A;  3FK8 A;  1GLP A;  4PQ1 A;  1CQH A;  2CAI A;  2REM A;  4KE3 A;  3F3Q A;  4JED A;  3L4N A;  3R3E A;  3KH9 A;  4LLR A;  1O73 A;  1JZW A;  4PGT A;  4GWR A;  2MMO A;  2N5A A;  1SJZ A;  4PX1 A;  4WF4 A;  3RHC A;  2H8L A;  2K8S A;  3ED3 A;  3V1W A;  3UMA A;  4JZQ A;  4A5P A;  5D8I A;  2PU9 C;  2P31 A;  4GF0 A;  5D9X A;  2I4A A;  3IHG A;  1IYH A;  1WIK A;  2FNO A;  5J4V A;  4QMK A;  2B5E A;  3L9U A;  1YF0 A;  1ACV A;  2YWI A;  4IKH A;  1Z6N A;  3FR9 A;  3GMF A;  4ZB7 A;  3AY8 A;  2CZ3 A;  4HU9 A;  1YDK A;  2VD1 A;  4K9Z A;  3G7Y A;  2OAD A;  2DJJ A;  5HR0 A;  3I43 A;  2WDU A;  1FHE A;  2VUP A;  1NHO A;  4O5Q A;  5ECS A;  2JL4 A;  1AQV A;  1XXU A;  2C0G A;  3L0H A;  2V2G A;  4K7I A;  1V9W A;  3W6G A;  4MZB A;  2FY6 A;  1OYJ A;  4WR5 A;  2DMM A;  20GS A;  3TKQ A;  3CRT A;  3IAM 2;  2WFC A;  3CSH A;  1HNC A;  4BVX B;  4YQU A;  2LNT A;  4V1A g;  6GST A;  1NHY A;  1GUM A;  3ZFL A;  3M3M A;  5LD0 A;  2CA8 A;  1RW1 A;  5CRH A;  3N5O A;  5A4U A;  3D0Z A;  2DKI A;  2V41 A;  2M46 A;  3NOF A;  4NV2 A;  3KH7 A;  2QC7 A;  3F4T A;  2C80 A;  4ZB9 A;  2X8G A;  6GSX A;  4O92 A;  4NPB A;  3R2Q A;  13GS A;  4OWY A;  4EKZ A;  4TR4 A;  4IS0 A;  3MIX A;  4FYU A;  4E8E A;  2H0G A;  3G7J A;  4O5U A;  1XIY A;  5F07 A;  1PN9 A;  4EXJ A;  2P0G A;  5ECL B;  3SBC A;  1M9B A;  1YF1 A;  4FH8 A;  2XBQ A;  4I6X A;  2HRK B;  1FG4 A;  5GSS A;  1RQM A;  2L6D A;  1WOU A;  3LOR A;  1X5D A;  3GV1 A;  3LYP A;  4IGJ A;  2EFH A;  5A4W A;  2WUL A;  1GNW A;  2FUG 2;  3CTG A;  2H75 A;  2VM1 A;  1SK1 A;  4KDY A;  4G19 A;  2FCH A;  2IPA A;  5IQY A;  2ON7 A;  2LNS A;  1FB0 A;  2HYX A;  2EFD A;  4AGS A;  4ISD A;  1N25 A;  4KCA A;  2G2Q A;  2OBK A;  2YOI A;  5HR1 A;  4FYC A;  5ECM B;  2VIM A;  4IHU A;  3W8J A;  4JU5 A;  1MEK A;  4LMW A;  5GZZ B;  5B7C A;  5CNW A;  2VCZ A;  2ZNM A;  1O8X A;  1F2E A;  1PKW A;  2L4C A;  4GCI A;  4AKX B;  2OBI A;  4TR0 A;  3GH6 A;  2L5O A;  4EE0 A;  2LRC A;  1NSW A;  1YY7 A;  2E2M A;  4BVY B;  1WRY A;  4BVX A;  3GSS A;  1ZZY A;  3LWA A;  1FAA A;  3FZ9 A;  2VAF A;  4LMV A;  2LRN