5IQYA

Structure of apo-dehydroascorbate reductase from pennisetum glaucum phased by iodide-sad method
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
211
Chain Sequence
VEVCVKAAVGAPDILGDCPFSQRVLLTLEEKKITYEMKLVDLSNKPEWFLKISPEGKVPVFNSGDGKWIADSDVITQVIEEKFPTPSLVTPPEYASVGSKIFPSFVKFLKSKDASDGSEKALLDELQALDEHLKAHGPYISGENVSAADLSLGPKLFHLQVALEHFKGWKIPENLTSVHAYTKALFSRESFVKTKPANQYLIAGWAPKVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dehydroascorbate reductase
publication title Non-native ligands define the active site of Pennisetum glaucum (L.) R. Br dehydroascorbate reductase
pubmed doi rcsb
source organism Pennisetum americanum
total genus 61
structure length 211
sequence length 211
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5iqyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5iqyA01
4IN0A 13GSA 3E0UA 1Q4JA 1XCCA 5AISA 3MAKA 1Z9HA 5A4UA 5D9WA 4MPGA 2EIOA 1EGOA 3IK9A 3WT1A 5AGYA 3TJGA 1ERUA 1SL2B 5IM9A 1QK8A 3H4KA 1ERWA 1RW1A 1JLWA 4XHMA 2VO4A 3HD5A 4EO3A 2PU9C 2LUSA 3A2XA 4DSRA 1O7UA 3N5OA 2LNSA 1XOAA 1YEPA 1V57A 2JSZA 5DCHA 1TK0B 3IR4A 5KN2A 3ZIJA 5JCUA 3TUEA 5KN3A 3GURA 1MTCA 3ZITA 5LD0A 2XBIA 2H1DA 2Z9SA 3DIEA 3GYKA 2L59A 1OYJA 1TRUA 3P90A 5HFKA 3GNJA 1O85A 3V1WA 3LWAA 5B8BA 3BOAA 1T3BA 5HR1A 4TN8A 1XWCA 4OD7A 3LQ7A 3BD2A 1N2AA 4ZL9A 4L0UA 3G9BA 3D6IA 5DCGA 2AHEA 1T8EB 3VWXA 2GQLA 1CQGA 3LXTA 3P2AA 2H72A 2HLSA 4Q5NA 2CV4A 1JZDA 2LKUA 3KP9A 5HR2A 3IC8A 3W8SA 1Z7RA 4CDOA 1SU9A 2ZNMA 4TXOA 2L6DA 3BBYA 5AN1A 5FT3A 4KDUA 4KAEA 3PGTA 1VF1A 1LU4A 2HZEB 1AXDA 4JBBA 5B6NA 1OVNA 5CAXA 2F9SA 2HSMB 4F0BA 4EC0A 5A5KA 1GLPA 1KEBA 2WS2A 2P5QA 4K1FA 1E2YA 1JZRA 2GZYA 5L71A 1XWKA 3A5WA 3KEBA 2I81A 2IWTA 4F82A 5B6MA 2M72A 4G0IA 5JWRB 3QMXA 1K3YA 4G0KA 3D21A 1MDJA 2H6XA 2HI7A 2A2RA 4TKYA 3L4NA 3UAPA 3LEFA 1ERTA 4HJMA 2RUEA 4OFMA 3KIJA 3HXSA 3HDCA 2J9HA 2M80A 2VL9A 2OBIA 4Q5FA 2ALBA 4MJEA 3A2VA 2KUCA 2C1YA 3F4RA 3CXGA 4AJ7A 1GNEA 1SL0B 4OO4A 2FD3A 2B1KA 3UMAA 1HNBA 2GT5A 4IP1A 2B5YA 1TRWA 5ECRB 4BA7A 2GTUA 2LQOA 1PRXA 2OBKA 3MDKA 4L0WA 2AAWA 2C8UA 1J0FA 4NHWA 4IJ3A 2HQTA 4V2MA 4MMMA 3GX0A 2B3SA 2WFCA 4WKWA 1XIYA 4GQFA 1KNGA 4V1Ag 2CVBA 5E4WA 2NVLA 1NM3A 4ECIA 2LJKA 1TRVA 2RIIA 3ZTLA 4N30A 3IHQA 4HQSA 1C72A 1AAZA 1VF3A 2GSRA 4LLRA 2VD0A 5JCWA 2GDRA 1V9WA 2DJ2A 2MBTA 1X9SB 3TKSC 3ZVJA 4MP4A 4WBRD 1EOHA 1JHBA 2NTOA 2B7KA 5IMZA 1O8WA 1VGLA 2VCTA 3C1SA 5F0GA 4N0ZA 1TJDA 4ML1A 3UBKA 1DE2A 4MZWA 1JFUA 3OR5A 3VI7A 4ECBA 1QFNA 5HR3A 2GGTA 2OKAA 2MMOA 1OKDA 1X5DA 3HVSA 3EURA 4V2LA 3BCKA 4HZ4A 3M9JA 3DYRA 2D2ZA 2VCQA 4E8EA 2C4JA 2JU5A 2AYTA 4GF0A 4HQZA 1LJRA 4ZL7A 4TOPA 3TKRA 4OO5A 3C73A 6GSUA 3EMXA 3UARA 10GSA 1THOA 2V41A 4OCEA 4KSMA 2H0IA 2VD1A 4JE1A 2IMIA 3ZZXA 1TI1A 1YF0A 4K6XA 1FVKA 1K0CA 2VCWA 3F0IA 4F03A 3R3EA 4MF7A 2PVOC 3FEUA 2A4VA 5G31A 4ECJA 4KX4A 5DVBA 4V2NA 1SK2A 4POBA 1SYXA 2G0FA 5E59A 3GFKA 3TGZA 3ME8A 3TOUA 4XS6A 7GSSA 3U5RE 1ZOFA 1NHOA 2QSIA 3KMNA 2TRCP 2E0QA 5ELAA 3HVVA 2H71A 2WZ9A 3N9JA 1T00A 4TXOB 5ECNB 2DC5A 2KOKA 3FR6A 1JLVA 2FA4A 3I69A 3DVWA 3ZFLA 4MZBA 1RQMA 3MSZA 1UVZA 4EVMA 2CAQA 2UZ8A 1O6JA 4HJ2A 5KN1A 2DIYA 2HNLA 2VIMA 4KW6A 1BX9A 4X0XA 4I2UA 2TRXA 3TDGA 2H30A 1AIUA 4TR0A 3HA9A 3ZL5A 5F06A 1DUGA 5CREA 2N5FA 5CRDA 3TJKA 1EV4A 5IMDA 4PTSA 3M8NA 1A24A 2WCIA 3TKSE 4TW5A 5D73A 1FB0A 3ZREA 2HRAA 2XBQA 5HR0A 1ZMAA 4IW9A 2YV9A 1THXA 1GSEA 3KGKA 1YY7A 1B4PA 3QAGA 2F51A 3D0ZA 1ZGNA 2O89A 2R5GA 2LRNA 2B6MA 1M2BA 3CBUA 2PMTA 4HZ2A 4WBJA 3GSSA 3H8QA 3GX8A 2EIQA 2HRFA 2F8FA 2C3QA 1QXHA 3E9JB 5IMCA 1ML6A 2IN3A 1GP1A 5HFGA 3TJBA 2O8VB 3IA1A 2E2MA 2LNTA 3FYGA 4O7HA 3H1NA 3NOFA 1OC3A 1W4VA 5J41A 5CRGA 1EP8A 4NHZA 6GSTA 3VLNA 4ZB8A 1GL8A 3EMPA 3Q18A 2DBCA 3C1RA 1XW9A 3A3TA 5CO3A 1EP7A 3LYKA 3F4TA 1H4OA 5DQYA 2BJXA 2FGXA 5IPHA 4YAVA 1DBYA 1SK1A 4KCEA 4IQ1A 4JRRA 2OADA 2YV7A 1BEDA 4WETA 1YEXA 4PNFA 1ZCPA 2RM5A 5DDLA 3AY8A 1XVWA 1J08A 3FZ9A 3M0FA 5G5EA 2YCDA 1R4WA 3EE2A 3E3EA 5HQPA 4QQ7A 4RQXA 2WULA 3J7Yk 2KP2A 1OKTA 3CSIA 2MYGA 4BWSA 2WJUA 1GUKA 1O81A 3HKRA 4FH8A 3GTUA 1U3IA 3WGXA 1PKZA 5H5SA 2HT9A 3P8WA 2JADA 4BWQA 4F2IA 2XPEA 1TI3A 1KTEA 2H1GA 1S3AA 4BPYA 1ERVA 2H0GA 4KDXA 2VLUA 3G7IA 1Z6MA 3IDVA 4POMA 5LNKe 5GSSA 3EVIA 2VM1A 4GCIA 2VL2C 5GAPD 5IQYA 1URMA 3ZMLA 4WF4A 4IS0A 4K0NA 1PX7A 2JZRA 1X5EA 1FOVA 4XRDA 3GL3A 3MWHA 4NWYA 3G7YA 2X8CA 3EINA 2DJ0A 1ZL9A 2PWJA 2HRKB 1PA3A 5J5NA 2PN8A 4YQMA 2YWOA 2IFQB 2NDOA 2HZFA 3RAZA 2YN1A 4MJCA 4KSOA 4MH2A 4POKA 5GZZB 1M2DA 2DLXA 4YQVA 2VLVA 1PX6A 4WEYA 2MZCA 4USSA 3TRQA 1TOFA 4I2TA 2F3MA 4KDYA 3C7MA 4BVXA 2B5XA 2PPTA 4YQUA 3F3RA 1PGTA 5D9VA 2MBSA 1EWXA 1FAAA 3GRXA 5J9CA 5IMVA 4QL9A 3HZ8A 4LL4B 5ID2A 1UA5A 4I6XA 1GSUA 1WP0A 1PSQA 4GTUA 4MCUA 5D96A 4EDZA 5BMUA 4PQ1A 2CAIA 1Z3EA 4MJAA 5DALA 2VOCA 2B7JA 2AB6A 4ECCA 4TXVA 6GSWA 4KUNA 4NV2A 5EVOA 3GL5A 1A8YA 1N8JA 1I9DA 2ES7A 1SKRB 1TTZA 3NIVA 4Q5RA 3LG6A 4MABA 4BVYA 5KEJA 1A8LA 1OE8A 3UJ1A 2C0FA 4FYCA 4ZXGA 1PN9A 2H19A 4RI6A 3QR6A 3EWLA 1W89A 4GXZA 3L0HA 3J7Yb 4DSSA 2YJHA 1X0RA 1R5AA 3FY7A 4GSTA 4XIHA 2FCHA 4Z7XA 4HS1A 5FHIA 3HZ4A 4WR5A 3PR8A 3ZRDA 2VCZA 2RUFA 2HSHA 3R2QA 3DWVA 1XOBA 4JZQA 5D9XA 4ZB6A 2VUPA 3SBCA 2FA8A 1M99A 4BL7A 3VURA 5ECMB 5IIZA 1ABAA 2R37A 4PGTA 2MMNA 2GSQA 3WT2A 5DJMA 3S9FA 3H79A 4O5RA 2X99A 2K6VA 4GLTA 3I9V2 4O92A 3HJPA 1BQ7A 1PD21 2LRTA 1FW1A 5EL8A 2B5EA 5D93A 3ERGA 1S3DA 1TK5B 1AQVA 2DMMA 3A2WA 1M9BA 5J9BA 4CHSA 1Z7PA 2O87A 1AQWA 1ACVA 2QC7A 2YANA 1A2MA 5A4WA 1AQXA 1AUCA 4FIWA 3KMOA 2XPDA 3U6VA 3I43A 1PQNA 1WJKA 4ILFA 5ENUA 3W8JA 4K7NA 1UN2A 1NHYA 1JZWA 1DE1A 1T4YA 5JWOB 2L57A 4JEDA 4HU7A 1F3AA 1Y6EA 3RBTA 4NMUA 1K3LA 2H1BA 5G1LA 4RUVA 3F6DA 2IL3A 1VF2A 3DXBA 3Q19A 4PUAA 4PXOA 4G9HA 3CYNA 3DD3A 1A2JA 4GRFA 4K9ZA 1TK8B 4EE0A 1M0UA 2CVDA 3GN3A 4X1UA 1SJZA 2IIYA 2FWEA 4ML6A 3EU4A 4NAXA 5ECSA 2K18A 1ZZYA 2L5LA 3VPTA 4NV5A 1YZXA 2GZZA 5B8AA 4K7OA 1K0OA 2H75A 2FLSA 1OAZA 3QDNA 4HOJA 4OMVA 2FWHA 1V58A 3EYTA 4TVEA 5CYYA 1QGVA 3D5JA 4LMVA 2IPAA 4DSQA 1K0MA 2K8SA 3KD0A 1XPVA 3O3TA 4ID0A 1O8XA 3ME7A 5G2ZA 3VWWA 4KNDA 1Y25A 2MMZA 2PERA 1GSQA 2WGRA 2YPMA 4EXJA 2H73A 1PL2A 2OE1A 1HYUA 2JZSA 4BVXB 1EZKA 2DIZA 1SJ6A 3DGQA 2YWIA 3GHAA 3LORA 8GSSA 4P3YB 4PQHA 4H86A 4JR4A 1EEJA 3PINA 3APSA 1SL1B 1WOUA 1GSFA 2CVKA 3FR9A 2K9FA 4OWYA 2DJ1A 2L6CA 4IJIA 2ZUPA 2PBJA 4EDYA 1G7EA 3KTLA 3CTFA 4N10A 2YZHA 3L9SA 1SKWB 3FW2A 1GSYA 5IOXA 5ECQB 1SENA 3RPNA 3FHKA 1K3OA 1WMJA 2H01A 2E7PA 4J57E 3CRTA 1YDKA 3LJRA 3ZLPA 1H75A 1AW9A 2YZUA 3LSZA 4BVYB 3D4MA 1GTAA 3BCIA 1XW6A 4I97A 3L78A 3IRAA 3VFIA 4DSSB 2GSSA 5J4UA 3LYPA 1XZOA 5A4VA 4K2DA 1R7HA 4MLYA 1TU7A 2X8HA 2HRNA 4N11A 1USBA 3DKSA 3F3QA 3TCOA 1FVJA 5DJLA 2H1AA 4XTSA 3UVTA 4IBPA 2YWNA 4KE3A 1NW2A 2GS3A 4BL7B 2CX4A 4K8MA 2M46A 4NXIA 4FYBA 2HE3A 3WGEA 3W6GA 1U88A 3UL3A 2O7KA 2DMLA 2K8VA 1JZOA 4AGSA 2GLRA 1Q98A 5H5QA 1R5PA 2H76A 2CA8A 4K0GA 4Q5QA 5IO0A 2H74A 2LEGA 3C8EA 3EC3A 4XS1A 1G7OA 1GUHA 3UBLA 3HVXA 4MK3A 3DRNA 4PURA 1VRSD 4XRAA 3D4TA 4AF2A 1TDIA 5G30A 2DJKA 4IVFA 2OE3A 1PL1A 2EC4A 3MNGA 1V40A 4RI7A 3VK9A 3HJOA 4O32A 3IAM2 2JZTA 3KH9A 1UC7A 1WRYA 2E2GA 4TR4A 3TJJA 3FZ5A 2R4VA 3O6TA 1AC1A 4ZBDA 1GWCA 22GSA 2HSYA 1X5CA 5CRHA 5D9TA 5J3RA 1PMTA 2FHEA 4KB3A 2YNXA 1ZYEA 1IYIA 4ACSA 2DJ3A 3ZIVA 5AIXA 2JL4A 1FO5A 4ZBAA 1FHEA 4IELA 2H8LA 3IC4A 5JWQB 1XXUA 1NSWA 5ABRA 1MD4A 3VWVA 19GSA 5DQSA 1TW9A 1ST9A 4ZIJA 4PUFC 4MA9A 1XW5A 1T7PB 2LJAA 1LBKA 4HEA2 4TR1A 1MDIA 1XFLA 2L4QA 3QFAC 4L5OA 3GMFA 3KH7A 2PVQA 3QCPA 2G2QA 5F07A 1V2AA 20GSA 4TR3A 4F9ZA 1RK4A 3HYPA 2R6KA 1GLQA 3IV4A 5IPGA 3KM6A 4XS4A 2FWGA 1SD9A 1G0TA 4OCFA 1GTUA 5KN0A 5CRWA 1XWBA 4TRXA 3US3A 1F2EA 1K0NA 2P5RA 5DAKA 3DMLA 2FNOA 1T4ZA 3Q74A 5G5FA 2GQKA 1GH2A 2H6YA 5IMFA 2H6ZA 4IQAA 1QMVA 1QQ2A 4JU5A 1YKCA 2FY6A 4ZB9A 4KH7A 2KHPA 3HJMA 4FQUA 5F05A 1DSBA 2YWMA 4G0LA 1U3AA 17GSA 1XBSA 1I5GA 3L9UA 4AJ8A 5IO2A 2LQQA 5ECIB 2L5OA 1TKDB 4IHUA 5B7CA 1EEMA 2GVPA 4WF5A 4MH3A 3IE3A 2B1LA 3ISOA 1SYRA 14GSA 1B48A 3K8NA 3IK7A 4D73A 2IMFA 2QGVA 3CTGA 2I4AA 2JSYA 4NPBA 2KP1A 3KZQA 3LGCA 1SD8A 3UVHA 3I6AA 1HQOA 1T1VA 2IJYA 3M9KA 3CSHA 1TRSA 3QD9A 1J9BA 2P31A 1YJ6A 2VL3A 1QUWA 2V32A 3DVXA 4J2FA 2VM2A 3F9UA 1B4QA 4CW9A 2ON7A 3IAS2 4HI7A 1Z5YE 4LMWA 2VCXA 4IGJA 2C80A 5DBQA 1XWAA 4DVCA 6GSXA 1K0BA 2C3TA 3M1GA 3WGDA 4PX1A 3QPMA 3VPQA 2CZ3A 2DJJA 2NPBA 4KCAA 3IPZA 5AIVA 3FZ4A 4ULXA 3F8UA 3KXOA 2VL2A 1BYEA 4EUYA 3P7XA 3UEMA 2GZPA 2OACA 3C71A 2HXKA 3RDWA 1U6TA 5INYA 1WE0A 2KLXA 1XWGA 5LCZA 4MF5A 1EV9A 1TXXA 1F6MC 3GKMA 4MJBA 1GUMA 1SJIA 1YKAA 2RM6A 3GIXA 5IMAA 2OE0A 1F9MA 3BJ5A 16GSA 3WD6A 2I9HA 2V1MA 1ILOA 5ECLB 1GSSA 2C3NA 3GH9A 1BJXA 5GSTA 2VAFA 1O73A 12GSA 4MDCA 3VWUA 2AV4A 1OC9A 3ERWA 4E8HA 2C0GA 5ECPB 4EKZA 1A0FA 1K0DA 4OFNA 4ISDA 4PNGA 3QOUA 4YH2A 2EIRA 3WYWA 3IOSA 3SWLA 2YP6A 3GTUB 3TRXA 2ON5A 1A0RP 2I1UA 2LS5A 1SK0A 6GSSA 5ECKB 1ZYQB 5F8BA 2V2GA 2X64A 4N0VA 4KA0A 1KBNA 3PPUA 3LFLA 2R3XA 4TR1B 18GSA 4KGIA 4G10A 5JCGA 1M9AA 1S3CA 1GTIA 1R26A 3APOA 3ED3A 3L9VA 4GWRA 1IYHA 4EL1A 5C04A 4L8EA 3TOTA 4GSNA 4AJ6A 2GT6A 1XVQA 4XS4B 4I5QA 2VLTA 2CT6A 4MF6A 3O76A 2BMXA 1SKSB 5DAKB 1ON4A 2OA7A 4JR6A 1B8XA 3F6FA 3APQA 3GSTA 4OFTA 1K0AA 4GQCA 4V1Ap 1FG4A 1HNAA 4DEJA 1MD3A 1GSDA 2H0HA 3CSJA 4IKHA 1E6BA 2AJQB 2J23A 1EOGA 1V98A 1TU8A 3IBHA 5EPFA 3GA4A 2V6OA 3FRCA 3GKKA 2HRKA 5HFIA 1YQ1A 1A2LA 2LSTA 4WR4A 1YF1A 1G6YA 3LXZA 3FZAA 3KCMA 3Q6OA 5ID2B 2VCVA 2IFQA 3RHBA 1X9MB 2F8AA 3RHCA 1HNCA 2MMAA 1MEKA 3ERFA 5EY6A 2CX3A 3CRUA 1GTBA 3QAWA 5CNWA 4D73B 5DALB 1F37A 2HSNB 3FKFA 1B9YC 3KJYA 3QAVA 3ZVJD 3TKQA 3UOMA 2GQMA 1HD2A 5ELGA 4LL1B 4G19A 4GSSA 2BTOT 2NBSA 9GSSA 2CZ2A 1G6WA 3QFBC 4IP6A 1OC8A 4QL7A 3HHVA 2ZCTA 4ZL8A 4J56E 3GKXA 2FUG2 3EU3A 6GSYA 2GSTA 3ZFBA 2I3YA 3HCZA 2V6KA 4FO5A 1F3BA 3GUSA 2R2JA 3FK8A 2WRTA 2DSAA 5H5RA 1BG5A 6GSVA 3FR3A 1WPIA 3ZYWA 2HZEA 2N5BA 4I8BA 2N5AA 3TRPA 2C0EA 3TKSA 4X43A 4FYUA 2O85A 2JACA 4WXTA 2HSMA 2XHFA 2PUKC 1EGRA 2FWFA 1TP9A 5IOWA 1MDKA 3F63A 2HYXA 4MZCA 1M2AA 5ECHB 3CMIA 4POLA 2QKEA 4HU9A 3TJFA 3PH9A 3IXRA 3F4SA 2HFDA 2LTKA 2P0GA 2TIRA 5G1KA 2YJ7A 3H93A 4G2EA 3KTBA 3TB2A 2CQ9A 2IMDA 5ECOB 4EF0A 5FWGA 4RQRA 3M3MA 2H66A 2LV3A 5GAND 4ZBBA 4XCSA 5CP1A 4YAPA 1B9XC 3ZMKA 1OC9B 3TKPA 2X8GA 2WDUA 3D22A 4PQIA 1GULA 3GV1A 2OJLA 2RLIA 4HUAA 2LJRA 4F0CA 3GKNA 2XC2A 2REMA 3KP8A 5C00A 4L5LA 3JCML 2IMEA 2A2SA 2AUVA 11GSA 4KF9A 1BAYA 1Z6NA 4ZILA 1U87A 3G7JA 5COHA 2C0DA 3GH6A 3VI5A 2PGTA 1WIKA 3UIWA 2L4CA 5D8IA 1GRXA 4HDEA 3HY2A 2IMKA 2YOIA 2H70A 1GNWA 1VF4A 1CQHA 1M7TA 1FB6A 1A23A 2LRCA 3RPPA 1WWJA 3NZNA 3DEXA 4LA1A 1X9WB 1OE7A 1PKWA 2WB9A 4K7IA 4MPFA
