5J5NA

Crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
SDQVTLLDFWPSPFGMRVRLALAEKGVKYEYSEEDLWNKSALLLQMNPVNKQIPVLVHNGKPVCESLIIVQYIDEVWKDSAPLLPSDPYQRAQSRFWADFVDKKIYDLGRKIWTKKGEEQEAAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEAECPKMIAYCKRCLQKETVSKALEDPQKVYDFVLMLMKKFGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase family protein
publication title Functional and Structural Profiles of GST Gene Family from Three Populus Species Revealed the Sequence-function Decoupling of Orthologous Genes
rcsb
source organism Populus trichocarpa
total genus 79
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5j5nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j5nA01
3W6GA 1QFNA 3C1SA 1M2BA 3VWUA 4YQMA 3ERGA 2EIRA 2F9SA 4K0NA 3HJPA 4G2EA 4PNFA 5ECOB 4JZQA 1BX9A 4ZL8A 5J4UA 1FOVA 4J57E 1WE0A 2YZHA 5L71A 2VM2A 3UBLA 3HKRA 18GSA 4IP6A 4ZILA 12GSA 1HQOA 2RIIA 2H19A 4POLA 1VGLA 5IMAA 3IAS2 4OO5A 3H1NA 1U87A 3GN3A 2GSTA 1UA5A 3C8EA 1X5CA 1V98A 1YF0A 3P7XA 5LNKe 1M9BA 4K7NA 3KMNA 5IOWA 1GUKA 2LRNA 4BA7A 3KTBA 3LYKA 3HZ8A 3TKQA 3CBUA 3V1WA 4N11A 4F9ZA 1K3OA 3N5OA 4PXOA 3CRTA 3NOFA 4CHSA 1GTAA 5A4WA 4ML1A 3IHQA 3UVHA 2F3MA 4V2MA 5JCWA 2B3SA 3PGTA 4POMA 2YOIA 1GUHA 4EXJA 1FW1A 4OFNA 4KSOA 4IGJA 2F51A 1PRXA 3IV4A 1ML6A 2HRKA 2MBTA 2DIZA 3FZ9A 3UEMA 1BJXA 4ECCA 2C4JA 1ILOA 2ALBA 1M9AA 2I4AA 4NWYA 5LCZA 1RQMA 1XBSA 1LBKA 1PN9A 2YN1A 1EEJA 1UVZA 4IHUA 2LRTA 4OCEA 3IC4A 4PQ1A 3N9JA 4HQZA 3MNGA 2ON7A 2HRKB 2H0GA 3LXTA 1GL8A 1TU8A 1GSYA 2PUKC 2B7KA 2JADA 2WULA 4MF5A 1GULA 1TP9A 2H1AA 2CAIA 4E8HA 4Z7XA 2VD0A 3QMXA 3WGDA 2EIQA 2YP6A 4IP1A 2O89A 4IW9A 5BMUA 1BYEA 1FB0A 2GZPA 2YCDA 3HJOA 3DVWA 2KUCA 3LG6A 1A2LA 2YWOA 2AHEA 2HFDA 2DMMA 1M0UA 4O32A 3A2XA 3ZYWA 3GA4A 2OE0A 2FA4A 1AW9A 4EO3A 2HSNB 4IJIA 2CAQA 4PQIA 1GWCA 4RI6A 1A0RP 1WMJA 5CO3A 5AN1A 1B48A 1EV4A 1PL1A 2OBKA 4KB3A 2V32A 2L5LA 4MA9A 1V9WA 2GDRA 1A24A 2HLSA 2LKUA 3F6FA 3JCML 3GKNA 4AJ7A 5HR0A 2C3TA 3RAZA 1PD21 3D5JA 1GSUA 1EV9A 4O5RA 2GTUA 2IMFA 2VLVA 4MF7A 4F0BA 3LFLA 5IMCA 1URMA 5ELGA 2HSHA 2IMIA 2WCIA 4MPGA 1TXXA 