A;  2B3S A;  1EWX A;  4HOJ A;  5CP1 A;  2RLI A;  4MPF A;  4N0V A;  1PQN A;  4XS6 A;  2LJK A;  5C04 A;  5IMD A;  3G9B A;  5AIS A;  4YAV A;  4TRX A;  4I2T A;  5IMA A;  2LJA A;  1FW1 A;  1SKR B;  1XW5 A;  4HJ2 A;  9GSS A;  2YZU A;  3EE2 A;  4X43 A;  1TW9 A;  2BTO T;  5CRD A;  3Q74 A;  3HJO A;  2JU5 A;  1VF4 A;  4ILF A;  4WBR D;  2FWE A;  3IOS A;  2VCQ A;  1ERU A;  5B6M A;  2YWN A;  4MAB A;  3C7M A;  1X9W B;  3GL5 A;  4KSM A;  2YWM A;  2O87 A;  2H73 A;  4ICY A;  2KOK A;  1GSD A;  1SD9 A;  5ABR A;  4Q5Q A;  1JZD A;  2ON5 A;  3M0F A;  3ZML A;  5IOW A;  2E0Q A;  5D73 A;  4DVC A;  5AIX A;  5D9T A;  2LQO A;  4PUR A;  4OMV A;  5GAN D;  4AKI A;  5ELG A;  4TR3 A;  5L71 A;  1HQO A;  6GSW A;  4MJA A;  1K0A A;  3GA4 A;  3DD3 A;  3ZVJ A;  1B4Q A;  3RHB A;  2WS2 A;  1I5G A;  3ZIJ A;  2HZE A;  1GTU A;  3KP8 A;  1TU7 A;  2YV7 A;  2H66 A;  3TJB A;  3TGZ A;  3MYD A;  3ZVJ D;  1GLQ A;  2VKZ G;  1T3B A;  2YN1 A;  4CHS A;  4YH2 A;  3O76 A;  2VL9 A;  4NHW A;  3QMX A;  2NBS A;  5DAK B;  2WJU A;  1SJ6 A;  2FA4 A;  3IAS 2;  4IVF A;  3LW9 A;  3ISO A;  2CX3 A;  2C4J A;  5JCG A;  2O8V B;  3O3T A;  3D4T A;  4WET A;  1O85 A;  18GS A;  4EF0 A;  4E68 A;  5G2Z A;  5H5R A;  3HJP A;  2E2G A;  1AXD A;  4KUN A;  3FRC A;  1OC8 A;  2LV3 A;  3BCK A;  3QAW A;  4D73 B;  2XHF A;  4NMU A;  1RK4 A;  4KCE A;  4I97 A;  1OC9 A;  4XRA A;  3RAZ A;  2PMT A;  4GRF A;  1A24 A;  1GUK A;  3LFL A;  5BRT A;  3HD5 A;  5G5E A;  3BOA A;  4N11 A;  1GTI A;  4MDC A;  5DBQ A;  4XRD A;  2ALB A;  5J5N A;  1K0B A;  1XW6 A;  4V2N A;  2K9F A;  5IIZ A;  5ECO B;  1ZYQ B;  2DJ1 A;  3ZFB A;  4O5R A;  3HJM A;  3Q6O A;  1LU4 A;  1GSS A;  2R37 A;  4IP6 A;  3FZ4 A;  2CZ2 A;  4KDU A;  1M99 A;  1S3C A;  1F3B A;  4TVE A;  4IN0 A;  5IMZ A;  1XZO A;  1ON4 A;  1XWK A;  1DUG A;  1FOV A;  2FLS A;  6GSS A;  4NHZ A;  3W8S A;  5KN3 A;  3VWV A;  5DCH A;  3P7X A;  3DWV A;  1DE2 A;  3WT2 A;  4RI6 A;  2DJ0 A;  1GTB A;  5EVO A;  1W89 A;  2G0F A;  3RPN A;  3HXS A;  3DML A;  5J40 A;  3H93 A;  3EUR A;  2J23 A;  2AV4 A;  1MD3 A;  1VF2 A;  4KAE A;  2JZR A;  