chains in the Genus database with same CATH superfamily
4IN0A 13GSA 3E0UA 1Q4JA 1XCCA 5AISA 2X4AA 3MAKA 1Z9HA 5A4UA 5D9WA 4MPGA 2EIOA 1EGOA 3IK9A 3WT1A 5AGYA 3TJGA 1ERUA 1SL2B 5IM9A 1QK8A 3H4KA 1ERWA 1RW1A 1JLWA 4XHMA 2VO4A 3HD5A 4EO3A 2PU9C 2LUSA 3A2XA 4DSRA 1O7UA 3N5OA 2LNSA 1XOAA 1YEPA 1V57A 2JSZA 5DCHA 1TK0B 3IR4A 5KN2A 3ZIJA 5JCUA 3TUEA 5KN3A 3GURA 1MTCA 3ZITA 5LD0A 2XBIA 2H1DA 2Z9SA 3DIEA 3GYKA 3HVNA 2L59A 1OYJA 1TRUA 3P90A 5HFKA 3GNJA 1O85A 3V1WA 3LWAA 5B8BA 3BOAA 1T3BA 5HR1A 4TN8A 1XWCA 4OD7A 3LQ7A 3BD2A 1N2AA 4ZL9A 4L0UA 3G9BA 3D6IA 2EFCA 1ZYNA 5DCGA 2EFDA 2AHEA 1N25A 1T8EB 3VWXA 2GQLA 2WW3A 1CQGA 3LXTA 3P2AA 2H72A 5J4VA 2HLSA 1SVMA 4Q5NA 2CV4A 1JZDA 2LKUA 3KP9A 2R0PA 1FOHA 5HR2A 3IC8A 3W8SA 1Z7RA 4CDOA 1SU9A 2ZNMA 4TXOA 2L6DA 3BBYA 5AN1A 5FT3A 4KDUA 4KAEA 3PGTA 1VF1A 1LU4A 2HZEB 1AXDA 4JBBA 5B6NA 1OVNA 5CAXA 2F9SA 2HSMB 4F0BA 4EC0A 5A5KA 1GLPA 1KEBA 2WS2A 2P5QA 4K1FA 1E2YA 1JZRA 2GZYA 5L71A 1XWKA 4K5SA 2WVXA 3A5WA 3KEBA 2I81A 2IWTA 4F82A 5B6MA 2M72A 4X4JA 4G0IA 5JWRB 3QMXA 1K3YA 4G0KA 3D21A 5J47A 1MDJA 2H6XA 2HI7A 2A2RA 4TKYA 3L4NA 3UAPA 3LEFA 1ERTA 4HJMA 2RUEA 4OFMA 3KIJA 3HXSA 3HDCA 2J9HA 2M80A 2VL9A 2OBIA 4Q5FA 2ALBA 4MJEA 3A2VA 2KUCA 2C1YA 3F4RA 3CXGA 4AJ7A 1GNEA 1SL0B 4OO4A 2FD3A 2B1KA 3UMAA 1HNBA 2GT5A 4IP1A 2B5YA 1TRWA 5ECRB 4BA7A 2GTUA 2LQOA 1PRXA 2OBKA 3MDKA 4L0WA 2AAWA 2C8UA 1J0FA 1SVOA 4NHWA 4IJ3A 2HQTA 4V2MA 4MMMA 3GX0A 1S3RA 2O5VA 2B3SA 2WFCA 4WKWA 1XIYA 4A5PA 4GQFA 1KNGA 4V1Ag 2CVBA 5E4WA 3FMWA 1SVLA 2NVLA 1NM3A 4ECIA 2LJKA 1TRVA 2RIIA 3ZTLA 4N30A 3IHQA 4HQSA 1C72A 1AAZA 1VF3A 2GSRA 4LLRA 2VD0A 5JCWA 2GDRA 1V9WA 2DJ2A 2MBTA 1X9SB 3TKSC 3ZVJA 4MP4A 4WBRD 1EOHA 1JHBA 2NTOA 2B7KA 3MYDA 5IMZA 1O8WA 1VGLA 2VCTA 3C1SA 5F0GA 4N0ZA 1TJDA 4ML1A 3UBKA 1DE2A 4MZWA 1JFUA 3OR5A 3VI7A 4ECBA 1QFNA 5HR3A 2GGTA 2OKAA 2MMOA 1OKDA 1X5DA 3HVSA 3EURA 4V2LA 3BCKA 4HZ4A 3M9JA 3DYRA 2D2ZA 2VCQA 4E8EA 2C4JA 2JU5A 2AYTA 4GF0A 4HQZA 1LJRA 4PI2C 4ZL7A 4TOPA 3TKRA 4OO5A 3C73A 6GSUA 3EMXA 3UARA 10GSA 1THOA 2V41A 4OCEA 4KSMA 2H0IA 2VD1A 4JE1A 2IMIA 3ZZXA 3IHGA 1TI1A 1YF0A 4K6XA 1FVKA 1K0CA 2WW0A 2VCWA 3F0IA 4F03A 3R3EA 4MF7A 2PVOC 3FEUA 2A4VA 5G31A 4ECJA 4KX4A 5DVBA 4V2NA 1SK2A 4POBA 1SYXA 2G0FA 5E59A 3GFKA 3TGZA 2QA2A 3ME8A 3TOUA 4XS6A 7GSSA 3U5RE 1ZOFA 1NHOA 2QSIA 3KMNA 3MIXA 2TRCP 2E0QA 5ELAA 3HVVA 2H71A 2WZ9A 3N9JA 1T00A 4TXOB 5ECNB 2DC5A 2KOKA 2EFEA 3FR6A 1JLVA 2FA4A 3I69A 3DVWA 3ZFLA 4MZBA 1RQMA 3MSZA 1UVZA 4EVMA 2CAQA 2UZ8A 1O6JA 4HJ2A 5KN1A 2DIYA 2HNLA 2VIMA 4KW6A 1BX9A 4X0XA 4I2UA 2TRXA 3TDGA 2H30A 1AIUA 2O3EA 4TR0A 3HA9A 3ZL5A 5F06A 1DUGA 5CREA 2N5FA 5CRDA 3TJKA 1EV4A 5IMDA 4PTSA 3M8NA 2WVXB 1A24A 1PN0A 2WCIA 3TKSE 4TW5A 5D73A 1FB0A 3ZREA 2HRAA 2XBQA 5HR0A 2R0CA 1ZMAA 4IW9A 2YV9A 1THXA 1GSEA 3KGKA 1YY7A 1B4PA 3QAGA 4ICYA 2F51A 3D0ZA 1ZGNA 2O89A 2R5GA 2LRNA 2B6MA 1M2BA 3CBUA 2PMTA 4HZ2A 4WBJA 3GSSA 2WZSA 3H8QA 3GX8A 2EIQA 2HRFA 2F8FA 2C3QA 1QXHA 3E9JB 5IMCA 1ML6A 2IN3A 1GP1A 5HFGA 3TJBA 2O8VB 3IA1A 2E2MA 2LNTA 3FYGA 4O7HA 3H1NA 3NOFA 1OC3A 1W4VA 5J41A 1M3JA 5CRGA 1EP8A 4NHZA 6GSTA 3TU3B 3VLNA 2H1LA 4ZB8A 1GL8A 4GDFA 3EMPA 3Q18A 2DBCA 3C1RA 1XW9A 3A3TA 5CO3A 1EP7A 3LYKA 3F4TA 1H4OA 5DQYA 2BJXA 2FGXA 5IPHA 4YAVA 1DBYA 4ZB7A 1SK1A 4KCEA 4IQ1A 4JRRA 2OADA 2YV7A 1BEDA 4WETA 1YEXA 4PNFA 1ZCPA 2RM5A 5DDLA 3AY8A 1XVWA 1J08A 3FZ9A 3M0FA 1ZYPA 5G5EA 2YCDA 1R4WA 3EE2A 3E3EA 5HQPA 4QQ7A 4RQXA 2WULA 3J7Yk 2KP2A 1OKTA 3CSIA 2MYGA 4BWSA 2WJUA 1GUKA 1O81A 4O5UA 3HKRA 4FH8A 3GTUA 1U3IA 3WGXA 1PKZA 5H5SA 2HT9A 3P8WA 2JADA 4BWQA 4F2IA 2XPEA 1TI3A 1KTEA 2H1GA 1S3AA 4BPYA 1ERVA 2H0GA 4KDXA 2VLUA 3G7IA 1Z6MA 3IDVA 4POMA 5LNKe 5GSSA 3EVIA 2VM1A 4GCIA 2VL2C 4FXYP 5GAPD 5IQYA 1URMA 3ZMLA 4WF4A 4IS0A 4K0NA 5J40A 1PX7A 2JZRA 1X5EA 1FOVA 4XRDA 3GL3A 3MWHA 4NWYA 3G7YA 2X8CA 2WW2A 3EINA 2DJ0A 1ZL9A 2PWJA 2HRKB 1PA3A 5A1NA 5J5NA 2PN8A 4YQMA 2YWOA 5A5HA 2IFQB 2NDOA 2HZFA 3RAZA 2YN1A 4MJCA 4KSOA 4MH2A 4POKA 5GZZB 1YVLA 1M2DA 2DLXA 4YQVA 2VLVA 1PX6A 4WEYA 1S4BP 5BRTA 5J4YA 2MZCA 4USSA 3TRQA 1TOFA 4I2TA 2F3MA 4KDYA 3C7MA 4BVXA 2B5XA 2PPTA 1Y1UA 4YQUA 3F3RA 1PGTA 5D9VA 2MBSA 1EWXA 1FAAA 3GRXA 5J9CA 5IMVA 4QL9A 3HZ8A 4LL4B 5ID2A 1UA5A 4I6XA 1GSUA 1WP0A 1PSQA 4GTUA 4MCUA 5D96A 4EDZA 5BMUA 4PQ1A 2CAIA 1Z3EA 4MJAA 3HMJG 5DALA 2VOCA 2B7JA 2AB6A 4ECCA 4TXVA 6GSWA 4KUNA 4NV2A 5EVOA 3GL5A 1A8YA 1N8JA 1I9DA 2ES7A 1SKRB 1TTZA 3NIVA 4Q5RA 3LG6A 4MABA 4BVYA 5KEJA 1A8LA 1OE8A 3UJ1A 2C0FA 4FYCA 4ZXGA 1PN9A 2H19A 4RI6A 3QR6A 3EWLA 1W89A 4AKHA 4GXZA 3L0HA 3J7Yb 4DSSA 2YJHA 1X0RA 1R5AA 3FY7A 4GSTA 4XIHA 2FCHA 4Z7XA 4HS1A 5FHIA 4EIQA 3HZ4A 4WR5A 3PR8A 3ZRDA 2VCZA 2RUFA 2HSHA 3R2QA 3DWVA 1XOBA 4JZQA 5D9XA 4ZB6A 2VUPA 3SBCA 2FA8A 1M99A 4BL7A 3VURA 5ECMB 5IIZA 1ABAA 2R37A 4PGTA 2MMNA 2GSQA 3WT2A 5DJMA 3S9FA 3H79A 4O5RA 2X99A 2K6VA 4GLTA 3I9V2 4O92A 3HJPA 1BQ7A 1PD21 2LRTA 1FW1A 5EL8A 2B5EA 5D93A 3ERGA 1S3DA 1TK5B 1AQVA 2DMMA 3A2WA 1M9BA 5J9BA 4CHSA 1Z7PA 2O87A 1AQWA 1ACVA 2QC7A 2YANA 1A2MA 5A4WA 1AQXA 1AUCA 4FIWA 3KMOA 2XPDA 3U6VA 2A2PA 4O5QA 3I43A 4Z2RA 1PQNA 1WJKA 4ILFA 5ENUA 3EPTA 3W8JA 4K7NA 1UN2A 1NHYA 1JZWA 1DE1A 1T4YA 5JWOB 2L57A 4JEDA 4HU7A 1F3AA 1BF5A 1Y6EA 3RBTA 4NMUA 1K3LA 2H1BA 5G1LA 4RUVA 3F6DA 2IL3A 1VF2A 3DXBA 3Q19A 4PUAA 4PXOA 4G9HA 3CYNA 3DD3A 1A2JA 4GRFA 4K9ZA 1TK8B 4EE0A 1M0UA 2CVDA 3GN3A 4X1UA 1SJZA 2IIYA 2FWEA 4ML6A 3EU4A 4NAXA 5ECSA 2K18A 1ZZYA 2L5LA 3VPTA 1YEWC 4NV5A 1YZXA 2GZZA 5B8AA 4K7OA 1K0OA 2H75A 2FLSA 2UV8G 1OAZA 3QDNA 4HOJA 4OMVA 2FWHA 1V58A 3EYTA 4TVEA 5CYYA 1QGVA 3D5JA 4LMVA 2IPAA 5A5HB 4Z2TA 4DSQA 4YKGA 1K0MA 2K8SA 3KD0A 1XPVA 3O3TA 4ID0A 1O8XA 3ME7A 5G2ZA 1M3IA 3VWWA 4KNDA 1Y25A 2MMZA 2PERA 1GSQA 2WGRA 2YPMA 4EXJA 2H73A 1PL2A 2OE1A 1HYUA 4PI0C 2JZSA 4BVXB 1EZKA 2DIZA 1SJ6A 3DGQA 2YWIA 3GHAA 4AKGA 3LORA 8GSSA 4P3YB 4PQHA 4H86A 4JR4A 1EEJA 3PINA 3APSA 1SL1B 1WOUA 1GSFA 2CVKA 3FR9A 2K9FA 4OWYA 2DJ1A 2L6CA 4IJIA 2ZUPA 2PBJA 4EDYA 1G7EA 3KTLA 3CTFA 4N10A 2YZHA 3L9SA 1SKWB 3FW2A 1GSYA 5IOXA 5ECQB 1SENA 3RPNA 3FHKA 1K3OA 1WMJA 2H01A 2E7PA 4J57E 3CRTA 1YDKA 3LJRA 3ZLPA 1H75A 1AW9A 1I1IP 2YZUA 3LSZA 4BVYB 3D4MA 1GTAA 3BCIA 1XW6A 4I97A 3L78A 4CY6A 3IRAA 3VFIA 4DSSB 2GSSA 4K5RA 5J4UA 3LYPA 5KOWA 1XZOA 5A4VA 4K2DA 1R7HA 4MLYA 1TU7A 2X8HA 2HRNA 4N11A 1USBA 3DKSA 3F3QA 3TCOA 1FVJA 5DJLA 2H1AA 4XTSA 3UVTA 4IBPA 2YWNA 4KE3A 1NW2A 2GS3A 4BL7B 2CX4A 4K8MA 2M46A 4NXIA 4FYBA 2HE3A 3WGEA 3W6GA 1U88A 3UL3A 2O7KA 2DMLA 2K8VA 1JZOA 2OT3A 4AGSA 4QMKA 2GLRA 1Q98A 5H5QA 4HSCX 1R5PA 2H76A 2CA8A 4K0GA 4Q5QA 5IO0A 2H74A 2LEGA 3C8EA 3EC3A 4XS1A 1G7OA 1GUHA 3UBLA 3HVXA 4MK3A 3A5IA 3DRNA 4PURA 1VRSD 4XRAA 3D4TA 4AF2A 1TDIA 5G30A 2DJKA 4IVFA 2OE3A 1PL1A 2EC4A 3MNGA 1V40A 4RI7A 3VK9A 3HJOA 4O32A 3IAM2 2JZTA 3KH9A 1UC7A 1WRYA 2E2GA 4TR4A 3TJJA 3FZ5A 2R4VA 3O6TA 1AC1A 4ZBDA 1GWCA 22GSA 2HSYA 1X5CA 5CRHA 5D9TA 5J3RA 1PMTA 2FHEA 4KB3A 2YNXA 1ZYEA 1IYIA 4ACSA 2DJ3A 3ZIVA 5AIXA 2JL4A 1FO5A 1XG8A 4ZBAA 1FHEA 4IELA 2H8LA 3IC4A 5JWQB 1XXUA 1NSWA 5ABRA 1MD4A 3VWVA 19GSA 5DQSA 1TW9A 1ST9A 4ZIJA 4PUFC 4MA9A 1XW5A 1T7PB 2LJAA 1LBKA 4HEA2 4TR1A 1MDIA 1XFLA 2L4QA 3QFAC 4L5OA 3GMFA 3KH7A 2PVQA 3QCPA 2WVZA 2G2QA 5F07A 1V2AA 20GSA 4TR3A 4F9ZA 1RK4A 2VKZG 3HYPA 2R6KA 1GLQA 3IV4A 5IPGA 3KM6A 4XS4A 2FWGA 1SD9A 1G0TA 4OCFA 1GTUA 5KN0A 5CRWA 1XWBA 4TRXA 3US3A 1F2EA 1K0NA 2P5RA 5DAKA 4E68A 3DMLA 2FNOA 1T4ZA 3Q74A 5G5FA 2GQKA 1GH2A 4MNNA 2H6YA 5IMFA 2H6ZA 4IQAA 1QMVA 1QQ2A 4JU5A 1YKCA 2FY6A 4ZB9A 4KH7A 2KHPA 3HJMA 4FQUA 5F05A 1DSBA 2YWMA 4G0LA 1U3AA 17GSA 1XBSA 1I5GA 3L9UA 4AJ8A 5IO2A 2LQQA 5ECIB 2L5OA 1TKDB 2DKIA 5A34A 4IHUA 5B7CA 1EEMA 2GVPA 4WF5A 4W66A 4MH3A 3IE3A 2B1LA 3ISOA 1SYRA 14GSA 1B48A 3K8NA 3IK7A 4D73A 2IMFA 2QGVA 2HSNA 2WW1A 3CTGA 2I4AA 2JSYA 4NPBA 2KP1A 3KZQA 3LGCA 1SD8A 3UVHA 3I6AA 1HQOA 1T1VA 2IJYA 3M9KA 3CSHA 1TRSA 3QD9A 1J9BA 4AI6A 2P31A 1YJ6A 2VL3A 1QUWA 3CQFA 2V32A 3DVXA 4J2FA 2VM2A 3F9UA 1B4QA 4CW9A 2ON7A 3IAS2 4HI7A 1Z5YE 4LMWA 2VCXA 4IGJA 2C80A 5DBQA 3LW9A 1XWAA 4DVCA 6GSXA 1K0BA 2C3TA 3M1GA 3WGDA 4PX1A 3QPMA 3VPQA 2CZ3A 2DJJA 2NPBA 4KCAA 3IPZA 5AIVA 3FZ4A 4ULXA 3F8UA 3KXOA 4AKIA 2VL2A 1BG1A 1BYEA 4EUYA 3P7XA 3UEMA 2GZPA 4G01A 2OACA 3C71A 2HXKA 3RDWA 1U6TA 5INYA 1WE0A 2KLXA 1XWGA 5LCZA 4MF5A 1EV9A 1TXXA 1F6MC 3RFRC 3GKMA 4MJBA 1GUMA 1SJIA 1YKAA 2RM6A 3GIXA 5IMAA 2OE0A 1F9MA 3BJ5A 16GSA 3WD6A 2I9HA 2V1MA 1ILOA 5ECLB 1GSSA 2C3NA 3GH9A 1BJXA 5GSTA 2VAFA 1O73A 12GSA 4MDCA 3VWUA 2AV4A 1OC9A 3ERWA 4E8HA 2C0GA 5ECPB 4EKZA 1A0FA 1K0DA 4OFNA 4ISDA 4PNGA 3QOUA 4YH2A 2EIRA 3WYWA 2DKHA 3IOSA 3SWLA 2YP6A 3GTUB 3TRXA 2ON5A 1A0RP 2I1UA 2LS5A 1SK0A 6GSSA 5ECKB 1ZYQB 5F8BA 2V2GA 2X64A 4N0VA 4KA0A 1KBNA 2R0GA 3PPUA 3LFLA 2R3XA 4TR1B 18GSA 4KGIA 4G10A 5JCGA 1M9AA 1S3CA 1GTIA 3CHXC 1R26A 3APOA 