4GWRA 3MSZA 2I3YA 2YJ7A 3IE3A 2VL2C 1HNAA 2LS5A 4HU9A 1GTUA 2C1YA 3M8NA 1PA3A 4WBJA 2R3XA 5ECRB 4X1UA 2X8CA 2H71A 4L0WA 1TU7A 3VWVA 2JU5A 1V58A 3H4KA 1O73A 1YJ6A 1FG4A 5GZZB 2C3NA 1V2AA 2YNXA 2E2MA 1SYXA 4NHWA 1XWAA 1XWKA 3KP8A 1QMVA 1J9BA 2NTOA 4ID0A 2ES7A 5C00A 1R5PA 3Q6OA 1SL2B 2BJXA 1S3DA 2KLXA 1EZKA 5G30A 3ZVJD 4IVFA 1QUWA 2UZ8A 5ABRA 4ML6A 5AISA 3WD6A 3J7Yk 5DALA 5ECPB 1YF1A 4BPYA 3DD3A 4KCAA 3C73A 4HZ4A 2JZTA 4G19A 4ZB9A 3CYNA 3ZTLA 3GL5A 16GSA 1U3AA 1DE1A 3C71A 1ERWA 3WGEA 2H0IA 4MPFA 1XW5A 3D22A 2K8VA 2VCXA 2GSQA 2AJQB 2JSZA 4CDOA 4IQ1A 1EOHA 4TR1A 4HS1A 4I5QA 1TRWA 1EP7A 3A2VA 3UL3A 2JZRA 1ZGNA 2VM1A 2HSMA 1SKWB 1S3AA 1K0MA 1MDIA 3GIXA 5GAPD 2GZZA 1SL1B 4CW9A 3FY7A 2VAFA 2A4VA 1JHBA 1JZWA 3TCOA 1ABAA 1GTIA 4MK3A 1TI3A 2PWJA 3D0ZA 1H4OA 3QD9A 4G0KA 2G0FA 1HNCA 1EWXA 3WT1A 2PN8A 4TR1B 2DMLA 2B5EA 5KN0A 2KP2A 3GRXA 3CTFA 2R37A 2HYXA 1S3CA 1YEPA 2HZFA 1KEBA 4GTUA 4KDYA 3MDKA 2YWNA 4HQSA 5ECNB 4K6XA 3L9UA 2LNSA 1XXUA 3IPZA 3IK9A 2IIYA 6GSTA 2X8GA 4GCIA 4MJAA 4WXTA 1OVNA 1GSEA 2XPEA 4AJ6A 3EMPA 2CZ2A 5DQSA 1TK8B 2QSIA 1NM3A 2RM5A 3C1RA 4KUNA 1RW1A 1R7HA 1X9WB 4HJ2A 5JCUA 3ZITA 1T4ZA 3EVIA 5B6NA 5F0GA 2X64A 4ILFA 2VLUA 3U6VA 1TW9A 3I43A 3BBYA 3FZAA 1I5GA 5B8BA 3CTGA 2IMDA 3FK8A 3BJ5A 5D9XA 1VF4A 2WRTA 3H93A 5F8BA 3VWWA 4YH2A 5ECMB 1OC8A 11GSA 2P31A 2GSSA 5D9VA 3BOAA 1DE2A 5IPGA 4V2LA 1E2YA 5A5KA 2JZSA 1ACVA 2PERA 4EDYA 1V57A 2C80A 5D9WA 1O6JA 4YQVA 2IFQA 3HVVA 4TKYA 3FKFA 4EKZA 5AIXA 3L78A 2DJ3A 4EL1A 2VO4A 6GSWA 5CRDA 4N0VA 3R2QA 1O7UA 1THOA 3QDNA 1OAZA 4ECBA 4ZBAA 3F3QA 4XS4B 1ERUA 2GT6A 2KOKA 4FYBA 1F2EA 2HQTA 2RLIA 1NHYA 1R5AA 4KNDA 4XCSA 2H6XA 2FWFA 2NDOA 3RPNA 1QXHA 1R26A 1KTEA 2O8VB 3TKPA 3RPPA 1O8XA 4K0GA 1FHEA 1B8XA 2MMAA 1X9MB 4XS6A 2IFQB 4POKA 3TKSE 2AB6A 9GSSA 1XZOA 1FO5A 4PGTA 2YPMA 3EWLA 1WRYA 1A2JA 2I81A 4NXIA 4OWYA 1G0TA 2MMZA 3HD5A 1B4QA 3VURA 2MYGA 3QFAC 3APOA 1VF3A 3GSSA 5CRHA 2YV9A 2GLRA 1O85A 4I8BA 2VIMA 2DJ2A 4J56E 3D6IA 3WGXA 2FWHA 3TJKA 3RBTA 1GLQA 4TR4A 2GQKA 2VCZA 1X5DA 1OE8A 2PU9C 2AYTA 2X8HA 4NMUA 4Q5NA 2IJYA 3FW2A 4TVEA 1T00A 3PH9A 4N10A 