3HYP A;  2GQK A;  2H70 A;  2QA2 A;  3EU3 A;  3M8N A;  5GAP D;  1FVK A;  3QPM A;  3CWG A;  2P5R A;  4BA7 A;  2IMD A;  4FO5 A;  1FB6 A;  3PH9 A;  2NDO A;  3HZ8 A;  1B9Y C;  4IJ3 A;  3L9V A;  4X1U A;  3IV4 A;  5IO0 A;  4H86 A;  3LEF A;  1GSE A;  2F8F A;  2XPD A;  3IK9 A;  3C8E A;  1SU9 A;  2H76 A;  3GTU A;  4DSS B;  4EL1 A;  22GS A;  3GN3 A;  1YJ6 A;  4WEY A;  1A0R P;  4ZBA A;  3J7Y k;  4KF9 A;  3GKK A;  5HFG A;  4K0G A;  1OKT A;  3FKF A;  4Q5R A;  3K8N A;  5JWR B;  1K3L A;  1FOH A;  3J7Y b;  3C71 A;  4F0B A;  3GNJ A;  4F2I A;  3GX8 A;  3G7I A;  10GS A;  5DQS A;  1Q98 A;  1N2A A;  2N5F A;  2HSY A;  2JSY A;  2HSN B;  2C0D A;  5ECK B;  4K2X A;  3FW2 A;  5HFK A;  2UV8 G;  4K6X A;  3US3 A;  1EGR A;  2C1Y A;  3TJG A;  1ERW A;  3TJF A;  2WCI A;  1PSQ A;  2NPB A;  1V2A A;  2HLS A;  2HSM B;  1SL2 B;  1KBN A;  2QA1 A;  3TKS A;  2V1M A;  3P2A A;  2YP6 A;  4J57 E;  5KOX A;  1MDI A;  1B48 A;  3U6V A;  1A8L A;  4MPG A;  5A1N B;  4K5S A;  1SL0 B;  2B1L A;  1A23 A;  4J2F A;  5CRE A;  4IJI A;  4WKW A;  4F0C A;  2YWO A;  3ERG A;  1JZR A;  4ZXG A;  1UVZ A;  1Y25 A;  3IHQ A;  1SVL A;  4KW6 A;  3PIN A;  1G6Y A;  2OE1 A;  4JRR A;  4EDY A;  2VCT A;  3E9J B;  1QXH A;  4CY8 A;  3KXO A;  3WYW A;  2MMN A;  4BL7 B;  2B6M A;  4TR1 B;  5G1K A;  1FO5 A;  4MZC A;  2H01 A;  4TXO B;  1Z9H A;  5IPG A;  1XCC A;  1R26 A;  5F0G A;  5KOW A;  14GS A;  3ME7 A;  1U3A A;  5IO2 A;  1AQX A;  2L5L A;  2C3T A;  1ZGN A;  3GX0 A;  1SL1 B;  1YVL A;  3ZTL A;  1GNE A;  4OFM A;  4ECJ A;  2VM2 A;  2WZ9 A;  2PWJ A;  3LXT A;  3H4K A;  4GXZ A;  2Z9S A;  5C00 A;  5A5H B;  4G01 A;  5A34 A;  2FGX A;  1JLV A;  4FYB A;  3ERF A;  2B7K A;  3CMI A;  3F4S A;  5ELA A;  3GFK A;  1TRU A;  2MBT A;  1PKZ A;  1MDK A;  1JFU A;  1EV4 A;  4BWS A;  1MTC A;  4OFT A;  4GSS A;  8GSS A;  5FHI A;  3TKS C;  4OFN A;  3F6F A;  1G0T A;  1TK0 B;  3CSJ A;  2ES7 A;  5G5F A;  1EGO A;  3GRX A;  3DGQ A;  2DKH A;  4HU7 A;  5ECQ B;  4K8M A;  3FZ5 A;  4PUF C;  2LJR A;  2WGR A;  3TCO A;  2H19 A;  1GSQ A;  1O8W A;  3UBL A;  4F03 A;  2L4Q A;  4TW5 A;  