3ED3A 3L9VA 5KOXA 4GWRA 1IYHA 4EL1A 5C04A 4L8EA 3TOTA 4GSNA 4AJ6A 2GT6A 1XVQA 4XS4B 4I5QA 2VLTA 2CT6A 4EIPA 4MF6A 5A1NB 3O76A 2BMXA 1SKSB 5DAKB 1ON4A 2OA7A 4JR6A 1B8XA 3F6FA 3APQA 3GSTA 4OFTA 1K0AA 2WVYA 4GQCA 4V1Ap 1FG4A 1HNAA 4DEJA 1MD3A 1GSDA 2H0HA 3CSJA 4IKHA 1E6BA 2AJQB 2J23A 1EOGA 1V98A 1TU8A 3IBHA 5EPFA 3GA4A 2V6OA 3FRCA 3GKKA 2HRKA 5HFIA 1YQ1A 1A2LA 2LSTA 4WR4A 1YF1A 1G6YA 3LXZA 3FZAA 3KCMA 3Q6OA 5ID2B 2VCVA 2IFQA 3RHBA 1X9MB 2F8AA 5A34B 3RHCA 1HNCA 4N3ZA 2MMAA 1MEKA 3ERFA 5EY6A 2CX3A 5BMUB 3CRUA 1GTBA 3QAWA 5CNWA 4D73B 5DALB 1F37A 2HSNB 3FKFA 1B9YC 3KJYA 3QAVA 3ZVJD 3TKQA 3UOMA 2GQMA 1HD2A 5ELGA 4LL1B 4G19A 4GSSA 2BTOT 2NBSA 9GSSA 2CZ2A 1G6WA 3QFBC 4IP6A 1OC8A 4QL7A 3HHVA 2ZCTA 4ZL8A 4J56E 3GKXA 2FUG2 3EU3A 1TXUA 6GSYA 2GSTA 3ZFBA 2I3YA 3HCZA 2V6KA 4FO5A 1F3BA 3GUSA 3RGBC 2R2JA 3FK8A 2WRTA 2DSAA 4K2XA 5H5RA 1BG5A 6GSVA 3FR3A 1WPIA 3ZYWA 4Z2UA 2HZEA 2N5BA 4I8BA 2N5AA 3TRPA 4BIKA 2C0EA 3TKSA 4X43A 4PHZC 4FYUA 2O85A 2JACA 4WXTA 2HSMA 2XHFA 2PUKC 1EGRA 2FWFA 1TP9A 5IOWA 1MDKA 3F63A 2HYXA 4MZCA 1M2AA 5ECHB 3CMIA 4POLA 2QKEA 4HU9A 3TJFA 2O36A 4CY8A 3PH9A 3IXRA 3F4SA 2HFDA 2LTKA 2P0GA 2TIRA 5G1KA 2YJ7A 3H93A 4G2EA 3KTBA 3TB2A 2CQ9A 2X49A 2A4HA 2IMDA 5ECOB 4EF0A 5FWGA 4RQRA 3M3MA 2H66A 2LV3A 5GAND 4ZBBA 4XCSA 5CP1A 4YAPA 1B9XC 3ZMKA 1OC9B 3TKPA 4AKXB 2X8GA 2WDUA 3D22A 4PQIA 1GULA 3GV1A 2OJLA 2RLIA 3CWGA 4HUAA 2LJRA 4F0CA 3GKNA 2XC2A 2REMA 3KP8A 5C00A 4L5LA 3JCML 2IMEA 2A2SA 2AUVA 11GSA 4KF9A 1BAYA 1Z6NA 4ZILA 1U87A 3G7JA 5COHA 2C0DA 3GH6A 3VI5A 2PGTA 4YKFA 1WIKA 3UIWA 2L4CA 5D8IA 1GRXA 4HDEA 3HY2A 1PFOA 2IMKA 2YOIA 2H70A 1GNWA 1VF4A 1CQHA 1M7TA 1FB6A 1A23A 2QA1A 2LRCA 2EFHA 3RPPA 1WWJA 3NZNA 3DEXA 4LA1A 1X9WB 1OE7A 1PKWA 2WB9A 4K7IA 4MPFA
chains in the Genus database with same CATH topology
4IN0A 13GSA 3E0UA 1Q4JA 1XCCA 5AISA 2X4AA 3MAKA 1Z9HA 5A4UA 5D9WA 4MPGA 2EIOA 1EGOA 3IK9A 3WT1A 5AGYA 3TJGA 1ERUA 1SL2B 5IM9A 1QK8A 3H4KA 1ERWA 1RW1A 1JLWA 4XHMA 2VO4A 3HD5A 4EO3A 2PU9C 2LUSA 3A2XA 4DSRA 1O7UA 3N5OA 2LNSA 1XOAA 1YEPA 1V57A 2JSZA 5DCHA 1TK0B 3IR4A 5KN2A 3ZIJA 5JCUA 3TUEA 5KN3A 3GURA 1MTCA 3ZITA 5LD0A 2XBIA 2H1DA 2Z9SA 3DIEA 3GYKA 2L59A 1OYJA 1TRUA 3P90A 5HFKA 3GNJA 1O85A 3V1WA 3LWAA 5B8BA 3BOAA 1T3BA 5HR1A 4TN8A 1XWCA 4OD7A 3LQ7A 3BD2A 1N2AA 4ZL9A 4L0UA 3G9BA 3D6IA 2EFCA 1ZYNA 5DCGA 2EFDA 2AHEA 1N25A 1T8EB 3VWXA 2GQLA 1CQGA 3LXTA 3P2AA 2H72A 5J4VA 2HLSA 1SVMA 4Q5NA 2CV4A 1JZDA 2LKUA 3KP9A 2R0PA 1FOHA 5HR2A 3IC8A 3W8SA 1Z7RA 4CDOA 1SU9A 2ZNMA 4TXOA 2L6DA 3BBYA 5AN1A 5FT3A 4KDUA 4KAEA 3PGTA 1VF1A 1LU4A 2HZEB 1AXDA 4JBBA 5B6NA 1OVNA 5CAXA 2F9SA 2HSMB 4F0BA 4EC0A 5A5KA 1GLPA 1KEBA 2WS2A 2P5QA 4K1FA 1E2YA 1JZRA 2GZYA 5L71A 1XWKA 4K5SA 3A5WA 3KEBA 2I81A 2IWTA 4F82A 5B6MA 2M72A 4X4JA 4G0IA 5JWRB 3QMXA 1K3YA 4G0KA 3D21A 5J47A 1MDJA 2H6XA 2HI7A 2A2RA 4TKYA 3L4NA 3UAPA 3LEFA 1ERTA 4HJMA 2RUEA 4OFMA 3KIJA 3HXSA 3HDCA 2J9HA 2M80A 2VL9A 2OBIA 4Q5FA 2ALBA 4MJEA 3A2VA 2KUCA 2C1YA 3F4RA 3CXGA 4AJ7A 1GNEA 1SL0B 4OO4A 2FD3A 2B1KA 3UMAA 1HNBA 2GT5A 4IP1A 2B5YA 1TRWA 5ECRB 4BA7A 2GTUA 2LQOA 1PRXA 2OBKA 3MDKA 4L0WA 2AAWA 2C8UA 1J0FA 1SVOA 4NHWA 4IJ3A 2HQTA 4V2MA 4MMMA 3GX0A 2O5VA 2B3SA 2WFCA 4WKWA 1XIYA 4A5PA 4GQFA 1KNGA 4V1Ag 2CVBA 5E4WA 3FMWA 1SVLA 2NVLA 1NM3A 4ECIA 2LJKA 1TRVA 2RIIA 3ZTLA 4N30A 3IHQA 4HQSA 1C72A 1AAZA 1VF3A 2GSRA 4LLRA 2VD0A 5JCWA 2GDRA 1V9WA 2DJ2A 2MBTA 1X9SB 3TKSC 3ZVJA 4MP4A 4WBRD 1EOHA 1JHBA 2NTOA 2B7KA 3MYDA 5IMZA 1O8WA 1VGLA 2VCTA 3C1SA 5F0GA 4N0ZA 1TJDA 4ML1A 3UBKA 1DE2A 4MZWA 1JFUA 3OR5A 3VI7A 4ECBA 1QFNA 5HR3A 2GGTA 2OKAA 2MMOA 1OKDA 1X5DA 3HVSA 3EURA 4V2LA 3BCKA 4HZ4A 3M9JA 3DYRA 2D2ZA 2VCQA 4E8EA 2C4JA 2JU5A 2AYTA 4GF0A 4HQZA 1LJRA 4ZL7A 4TOPA 3TKRA 4OO5A 3C73A 6GSUA 3EMXA 3UARA 10GSA 1THOA 2V41A 4OCEA 4KSMA 2H0IA 2VD1A 4JE1A 2IMIA 3ZZXA 3IHGA 1TI1A 1YF0A 4K6XA 1FVKA 1K0CA 2VCWA 3F0IA 4F03A 3R3EA 4MF7A 2PVOC 3FEUA 2A4VA 5G31A 4ECJA 4KX4A 5DVBA 4V2NA 1SK2A 4POBA 1SYXA 2G0FA 5E59A 3GFKA 3TGZA 2QA2A 3ME8A 3TOUA 4XS6A 7GSSA 3U5RE 1ZOFA 1NHOA 2QSIA 3KMNA 3MIXA 2TRCP 2E0QA 5ELAA 3HVVA 2H71A 2WZ9A 3N9JA 1T00A 4TXOB 5ECNB 2DC5A 2KOKA 2EFEA 3FR6A 1JLVA 2FA4A 3I69A 3DVWA 3ZFLA 4MZBA 1RQMA 3MSZA 1UVZA 4EVMA 2CAQA 2UZ8A 1O6JA 4HJ2A 5KN1A 2DIYA 2HNLA 2VIMA 4KW6A 1BX9A 4X0XA 4I2UA 2TRXA 3TDGA 2H30A 1AIUA 4TR0A 3HA9A 3ZL5A 5F06A 1DUGA 5CREA 2N5FA 5CRDA 3TJKA 1EV4A 5IMDA 4PTSA 3M8NA 1A24A 1PN0A 2WCIA 3TKSE 4TW5A 5D73A 1FB0A 3ZREA 2HRAA 2XBQA 5HR0A 2R0CA 1ZMAA 4IW9A 2YV9A 1THXA 1GSEA 3KGKA 1YY7A 1B4PA 3QAGA 4ICYA 2F51A 3D0ZA 1ZGNA 2O89A 2R5GA 2LRNA 2B6MA 1M2BA 3CBUA 2PMTA 4HZ2A 4WBJA 3GSSA 3H8QA 3GX8A 2EIQA 2HRFA 2F8FA 2C3QA 1QXHA 3E9JB 5IMCA 1ML6A 2IN3A 1GP1A 5HFGA 3TJBA 2O8VB 3IA1A 2E2MA 2LNTA 3FYGA 4O7HA 3H1NA 3NOFA 1OC3A 1W4VA 5J41A 5CRGA 1EP8A 4NHZA 6GSTA 3TU3B 3VLNA 2H1LA 4ZB8A 1GL8A 4GDFA 3EMPA 3Q18A 2DBCA 3C1RA 1XW9A 3A3TA 5CO3A 1EP7A 3LYKA 3F4TA 1H4OA 5DQYA 2BJXA 2FGXA 5IPHA 4YAVA 1DBYA 4ZB7A 1SK1A 4KCEA 4IQ1A 4JRRA 2OADA 2YV7A 1BEDA 4WETA 1YEXA 4PNFA 1ZCPA 2RM5A 5DDLA 3AY8A 1XVWA 1J08A 3FZ9A 3M0FA 1ZYPA 5G5EA 2YCDA 1R4WA 3EE2A 3E3EA 5HQPA 4QQ7A 4RQXA 2WULA 3J7Yk 2KP2A 1OKTA 3CSIA 2MYGA 4BWSA 2WJUA 1GUKA 1O81A 4O5UA 3HKRA 4FH8A 3GTUA 1U3IA 3WGXA 1PKZA 5H5SA 2HT9A 3P8WA 2JADA 4BWQA 4F2IA 2XPEA 1TI3A 1KTEA 2H1GA 1S3AA 4BPYA 1ERVA 2H0GA 4KDXA 2VLUA 3G7IA 1Z6MA 3IDVA 4POMA 5LNKe 5GSSA 3EVIA 2VM1A 4GCIA 2VL2C 5GAPD 5IQYA 1URMA 3ZMLA 4WF4A 4IS0A 4K0NA 5J40A 1PX7A 2JZRA 1X5EA 1FOVA 4XRDA 3GL3A 3MWHA 4NWYA 3G7YA 2X8CA 3EINA 2DJ0A 1ZL9A 2PWJA 2HRKB 1PA3A 5A1NA 5J5NA 2PN8A 4YQMA 2YWOA 5A5HA 2IFQB 2NDOA 2HZFA 3RAZA 2YN1A 4MJCA 4KSOA 4MH2A 4POKA 5GZZB 1YVLA 1M2DA 2DLXA 4YQVA 2VLVA 1PX6A 4WEYA 5BRTA 5J4YA 2MZCA 4USSA 3TRQA 1TOFA 4I2TA 2F3MA 4KDYA 3C7MA 4BVXA 2B5XA 2PPTA 1Y1UA 4YQUA 3F3RA 1PGTA 5D9VA 2MBSA 1EWXA 1FAAA 3GRXA 5J9CA 5IMVA 4QL9A 3HZ8A 4LL4B 5ID2A 1UA5A 4I6XA 1GSUA 1WP0A 1PSQA 4GTUA 4MCUA 5D96A 4EDZA 5BMUA 4PQ1A 2CAIA 1Z3EA 4MJAA 3HMJG 5DALA 2VOCA 2B7JA 2AB6A 4ECCA 4TXVA 6GSWA 4KUNA 4NV2A 5EVOA 3GL5A 1A8YA 1N8JA 1I9DA 2ES7A 1SKRB 1TTZA 3NIVA 4Q5RA 3LG6A 4MABA 4BVYA 5KEJA 1A8LA 1OE8A 3UJ1A 2C0FA 4FYCA 4ZXGA 1PN9A 2H19A 4RI6A 3QR6A 3EWLA 1W89A 4AKHA 4GXZA 3L0HA 3J7Yb 4DSSA 2YJHA 1X0RA 1R5AA 3FY7A 4GSTA 4XIHA 2FCHA 4Z7XA 4HS1A 5FHIA 4EIQA 3HZ4A 4WR5A 3PR8A 3ZRDA 2VCZA 2RUFA 2HSHA 3R2QA 3DWVA 1XOBA 4JZQA 5D9XA 4ZB6A 2VUPA 3SBCA 2FA8A 1M99A 4BL7A 3VURA 5ECMB 5IIZA 1ABAA 2R37A 4PGTA 2MMNA 2GSQA 3WT2A 5DJMA 3S9FA 3H79A 4O5RA 2X99A 2K6VA 4GLTA 3I9V2 4O92A 3HJPA 1BQ7A 1PD21 2LRTA 1FW1A 5EL8A 2B5EA 5D93A 3ERGA 1S3DA 1TK5B 1AQVA 2DMMA 3A2WA 1M9BA 5J9BA 4CHSA 1Z7PA 2O87A 1AQWA 1ACVA 2QC7A 2YANA 1A2MA 5A4WA 1AQXA 1AUCA 4FIWA 3KMOA 2XPDA 3U6VA 2A2PA 4O5QA 3I43A 4Z2RA 1PQNA 1WJKA 4ILFA 5ENUA 3EPTA 3W8JA 4K7NA 1UN2A 1NHYA 1JZWA 1DE1A 1T4YA 5JWOB 2L57A 4JEDA 4HU7A 1F3AA 1BF5A 1Y6EA 3RBTA 4NMUA 1K3LA 2H1BA 5G1LA 4RUVA 3F6DA 2IL3A 1VF2A 3DXBA 3Q19A 4PUAA 4PXOA 4G9HA 3CYNA 3DD3A 1A2JA 4GRFA 4K9ZA 1TK8B 4EE0A 1M0UA 2CVDA 3GN3A 4X1UA 1SJZA 2IIYA 2FWEA 4ML6A 3EU4A 4NAXA 5ECSA 2K18A 1ZZYA 2L5LA 3VPTA 4NV5A 1YZXA 2GZZA 5B8AA 4K7OA 1K0OA 2H75A 2FLSA 2UV8G 1OAZA 3QDNA 4HOJA 4OMVA 2FWHA 1V58A 3EYTA 4TVEA 5CYYA 1QGVA 3D5JA 4LMVA 2IPAA 5A5HB 4Z2TA 4DSQA 4YKGA 1K0MA 2K8SA 3KD0A 1XPVA 3O3TA 4ID0A 1O8XA 3ME7A 5G2ZA 3VWWA 4KNDA 1Y25A 2MMZA 2PERA 1GSQA 2WGRA 2YPMA 4EXJA 2H73A 1PL2A 2OE1A 1HYUA 2JZSA 4BVXB 1EZKA 2DIZA 1SJ6A 3DGQA 2YWIA 3GHAA 4AKGA 3LORA 8GSSA 4P3YB 4PQHA 4H86A 4JR4A 1EEJA 3PINA 3APSA 1SL1B 1WOUA 1GSFA 2CVKA 3FR9A 2K9FA 4OWYA 2DJ1A 2L6CA 4IJIA 2ZUPA 2PBJA 4EDYA 1G7EA 3KTLA 3CTFA 4N10A 2YZHA 3L9SA 1SKWB 3FW2A 1GSYA 5IOXA 5ECQB 1SENA 3RPNA 3FHKA 1K3OA 1WMJA 2H01A 2E7PA 4J57E 3CRTA 1YDKA 3LJRA 3ZLPA 1H75A 1AW9A 2YZUA 3LSZA 4BVYB 3D4MA 1GTAA 3BCIA 1XW6A 4I97A 3L78A 4CY6A 3IRAA 3VFIA 4DSSB 2GSSA 4K5RA 5J4UA 3LYPA 5KOWA 1XZOA 5A4VA 4K2DA 1R7HA 4MLYA 1TU7A 2X8HA 2HRNA 4N11A 1USBA 3DKSA 3F3QA 3TCOA 1FVJA 5DJLA 2H1AA 4XTSA 3UVTA 4IBPA 2YWNA 4KE3A 1NW2A 2GS3A 4BL7B 2CX4A 4K8MA 2M46A 4NXIA 4FYBA 2HE3A 3WGEA 3W6GA 1U88A 3UL3A 2O7KA 2DMLA 2K8VA 1JZOA 2OT3A 4AGSA 4QMKA 2GLRA 1Q98A 5H5QA 1R5PA 2H76A 2CA8A 4K0GA 4Q5QA 5IO0A 2H74A 2LEGA 3C8EA 3EC3A 4XS1A 1G7OA 1GUHA 3UBLA 3HVXA 4MK3A 3A5IA 3DRNA 4PURA 1VRSD 4XRAA 3D4TA 4AF2A 1TDIA 5G30A 2DJKA 4IVFA 2OE3A 1PL1A 2EC4A 3MNGA 1V40A 4RI7A 3VK9A 3HJOA 4O32A 3IAM2 2JZTA 3KH9A 1UC7A 1WRYA 2E2GA 4TR4A 3TJJA 3FZ5A 2R4VA 3O6TA 1AC1A 4ZBDA 1GWCA 22GSA 2HSYA 1X5CA 5CRHA 5D9TA 5J3RA 1PMTA 2FHEA 4KB3A 2YNXA 1ZYEA 1IYIA 4ACSA 2DJ3A 3ZIVA 5AIXA 2JL4A 1FO5A 4ZBAA 1FHEA 4IELA 2H8LA 3IC4A 5JWQB 1XXUA 1NSWA 5ABRA 1MD4A 3VWVA 19GSA 5DQSA 1TW9A 1ST9A 4ZIJA 4PUFC 4MA9A 1XW5A 1T7PB 2LJAA 1LBKA 4HEA2 4TR1A 1MDIA 1XFLA 2L4QA 3QFAC 4L5OA 3GMFA 3KH7A 2PVQA 3QCPA 2G2QA 5F07A 1V2AA 20GSA 4TR3A 4F9ZA 1RK4A 2VKZG 3HYPA 2R6KA 1GLQA 3IV4A 5IPGA 3KM6A 4XS4A 2FWGA 1SD9A 1G0TA 4OCFA 1GTUA 5KN0A 5CRWA 1XWBA 4TRXA 3US3A 1F2EA 1K0NA 2P5RA 5DAKA 4E68A 3DMLA 2FNOA 1T4ZA 3Q74A 5G5FA 2GQKA 1GH2A 4MNNA 2H6YA 5IMFA 2H6ZA 4IQAA 1QMVA 1QQ2A 4JU5A 1YKCA 2FY6A 4ZB9A 4KH7A 2KHPA 3HJMA 4FQUA 5F05A 1DSBA 2YWMA 4G0LA 1U3AA 17GSA 1XBSA 1I5GA 3L9UA 4AJ8A 5IO2A 2LQQA 5ECIB 2L5OA 1TKDB 2DKIA 5A34A 4IHUA 5B7CA 1EEMA 2GVPA 4WF5A 4W66A 4MH3A 3IE3A 2B1LA 3ISOA 1SYRA 14GSA 1B48A 3K8NA 3IK7A 4D73A 2IMFA 2QGVA 2HSNA 3CTGA 2I4AA 2JSYA 4NPBA 2KP1A 3KZQA 3LGCA 1SD8A 3UVHA 3I6AA 1HQOA 1T1VA 2IJYA 3M9KA 3CSHA 1TRSA 3QD9A 1J9BA 4AI6A 2P31A 1YJ6A 2VL3A 1QUWA 2V32A 3DVXA 4J2FA 2VM2A 3F9UA 1B4QA 4CW9A 2ON7A 3IAS2 4HI7A 1Z5YE 4LMWA 2VCXA 4IGJA 2C80A 5DBQA 3LW9A 1XWAA 4DVCA 6GSXA 1K0BA 2C3TA 3M1GA 3WGDA 4PX1A 3QPMA 