4ZB6A 3F4RA 4N0ZA 5DVBA 3EE2A 2DJ0A 5GAND 2I9HA 3BCIA 2MMNA 3KEBA 3ZRDA 4GXZA 2VD1A 4HUAA 5IM9A 5H5SA 2PGTA 1JZOA 3RHCA 2RM6A 1WOUA 4IQAA 4BL7A 1SENA 4LL1B 2A2SA 4HZ2A 1Q4JA 3UMAA 4Q5FA 4KCEA 3M3MA 3Q18A 1K0BA 5G1KA 2PBJA 5KN2A 2WGRA 3P2AA 3IK7A 2O7KA 1PL2A 2P5RA 3GX8A 5D73A 2LEGA 3AY8A 1ZL9A 1NSWA 3R3EA 3DXBA 1N2AA 2WB9A 4I97A 1XCCA 1IYHA 4BL7B 1YQ1A 4AF2A 2V2GA 1MTCA 5A4VA 2L4CA 3ME7A 1Y25A 2B6MA 3ME8A 3ERFA 4USSA 4RUVA 1EP8A 2DJJA 2PVOC 5ECQB 3F9UA 3GKMA 1AUCA 1T8EB 1OE7A 4JR6A 3DVXA 6GSVA 4ECIA 4XTSA 1BG5A 1SJZA 2HE3A 3LYPA 3VI7A 1V40A 4ULXA 2PVQA 1GH2A 5HR1A 2HXKA 5E59A 1PSQA 1Z3EA 2NPBA 3QCPA 3IXRA 1SU9A 4PUAA 1XWBA 2XHFA 1E6BA 3GSTA 1C72A 5LD0A 3L0HA 4KDXA 5ECHB 1TK5B 3HDCA 3KCMA 3P90A 2FLSA 2FCHA 4ZBDA 2CVKA 1T4YA 3UBKA 5HFKA 2MZCA 1GSFA 3ZFLA 5DBQA 3EURA 1F6MC 4TOPA 1K0CA 2V41A 3ZMKA 3WYWA 3APSA 1AAZA 3ZIJA 2TRCP 5IIZA 4ZBBA 5JCGA 5IO0A 1GNEA 3TJFA 4RQXA 1F3AA 1K0DA 5GSSA 4IELA 4MMMA 4YAVA 1X9SB 3GHAA 2FA8A 1DSBA 2LNTA 3FEUA 5E4WA 3UARA 3QPMA 5CRGA 1CQHA 2OBIA 1B4PA 1G6WA 3TJJA 2NBSA 4OFTA 2GVPA 2L4QA 3IDVA 2YANA 5J3RA 4ZB8A 4KH7A 5CYYA 3FR3A 2DJ1A 1OC3A 4DVCA 3TKSC 1BAYA 5IOXA 3VLNA 2VCQA 5G2ZA 4IS0A 2J9HA 2WDUA 1JZDA 3FRCA 4JBBA 4XIHA 1SD9A 4L5LA 2YJHA 2LJRA 1MDJA 2YWMA 1Q98A 3QAWA 1VF1A 3KP9A 4DEJA 1ZOFA 2C0FA 2XBQA 1HNBA 3EC3A 2GT5A 4OO4A 4QL7A 1A0FA 3W8JA 1GTBA 3PPUA 1MEKA 2JSYA 4LA1A 2AAWA 5ID2B 1SK0A 4FQUA 3EYTA 4MF6A 3CSIA 1M2DA 5J9CA 3HVSA 2LJKA 4J2FA 2FWGA 3UOMA 1IYIA 1FB6A 4L8EA 4TW5A 1JZRA 4Q5QA 2C0DA 1LJRA 2HRNA 2VOCA 4AGSA 2QGVA 1XIYA 4BWQA 4WR5A 3GTUA 3H8QA 3QOUA 2B1LA 3IR4A 5H5QA 1MD3A 2L59A 3DWVA 4MZCA 2QKEA 3E9JB 4MJEA 2CX4A 3A3TA 3IAM2 4PTSA 1J08A 2WFCA 2DBCA 1Z6NA 5INYA 3BCKA 5G31A 4GSTA 2LV3A 22GSA 3DRNA 2YV7A 3GTUB 5C04A 1WP0A 3G7IA 2BMXA 4KGIA 5D93A 3TDGA 4JU5A 4EE0A 2H1DA 5FHIA 4G0IA 1JLWA 2OE1A 1SD8A 1PX7A 4D73B 3M9KA 2VUPA 3HHVA 5D8IA 1ST9A 1OKTA 3FZ5A 1ZMAA 20GSA 5ENUA 2H72A 2R4VA 1R4WA 1DBYA 3EINA 5EVOA 1G6YA 4DSRA 4GQCA 3UJ1A 2HRFA 2BTOT 3LSZA 2HSYA 4OD7A 1ERTA 3KJYA 2LTKA 4MP4A 1H75A 4V2NA 4F2IA 1K0NA 2VL2A 2HI7A 3TKSA 2WJUA 1XW6A 3Q19A 