2H0H A;  4AKH A;  3QR6 A;  2IFQ B;  1BF5 A;  5A1N A;  1ST9 A;  5CRW A;  4CW9 A;  3A3T A;  1K0N A;  4G9H A;  5G31 A;  2O85 A;  3SWL A;  5LNK e;  3VUR A;  5DJL A;  2DBC A;  1DSB A;  3DRN A;  1BJX A;  3DVX A;  2XPE A;  1ABA A;  2PVQ A;  1K3Y A;  3I69 A;  5AN1 A;  2GSS A;  3H1N A;  3D22 A;  1M0U A;  2IJY A;  3TJJ A;  2JAD A;  3GH9 A;  3LYK A;  1LBK A;  3GIX A;  3ZLP A;  3UIW A;  2YJH A;  1W4V A;  1XWA A;  4FQU A;  2GST A;  2FA8 A;  1EV9 A;  2KHP A;  1S3A A;  1BX9 A;  2M80 A;  2YPM A;  1GP1 A;  5J41 A;  1E6B A;  3UVT A;  4EVM A;  1GH2 A;  2R4V A;  5G1L A;  1A2J A;  2HRA A;  1XVQ A;  1EOH A;  5DDL A;  2FD3 A;  4IEL A;  5A5H A;  5DCG A;  3EMX A;  2PN8 A;  2IMK A;  4G10 A;  5D9W A;  1EEM A;  3HCZ A;  1EP8 A;  2ZCT A;  1R5P A;  2F3M A;  3UBK A;  1U88 A;  1PX7 A;  4GTU A;  3IK7 A;  4CDO A;  2PGT A;  5ECI B;  3A2X A;  4HI7 A;  5E4W A;  4RUV A;  4TXV A;  3VWW A;  3L9S A;  4GLT A;  1IYI A;  2UZ8 A;  2LST A;  3A5I A;  3KGK A;  2LEG A;  1A8Y A;  4G0I A;  4KSO A;  4Z2R A;  4ZL8 A;  1EEJ A;  5GST A;  4YQM A;  2RM5 A;  2I1U A;  1HYU A;  3Q18 A;  1TXX A;  2EIO A;  3I9V 2;  2R0C A;  5DVB A;  2HRK A;  3LXZ A;  3IA1 A;  4L5O A;  2IME A;  1OE8 A;  4GSN A;  1R4W A;  2IFQ A;  3E3E A;  3WGD A;  3TU3 B;  3TUE A;  6GSV A;  3QOU A;  4KB3 A;  4MMM A;  5J4U A;  1WE0 A;  3APO A;  1THO A;  1K3O A;  2CVD A;  3IR4 A;  2LUS A;  4HQZ A;  1QFN A;  1F3A A;  1G6W A;  3BJ5 A;  2N5B A;  2VL3 A;  3KTL A;  2VCX A;  5CYY A;  2GQM A;  2XC2 A;  1ZCP A;  1F6M C;  4F9Z A;  3WGE A;  3KD0 A;  1VF1 A;  1SKW B;  3FMW A;  3JCM L;  1GTA A;  2YNX A;  1BED A;  5EPF A;  6GSU A;  3IDV A;  2H74 A;  2E7P A;  1XFL A;  4MH2 A;  1KEB A;  2KUC A;  2QKE A;  1USB A;  2DLX A;  4HJM A;  4ECC A;  3BBY A;  4HQS A;  5FWG A;  1XW9 A;  2GZP A;  5F06 A;  2R2J A;  1X0R A;  5CO3 A;  2HSH A;  2TRC P;  4ULX A;  2CVK A;  1GSU A;  3QCP A;  3M9J A;  1B9X C;  4OCE A;  3QFB C;  4BVY A;  4AJ8 A;  2RUF A;  5DAL B;  2HT9 A;  2WRT A;  1TDI A;  3HMJ G;  2EC4 A;  1MDJ A;  2CV4 A;  3CYN A;  2B7J A;  3DIE A;  4PUA A;  2GZY A;  4XS4 B;  2FWG A;  4OD7 