3VPQA 2CZ3A 2DJJA 2NPBA 4KCAA 3IPZA 5AIVA 3FZ4A 4ULXA 3F8UA 3KXOA 4AKIA 2VL2A 1BG1A 1BYEA 4EUYA 3P7XA 3UEMA 2GZPA 4G01A 2OACA 3C71A 2HXKA 3RDWA 1U6TA 5INYA 1WE0A 2KLXA 1XWGA 5LCZA 4MF5A 1EV9A 1TXXA 1F6MC 3GKMA 4MJBA 1GUMA 1SJIA 1YKAA 2RM6A 3GIXA 5IMAA 2OE0A 1F9MA 3BJ5A 16GSA 3WD6A 2I9HA 2V1MA 1ILOA 5ECLB 1GSSA 2C3NA 3GH9A 1BJXA 5GSTA 2VAFA 1O73A 12GSA 4MDCA 3VWUA 2AV4A 1OC9A 3ERWA 4E8HA 2C0GA 5ECPB 4EKZA 1A0FA 1K0DA 4OFNA 4ISDA 4PNGA 3QOUA 4YH2A 2EIRA 3WYWA 2DKHA 3IOSA 3SWLA 2YP6A 3GTUB 3TRXA 2ON5A 1A0RP 2I1UA 2LS5A 1SK0A 6GSSA 5ECKB 1ZYQB 5F8BA 2V2GA 2X64A 4N0VA 4KA0A 1KBNA 2R0GA 3PPUA 3LFLA 2R3XA 4TR1B 18GSA 4KGIA 4G10A 5JCGA 1M9AA 1S3CA 1GTIA 1R26A 3APOA 3ED3A 3L9VA 5KOXA 4GWRA 1IYHA 4EL1A 5C04A 4L8EA 3TOTA 4GSNA 4AJ6A 2GT6A 1XVQA 4XS4B 4I5QA 2VLTA 2CT6A 4EIPA 4MF6A 5A1NB 3O76A 2BMXA 1SKSB 5DAKB 1ON4A 2OA7A 4JR6A 1B8XA 3F6FA 3APQA 3GSTA 4OFTA 1K0AA 4GQCA 4V1Ap 1FG4A 1HNAA 4DEJA 1MD3A 1GSDA 2H0HA 3CSJA 4IKHA 1E6BA 2AJQB 2J23A 1EOGA 1V98A 1TU8A 3IBHA 5EPFA 3GA4A 2V6OA 3FRCA 3GKKA 2HRKA 5HFIA 1YQ1A 1A2LA 2LSTA 4WR4A 1YF1A 1G6YA 3LXZA 3FZAA 3KCMA 3Q6OA 5ID2B 2VCVA 2IFQA 3RHBA 1X9MB 2F8AA 5A34B 3RHCA 1HNCA 4N3ZA 2MMAA 1MEKA 3ERFA 5EY6A 2CX3A 5BMUB 3CRUA 1GTBA 3QAWA 5CNWA 4D73B 5DALB 1F37A 2HSNB 3FKFA 1B9YC 3KJYA 3QAVA 3ZVJD 3TKQA 3UOMA 2GQMA 1HD2A 5ELGA 4LL1B 4G19A 4GSSA 2BTOT 2NBSA 9GSSA 2CZ2A 1G6WA 3QFBC 4IP6A 1OC8A 4QL7A 3HHVA 2ZCTA 4ZL8A 4J56E 3GKXA 2FUG2 3EU3A 1TXUA 6GSYA 2GSTA 3ZFBA 2I3YA 3HCZA 2V6KA 4FO5A 1F3BA 3GUSA 2R2JA 3FK8A 2WRTA 2DSAA 4K2XA 5H5RA 1BG5A 6GSVA 3FR3A 1WPIA 3ZYWA 4Z2UA 2HZEA 2N5BA 4I8BA 2N5AA 3TRPA 2C0EA 3TKSA 4X43A 4FYUA 2O85A 2JACA 4WXTA 2HSMA 2XHFA 2PUKC 1EGRA 2FWFA 1TP9A 5IOWA 1MDKA 3F63A 2HYXA 4MZCA 1M2AA 5ECHB 3CMIA 4POLA 2QKEA 4HU9A 3TJFA 4CY8A 3PH9A 3IXRA 3F4SA 2HFDA 2LTKA 2P0GA 2TIRA 5G1KA 2YJ7A 3H93A 4G2EA 3KTBA 3TB2A 2CQ9A 2X49A 2A4HA 2IMDA 5ECOB 4EF0A 5FWGA 4RQRA 3M3MA 2H66A 2LV3A 5GAND 4ZBBA 4XCSA 5CP1A 4YAPA 1B9XC 3ZMKA 1OC9B 3TKPA 4AKXB 2X8GA 2WDUA 3D22A 4PQIA 1GULA 3GV1A 2OJLA 2RLIA 3CWGA 4HUAA 2LJRA 4F0CA 3GKNA 2XC2A 2REMA 3KP8A 5C00A 4L5LA 3JCML 2IMEA 2A2SA 2AUVA 11GSA 4KF9A 1BAYA 1Z6NA 4ZILA 1U87A 3G7JA 5COHA 2C0DA 3GH6A 3VI5A 2PGTA 4YKFA 1WIKA 3UIWA 2L4CA 5D8IA 1GRXA 4HDEA 3HY2A 2IMKA 2YOIA 2H70A 1GNWA 1VF4A 1CQHA 1M7TA 1FB6A 1A23A 2QA1A 2LRCA 2EFHA 3RPPA 1WWJA 3NZNA 3DEXA 4LA1A 1X9WB 1OE7A 1PKWA 2WB9A 4K7IA 4MPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IN0 A;  13GS A;  3E0U A;  1Q4J A;  1XCC A;  5AIS A;  3MAK A;  1Z9H A;  5A4U A;  5D9W A;  4MPG A;  2EIO A;  1EGO A;  3IK9 A;  3WT1 A;  5AGY A;  3TJG A;  1ERU A;  1SL2 B;  5IM9 A;  1QK8 A;  3H4K A;  1ERW A;  1RW1 A;  1JLW A;  4XHM A;  2VO4 A;  3HD5 A;  4EO3 A;  2PU9 C;  2LUS A;  3A2X A;  4DSR A;  1O7U A;  3N5O A;  2LNS A;  1XOA A;  1YEP A;  1V57 A;  2JSZ A;  5DCH A;  1TK0 B;  3IR4 A;  5KN2 A;  3ZIJ A;  5JCU A;  3TUE A;  5KN3 A;  3GUR A;  1MTC A;  3ZIT A;  5LD0 A;  2XBI A;  2H1D A;  2Z9S A;  3DIE A;  3GYK A;  2L59 A;  1OYJ A;  1TRU A;  3P90 A;  5HFK A;  3GNJ A;  1O85 A;  3V1W A;  3LWA A;  5B8B A;  3BOA A;  1T3B A;  5HR1 A;  4TN8 A;  1XWC A;  4OD7 A;  3LQ7 A;  3BD2 A;  1N2A A;  4ZL9 A;  4L0U A;  3G9B A;  3D6I A;  5DCG A;  2AHE A;  1T8E B;  3VWX A;  2GQL A;  1CQG A;  3LXT A;  3P2A A;  2H72 A;  2HLS A;  4Q5N A;  2CV4 A;  1JZD A;  2LKU A;  3KP9 A;  5HR2 A;  3IC8 A;  3W8S A;  1Z7R A;  4CDO A;  1SU9 A;  2ZNM A;  4TXO A;  2L6D A;  3BBY A;  5AN1 A;  5FT3 A;  4KDU A;  4KAE A;  3PGT A;  1VF1 A;  1LU4 A;  2HZE B;  1AXD A;  4JBB A;  5B6N A;  1OVN A;  5CAX A;  2F9S A;  2HSM B;  4F0B A;  4EC0 A;  5A5K A;  1GLP A;  1KEB A;  2WS2 A;  2P5Q A;  4K1F A;  1E2Y A;  1JZR A;  2GZY A;  5L71 A;  1XWK A;  3A5W A;  3KEB A;  2I81 A;  2IWT A;  4F82 A;  5B6M A;  2M72 A;  4G0I A;  5JWR B;  3QMX A;  1K3Y A;  4G0K A;  3D21 A;  1MDJ A;  2H6X A;  2HI7 A;  2A2R A;  4TKY A;  3L4N A;  3UAP A;  3LEF A;  1ERT A;  4HJM A;  2RUE A;  4OFM A;  3KIJ A;  3HXS A;  3HDC A;  2J9H A;  2M80 A;  2VL9 A;  2OBI A;  4Q5F A;  2ALB A;  4MJE A;  3A2V A;  2KUC A;  2C1Y A;  3F4R A;  3CXG A;  4AJ7 A;  1GNE A;  1SL0 B;  4OO4 A;  2FD3 A;  2B1K A;  3UMA A;  1HNB A;  2GT5 A;  4IP1 A;  2B5Y A;  1TRW A;  5ECR B;  4BA7 A;  2GTU A;  2LQO A;  1PRX A;  2OBK A;  3MDK A;  4L0W A;  2AAW A;  2C8U A;  1J0F A;  4NHW A;  4IJ3 A;  2HQT A;  4V2M A;  4MMM A;  3GX0 A;  2B3S A;  2WFC A;  4WKW A;  1XIY A;  4GQF A;  1KNG A;  4V1A g;  2CVB A;  5E4W A;  2NVL A;  1NM3 A;  4ECI A;  2LJK A;  1TRV A;  2RII A;  3ZTL A;  4N30 A;  3IHQ A;  4HQS A;  1C72 A;  1AAZ A;  1VF3 A;  2GSR A;  4LLR A;  2VD0 A;  5JCW A;  2GDR A;  1V9W A;  2DJ2 A;  2MBT A;  1X9S B;  3TKS C;  3ZVJ A;  4MP4 A;  4WBR D;  1EOH A;  1JHB A;  2NTO A;  2B7K A;  5IMZ A;  1O8W A;  1VGL A;  2VCT A;  3C1S A;  5F0G A;  4N0Z A;  1TJD A;  4ML1 A;  3UBK A;  1DE2 A;  4MZW A;  1JFU A;  3OR5 A;  3VI7 A;  4ECB A;  1QFN A;  5HR3 A;  2GGT A;  2OKA A;  2MMO A;  1OKD A;  1X5D A;  3HVS A;  3EUR A;  4V2L A;  3BCK A;  4HZ4 A;  3M9J A;  3DYR A;  2D2Z A;  2VCQ A;  4E8E A;  2C4J A;  2JU5 A;  2AYT A;  4GF0 A;  4HQZ A;  1LJR A;  4ZL7 A;  4TOP A;  3TKR A;  4OO5 A;  3C73 A;  6GSU A;  3EMX A;  3UAR A;  10GS A;  1THO A;  2V41 A;  4OCE A;  4KSM A;  2H0I A;  2VD1 A;  4JE1 A;  2IMI A;  3ZZX A;  1TI1 A;  1YF0 A;  4K6X A;  1FVK A;  1K0C A;  2VCW A;  3F0I A;  4F03 A;  3R3E A;  4MF7 A;  2PVO C;  3FEU A;  2A4V A;  5G31 A;  4ECJ A;  4KX4 A;  5DVB A;  4V2N A;  1SK2 A;  4POB A;  1SYX A;  2G0F A;  5E59 A;  3GFK A;  3TGZ A;  3ME8 A;  3TOU A;  4XS6 A;  7GSS A;  3U5R E;  1ZOF A;  1NHO A;  2QSI A;  3KMN A;  2TRC P;  2E0Q A;  5ELA A;  3HVV A;  2H71 A;  2WZ9 A;  3N9J A;  1T00 A;  4TXO B;  5ECN B;  2DC5 A;  2KOK A;  3FR6 A;  1JLV A;  2FA4 A;  3I69 A;  3DVW A;  3ZFL A;  4MZB A;  1RQM A;  3MSZ A;  1UVZ A;  4EVM A;  2CAQ A;  2UZ8 A;  1O6J A;  4HJ2 A;  5KN1 A;  2DIY A;  2HNL A;  2VIM A;  4KW6 A;  1BX9 A;  4X0X A;  4I2U A;  2TRX A;  3TDG A;  2H30 A;  1AIU A;  4TR0 A;  3HA9 A;  3ZL5 A;  5F06 A;  1DUG A;  5CRE A;  2N5F A;  5CRD A;  3TJK A;  1EV4 A;  5IMD A;  4PTS A;  3M8N A;  1A24 A;  2WCI A;  3TKS E;  4TW5 A;  5D73 A;  1FB0 A;  3ZRE A;  2HRA A;  2XBQ A;  5HR0 A;  1ZMA A;  4IW9 A;  2YV9 A;  1THX A;  1GSE A;  3KGK A;  1YY7 A;  1B4P A;  3QAG A;  2F51 A;  3D0Z A;  1ZGN A;  2O89 A;  2R5G A;  2LRN A;  2B6M A;  1M2B A;  3CBU A;  2PMT A;  4HZ2 A;  4WBJ A;  3GSS A;  3H8Q A;  3GX8 A;  2EIQ A;  2HRF A;  2F8F A;  2C3Q A;  1QXH A;  3E9J B;  5IMC A;  1ML6 A;  2IN3 A;  1GP1 A;  5HFG A;  3TJB A;  2O8V B;  3IA1 A;  2E2M A;  2LNT A;  3FYG A;  4O7H A;  3H1N A;  3NOF A;  1OC3 A;  1W4V A;  5J41 A;  5CRG A;  1EP8 A;  4NHZ A;  6GST A;  3VLN A;  4ZB8 A;  1GL8 A;  3EMP A;  3Q18 A;  2DBC A;  3C1R A;  1XW9 A;  3A3T A;  5CO3 A;  1EP7 A;  3LYK A;  3F4T A;  1H4O A;  5DQY A;  2BJX A;  2FGX A;  5IPH A;  4YAV A;  1DBY A;  1SK1 A;  4KCE A;  4IQ1 A;  4JRR A;  2OAD A;  2YV7 A;  1BED A;  4WET A;  1YEX A;  4PNF A;  1ZCP A;  2RM5 A;  5DDL A;  3AY8 A;  1XVW A;  1J08 A;  3FZ9 A;  3M0F A;  5G5E A;  2YCD A;  1R4W A;  3EE2 A;  3E3E A;  5HQP A;  4QQ7 A;  4RQX A;  2WUL A;  3J7Y k;  2KP2 A;  1OKT A;  3CSI A;  2MYG A;  4BWS A;  2WJU A;  1GUK A;  1O81 A;  3HKR A;  4FH8 A;  3GTU A;  1U3I A;  3WGX A;  1PKZ A;  5H5S A;  2HT9 A;  3P8W A;  2JAD A;  4BWQ A;  4F2I A;  2XPE A;  1TI3 A;  1KTE A;  2H1G A;  1S3A A;  4BPY A;  1ERV A;  2H0G A;  4KDX A;  2VLU A;  3G7I A;  1Z6M A;  3IDV A;  4POM A;  5LNK e;  5GSS A;  3EVI A;  2VM1 A;  4GCI A;  2VL2 C;  5GAP D;  5IQY A;  1URM A;  3ZML A;  4WF4 A;  4IS0 A;  4K0N A;  1PX7 A;  2JZR A;  1X5E A;  1FOV A;  4XRD A;  3GL3 A;  3MWH A;  4NWY A;  3G7Y A;  2X8C A;  3EIN A;  2DJ0 A;  1ZL9 A;  2PWJ A;  2HRK B;  1PA3 A;  5J5N A;  2PN8 A;  4YQM A;  2YWO A;  2IFQ B;  2NDO A;  2HZF A;  3RAZ A;  2YN1 A;  4MJC A;  4KSO A;  4MH2 A;  4POK A;  5GZZ B;  1M2D A;  2DLX A;  4YQV A;  2VLV A;  1PX6 A;  4WEY A;  2MZC A;  4USS A;  3TRQ A;  1TOF A;  4I2T A;  2F3M A;  4KDY A;  3C7M A;  4BVX A;  2B5X A;  2PPT A;  4YQU A;  3F3R A;  1PGT A;  5D9V A;  2MBS A;  1EWX A;  1FAA A;  3GRX A;  5J9C A;  5IMV A;  4QL9 A;  3HZ8 A;  4LL4 B;  5ID2 A;  1UA5 A;  4I6X A;  1GSU A;  1WP0 A;  1PSQ A;  4GTU A;  4MCU A;  5D96 A;  4EDZ A;  5BMU A;  4PQ1 A;  2CAI A;  1Z3E A;  4MJA A;  5DAL A;  2VOC A;  2B7J A;  2AB6 A;  4ECC A;  4TXV A;  6GSW A;  4KUN A;  4NV2 A;  5EVO A;  3GL5 A;  1A8Y A;  1N8J A;  1I9D A;  2ES7 A;  1SKR B;  1TTZ A;  3NIV A;  4Q5R A;  3LG6 A;  4MAB A;  4BVY A;  5KEJ A;  1A8L A;  1OE8 A;  3UJ1 A;  2C0F A;  4FYC A;  4ZXG A;  1PN9 A;  2H19 A;  4RI6 A;  3QR6 A;  3EWL A;  1W89 A;  4GXZ A;  3L0H A;  3J7Y b;  4DSS A;  2YJH A;  1X0R A;  1R5A A;  3FY7 A;  4GST A;  4XIH A;  2FCH A;  4Z7X A;  4HS1 A;  5FHI A;  3HZ4 A;  4WR5 A;  3PR8 A;  3ZRD A;  2VCZ A;  2RUF A;  2HSH A;  3R2Q A;  3DWV A;  1XOB A;  4JZQ A;  5D9X A;  4ZB6 A;  2VUP A;  3SBC A;  2FA8 A;  1M99 A;  4BL7 A;  3VUR A;  5ECM B;  5IIZ A;  1ABA A;  2R37 A;  4PGT A;  2MMN A;  2GSQ A;  3WT2 A;  5DJM A;  3S9F A;  3H79 A;  4O5R A;  2X99 A;  2K6V A;  4GLT A;  3I9V 2;  4O92 A;  3HJP A;  1BQ7 A;  1PD2 1;  2LRT A;  1FW1 A;  5EL8 A;  2B5E A;  5D93 A;  3ERG A;  1S3D A;  1TK5 B;  1AQV A;  2DMM A;  3A2W A;  1M9B A;  5J9B A;  4CHS A;  1Z7P A;  2O87 A;  1AQW A;  1ACV A;  2QC7 A;  2YAN A;  1A2M A;  5A4W A;  1AQX A;  1AUC A;  4FIW A;  3KMO A;  2XPD A;  3U6V A;  3I43 A;  1PQN A;  1WJK A;  4ILF A;  5ENU A;  3W8J A;  4K7N A;  1UN2 A;  1NHY A;  1JZW A;  1DE1 A;  1T4Y A;  5JWO B;  2L57 A;  4JED A;  4HU7 A;  1F3A A;  1Y6E A;  3RBT A;  4NMU A;  1K3L A;  2H1B A;  5G1L A;  