4L5OA 2AV4A 1YKCA 3IRAA 5ELAA 1GLPA 3F63A 3DEXA 3EU4A 5JWOB 4FYCA 3IBHA 1K0OA 4TXVA 4XS4A 4GSSA 3J7Yb 1PQNA 2MMOA 3H79A 2HZEA 4HI7A 1SJIA 1THXA 2TIRA 2B1KA 4KE3A 1WJKA 4K2DA 3EMXA 4O92A 2LQQA 5A4UA 4I2UA 4I2TA 1ZCPA 3GYKA 4H86A 1DUGA 3KIJA 3ISOA 1QGVA 1ZYEA 4PNGA 4IN0A 2DC5A 4G10A 3LJRA 3A5WA 3VFIA 1TK0B 2VLTA 1I9DA 2H6YA 2N5AA 1TJDA 4XS1A 2XPDA 2HZEB 3TOUA 4KSMA 5DQYA 5CP1A 3TKRA 2VL3A 4TR0A 5G1LA 1A8LA 2WZ9A 1LU4A 3PINA 2FNOA 1ZZYA 3C7MA 3S9FA 1EEMA 2ZCTA 3K8NA 2H73A 1CQGA 3TRXA 1PGTA 4EUYA 2GGTA 4E8EA 1PMTA 13GSA 4BVYA 2FD3A 2L6DA 2J23A 1AIUA 1O8WA 5G5EA 4NAXA 3UAPA 1GRXA 5D9TA 19GSA 5HR2A 1FVJA 2CZ3A 5CREA 4KF9A 5DCHA 5IPHA 1SYRA 1ERVA 5F07A 1B9YC 5IMZA 4JRRA 1Z7PA 1TOFA 2G2QA 4MCUA 3UVTA 1HD2A 3ZFBA 1VRSD 5H5RA 4BVYB 3APQA 4WF5A 1O81A 1SKSB 3ZIVA 3M0FA 2L5OA 3CXGA 1XFLA 4FO5A 4EDZA 7GSSA 4X0XA 1A8YA 1YY7A 5ECSA 3GKXA 2FWEA 2H70A 5AIVA 4WR4A 3D4TA 5F05A 3VK9A 3GV1A 2VCWA 1X5EA 3MWHA 1Z9HA 1U6TA 2IPAA 2VL9A 3GKKA 3F4SA 2GZYA 1MDKA 1XVQA 2ON5A 2K18A 3GNJA 1G7OA 2E0QA 2VCVA 3G7YA 3WT2A 1AQXA 4MLYA 2V6OA 2OE3A 2H6ZA 3FZ4A 1EOGA 3L4NA 4KDUA 4BWSA 2TRXA 4XHMA 2N5FA 4JR4A 4DSSA 3KH7A 3GUSA 2O87A 1M2AA 2KP1A 2DLXA 1U88A 4FYUA 3I6AA 3TGZA 3TB2A 4MZWA 1FAAA 4WEYA 3HA9A 2L6CA 4Q5RA 1F37A 2R2JA 1UC7A 1XW9A 2LQOA 3L9VA 3GFKA 1T7PB 2FY6A 5HQPA 4XRAA 1MD4A 1SK1A 3NIVA 14GSA 5HR3A 5FWGA 2DIYA 4HEA2 3VPTA 4PQHA 4DSSB 4G0LA 5CRWA 5CAXA 3KMOA 2YWIA 2K9FA 1XWGA 4MH3A 1RK4A 5ECKB 6GSSA 3CSJA 1WWJA 2FUG2 3TRQA 5ECLB 4WF4A 3KZQA 5HFGA 1XOBA 5DDLA 1Y6EA 4F0CA 4V1Ap 4EF0A 2H66A 2LJAA 4V1Ag 2HT9A 3L9SA 4F03A 4YQUA 2FGXA 1TRVA 3FHKA 3G9BA 3KTLA 2N5BA 2JACA 2MBSA 3GMFA 2D2ZA 3ZVJA 2CX3A 6GSXA 2H8LA 4GSNA 3F6DA 2M46A 2H0HA 4LLRA 2R5GA 1USBA 1GNWA 1TDIA 5KEJA 4POBA 2QC7A 5J41A 2K8SA 2P5QA 4GQFA 3QAVA 4AJ8A 3DYRA 2EC4A 3ERWA 4RQRA 5JWQB 2PMTA 4MJBA 4P3YB 3TRPA 4JE1A 2IN3A 3GH9A 1NW2A 2R6KA 3IC8A 1AQWA 3QAGA 1SK2A 1W89A 3IA1A 2NVLA 3F3RA 3QR6A 4GF0A 2B5XA 4ECJA 4QQ7A 1OC9A 1K0AA 2WS2A 2V1MA 3TJGA 1U3IA 1UN2A 3P8WA 1N8JA 4N30A 1M7TA 3HZ4A 4MJCA 1Z7RA 2A2RA 3LEFA 5B6MA 4NV5A 4F82A 4YAPA 2LRCA 1A23A 