A;  4WXT A;  5H5Q A;  1NW2 A;  2O89 A;  4KX4 A;  4EIQ A;  1SEN A;  1PL2 A;  3FZA A;  1EZK A;  1V98 A;  1ZMA A;  2VL2 A;  2R5G A;  5B8A A;  2AJQ B;  3F3R A;  5HFI A;  3KJY A;  2H1L A;  1WPI A;  2LS5 A;  2H1A A;  4HS1 A;  3GST A;  4IW9 A;  3TRX A;  3FYG A;  3WGX A;  4GQF A;  3GUS A;  2YCD A;  1WWJ A;  4X4J A;  1PMT A;  1T1V A;  4PXO A;  1PRX A;  2R3X A;  1B8X A;  1Z7P A;  2MZC A;  1JLW A;  4HUA A;  1J08 A;  2JSZ A;  2R0G A;  4EC0 A;  1GL8 A;  2DML A;  2AAW A;  19GS A;  2DIZ A;  5BMU B;  3KP9 A;  1X9S B;  2LRT A;  1TTZ A;  4JR4 A;  2OT3 A;  3EMP A;  4ZL7 A;  4MJC A;  5HQP A;  3C1S A;  4ECI A;  2DSA A;  3TRP A;  2ZUP A;  3A2W A;  1TRW A;  1X5E A;  2BJX A;  3F4R A;  5E59 A;  1WMJ A;  2X99 A;  1TU8 A;  3EIN A;  2EFE A;  2J9H A;  1AQW A;  3MDK A;  3UJ1 A;  2LKU A;  2PBJ A;  3VLN A;  3GHA A;  3LGC A;  1B4P A;  5DAK A;  3HHV A;  3PPU A;  1V58 A;  2VL2 C;  2AB6 A;  2H6X A;  2HNL A;  1HD2 A;  4V2L A;  1SKS B;  5A5K A;  2MBS A;  1ILO A;  3ZRD A;  4MJE A;  2O5V A;  1N8J A;  1UA5 A;  4HZ4 A;  2JZS A;  1OE7 A;  2DC5 A;  5HR2 A;  4PQI A;  1VGL A;  1TXU A;  2PPT A;  4LL4 B;  4D73 A;  1THX A;  4ML1 A;  4BPY A;  3HZ4 A;  1JZO A;  4MF6 A;  2AYT A;  1S3D A;  1HNA A;  4GDF A;  1FVJ A;  2PER A;  4AJ7 A;  1YKA A;  3UL3 A;  1EOG A;  2A2R A;  1K0O A;  4G2E A;  4EUY A;  3M1G A;  7GSS A;  5IMV A;  1PL1 A;  2GSQ A;  1R5A A;  3N9J A;  3F6D A;  2GGT A;  4BWQ A;  3A5W A;  3KEB A;  1Q4J A;  4E8H A;  1ZOF A;  1O6J A;  4WR4 A;  4HZ2 A;  4MLY A;  4L8E A;  5IOX A;  4Z2T A;  2LQQ A;  4POL A;  2BMX A;  3HVV A;  3KMO A;  4ZB8 A;  2RUE A;  3TDG A;  3OR5 A;  3MSZ A;  1BAY A;  3FR6 A;  3NZN A;  1M9A A;  2CT6 A;  2IWT A;  3VI7 A;  3IRA A;  3IE3 A;  3D4M A;  1URM A;  5KN1 A;  1ZYN A;  3QFA C;  2IIY A;  6GSY A;  3APQ A;  3UAR A;  3C1R A;  3D21 A;  5JWQ B;  1QUW A;  1BG1 A;  4K7N A;  2RM6 A;  3ZYW A;  4OO4 A;  2EFC A;  3ZMK A;  1XOB A;  1SYR A;  4IQA A;  1SVM A;  2H6Z A;  4NAX A;  1Z3E A;  3PGT A;  1YEX A;  1DE1 A;  1VRS D;  2HE3 A;  4KND A;  4EO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...