4RUV A;  3F6D A;  2IL3 A;  1VF2 A;  3DXB A;  3Q19 A;  4PUA A;  4PXO A;  4G9H A;  3CYN A;  3DD3 A;  1A2J A;  4GRF A;  4K9Z A;  1TK8 B;  4EE0 A;  1M0U A;  2CVD A;  3GN3 A;  4X1U A;  1SJZ A;  2IIY A;  2FWE A;  4ML6 A;  3EU4 A;  4NAX A;  5ECS A;  2K18 A;  1ZZY A;  2L5L A;  3VPT A;  4NV5 A;  1YZX A;  2GZZ A;  5B8A A;  4K7O A;  1K0O A;  2H75 A;  2FLS A;  1OAZ A;  3QDN A;  4HOJ A;  4OMV A;  2FWH A;  1V58 A;  3EYT A;  4TVE A;  5CYY A;  1QGV A;  3D5J A;  4LMV A;  2IPA A;  4DSQ A;  1K0M A;  2K8S A;  3KD0 A;  1XPV A;  3O3T A;  4ID0 A;  1O8X A;  3ME7 A;  5G2Z A;  3VWW A;  4KND A;  1Y25 A;  2MMZ A;  2PER A;  1GSQ A;  2WGR A;  2YPM A;  4EXJ A;  2H73 A;  1PL2 A;  2OE1 A;  1HYU A;  2JZS A;  4BVX B;  1EZK A;  2DIZ A;  1SJ6 A;  3DGQ A;  2YWI A;  3GHA A;  3LOR A;  8GSS A;  4P3Y B;  4PQH A;  4H86 A;  4JR4 A;  1EEJ A;  3PIN A;  3APS A;  1SL1 B;  1WOU A;  1GSF A;  2CVK A;  3FR9 A;  2K9F A;  4OWY A;  2DJ1 A;  2L6C A;  4IJI A;  2ZUP A;  2PBJ A;  4EDY A;  1G7E A;  3KTL A;  3CTF A;  4N10 A;  2YZH A;  3L9S A;  1SKW B;  3FW2 A;  1GSY A;  5IOX A;  5ECQ B;  1SEN A;  3RPN A;  3FHK A;  1K3O A;  1WMJ A;  2H01 A;  2E7P A;  4J57 E;  3CRT A;  1YDK A;  3LJR A;  3ZLP A;  1H75 A;  1AW9 A;  2YZU A;  3LSZ A;  4BVY B;  3D4M A;  1GTA A;  3BCI A;  1XW6 A;  4I97 A;  3L78 A;  3IRA A;  3VFI A;  4DSS B;  2GSS A;  5J4U A;  3LYP A;  1XZO A;  5A4V A;  4K2D A;  1R7H A;  4MLY A;  1TU7 A;  2X8H A;  2HRN A;  4N11 A;  1USB A;  3DKS A;  3F3Q A;  3TCO A;  1FVJ A;  5DJL A;  2H1A A;  4XTS A;  3UVT A;  4IBP A;  2YWN A;  4KE3 A;  1NW2 A;  2GS3 A;  4BL7 B;  2CX4 A;  4K8M A;  2M46 A;  4NXI A;  4FYB A;  2HE3 A;  3WGE A;  3W6G A;  1U88 A;  3UL3 A;  2O7K A;  2DML A;  2K8V A;  1JZO A;  4AGS A;  2GLR A;  1Q98 A;  5H5Q A;  1R5P A;  2H76 A;  2CA8 A;  4K0G A;  4Q5Q A;  5IO0 A;  2H74 A;  2LEG A;  3C8E A;  3EC3 A;  4XS1 A;  1G7O A;  1GUH A;  3UBL A;  3HVX A;  4MK3 A;  3DRN A;  4PUR A;  1VRS D;  4XRA A;  3D4T A;  4AF2 A;  1TDI A;  5G30 A;  2DJK A;  4IVF A;  2OE3 A;  1PL1 A;  2EC4 A;  3MNG A;  1V40 A;  4RI7 A;  3VK9 A;  3HJO A;  4O32 A;  3IAM 2;  2JZT A;  3KH9 A;  1UC7 A;  1WRY A;  2E2G A;  4TR4 A;  3TJJ A;  3FZ5 A;  2R4V A;  3O6T A;  1AC1 A;  4ZBD A;  1GWC A;  22GS A;  2HSY A;  1X5C A;  5CRH A;  5D9T A;  5J3R A;  1PMT A;  2FHE A;  4KB3 A;  2YNX A;  1ZYE A;  1IYI A;  4ACS A;  2DJ3 A;  3ZIV A;  5AIX A;  2JL4 A;  1FO5 A;  4ZBA A;  1FHE A;  4IEL A;  2H8L A;  3IC4 A;  5JWQ B;  1XXU A;  1NSW A;  5ABR A;  1MD4 A;  3VWV A;  19GS A;  5DQS A;  1TW9 A;  1ST9 A;  4ZIJ A;  4PUF C;  4MA9 A;  1XW5 A;  1T7P B;  2LJA A;  1LBK A;  4HEA 2;  4TR1 A;  1MDI A;  1XFL A;  2L4Q A;  3QFA C;  4L5O A;  3GMF A;  3KH7 A;  2PVQ A;  3QCP A;  2G2Q A;  5F07 A;  1V2A A;  20GS A;  4TR3 A;  4F9Z A;  1RK4 A;  3HYP A;  2R6K A;  1GLQ A;  3IV4 A;  5IPG A;  3KM6 A;  4XS4 A;  2FWG A;  1SD9 A;  1G0T A;  4OCF A;  1GTU A;  5KN0 A;  5CRW A;  1XWB A;  4TRX A;  3US3 A;  1F2E A;  1K0N A;  2P5R A;  5DAK A;  3DML A;  2FNO A;  1T4Z A;  3Q74 A;  5G5F A;  2GQK A;  1GH2 A;  2H6Y A;  5IMF A;  2H6Z A;  4IQA A;  1QMV A;  1QQ2 A;  4JU5 A;  1YKC A;  2FY6 A;  4ZB9 A;  4KH7 A;  2KHP A;  3HJM A;  4FQU A;  5F05 A;  1DSB A;  2YWM A;  4G0L A;  1U3A A;  17GS A;  1XBS A;  1I5G A;  3L9U A;  4AJ8 A;  5IO2 A;  2LQQ A;  5ECI B;  2L5O A;  1TKD B;  4IHU A;  5B7C A;  1EEM A;  2GVP A;  4WF5 A;  4MH3 A;  3IE3 A;  2B1L A;  3ISO A;  1SYR A;  14GS A;  1B48 A;  3K8N A;  3IK7 A;  4D73 A;  2IMF A;  2QGV A;  3CTG A;  2I4A A;  2JSY A;  4NPB A;  2KP1 A;  3KZQ A;  3LGC A;  1SD8 A;  3UVH A;  3I6A A;  1HQO A;  1T1V A;  2IJY A;  3M9K A;  3CSH A;  1TRS A;  3QD9 A;  1J9B A;  2P31 A;  1YJ6 A;  2VL3 A;  1QUW A;  2V32 A;  3DVX A;  4J2F A;  2VM2 A;  3F9U A;  1B4Q A;  4CW9 A;  2ON7 A;  3IAS 2;  4HI7 A;  1Z5Y E;  4LMW A;  2VCX A;  4IGJ A;  2C80 A;  5DBQ A;  1XWA A;  4DVC A;  6GSX A;  1K0B A;  2C3T A;  3M1G A;  3WGD A;  4PX1 A;  3QPM A;  3VPQ A;  2CZ3 A;  2DJJ A;  2NPB A;  4KCA A;  3IPZ A;  5AIV A;  3FZ4 A;  4ULX A;  3F8U A;  3KXO A;  2VL2 A;  1BYE A;  4EUY A;  3P7X A;  3UEM A;  2GZP A;  2OAC A;  3C71 A;  2HXK A;  3RDW A;  1U6T A;  5INY A;  1WE0 A;  2KLX A;  1XWG A;  5LCZ A;  4MF5 A;  1EV9 A;  1TXX A;  1F6M C;  3GKM A;  4MJB A;  1GUM A;  1SJI A;  1YKA A;  2RM6 A;  3GIX A;  5IMA A;  2OE0 A;  1F9M A;  3BJ5 A;  16GS A;  3WD6 A;  2I9H A;  2V1M A;  1ILO A;  5ECL B;  1GSS A;  2C3N A;  3GH9 A;  1BJX A;  5GST A;  2VAF A;  1O73 A;  12GS A;  4MDC A;  3VWU A;  2AV4 A;  1OC9 A;  3ERW A;  4E8H A;  2C0G A;  5ECP B;  4EKZ A;  1A0F A;  1K0D A;  4OFN A;  4ISD A;  4PNG A;  3QOU A;  4YH2 A;  2EIR A;  3WYW A;  3IOS A;  3SWL A;  2YP6 A;  3GTU B;  3TRX A;  2ON5 A;  1A0R P;  2I1U A;  2LS5 A;  1SK0 A;  6GSS A;  5ECK B;  1ZYQ B;  5F8B A;  2V2G A;  2X64 A;  4N0V A;  4KA0 A;  1KBN A;  3PPU A;  3LFL A;  2R3X A;  4TR1 B;  18GS A;  4KGI A;  4G10 A;  5JCG A;  1M9A A;  1S3C A;  1GTI A;  1R26 A;  3APO A;  3ED3 A;  3L9V A;  4GWR A;  1IYH A;  4EL1 A;  5C04 A;  4L8E A;  3TOT A;  4GSN A;  4AJ6 A;  2GT6 A;  1XVQ A;  4XS4 B;  4I5Q A;  2VLT A;  2CT6 A;  4MF6 A;  3O76 A;  2BMX A;  1SKS B;  5DAK B;  1ON4 A;  2OA7 A;  4JR6 A;  1B8X A;  3F6F A;  3APQ A;  3GST A;  4OFT A;  1K0A A;  4GQC A;  4V1A p;  1FG4 A;  1HNA A;  4DEJ A;  1MD3 A;  1GSD A;  2H0H A;  3CSJ A;  4IKH A;  1E6B A;  2AJQ B;  2J23 A;  1EOG A;  1V98 A;  1TU8 A;  3IBH A;  5EPF A;  3GA4 A;  2V6O A;  3FRC A;  3GKK A;  2HRK A;  5HFI A;  1YQ1 A;  1A2L A;  2LST A;  4WR4 A;  1YF1 A;  1G6Y A;  3LXZ A;  3FZA A;  3KCM A;  3Q6O A;  5ID2 B;  2VCV A;  2IFQ A;  3RHB A;  1X9M B;  2F8A A;  3RHC A;  1HNC A;  2MMA A;  1MEK A;  3ERF A;  5EY6 A;  2CX3 A;  3CRU A;  1GTB A;  3QAW A;  5CNW A;  4D73 B;  5DAL B;  1F37 A;  2HSN B;  3FKF A;  1B9Y C;  3KJY A;  3QAV A;  3ZVJ D;  3TKQ A;  3UOM A;  2GQM A;  1HD2 A;  5ELG A;  4LL1 B;  4G19 A;  4GSS A;  2BTO T;  2NBS A;  9GSS A;  2CZ2 A;  1G6W A;  3QFB C;  4IP6 A;  1OC8 A;  4QL7 A;  3HHV A;  2ZCT A;  4ZL8 A;  4J56 E;  3GKX A;  2FUG 2;  3EU3 A;  6GSY A;  2GST A;  3ZFB A;  2I3Y A;  3HCZ A;  2V6K A;  4FO5 A;  1F3B A;  3GUS A;  2R2J A;  3FK8 A;  2WRT A;  2DSA A;  5H5R A;  1BG5 A;  6GSV A;  3FR3 A;  1WPI A;  3ZYW A;  2HZE A;  2N5B A;  4I8B A;  2N5A A;  3TRP A;  2C0E A;  3TKS A;  4X43 A;  4FYU A;  2O85 A;  2JAC A;  4WXT A;  2HSM A;  2XHF A;  2PUK C;  1EGR A;  2FWF A;  1TP9 A;  5IOW A;  1MDK A;  3F63 A;  2HYX A;  4MZC A;  1M2A A;  5ECH B;  3CMI A;  4POL A;  2QKE A;  4HU9 A;  3TJF A;  3PH9 A;  3IXR A;  3F4S A;  2HFD A;  2LTK A;  2P0G A;  2TIR A;  5G1K A;  2YJ7 A;  3H93 A;  4G2E A;  3KTB A;  3TB2 A;  2CQ9 A;  2IMD A;  5ECO B;  4EF0 A;  5FWG A;  4RQR A;  3M3M A;  2H66 A;  2LV3 A;  5GAN D;  4ZBB A;  4XCS A;  5CP1 A;  4YAP A;  1B9X C;  3ZMK A;  1OC9 B;  3TKP A;  2X8G A;  2WDU A;  3D22 A;  4PQI A;  1GUL A;  3GV1 A;  2OJL A;  2RLI A;  4HUA A;  2LJR A;  4F0C A;  3GKN A;  2XC2 A;  2REM A;  3KP8 A;  5C00 A;  4L5L A;  3JCM L;  2IME A;  2A2S A;  2AUV A;  11GS A;  4KF9 A;  1BAY A;  1Z6N A;  4ZIL A;  1U87 A;  3G7J A;  5COH A;  2C0D A;  3GH6 A;  3VI5 A;  2PGT A;  1WIK A;  3UIW A;  2L4C A;  5D8I A;  1GRX A;  4HDE A;  3HY2 A;  2IMK A;  2YOI A;  2H70 A;  1GNW A;  1VF4 A;  1CQH A;  1M7T A;  1FB6 A;  1A23 A;  2LRC A;  3RPP A;  1WWJ A;  3NZN A;  3DEX A;  4LA1 A;  1X9W B;  1OE7 A;  1PKW A;  2WB9 A;  4K7I A;  4MPF A; 
#chains in the Genus database with same CATH topology
 4IN0 A;  13GS A;  3E0U A;  1Q4J A;  1XCC A;  5AIS A;  2X4A A;  3MAK A;  1Z9H A;  5A4U A;  5D9W A;  4MPG A;  2EIO A;  1EGO A;  3IK9 A;  3WT1 A;  5AGY A;  3TJG A;  1ERU A;  1SL2 B;  5IM9 A;  1QK8 A;  3H4K A;  1ERW A;  1RW1 A;  1JLW A;  4XHM A;  2VO4 A;  3HD5 A;  4EO3 A;  2PU9 C;  2LUS A;  3A2X A;  4DSR A;  1O7U A;  3N5O A;  2LNS A;  1XOA A;  1YEP A;  1V57 A;  2JSZ A;  5DCH A;  1TK0 B;  3IR4 A;  5KN2 A;  3ZIJ A;  5JCU A;  3TUE A;  5KN3 A;  3GUR A;  1MTC A;  3ZIT A;  5LD0 A;  2XBI A;  2H1D A;  2Z9S A;  3DIE A;  3GYK A;  3HVN A;  2L59 A;  1OYJ A;  1TRU A;  3P90 A;  5HFK A;  3GNJ A;  1O85 A;  3V1W A;  3LWA A;  5B8B A;  3BOA A;  1T3B A;  5HR1 A;  4TN8 A;  1XWC A;  4OD7 A;  3LQ7 A;  3BD2 A;  1N2A A;  4ZL9 A;  4L0U A;  3G9B A;  3D6I A;  2EFC A;  1ZYN A;  5DCG A;  2EFD A;  2AHE A;  1N25 A;  1T8E B;  3VWX A;  2GQL A;  2WW3 A;  1CQG A;  3LXT A;  3P2A A;  2H72 A;  5J4V A;  2HLS A;  1SVM A;  4Q5N A;  2CV4 A;  1JZD A;  2LKU A;  3KP9 A;  2R0P A;  1FOH A;  5HR2 A;  3IC8 A;  3W8S A;  1Z7R A;  4CDO A;  1SU9 A;  2ZNM A;  4TXO A;  2L6D A;  3BBY A;  5AN1 A;  5FT3 A;  4KDU A;  4KAE A;  3PGT A;  1VF1 A;  1LU4 A;  2HZE B;  1AXD A;  4JBB A;  5B6N A;  1OVN A;  5CAX A;  2F9S A;  2HSM B;  4F0B A;  4EC0 A;  5A5K A;  1GLP A;  1KEB A;  2WS2 A;  2P5Q A;  4K1F A;  1E2Y A;  1JZR A;  2GZY A;  5L71 A;  1XWK A;  4K5S A;  2WVX A;  3A5W A;  3KEB A;  2I81 A;  2IWT A;  4F82 A;  5B6M A;  2M72 A;  4X4J A;  4G0I A;  5JWR B;  3QMX A;  1K3Y A;  4G0K A;  3D21 A;  5J47 A;  1MDJ A;  2H6X A;  2HI7 A;  2A2R A;  4TKY A;  3L4N A;  3UAP A;  3LEF A;  1ERT A;  4HJM A;  2RUE A;  4OFM A;  3KIJ A;  3HXS A;  3HDC A;  2J9H A;  2M80 A;  2VL9 A;  2OBI A;  4Q5F A;  2ALB A;  4MJE A;  3A2V A;  2KUC A;  2C1Y A;  3F4R A;  3CXG A;  4AJ7 A;  1GNE A;  1SL0 B;  4OO4 A;  2FD3 A;  2B1K A;  3UMA A;  1HNB A;  2GT5 A;  4IP1 A;  2B5Y A;  1TRW A;  5ECR B;  4BA7 A;  2GTU A;  2LQO A;  1PRX A;  2OBK A;  3MDK A;  4L0W A;  2AAW A;  2C8U A;  1J0F A;  1SVO A;  4NHW A;  4IJ3 A;  2HQT A;  4V2M A;  4MMM A;  3GX0 A;  1S3R A;  2O5V A;  2B3S A;  2WFC A;  4WKW A;  1XIY A;  4A5P A;  4GQF A;  1KNG A;  4V1A g;  2CVB A;  5E4W A;  3FMW A;  1SVL A;  2NVL A;  