4G9HA 5DJMA 3E0UA 5IMFA 5J9BA 2H74A 1G7EA 3D4MA 3SBCA 2CQ9A 1T1VA 4EVMA 5CNWA 5IMVA 4IBPA 2HNLA 4K7IA 3QFBC 1OC9B 2F8FA 2LSTA 3G7JA 4BVXA 1TRUA 3VPQA 4QL9A 4LMWA 5IMDA 1AXDA 2XBIA 1GUMA 3FR9A 5ID2A 1GSQA 4K7OA 1QQ2A 1F9MA 4MABA 3GURA 6GSYA 3KD0A 1GSDA 3HYPA 4PURA 3US3A 3ZREA 3ED3A 5DCGA 2B7JA 4ISDA 2H30A 3ZL5A 5AGYA 2C0GA 3RDWA 5GSTA 5EL8A 2CT6A 4HOJA 3Q74A 4ZXGA 4TR3A 2H76A 3PR8A 1F3BA 2C0EA 4BVXB 4PX1A 1T3BA 4K9ZA 1EGOA 3HY2A 1BEDA 2IMKA 3FR6A 4TRXA 4HDEA 3ZZXA 2REMA 3DMLA 2F8AA 2O85A 2CV4A 3CRUA 3IOSA 5JWRB 2OADA 3LXZA 6GSUA 5IO2A 2GSRA 2V6KA 3KXOA 3SWLA 3RHBA 4HU7A 3F0IA 1XWCA 5B8AA 4JEDA 1Z5YE 2B5YA 4X43A 3I69A 2JL4A 1TRSA 4LL4B 1TTZA 1YZXA 1TKDB 4DSQA 2GQMA 4K1FA 5FT3A 1XVWA 1KNGA 5B7CA 4FH8A 5DALB 4MZBA 3VWXA 2KHPA 4O7HA 4OMVA 1VF2A 2GQLA 4D73A 2CVDA 2C8UA 5EPFA 1Z6MA 1W4VA 3GX0A 1A2MA 2H1BA 4FIWA 3GL3A 1PKWA 5COHA 2DSAA 1AQVA 2H75A 1BQ7A 2HRAA 2E7PA 2IL3A 2OA7A 2LUSA 5F06A 4PUFC 10GSA 1HYUA 1OYJA 3TUEA 2HSMB 2Z9SA 5D96A 3KGKA 3DGQA 3CSHA 4IJ3A 3W8SA 1K3YA 1AC1A 2DJKA 3DIEA 1FVKA 3EU3A 2XC2A 2FHEA 5KN1A 3M9JA 5DAKA 4WKWA 2H01A 2M80A 3DKSA 2P0GA 3LORA 2C3QA 3KM6A 1YEXA 4HJMA 2VCTA 4TXOA 4XRDA 3TOTA 3HCZA 3HVXA 1K3LA 4I6XA 3E3EA 4KA0A 1SKRB 3D21A 1XOAA 4IKHA 4GLTA 3LWAA 8GSSA 4RI7A 4L0UA 2L57A 1KBNA 4MH2A 2CA8A 2H1GA 2K6VA 2OKAA 2PPTA 3O3TA 3VI5A 4OFMA 4ZIJA 3TJBA 5DAKB 2I1UA 5J5NA 3NZNA 4WETA 4LMVA 1QK8A 1EGRA 5ECIB 3GH6A 1XPVA 2X99A 1GP1A 3UIWA 3HXSA 3I9V2 4TXOB 1YKAA 3CMIA 3KH9A 3U5RE 1PX6A 5G5FA 2OJLA 5KN3A 2EIOA 1SL0B 2ZNMA 3LQ7A 4KX4A 3ZMLA 3O6TA 2OACA 2E2GA 3A2WA 5EY6A 4ZL9A 4ZL7A 3O76A 4TN8A 4OCFA 4NHZA 3BD2A 1OKDA 1ZYQB 1X0RA 2M72A 1B9XC 3M1GA 1M99A 3HJMA 2RUEA 3MAKA 4ACSA 2IWTA 3ZLPA 2YZUA 2GS3A 1NHOA 17GSA 1PKZA 4WBRD 1ON4A 5IQYA 4KAEA 4K8MA 1GSSA 3F4TA 3FYGA 1TI1A 4NPBA 5DJLA 4EC0A 3F8UA 1WIKA 1WPIA 2RUFA 4MDCA 4NV2A 2CVBA 1JFUA 2AUVA 3LGCA 4KW6A 5HFIA 1YDKA 2IMEA 2ZUPA 3OR5A 1JLVA 4GRFA 1J0FA 1SJ6A
chains in the Genus database with same CATH superfamily
3W6GA 1QFNA 3C1SA 1M2BA 3VWUA 2WVXA 4YQMA 3ERGA 2EIRA 2F9SA 4K0NA 3HJPA 3LW9A 4G2EA 4PNFA 5ECOB 4JZQA 1BX9A 4ZL8A 5J4UA 1FOVA 4J57E 1WE0A 2YZHA 5L71A 2VM2A 3UBLA 3HKRA 18GSA 4IP6A 4ZILA 12GSA 1SVOA 1HQOA 2RIIA 2H19A 4POLA 1VGLA 5IMAA 3IAS2 4OO5A 3H1NA 1U87A 2R0CA 3GN3A 2GSTA 1I1IP 1UA5A 3C8EA 1X5CA 1V98A 1YF0A 3P7XA 5LNKe 1M9BA 4K7NA 3KMNA 5IOWA 1GUKA 2LRNA 4BA7A 3KTBA 3LYKA 1YVLA 3HZ8A 3TKQA 3CBUA 3V1WA 4N11A 4F9ZA 1K3OA 3N5OA 4PXOA 3CRTA 3NOFA 4Z2RA 4CHSA 1GTAA 5A4WA 2WW1A 4ML1A 3IHQA 3UVHA 2F3MA 4V2MA 5JCWA 2B3SA 3PGTA 4POMA 2YOIA 1GUHA 4EXJA 1FW1A 4OFNA 4KSOA 4Z2UA 4IGJA 2F51A 1PRXA 3IV4A 1ML6A 2HRKA 2MBTA 2DIZA 3FZ9A 3UEMA 1BJXA 4ECCA 5A34B 2C4JA 1ILOA 2ALBA 1M9AA 2I4AA 4NWYA 5LCZA 1RQMA 1XBSA 1LBKA 1PN9A 2YN1A 1EEJA 1UVZA 4IHUA 2LRTA 4OCEA 3IC4A 4PQ1A 3N9JA 4HQZA 3MNGA 2ON7A 2HRKB 2H0GA 3LXTA 1GL8A 1TU8A 2WZSA 1GSYA 2PUKC 2B7KA 2JADA 2WULA 4MF5A 2HSNA 1GULA 1TP9A 2H1AA 2CAIA 4E8HA 4Z7XA 4BIKA 2VD0A 3QMXA 3WGDA 2EIQA 2YP6A 3CHXC 4IP1A 2O89A 4IW9A 5BMUA 1BYEA 1FB0A 2GZPA 2YCDA 3HJOA 3DVWA 2KUCA 3LG6A 1A2LA 2YWOA 2AHEA 2HFDA 2DMMA 1M0UA 4O32A 3A2XA 3ZYWA 3GA4A 2OE0A 2FA4A 1AW9A 4ZB7A 4EO3A 2HSNB 4AKHA 4IJIA 2CAQA 4PQIA 1GWCA 4RI6A 1A0RP 1WMJA 5BMUB 5CO3A 5AN1A 1B48A 1EV4A 1PL1A 2OBKA 4KB3A 2V32A 2L5LA 4MA9A 1V9WA 2GDRA 1A24A 2HLSA 2LKUA 3F6FA 3JCML 3GKNA 4AJ7A 5HR0A 2UV8G 2C3TA 3RAZA 1PD21 3D5JA 2DKHA 1GSUA 1EV9A 4O5RA 2GTUA 2IMFA 2VLVA 4MF7A 4F0BA 3LFLA 5IMCA 1URMA 5ELGA 2HSHA 2IMIA 2WCIA 4MPGA 1TXXA 4GWRA 3MSZA 2I3YA 2YJ7A 3IE3A 2VL2C 1HNAA 2LS5A 4HU9A 1GTUA 2C1YA 3M8NA 1PA3A 4WBJA 5J4YA 4K5SA 2R3XA 5ECRB 4X1UA 2X8CA 2R0PA 2H71A 4L0WA 1TU7A 3VWVA 2JU5A 1V58A 3H4KA 1O73A 1YJ6A 1FG4A 5GZZB 2C3NA 1V2AA 2YNXA 2E2MA 1SYXA 4NHWA 1XWAA 1XWKA 3KP8A 1QMVA 1J9BA 2NTOA 4ID0A 2ES7A 5C00A 1R5PA 3Q6OA 1SL2B 2BJXA 1S3DA 2KLXA 1EZKA 5G30A 3ZVJD 4IVFA 1QUWA 2UZ8A 5ABRA 4ML6A 5AISA 3WD6A 3J7Yk 5DALA 5ECPB 1YF1A 4BPYA 3DD3A 2QA1A 4KCAA 3C73A 4HZ4A 2JZTA 4G19A 4N3ZA 4ZB9A 3CYNA 3ZTLA 3GL5A 16GSA 1U3AA 1DE1A 3C71A 1ERWA 3WGEA 2H0IA 4MPFA 1XW5A 3D22A 2K8VA 2VCXA 2GSQA 2AJQB 2JSZA 4CDOA 4IQ1A 1EOHA 4TR1A 4HS1A 4I5QA 1TRWA 1EP7A 3A2VA 3UL3A 2JZRA 1ZGNA 2VM1A 2HSMA 1SKWB 1S3AA 1K0MA 