1NM3 A;  4ECI A;  2LJK A;  1TRV A;  2RII A;  3ZTL A;  4N30 A;  3IHQ A;  4HQS A;  1C72 A;  1AAZ A;  1VF3 A;  2GSR A;  4LLR A;  2VD0 A;  5JCW A;  2GDR A;  1V9W A;  2DJ2 A;  2MBT A;  1X9S B;  3TKS C;  3ZVJ A;  4MP4 A;  4WBR D;  1EOH A;  1JHB A;  2NTO A;  2B7K A;  3MYD A;  5IMZ A;  1O8W A;  1VGL A;  2VCT A;  3C1S A;  5F0G A;  4N0Z A;  1TJD A;  4ML1 A;  3UBK A;  1DE2 A;  4MZW A;  1JFU A;  3OR5 A;  3VI7 A;  4ECB A;  1QFN A;  5HR3 A;  2GGT A;  2OKA A;  2MMO A;  1OKD A;  1X5D A;  3HVS A;  3EUR A;  4V2L A;  3BCK A;  4HZ4 A;  3M9J A;  3DYR A;  2D2Z A;  2VCQ A;  4E8E A;  2C4J A;  2JU5 A;  2AYT A;  4GF0 A;  4HQZ A;  1LJR A;  4PI2 C;  4ZL7 A;  4TOP A;  3TKR A;  4OO5 A;  3C73 A;  6GSU A;  3EMX A;  3UAR A;  10GS A;  1THO A;  2V41 A;  4OCE A;  4KSM A;  2H0I A;  2VD1 A;  4JE1 A;  2IMI A;  3ZZX A;  3IHG A;  1TI1 A;  1YF0 A;  4K6X A;  1FVK A;  1K0C A;  2WW0 A;  2VCW A;  3F0I A;  4F03 A;  3R3E A;  4MF7 A;  2PVO C;  3FEU A;  2A4V A;  5G31 A;  4ECJ A;  4KX4 A;  5DVB A;  4V2N A;  1SK2 A;  4POB A;  1SYX A;  2G0F A;  5E59 A;  3GFK A;  3TGZ A;  2QA2 A;  3ME8 A;  3TOU A;  4XS6 A;  7GSS A;  3U5R E;  1ZOF A;  1NHO A;  2QSI A;  3KMN A;  3MIX A;  2TRC P;  2E0Q A;  5ELA A;  3HVV A;  2H71 A;  2WZ9 A;  3N9J A;  1T00 A;  4TXO B;  5ECN B;  2DC5 A;  2KOK A;  2EFE A;  3FR6 A;  1JLV A;  2FA4 A;  3I69 A;  3DVW A;  3ZFL A;  4MZB A;  1RQM A;  3MSZ A;  1UVZ A;  4EVM A;  2CAQ A;  2UZ8 A;  1O6J A;  4HJ2 A;  5KN1 A;  2DIY A;  2HNL A;  2VIM A;  4KW6 A;  1BX9 A;  4X0X A;  4I2U A;  2TRX A;  3TDG A;  2H30 A;  1AIU A;  2O3E A;  4TR0 A;  3HA9 A;  3ZL5 A;  5F06 A;  1DUG A;  5CRE A;  2N5F A;  5CRD A;  3TJK A;  1EV4 A;  5IMD A;  4PTS A;  3M8N A;  2WVX B;  1A24 A;  1PN0 A;  2WCI A;  3TKS E;  4TW5 A;  5D73 A;  1FB0 A;  3ZRE A;  2HRA A;  2XBQ A;  5HR0 A;  2R0C A;  1ZMA A;  4IW9 A;  2YV9 A;  1THX A;  1GSE A;  3KGK A;  1YY7 A;  1B4P A;  3QAG A;  4ICY A;  2F51 A;  3D0Z A;  1ZGN A;  2O89 A;  2R5G A;  2LRN A;  2B6M A;  1M2B A;  3CBU A;  2PMT A;  4HZ2 A;  4WBJ A;  3GSS A;  2WZS A;  3H8Q A;  3GX8 A;  2EIQ A;  2HRF A;  2F8F A;  2C3Q A;  1QXH A;  3E9J B;  5IMC A;  1ML6 A;  2IN3 A;  1GP1 A;  5HFG A;  3TJB A;  2O8V B;  3IA1 A;  2E2M A;  2LNT A;  3FYG A;  4O7H A;  3H1N A;  3NOF A;  1OC3 A;  1W4V A;  5J41 A;  1M3J A;  5CRG A;  1EP8 A;  4NHZ A;  6GST A;  3TU3 B;  3VLN A;  2H1L A;  4ZB8 A;  1GL8 A;  4GDF A;  3EMP A;  3Q18 A;  2DBC A;  3C1R A;  1XW9 A;  3A3T A;  5CO3 A;  1EP7 A;  3LYK A;  3F4T A;  1H4O A;  5DQY A;  2BJX A;  2FGX A;  5IPH A;  4YAV A;  1DBY A;  4ZB7 A;  1SK1 A;  4KCE A;  4IQ1 A;  4JRR A;  2OAD A;  2YV7 A;  1BED A;  4WET A;  1YEX A;  4PNF A;  1ZCP A;  2RM5 A;  5DDL A;  3AY8 A;  1XVW A;  1J08 A;  3FZ9 A;  3M0F A;  1ZYP A;  5G5E A;  2YCD A;  1R4W A;  3EE2 A;  3E3E A;  5HQP A;  4QQ7 A;  4RQX A;  2WUL A;  3J7Y k;  2KP2 A;  1OKT A;  3CSI A;  2MYG A;  4BWS A;  2WJU A;  1GUK A;  1O81 A;  4O5U A;  3HKR A;  4FH8 A;  3GTU A;  1U3I A;  3WGX A;  1PKZ A;  5H5S A;  2HT9 A;  3P8W A;  2JAD A;  4BWQ A;  4F2I A;  2XPE A;  1TI3 A;  1KTE A;  2H1G A;  1S3A A;  4BPY A;  1ERV A;  2H0G A;  4KDX A;  2VLU A;  3G7I A;  1Z6M A;  3IDV A;  4POM A;  5LNK e;  5GSS A;  3EVI A;  2VM1 A;  4GCI A;  2VL2 C;  4FXY P;  5GAP D;  5IQY A;  1URM A;  3ZML A;  4WF4 A;  4IS0 A;  4K0N A;  5J40 A;  1PX7 A;  2JZR A;  1X5E A;  1FOV A;  4XRD A;  3GL3 A;  3MWH A;  4NWY A;  3G7Y A;  2X8C A;  2WW2 A;  3EIN A;  2DJ0 A;  1ZL9 A;  2PWJ A;  2HRK B;  1PA3 A;  5A1N A;  5J5N A;  2PN8 A;  4YQM A;  2YWO A;  5A5H A;  2IFQ B;  2NDO A;  2HZF A;  3RAZ A;  2YN1 A;  4MJC A;  4KSO A;  4MH2 A;  4POK A;  5GZZ B;  1YVL A;  1M2D A;  2DLX A;  4YQV A;  2VLV A;  1PX6 A;  4WEY A;  1S4B P;  5BRT A;  5J4Y A;  2MZC A;  4USS A;  3TRQ A;  1TOF A;  4I2T A;  2F3M A;  4KDY A;  3C7M A;  4BVX A;  2B5X A;  2PPT A;  1Y1U A;  4YQU A;  3F3R A;  1PGT A;  5D9V A;  2MBS A;  1EWX A;  1FAA A;  3GRX A;  5J9C A;  5IMV A;  4QL9 A;  3HZ8 A;  4LL4 B;  5ID2 A;  1UA5 A;  4I6X A;  1GSU A;  1WP0 A;  1PSQ A;  4GTU A;  4MCU A;  5D96 A;  4EDZ A;  5BMU A;  4PQ1 A;  2CAI A;  1Z3E A;  4MJA A;  3HMJ G;  5DAL A;  2VOC A;  2B7J A;  2AB6 A;  4ECC A;  4TXV A;  6GSW A;  4KUN A;  4NV2 A;  5EVO A;  3GL5 A;  1A8Y A;  1N8J A;  1I9D A;  2ES7 A;  1SKR B;  1TTZ A;  3NIV A;  4Q5R A;  3LG6 A;  4MAB A;  4BVY A;  5KEJ A;  1A8L A;  1OE8 A;  3UJ1 A;  2C0F A;  4FYC A;  4ZXG A;  1PN9 A;  2H19 A;  4RI6 A;  3QR6 A;  3EWL A;  1W89 A;  4AKH A;  4GXZ A;  3L0H A;  3J7Y b;  4DSS A;  2YJH A;  1X0R A;  1R5A A;  3FY7 A;  4GST A;  4XIH A;  2FCH A;  4Z7X A;  4HS1 A;  5FHI A;  4EIQ A;  3HZ4 A;  4WR5 A;  3PR8 A;  3ZRD A;  2VCZ A;  2RUF A;  2HSH A;  3R2Q A;  3DWV A;  1XOB A;  4JZQ A;  5D9X A;  4ZB6 A;  2VUP A;  3SBC A;  2FA8 A;  1M99 A;  4BL7 A;  3VUR A;  5ECM B;  5IIZ A;  1ABA A;  2R37 A;  4PGT A;  2MMN A;  2GSQ A;  3WT2 A;  5DJM A;  3S9F A;  3H79 A;  4O5R A;  2X99 A;  2K6V A;  4GLT A;  3I9V 2;  4O92 A;  3HJP A;  1BQ7 A;  1PD2 1;  2LRT A;  1FW1 A;  5EL8 A;  2B5E A;  5D93 A;  3ERG A;  1S3D A;  1TK5 B;  1AQV A;  2DMM A;  3A2W A;  1M9B A;  5J9B A;  4CHS A;  1Z7P A;  2O87 A;  1AQW A;  1ACV A;  2QC7 A;  2YAN A;  1A2M A;  5A4W A;  1AQX A;  1AUC A;  4FIW A;  3KMO A;  2XPD A;  3U6V A;  2A2P A;  4O5Q A;  3I43 A;  4Z2R A;  1PQN A;  1WJK A;  4ILF A;  5ENU A;  3EPT A;  3W8J A;  4K7N A;  1UN2 A;  1NHY A;  1JZW A;  1DE1 A;  1T4Y A;  5JWO B;  2L57 A;  4JED A;  4HU7 A;  1F3A A;  1BF5 A;  1Y6E A;  3RBT A;  4NMU A;  1K3L A;  2H1B A;  5G1L A;  4RUV A;  3F6D A;  2IL3 A;  1VF2 A;  3DXB A;  3Q19 A;  4PUA A;  4PXO A;  4G9H A;  3CYN A;  3DD3 A;  1A2J A;  4GRF A;  4K9Z A;  1TK8 B;  4EE0 A;  1M0U A;  2CVD A;  3GN3 A;  4X1U A;  1SJZ A;  2IIY A;  2FWE A;  4ML6 A;  3EU4 A;  4NAX A;  5ECS A;  2K18 A;  1ZZY A;  2L5L A;  3VPT A;  1YEW C;  4NV5 A;  1YZX A;  2GZZ A;  5B8A A;  4K7O A;  1K0O A;  2H75 A;  2FLS A;  2UV8 G;  1OAZ A;  3QDN A;  4HOJ A;  4OMV A;  2FWH A;  1V58 A;  3EYT A;  4TVE A;  5CYY A;  1QGV A;  3D5J A;  4LMV A;  2IPA A;  5A5H B;  4Z2T A;  4DSQ A;  4YKG A;  1K0M A;  2K8S A;  3KD0 A;  1XPV A;  3O3T A;  4ID0 A;  1O8X A;  3ME7 A;  5G2Z A;  1M3I A;  3VWW A;  4KND A;  1Y25 A;  2MMZ A;  2PER A;  1GSQ A;  2WGR A;  2YPM A;  4EXJ A;  2H73 A;  1PL2 A;  2OE1 A;  1HYU A;  4PI0 C;  2JZS A;  4BVX B;  1EZK A;  2DIZ A;  1SJ6 A;  3DGQ A;  2YWI A;  3GHA A;  4AKG A;  3LOR A;  8GSS A;  4P3Y B;  4PQH A;  4H86 A;  4JR4 A;  1EEJ A;  3PIN A;  3APS A;  1SL1 B;  1WOU A;  1GSF A;  2CVK A;  3FR9 A;  2K9F A;  4OWY A;  2DJ1 A;  2L6C A;  4IJI A;  2ZUP A;  2PBJ A;  4EDY A;  1G7E A;  3KTL A;  3CTF A;  4N10 A;  2YZH A;  3L9S A;  1SKW B;  3FW2 A;  1GSY A;  5IOX A;  5ECQ B;  1SEN A;  3RPN A;  3FHK A;  1K3O A;  1WMJ A;  2H01 A;  2E7P A;  4J57 E;  3CRT A;  1YDK A;  3LJR A;  3ZLP A;  1H75 A;  1AW9 A;  1I1I P;  2YZU A;  3LSZ A;  4BVY B;  3D4M A;  1GTA A;  3BCI A;  1XW6 A;  4I97 A;  3L78 A;  4CY6 A;  3IRA A;  3VFI A;  4DSS B;  2GSS A;  4K5R A;  5J4U A;  3LYP A;  5KOW A;  1XZO A;  5A4V A;  4K2D A;  1R7H A;  4MLY A;  1TU7 A;  2X8H A;  2HRN A;  4N11 A;  1USB A;  3DKS A;  3F3Q A;  3TCO A;  1FVJ A;  5DJL A;  2H1A A;  4XTS A;  3UVT A;  4IBP A;  2YWN A;  4KE3 A;  1NW2 A;  2GS3 A;  4BL7 B;  2CX4 A;  4K8M A;  2M46 A;  4NXI A;  4FYB A;  2HE3 A;  3WGE A;  3W6G A;  1U88 A;  3UL3 A;  2O7K A;  2DML A;  2K8V A;  1JZO A;  2OT3 A;  4AGS A;  4QMK A;  2GLR A;  1Q98 A;  5H5Q A;  4HSC X;  1R5P A;  2H76 A;  2CA8 A;  4K0G A;  4Q5Q A;  5IO0 A;  2H74 A;  2LEG A;  3C8E A;  3EC3 A;  4XS1 A;  1G7O A;  1GUH A;  3UBL A;  3HVX A;  4MK3 A;  3A5I A;  3DRN A;  4PUR A;  1VRS D;  4XRA A;  3D4T A;  4AF2 A;  1TDI A;  5G30 A;  2DJK A;  4IVF A;  2OE3 A;  1PL1 A;  2EC4 A;  3MNG A;  1V40 A;  4RI7 A;  3VK9 A;  3HJO A;  4O32 A;  3IAM 2;  2JZT A;  3KH9 A;  1UC7 A;  1WRY A;  2E2G A;  4TR4 A;  3TJJ A;  3FZ5 A;  2R4V A;  3O6T A;  1AC1 A;  4ZBD A;  1GWC A;  22GS A;  2HSY A;  1X5C A;  5CRH A;  5D9T A;  5J3R A;  1PMT A;  2FHE A;  4KB3 A;  2YNX A;  1ZYE A;  1IYI A;  4ACS A;  2DJ3 A;  3ZIV A;  5AIX A;  2JL4 A;  1FO5 A;  1XG8 A;  4ZBA A;  1FHE A;  4IEL A;  2H8L A;  3IC4 A;  5JWQ B;  1XXU A;  1NSW A;  5ABR A;  1MD4 A;  3VWV A;  19GS A;  5DQS A;  1TW9 A;  1ST9 A;  4ZIJ A;  4PUF C;  4MA9 A;  1XW5 A;  1T7P B;  2LJA A;  1LBK A;  4HEA 2;  4TR1 A;  1MDI A;  1XFL A;  2L4Q A;  3QFA C;  4L5O A;  3GMF A;  3KH7 A;  2PVQ A;  3QCP A;  2WVZ A;  2G2Q A;  5F07 A;  1V2A A;  20GS A;  4TR3 A;  4F9Z A;  1RK4 A;  2VKZ G;  3HYP A;  2R6K A;  1GLQ A;  3IV4 A;  5IPG A;  3KM6 A;  4XS4 A;  2FWG A;  1SD9 A;  1G0T A;  4OCF A;  1GTU A;  5KN0 A;  5CRW A;  1XWB A;  4TRX A;  3US3 A;  1F2E A;  1K0N A;  2P5R A;  5DAK A;  4E68 A;  3DML A;  2FNO A;  1T4Z A;  3Q74 A;  5G5F A;  2GQK A;  1GH2 A;  4MNN A;  2H6Y A;  5IMF A;  2H6Z A;  4IQA A;  1QMV A;  1QQ2 A;  4JU5 A;  1YKC A;  2FY6 A;  4ZB9 A;  4KH7 A;  2KHP A;  3HJM A;  4FQU A;  5F05 A;  1DSB A;  2YWM A;  4G0L A;  1U3A A;  17GS A;  1XBS A;  1I5G A;  3L9U A;  4AJ8 A;  5IO2 A;  2LQQ A;  5ECI B;  2L5O A;  1TKD B;  2DKI A;  5A34 A;  4IHU A;  5B7C A;  1EEM A;  2GVP A;  4WF5 A;  4W66 A;  4MH3 A;  3IE3 A;  2B1L A;  3ISO A;  1SYR A;  14GS A;  1B48 A;  3K8N A;  3IK7 A;  4D73 A;  2IMF A;  2QGV A;  2HSN A;  2WW1 A;  3CTG A;  2I4A A;  2JSY A;  4NPB A;  2KP1 A;  3KZQ A;  3LGC A;  1SD8 A;  3UVH A;  3I6A A;  1HQO A;  1T1V A;  2IJY A;  3M9K A;  3CSH A;  1TRS A;  3QD9 A;  1J9B A;  4AI6 A;  2P31 A;  1YJ6 A;  2VL3 A;  1QUW A;  3CQF A;  2V32 A;  3DVX A;  4J2F A;  2VM2 A;  3F9U A;  1B4Q A;  4CW9 A;  2ON7 A;  3IAS 2;  4HI7 A;  1Z5Y E;  4LMW A;  2VCX A;  4IGJ A;  2C80 A;  5DBQ A;  3LW9 A;  