1MDIA 3GIXA 5GAPD 2GZZA 1SL1B 4CW9A 3FY7A 2VAFA 2A4VA 1JHBA 1JZWA 3TCOA 1ABAA 1GTIA 4MK3A 1TI3A 2PWJA 4CY6A 3D0ZA 1H4OA 3QD9A 2X49A 4AKIA 4G0KA 2G0FA 1HNCA 1EWXA 3WT1A 2PN8A 4TR1B 2DMLA 2B5EA 5KOWA 5KN0A 2KP2A 3GRXA 3CTFA 2R37A 2HYXA 1S3CA 1YEPA 2HZFA 1KEBA 4GTUA 4KDYA 2WVZA 3MDKA 2YWNA 4HQSA 5ECNB 4K6XA 3L9UA 2LNSA 4AKGA 1XXUA 3IPZA 3IK9A 2IIYA 6GSTA 2X8GA 2EFHA 4GCIA 4MJAA 4WXTA 1OVNA 1GSEA 2XPEA 4AJ6A 3EMPA 2CZ2A 5DQSA 3A5IA 1TK8B 2QSIA 1NM3A 2RM5A 3C1RA 4KUNA 1RW1A 1R7HA 1X9WB 4HJ2A 5JCUA 3ZITA 1T4ZA 3EVIA 5B6NA 5F0GA 2X64A 4ILFA 2VLUA 5KOXA 3U6VA 1TW9A 3I43A 3BBYA 3FZAA 1I5GA 5B8BA 3CTGA 2IMDA 3FK8A 3BJ5A 5D9XA 1VF4A 2WRTA 3H93A 5F8BA 3VWWA 4YH2A 5ECMB 1OC8A 11GSA 2P31A 2GSSA 5D9VA 3BOAA 1DE2A 5IPGA 4V2LA 1E2YA 5A5KA 2JZSA 1ACVA 2PERA 4EDYA 1V57A 2C80A 5D9WA 1O6JA 4YQVA 2IFQA 3HVVA 4TKYA 3FKFA 4EKZA 5AIXA 3L78A 2DJ3A 4EL1A 2VO4A 6GSWA 5CRDA 4N0VA 3R2QA 1O7UA 1THOA 3QDNA 1OAZA 4ECBA 4ZBAA 3F3QA 4XS4B 4PHZC 1ERUA 2GT6A 2KOKA 4FYBA 1F2EA 2HQTA 2RLIA 1NHYA 1R5AA 4KNDA 4XCSA 2H6XA 2FWFA 2NDOA 3RPNA 1QXHA 1R26A 2O5VA 1KTEA 2O8VB 3TKPA 3RPPA 4K5RA 1O8XA 4K0GA 1FHEA 1B8XA 2MMAA 5A5HA 1X9MB 4XS6A 2IFQB 4POKA 3TKSE 2AB6A 9GSSA 1XZOA 1FO5A 4PGTA 2YPMA 3EWLA 1WRYA 1A2JA 2I81A 4NXIA 4OWYA 1G0TA 2MMZA 3HD5A 1B4QA 3HMJG 3VURA 2MYGA 4PI0C 3QFAC 3APOA 1VF3A 5A5HB 3GSSA 5CRHA 2YV9A 2GLRA 1O85A 4I8BA 2VIMA 2DJ2A 4J56E 3D6IA 3WGXA 2FWHA 3TJKA 3RBTA 1GLQA 4TR4A 2GQKA 2VCZA 1X5DA 1OE8A 2PU9C 2AYTA 2X8HA 4NMUA 4Q5NA 2IJYA 3FW2A 4TVEA 1T00A 3PH9A 4N10A 4ZB6A 3F4RA 4N0ZA 5DVBA 3EE2A 2DJ0A 5GAND 2I9HA 3BCIA 2MMNA 3KEBA 3ZRDA 4GXZA 2VD1A 4HUAA 5IM9A 5H5SA 2PGTA 5A34A 1JZOA 3RHCA 2RM6A 1WOUA 4IQAA 2OT3A 4BL7A 1SENA 4LL1B 4AI6A 2A2SA 4HZ2A 1Q4JA 3UMAA 4Q5FA 4KCEA 3M3MA 3Q18A 1Y1UA 1K0BA 5G1KA 2PBJA 5KN2A 2WGRA 2WW0A 3P2AA 3IK7A 2O7KA 1PL2A 2P5RA 3GX8A 5D73A 2LEGA 3AY8A 1ZL9A 1NSWA 3R3EA 3DXBA 1N2AA 2WB9A 4I97A 1XCCA 4W66A 1IYHA 4BL7B 1YQ1A 4AF2A 2V2GA 1MTCA 5A4VA 2L4CA 3ME7A 1Y25A 2B6MA 3ME8A 3ERFA 4USSA 4RUVA 1EP8A 2DJJA 2PVOC 5ECQB 3F9UA 3GKMA 1AUCA 1T8EB 1OE7A 4JR6A 3DVXA 6GSVA 4ECIA 4XTSA 1BG5A 