1XWA A;  4DVC A;  6GSX A;  1K0B A;  2C3T A;  3M1G A;  3WGD A;  4PX1 A;  3QPM A;  3VPQ A;  2CZ3 A;  2DJJ A;  2NPB A;  4KCA A;  3IPZ A;  5AIV A;  3FZ4 A;  4ULX A;  3F8U A;  3KXO A;  4AKI A;  2VL2 A;  1BG1 A;  1BYE A;  4EUY A;  3P7X A;  3UEM A;  2GZP A;  4G01 A;  2OAC A;  3C71 A;  2HXK A;  3RDW A;  1U6T A;  5INY A;  1WE0 A;  2KLX A;  1XWG A;  5LCZ A;  4MF5 A;  1EV9 A;  1TXX A;  1F6M C;  3RFR C;  3GKM A;  4MJB A;  1GUM A;  1SJI A;  1YKA A;  2RM6 A;  3GIX A;  5IMA A;  2OE0 A;  1F9M A;  3BJ5 A;  16GS A;  3WD6 A;  2I9H A;  2V1M A;  1ILO A;  5ECL B;  1GSS A;  2C3N A;  3GH9 A;  1BJX A;  5GST A;  2VAF A;  1O73 A;  12GS A;  4MDC A;  3VWU A;  2AV4 A;  1OC9 A;  3ERW A;  4E8H A;  2C0G A;  5ECP B;  4EKZ A;  1A0F A;  1K0D A;  4OFN A;  4ISD A;  4PNG A;  3QOU A;  4YH2 A;  2EIR A;  3WYW A;  2DKH A;  3IOS A;  3SWL A;  2YP6 A;  3GTU B;  3TRX A;  2ON5 A;  1A0R P;  2I1U A;  2LS5 A;  1SK0 A;  6GSS A;  5ECK B;  1ZYQ B;  5F8B A;  2V2G A;  2X64 A;  4N0V A;  4KA0 A;  1KBN A;  2R0G A;  3PPU A;  3LFL A;  2R3X A;  4TR1 B;  18GS A;  4KGI A;  4G10 A;  5JCG A;  1M9A A;  1S3C A;  1GTI A;  3CHX C;  1R26 A;  3APO A;  3ED3 A;  3L9V A;  5KOX A;  4GWR A;  1IYH A;  4EL1 A;  5C04 A;  4L8E A;  3TOT A;  4GSN A;  4AJ6 A;  2GT6 A;  1XVQ A;  4XS4 B;  4I5Q A;  2VLT A;  2CT6 A;  4EIP A;  4MF6 A;  5A1N B;  3O76 A;  2BMX A;  1SKS B;  5DAK B;  1ON4 A;  2OA7 A;  4JR6 A;  1B8X A;  3F6F A;  3APQ A;  3GST A;  4OFT A;  1K0A A;  2WVY A;  4GQC A;  4V1A p;  1FG4 A;  1HNA A;  4DEJ A;  1MD3 A;  1GSD A;  2H0H A;  3CSJ A;  4IKH A;  1E6B A;  2AJQ B;  2J23 A;  1EOG A;  1V98 A;  1TU8 A;  3IBH A;  5EPF A;  3GA4 A;  2V6O A;  3FRC A;  3GKK A;  2HRK A;  5HFI A;  1YQ1 A;  1A2L A;  2LST A;  4WR4 A;  1YF1 A;  1G6Y A;  3LXZ A;  3FZA A;  3KCM A;  3Q6O A;  5ID2 B;  2VCV A;  2IFQ A;  3RHB A;  1X9M B;  2F8A A;  5A34 B;  3RHC A;  1HNC A;  4N3Z A;  2MMA A;  1MEK A;  3ERF A;  5EY6 A;  2CX3 A;  5BMU B;  3CRU A;  1GTB A;  3QAW A;  5CNW A;  4D73 B;  5DAL B;  1F37 A;  2HSN B;  3FKF A;  1B9Y C;  3KJY A;  3QAV A;  3ZVJ D;  3TKQ A;  3UOM A;  2GQM A;  1HD2 A;  5ELG A;  4LL1 B;  4G19 A;  4GSS A;  2BTO T;  2NBS A;  9GSS A;  2CZ2 A;  1G6W A;  3QFB C;  4IP6 A;  1OC8 A;  4QL7 A;  3HHV A;  2ZCT A;  4ZL8 A;  4J56 E;  3GKX A;  2FUG 2;  3EU3 A;  1TXU A;  6GSY A;  2GST A;  3ZFB A;  2I3Y A;  3HCZ A;  2V6K A;  4FO5 A;  1F3B A;  3GUS A;  3RGB C;  2R2J A;  3FK8 A;  2WRT A;  2DSA A;  4K2X A;  5H5R A;  1BG5 A;  6GSV A;  3FR3 A;  1WPI A;  3ZYW A;  4Z2U A;  2HZE A;  2N5B A;  4I8B A;  2N5A A;  3TRP A;  4BIK A;  2C0E A;  3TKS A;  4X43 A;  4PHZ C;  4FYU A;  2O85 A;  2JAC A;  4WXT A;  2HSM A;  2XHF A;  2PUK C;  1EGR A;  2FWF A;  1TP9 A;  5IOW A;  1MDK A;  3F63 A;  2HYX A;  4MZC A;  1M2A A;  5ECH B;  3CMI A;  4POL A;  2QKE A;  4HU9 A;  3TJF A;  2O36 A;  4CY8 A;  3PH9 A;  3IXR A;  3F4S A;  2HFD A;  2LTK A;  2P0G A;  2TIR A;  5G1K A;  2YJ7 A;  3H93 A;  4G2E A;  3KTB A;  3TB2 A;  2CQ9 A;  2X49 A;  2A4H A;  2IMD A;  5ECO B;  4EF0 A;  5FWG A;  4RQR A;  3M3M A;  2H66 A;  2LV3 A;  5GAN D;  4ZBB A;  4XCS A;  5CP1 A;  4YAP A;  1B9X C;  3ZMK A;  1OC9 B;  3TKP A;  4AKX B;  2X8G A;  2WDU A;  3D22 A;  4PQI A;  1GUL A;  3GV1 A;  2OJL A;  2RLI A;  3CWG A;  4HUA A;  2LJR A;  4F0C A;  3GKN A;  2XC2 A;  2REM A;  3KP8 A;  5C00 A;  4L5L A;  3JCM L;  2IME A;  2A2S A;  2AUV A;  11GS A;  4KF9 A;  1BAY A;  1Z6N A;  4ZIL A;  1U87 A;  3G7J A;  5COH A;  2C0D A;  3GH6 A;  3VI5 A;  2PGT A;  4YKF A;  1WIK A;  3UIW A;  2L4C A;  5D8I A;  1GRX A;  4HDE A;  3HY2 A;  1PFO A;  2IMK A;  2YOI A;  2H70 A;  1GNW A;  1VF4 A;  1CQH A;  1M7T A;  1FB6 A;  1A23 A;  2QA1 A;  2LRC A;  2EFH A;  3RPP A;  1WWJ A;  3NZN A;  3DEX A;  4LA1 A;  1X9W B;  1OE7 A;  1PKW A;  2WB9 A;  4K7I A;  4MPF A; 
#chains in the Genus database with same CATH homology
 4IN0 A;  13GS A;  3E0U A;  1Q4J A;  1XCC A;  5AIS A;  2X4A A;  3MAK A;  1Z9H A;  5A4U A;  5D9W A;  4MPG A;  2EIO A;  1EGO A;  3IK9 A;  3WT1 A;  5AGY A;  3TJG A;  1ERU A;  1SL2 B;  5IM9 A;  1QK8 A;  3H4K A;  1ERW A;  1RW1 A;  1JLW A;  4XHM A;  2VO4 A;  3HD5 A;  4EO3 A;  2PU9 C;  2LUS A;  3A2X A;  4DSR A;  1O7U A;  3N5O A;  2LNS A;  1XOA A;  1YEP A;  1V57 A;  2JSZ A;  5DCH A;  1TK0 B;  3IR4 A;  5KN2 A;  3ZIJ A;  5JCU A;  3TUE A;  5KN3 A;  3GUR A;  1MTC A;  3ZIT A;  5LD0 A;  2XBI A;  2H1D A;  2Z9S A;  3DIE A;  3GYK A;  2L59 A;  1OYJ A;  1TRU A;  3P90 A;  5HFK A;  3GNJ A;  1O85 A;  3V1W A;  3LWA A;  5B8B A;  3BOA A;  1T3B A;  5HR1 A;  4TN8 A;  1XWC A;  4OD7 A;  3LQ7 A;  3BD2 A;  1N2A A;  4ZL9 A;  4L0U A;  3G9B A;  3D6I A;  2EFC A;  1ZYN A;  5DCG A;  2EFD A;  2AHE A;  1N25 A;  1T8E B;  3VWX A;  2GQL A;  1CQG A;  3LXT A;  3P2A A;  2H72 A;  5J4V A;  2HLS A;  1SVM A;  4Q5N A;  2CV4 A;  1JZD A;  2LKU A;  3KP9 A;  2R0P A;  1FOH A;  5HR2 A;  3IC8 A;  3W8S A;  1Z7R A;  4CDO A;  1SU9 A;  2ZNM A;  4TXO A;  2L6D A;  3BBY A;  5AN1 A;  5FT3 A;  4KDU A;  4KAE A;  3PGT A;  1VF1 A;  1LU4 A;  2HZE B;  1AXD A;  4JBB A;  5B6N A;  1OVN A;  5CAX A;  2F9S A;  2HSM B;  4F0B A;  4EC0 A;  5A5K A;  1GLP A;  1KEB A;  2WS2 A;  2P5Q A;  4K1F A;  1E2Y A;  1JZR A;  2GZY A;  5L71 A;  1XWK A;  4K5S A;  3A5W A;  3KEB A;  2I81 A;  2IWT A;  4F82 A;  5B6M A;  2M72 A;  4X4J A;  4G0I A;  5JWR B;  3QMX A;  1K3Y A;  4G0K A;  3D21 A;  5J47 A;  1MDJ A;  2H6X A;  2HI7 A;  2A2R A;  4TKY A;  3L4N A;  3UAP A;  3LEF A;  1ERT A;  4HJM A;  2RUE A;  4OFM A;  3KIJ A;  3HXS A;  3HDC A;  2J9H A;  2M80 A;  2VL9 A;  2OBI A;  4Q5F A;  2ALB A;  4MJE A;  3A2V A;  2KUC A;  2C1Y A;  3F4R A;  3CXG A;  4AJ7 A;  1GNE A;  1SL0 B;  4OO4 A;  2FD3 A;  2B1K A;  3UMA A;  1HNB A;  2GT5 A;  4IP1 A;  2B5Y A;  1TRW A;  5ECR B;  4BA7 A;  2GTU A;  2LQO A;  1PRX A;  2OBK A;  3MDK A;  4L0W A;  2AAW A;  2C8U A;  1J0F A;  1SVO A;  4NHW A;  4IJ3 A;  2HQT A;  4V2M A;  4MMM A;  3GX0 A;  2O5V A;  2B3S A;  2WFC A;  4WKW A;  1XIY A;  4A5P A;  4GQF A;  1KNG A;  4V1A g;  2CVB A;  5E4W A;  3FMW A;  1SVL A;  2NVL A;  1NM3 A;  4ECI A;  2LJK A;  1TRV A;  2RII A;  3ZTL A;  4N30 A;  3IHQ A;  4HQS A;  1C72 A;  1AAZ A;  1VF3 A;  2GSR A;  4LLR A;  2VD0 A;  5JCW A;  2GDR A;  1V9W A;  2DJ2 A;  2MBT A;  1X9S B;  3TKS C;  3ZVJ A;  4MP4 A;  4WBR D;  1EOH A;  1JHB A;  2NTO A;  2B7K A;  3MYD A;  5IMZ A;  1O8W A;  1VGL A;  2VCT A;  3C1S A;  5F0G A;  4N0Z A;  1TJD A;  4ML1 A;  3UBK A;  1DE2 A;  4MZW A;  1JFU A;  3OR5 A;  3VI7 A;  4ECB A;  1QFN A;  5HR3 A;  2GGT A;  2OKA A;  2MMO A;  1OKD A;  1X5D A;  3HVS A;  3EUR A;  4V2L A;  3BCK A;  4HZ4 A;  3M9J A;  3DYR A;  2D2Z A;  2VCQ A;  4E8E A;  2C4J A;  2JU5 A;  2AYT A;  4GF0 A;  4HQZ A;  1LJR A;  4ZL7 A;  4TOP A;  3TKR A;  4OO5 A;  3C73 A;  6GSU A;  3EMX A;  3UAR A;  10GS A;  1THO A;  2V41 A;  4OCE A;  4KSM A;  2H0I A;  2VD1 A;  4JE1 A;  2IMI A;  3ZZX A;  3IHG A;  1TI1 A;  1YF0 A;  4K6X A;  1FVK A;  1K0C A;  2VCW A;  3F0I A;  4F03 A;  3R3E A;  4MF7 A;  2PVO C;  3FEU A;  2A4V A;  5G31 A;  4ECJ A;  4KX4 A;  5DVB A;  4V2N A;  1SK2 A;  4POB A;  1SYX A;  2G0F A;  5E59 A;  3GFK A;  3TGZ A;  2QA2 A;  3ME8 A;  3TOU A;  4XS6 A;  7GSS A;  3U5R E;  1ZOF A;  1NHO A;  2QSI A;  3KMN A;  3MIX A;  2TRC P;  2E0Q A;  5ELA A;  3HVV A;  2H71 A;  2WZ9 A;  3N9J A;  1T00 A;  4TXO B;  5ECN B;  2DC5 A;  2KOK A;  2EFE A;  3FR6 A;  1JLV A;  2FA4 A;  3I69 A;  3DVW A;  3ZFL A;  4MZB A;  1RQM A;  3MSZ A;  1UVZ A;  4EVM A;  2CAQ A;  2UZ8 A;  1O6J A;  4HJ2 A;  5KN1 A;  2DIY A;  2HNL A;  2VIM A;  4KW6 A;  1BX9 A;  4X0X A;  4I2U A;  2TRX A;  3TDG A;  2H30 A;  1AIU A;  4TR0 A;  3HA9 A;  3ZL5 A;  5F06 A;  1DUG A;  5CRE A;  2N5F A;  5CRD A;  3TJK A;  1EV4 A;  5IMD A;  4PTS A;  3M8N A;  1A24 A;  1PN0 A;  2WCI A;  3TKS E;  4TW5 A;  5D73 A;  1FB0 A;  3ZRE A;  2HRA A;  2XBQ A;  5HR0 A;  2R0C A;  1ZMA A;  4IW9 A;  2YV9 A;  1THX A;  1GSE A;  3KGK A;  1YY7 A;  1B4P A;  3QAG A;  4ICY A;  2F51 A;  3D0Z A;  1ZGN A;  2O89 A;  2R5G A;  2LRN A;  2B6M A;  1M2B A;  3CBU A;  2PMT A;  4HZ2 A;  4WBJ A;  3GSS A;  3H8Q A;  3GX8 A;  2EIQ A;  2HRF A;  2F8F A;  2C3Q A;  1QXH A;  3E9J B;  5IMC A;  1ML6 A;  2IN3 A;  1GP1 A;  5HFG A;  3TJB A;  2O8V B;  3IA1 A;  2E2M A;  2LNT A;  3FYG A;  4O7H A;  3H1N A;  3NOF A;  1OC3 A;  1W4V A;  5J41 A;  5CRG A;  1EP8 A;  4NHZ A;  6GST A;  3TU3 B;  3VLN A;  2H1L A;  4ZB8 A;  1GL8 A;  4GDF A;  3EMP A;  3Q18 A;  2DBC A;  3C1R A;  1XW9 A;  3A3T A;  5CO3 A;  1EP7 A;  3LYK A;  3F4T A;  1H4O A;  5DQY A;  2BJX A;  2FGX A;  5IPH A;  4YAV A;  1DBY A;  4ZB7 A;  1SK1 A;  4KCE A;  4IQ1 A;  4JRR A;  2OAD A;  2YV7 A;  1BED A;  4WET A;  1YEX A;  4PNF A;  1ZCP A;  2RM5 A;  5DDL A;  3AY8 A;  1XVW A;  1J08 A;  3FZ9 A;  3M0F A;  1ZYP A;  5G5E A;  2YCD A;  1R4W A;  3EE2 A;  3E3E A;  5HQP A;  4QQ7 A;  4RQX A;  2WUL A;  3J7Y k;  2KP2 A;  1OKT A;  3CSI A;  2MYG A;  4BWS A;  2WJU A;  1GUK A;  1O81 A;  4O5U A;  3HKR A;  4FH8 A;  3GTU A;  1U3I A;  3WGX A;  1PKZ A;  5H5S A;  2HT9 A;  3P8W A;  2JAD A;  4BWQ A;  4F2I A;  2XPE A;  1TI3 A;  1KTE A;  2H1G A;  1S3A A;  4BPY A;  1ERV A;  2H0G A;  4KDX A;  2VLU A;  3G7I A;  1Z6M A;  3IDV A;  4POM A;  5LNK e;  5GSS A;  3EVI A;  2VM1 A;  4GCI A;  2VL2 C;  5GAP D;  5IQY A;  1URM A;  3ZML A;  4WF4 A;  4IS0 A;  4K0N A;  5J40 A;  1PX7 A;  2JZR A;  1X5E A;  1FOV A;  4XRD A;  3GL3 A;  3MWH A;  4NWY A;  3G7Y A;  2X8C A;  3EIN A;  2DJ0 A;  1ZL9 A;  2PWJ A;  2HRK B;  1PA3 A;  5A1N A;  5J5N A;  2PN8 A;  4YQM A;  2YWO A;  5A5H A;  2IFQ B;  2NDO A;  2HZF A;  3RAZ A;  2YN1 A;  4MJC A;  4KSO A;  4MH2 A;  4POK A;  5GZZ B;  1YVL A;  1M2D A;  2DLX A;  4YQV A;  2VLV A;  1PX6 A;  4WEY A;  5BRT A;  5J4Y A;  2MZC A;  4USS A;  3TRQ A;  1TOF A;  4I2T A;  2F3M A;  4KDY A;  3C7M A;  4BVX A;  2B5X A;  2PPT A;  1Y1U A;  4YQU A;  3F3R A;  1PGT A;  5D9V A;  2MBS A;  1EWX A;  1FAA A;  3GRX A;  5J9C A;  5IMV A;  4QL9 A;  3HZ8 A;  4LL4 B;  5ID2 A;  1UA5 A;  4I6X A;  1GSU A;  1WP0 A;  1PSQ A;  4GTU A;  4MCU A;  5D96 A;  4EDZ A;  5BMU A;  4PQ1 A;  2CAI A;  1Z3E A;  4MJA A;  3HMJ G;  5DAL A;  2VOC A;  2B7J A;  2AB6 A;  4ECC A;  4TXV A;  6GSW A;  4KUN A;  4NV2 A;  5EVO A;  3GL5 A;  1A8Y A;  1N8J A;  1I9D A;  2ES7 A;  1SKR B;  1TTZ A;  3NIV A;  4Q5R A;  3LG6 A;  4MAB A;  4BVY A;  5KEJ A;  1A8L A;  1OE8 A;  3UJ1 A;  2C0F A;  4FYC A;  4ZXG A;  1PN9 A;  2H19 A;  4RI6 A;  3QR6 A;  3EWL A;  1W89 A;  4AKH A;  4GXZ A;  3L0H A;  3J7Y b;  4DSS A;  2YJH A;  1X0R A;  1R5A A;  3FY7 A;  4GST A;  4XIH A;  2FCH A;  4Z7X A;  4HS1 A;  5FHI A;  4EIQ A;  3HZ4 A;  4WR5 A;  3PR8 A;  3ZRD A;  2VCZ A;  2RUF A;  2HSH A;  3R2Q A;  3DWV A;  1XOB A;  4JZQ A;  5D9X A;  4ZB6 A;  2VUP A;  3SBC A;  2FA8 A;  1M99 A;  4BL7 A;  3VUR A;  5ECM B;  5IIZ A;  1ABA A;  2R37 A;  4PGT A;  2MMN A;  2GSQ A;  3WT2 A;  5DJM A;  3S9F A;  3H79 A;  4O5R A;  2X99 A;  2K6V A;  4GLT A;  3I9V 2;  4O92 A;  3HJP A;  1BQ7 A;  1PD2 1;  2LRT A;  1FW1 A;  5EL8 A;  2B5E A;  5D93 A;  3ERG A;  1S3D A;  1TK5 B;  1AQV A;  2DMM A;  3A2W A;  1M9B A;  5J9B A;  4CHS A;  1Z7P A;  2O87 A;  1AQW A;  1ACV A;  2QC7 A;  2YAN A;  1A2M A;  5A4W A;  1AQX A;  1AUC A;  4FIW A;  3KMO A;  2XPD A;  3U6V A;  2A2P A;  4O5Q A;  3I43 A;  4Z2R A;  1PQN A;  1WJK A;  4ILF A;  5ENU A;  3EPT A;  3W8J A;  4K7N A;  1UN2 A;  1NHY A;  1JZW A;  1DE1 A;  1T4Y A;  5JWO B;  2L57 A;  4JED A;  4HU7 A;  1F3A A;  1BF5 A;  1Y6E A;  3RBT A;  4NMU A;  1K3L A;  2H1B A;  5G1L A;  4RUV A;  3F6D A;  2IL3 A;  1VF2 A;  3DXB A;  3Q19 A;  4PUA A;  4PXO A;  4G9H A;  3CYN A;  3DD3 A;  1A2J A;  4GRF A;  4K9Z A;  1TK8 B;  4EE0 A;  1M0U A;  2CVD A;  3GN3 A;  4X1U A;  1SJZ A;  2IIY A;  2FWE A;  4ML6 A;  3EU4 A;  4NAX A;  5ECS A;  2K18 A;  1ZZY A;  2L5L A;  3VPT A;  4NV5 A;  1YZX A;  2GZZ A;  5B8A A;  4K7O A;  1K0O A;  2H75 A;  2FLS A;  2UV8 G;  1OAZ A;  3QDN A;  4HOJ A;  4OMV A;  2FWH A;  1V58 A;  3EYT A;  4TVE A;  5CYY A;  1QGV A;  3D5J A;  4LMV A;  2IPA A;  5A5H B;  4Z2T A;  4DSQ A;  4YKG A;  1K0M A;  2K8S A;  3KD0 A;  1XPV A;  3O3T A;  4ID0 A;  1O8X A;  3ME7 A;  5G2Z A;  3VWW A;  4KND A;  1Y25 A;  2MMZ A;  2PER A;  1GSQ A;  2WGR A;  2YPM A;  4EXJ A;  2H73 A;  1PL2 A;  2OE1 A;  1HYU A;  2JZS A;  4BVX B;  1EZK A;  2DIZ A;  1SJ6 A;  3DGQ A;  2YWI A;  3GHA A;  4AKG A;  3LOR A;  8GSS A;  4P3Y B;  4PQH A;  4H86 A;  4JR4 A;  1EEJ A;  3PIN A;  3APS A;  1SL1 B;  1WOU A;  1GSF A;  2CVK A;  3FR9 A;  2K9F A;  4OWY A;  2DJ1 A;  2L6C A;  4IJI A;  2ZUP A;  2PBJ A;  4EDY A;  1G7E A;  3KTL A;  3CTF A;  4N10 A;  2YZH A;  3L9S A;  1SKW B;  3FW2 A;  1GSY A;  5IOX A;  5ECQ B;  1SEN A;  3RPN A;  3FHK A;  1K3O A;  1WMJ A;  2H01 A;  2E7P A;  4J57 E;  3CRT A;  1YDK A;  3LJR A;  3ZLP A;  1H75 A;  1AW9 A;  2YZU A;  3LSZ A;  4BVY B;  3D4M A;  1GTA A;  3BCI A;  1XW6 A;  4I97 A;  3L78 A;  4CY6 A;  3IRA A;  3VFI A;  4DSS B;  2GSS A;  4K5R A;  5J4U A;  3LYP A;  5KOW A;  1XZO A;  5A4V A;  4K2D A;  1R7H A;  4MLY A;  1TU7 A;  2X8H A;  2HRN A;  4N11 A;  1USB A;  3DKS A;  3F3Q A;  3TCO A;  1FVJ A;  5DJL A;  2H1A A;  4XTS A;  3UVT A;  4IBP A;  2YWN A;  4KE3 A;  1NW2 A;  2GS3 A;  4BL7 B;  2CX4 A;  4K8M A;  2M46 A;  4NXI A;  4FYB A;  2HE3 A;  3WGE A;  3W6G A;  1U88 A;  3UL3 A;  2O7K A;  2DML A;  2K8V A;  1JZO A;  2OT3 A;  4AGS A;  4QMK A;  2GLR A;  1Q98 A;  5H5Q A;  1R5P A;  2H76 A;  2CA8 A;  4K0G A;  4Q5Q A;  5IO0 A;  2H74 A;  2LEG A;  3C8E A;  3EC3 A;  4XS1 A;  1G7O A;  1GUH A;  3UBL A;  3HVX A;  4MK3 A;  3A5I A;  3DRN A;  4PUR A;  1VRS D;  4XRA A;  3D4T A;  4AF2 A;  1TDI A;  5G30 A;  2DJK A;  4IVF A;  2OE3 A;  1PL1 A;  2EC4 A;  3MNG A;  1V40 A;  4RI7 A;  3VK9 A;  3HJO A;  4O32 A;  3IAM 2;  2JZT A;  3KH9 A;  1UC7 A;  1WRY A;  2E2G A;  4TR4 A;  3TJJ A;  3FZ5 A;  2R4V A;  3O6T A;  1AC1 A;  4ZBD A;  1GWC A;  22GS A;  2HSY A;  1X5C A;  5CRH A;  5D9T A;  5J3R A;  1PMT A;  2FHE A;  4KB3 A;  2YNX A;  1ZYE A;  1IYI A;  4ACS A;  2DJ3 A;  3ZIV A;  5AIX A;  2JL4 A;  1FO5 A;  4ZBA A;  1FHE A;  4IEL A;  2H8L A;  3IC4 A;  5JWQ B;  1XXU A;  1NSW A;  5ABR A;  1MD4 A;  3VWV A;  19GS A;  5DQS A;  1TW9 A;  1ST9 A;  4ZIJ A;  4PUF C;  4MA9 A;  1XW5 A;  1T7P B;  2LJA A;  1LBK A;  4HEA 2;  4TR1 A;  1MDI A;  1XFL A;  2L4Q A;  3QFA C;  4L5O A;  3GMF A;  3KH7 A;  2PVQ A;  3QCP A;  2G2Q A;  5F07 A;  1V2A A;  20GS A;  4TR3 A;  4F9Z A;  1RK4 A;  2VKZ G;  3HYP A;  2R6K A;  1GLQ A;  3IV4 A;  5IPG A;  3KM6 A;  4XS4 A;  2FWG A;  1SD9 A;  1G0T A;  4OCF A;  1GTU A;  5KN0 A;  5CRW A;  1XWB A;  4TRX A;  3US3 A;  1F2E A;  1K0N A;  2P5R A;  5DAK A;  4E68 A;  3DML A;  2FNO A;  1T4Z A;  3Q74 A;  5G5F A;  2GQK A;  1GH2 A;  4MNN A;  2H6Y A;  5IMF A;  2H6Z A;  4IQA A;  1QMV A;  1QQ2 A;  4JU5 A;  1YKC A;  2FY6 A;  4ZB9 A;  4KH7 A;  2KHP A;  3HJM A;  4FQU A;  5F05 A;  1DSB A;  2YWM A;  4G0L A;  1U3A A;  17GS A;  1XBS A;  1I5G A;  3L9U A;  4AJ8 A;  5IO2 A;  2LQQ A;  5ECI B;  2L5O A;  1TKD B;  2DKI A;  5A34 A;  4IHU A;  5B7C A;  1EEM A;  2GVP A;  4WF5 A;  4W66 A;  4MH3 A;  3IE3 A;  2B1L A;  3ISO A;  1SYR A;  14GS A;  1B48 A;  3K8N A;  3IK7 A;  4D73 A;  2IMF A;  2QGV A;  2HSN A;  3CTG A;  2I4A A;  2JSY A;  4NPB A;  2KP1 A;  3KZQ A;  3LGC A;  1SD8 A;  3UVH A;  3I6A A;  1HQO A;  1T1V A;  2IJY A;  3M9K A;  3CSH A;  1TRS A;  3QD9 A;  1J9B A;  4AI6 A;  2P31 A;  1YJ6 A;  2VL3 A;  1QUW A;  2V32 A;  3DVX A;  4J2F A;  2VM2 A;  3F9U A;  1B4Q A;  4CW9 A;  2ON7 A;  3IAS 2;  4HI7 A;  1Z5Y E;  4LMW A;  2VCX A;  4IGJ A;  2C80 A;  5DBQ A;  3LW9 A;  1XWA A;  4DVC A;  6GSX A;  1K0B A;  2C3T A;  3M1G A;  3WGD A;  4PX1 A;  3QPM A;  3VPQ A;  2CZ3 A;  2DJJ A;  2NPB A;  4KCA A;  3IPZ A;  5AIV A;  3FZ4 A;  4ULX A;  3F8U A;  3KXO A;  4AKI A;  2VL2 A;  1BG1 A;  1BYE A;  4EUY A;  3P7X A;  3UEM A;  2GZP A;  4G01 A;  2OAC A;  3C71 A;  2HXK A;  3RDW A;  1U6T A;  5INY A;  1WE0 A;  2KLX A;  1XWG A;  5LCZ A;  4MF5 A;  1EV9 A;  1TXX A;  1F6M C;  3GKM A;  4MJB A;  1GUM A;  1SJI A;  1YKA A;  2RM6 A;  3GIX A;  5IMA A;  2OE0 A;  1F9M A;  3BJ5 A;  16GS A;  3WD6 A;  2I9H A;  2V1M A;  1ILO A;  5ECL B;  1GSS A;  2C3N A;  3GH9 A;  1BJX A;  5GST A;  2VAF A;  1O73 A;  12GS A;  4MDC A;  3VWU A;  2AV4 A;  1OC9 A;  3ERW A;  4E8H A;  2C0G A;  5ECP B;  4EKZ A;  1A0F A;  1K0D A;  4OFN A;  4ISD A;  4PNG A;  3QOU A;  4YH2 A;  2EIR A;  3WYW A;  2DKH A;  3IOS A;  3SWL A;  2YP6 A;  3GTU B;  3TRX A;  2ON5 A;  1A0R P;  2I1U A;  2LS5 A;  1SK0 A;  6GSS A;  5ECK B;  1ZYQ B;  5F8B A;  2V2G A;  2X64 A;  4N0V A;  4KA0 A;  1KBN A;  2R0G A;  3PPU A;  3LFL A;  2R3X A;  4TR1 B;  18GS A;  4KGI A;  4G10 A;  5JCG A;  1M9A A;  1S3C A;  1GTI A;  1R26 A;  3APO A;  3ED3 A;  3L9V A;  5KOX A;  4GWR A;  1IYH A;  4EL1 A;  5C04 A;  4L8E A;  3TOT A;  4GSN A;  4AJ6 A;  2GT6 A;  1XVQ A;  4XS4 B;  4I5Q A;  2VLT A;  2CT6 A;  4EIP A;  4MF6 A;  5A1N B;  3O76 A;  2BMX A;  1SKS B;  5DAK B;  1ON4 A;  2OA7 A;  4JR6 A;  1B8X A;  3F6F A;  3APQ A;  3GST A;  4OFT A;  1K0A A;  4GQC A;  4V1A p;  1FG4 A;  1HNA A;  4DEJ A;  1MD3 A;  1GSD A;  2H0H A;  3CSJ A;  4IKH A;  1E6B A;  2AJQ B;  2J23 A;  1EOG A;  1V98 A;  1TU8 A;  3IBH A;  5EPF A;  3GA4 A;  2V6O A;  3FRC A;  3GKK A;  2HRK A;  5HFI A;  1YQ1 A;  1A2L A;  2LST A;  4WR4 A;  1YF1 A;  1G6Y A;  3LXZ A;  3FZA A;  3KCM A;  3Q6O A;  5ID2 B;  2VCV A;  2IFQ A;  3RHB A;  1X9M B;  2F8A A;  5A34 B;  3RHC A;  1HNC A;  4N3Z A;  2MMA A;  1MEK A;  3ERF A;  5EY6 A;  2CX3 A;  5BMU B;  3CRU A;  1GTB A;  3QAW A;  5CNW A;  4D73 B;  5DAL B;  1F37 A;  2HSN B;  3FKF A;  1B9Y C;  3KJY A;  3QAV A;  3ZVJ D;  3TKQ A;  3UOM A;  2GQM A;  1HD2 A;  5ELG A;  4LL1 B;  4G19 A;  4GSS A;  2BTO T;  2NBS A;  9GSS A;  2CZ2 A;  1G6W A;  3QFB C;  4IP6 A;  1OC8 A;  4QL7 A;  3HHV A;  2ZCT A;  4ZL8 A;  4J56 E;  3GKX A;  2FUG 2;  3EU3 A;  1TXU A;  6GSY A;  2GST A;  3ZFB A;  2I3Y A;  3HCZ A;  2V6K A;  4FO5 A;  1F3B A;  3GUS A;  2R2J A;  3FK8 A;  2WRT A;  2DSA A;  4K2X A;  5H5R A;  1BG5 A;  6GSV A;  3FR3 A;  1WPI A;  3ZYW A;  4Z2U A;  2HZE A;  2N5B A;  4I8B A;  2N5A A;  3TRP A;  2C0E A;  3TKS A;  4X43 A;  4FYU A;  2O85 A;  2JAC A;  4WXT A;  2HSM A;  2XHF A;  2PUK C;  1EGR A;  2FWF A;  1TP9 A;  5IOW A;  1MDK A;  3F63 A;  2HYX A;  4MZC A;  1M2A A;  5ECH B;  3CMI A;  4POL A;  2QKE A;  4HU9 A;  3TJF A;  4CY8 A;  3PH9 A;  3IXR A;  3F4S A;  2HFD A;  2LTK A;  2P0G A;  2TIR A;  5G1K A;  2YJ7 A;  3H93 A;  4G2E A;  3KTB A;  3TB2 A;  2CQ9 A;  2X49 A;  2A4H A;  2IMD A;  5ECO B;  4EF0 A;  5FWG A;  4RQR A;  3M3M A;  2H66 A;  2LV3 A;  5GAN D;  4ZBB A;  4XCS A;  5CP1 A;  4YAP A;  1B9X C;  3ZMK A;  1OC9 B;  3TKP A;  4AKX B;  2X8G A;  2WDU A;  3D22 A;  4PQI A;  1GUL A;  3GV1 A;  2OJL A;  2RLI A;  3CWG A;  4HUA A;  2LJR A;  4F0C A;  3GKN A;  2XC2 A;  2REM A;  3KP8 A;  5C00 A;  4L5L A;  3JCM L;  2IME A;  2A2S A;  2AUV A;  11GS A;  4KF9 A;  1BAY A;  1Z6N A;  4ZIL A;  1U87 A;  3G7J A;  5COH A;  2C0D A;  3GH6 A;  3VI5 A;  2PGT A;  4YKF A;  1WIK A;  3UIW A;  2L4C A;  5D8I A;  1GRX A;  4HDE A;  3HY2 A;  2IMK A;  2YOI A;  2H70 A;  1GNW A;  1VF4 A;  1CQH A;  1M7T A;  1FB6 A;  1A23 A;  2QA1 A;  2LRC A;  2EFH A;  3RPP A;  1WWJ A;  3NZN A;  3DEX A;  4LA1 A;  1X9W B;  1OE7 A;  1PKW A;  2WB9 A;  4K7I A;  4MPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...