1SJZA 2HE3A 3LYPA 3VI7A 1V40A 4ULXA 2PVQA 1GH2A 5HR1A 2HXKA 5E59A 1PSQA 1Z3EA 2NPBA 3QCPA 3IXRA 1SU9A 4PUAA 1XWBA 2XHFA 1E6BA 3GSTA 1C72A 5LD0A 3L0HA 4KDXA 5ECHB 1TK5B 2WW3A 3HDCA 3KCMA 3P90A 2FLSA 2FCHA 4ZBDA 2CVKA 1T4YA 3UBKA 5HFKA 2MZCA 1GSFA 3ZFLA 5DBQA 3EURA 1F6MC 4TOPA 1K0CA 2V41A 3ZMKA 3WYWA 3APSA 1AAZA 3ZIJA 2TRCP 5IIZA 4ZBBA 5JCGA 5IO0A 1GNEA 3TJFA 4RQXA 1F3AA 4X4JA 1K0DA 5GSSA 4IELA 4MMMA 1PN0A 4YAVA 1X9SB 3GHAA 2FA8A 1DSBA 2LNTA 3FEUA 5E4WA 3UARA 5A1NB 3QPMA 5CRGA 1CQHA 2OBIA 1B4PA 1G6WA 3TJJA 2NBSA 4OFTA 2EFEA 2GVPA 2L4QA 3IDVA 2YANA 5J3RA 4ZB8A 4KH7A 5CYYA 3FR3A 2DJ1A 1OC3A 4DVCA 3TKSC 1BAYA 1SVMA 1N25A 5IOXA 3VLNA 2VCQA 5G2ZA 4IS0A 2J9HA 2WDUA 1JZDA 3FRCA 4JBBA 4XIHA 1SD9A 4L5LA 1M3JA 2YJHA 2LJRA 1MDJA 2YWMA 1Q98A 3QAWA 1VF1A 1ZYPA 3KP9A 4DEJA 1ZOFA 2C0FA 2XBQA 1HNBA 3EC3A 2GT5A 4OO4A 4QL7A 1A0FA 3MIXA 3W8JA 1GTBA 3PPUA 1MEKA 2JSYA 4LA1A 2AAWA 5ID2B 1SK0A 4FQUA 3EYTA 4MF6A 3CSIA 1M2DA 4YKGA 5J9CA 3HVSA 2LJKA 4J2FA 2FWGA 3UOMA 1IYIA 1FB6A 2DKIA 4L8EA 4TW5A 1JZRA 4Q5QA 2C0DA 1LJRA 2HRNA 4AKXB 2VOCA 4AGSA 2QGVA 1XIYA 4BWQA 4WR5A 3GTUA 3H8QA 3QOUA 2B1LA 3IR4A 4GDFA 5H5QA 1MD3A 2L59A 3DWVA 4MZCA 2QKEA 3E9JB 4MJEA 2CX4A 3A3TA 3IAM2 4PTSA 1J08A 2WFCA 1PFOA 2DBCA 1TXUA 1Z6NA 5INYA 4E68A 2A4HA 3BCKA 5G31A 4GSTA 2LV3A 22GSA 3DRNA 2YV7A 3GTUB 5C04A 1WP0A 3G7IA 2BMXA 4KGIA 5D93A 3TDGA 4JU5A 4EE0A 2H1DA 5FHIA 4G0IA 4G01A 1JLWA 2EFCA 1SD8A 2OE1A 1PX7A 4D73B 3M9KA 2VUPA 3HHVA 5D8IA 1ST9A 1OKTA 3FZ5A 4MNNA 1ZMAA 20GSA 5ENUA 2H72A 2R4VA 1R4WA 1DBYA 3EINA 5EVOA 1G6YA 4DSRA 4GQCA 3UJ1A 2HRFA 2BTOT 3LSZA 2HSYA 4OD7A 1ERTA 3KJYA 2LTKA 4MP4A 1H75A 2A2PA 4V2NA 4F2IA 1K0NA 2VL2A 2HI7A 4ICYA 3TKSA 2WJUA 1XW6A 3Q19A 4L5OA 1S3RA 2AV4A 1YKCA 3IRAA 5ELAA 1GLPA 3F63A 3DEXA 3EU4A 5JWOB 4FYCA 3IBHA 1K0OA 4TXVA 4XS4A 4GSSA 3J7Yb 1PQNA 2MMOA 3H79A 2HZEA 4HI7A 1SJIA 1THXA 2TIRA 2B1KA 4KE3A 4YKFA 4HSCX 1WJKA 4K2DA 3EMXA 4O92A 2LQQA 5A4UA 4I2UA 4I2TA 1ZCPA 3GYKA 4H86A 1DUGA 3KIJA 3ISOA 1QGVA 1ZYEA 4PNGA 4IN0A 2DC5A 4G10A 3LJRA 3A5WA 3VFIA 1TK0B 2VLTA 1I9DA 2H6YA 2N5AA 1TJDA 4XS1A 5J40A 2XPDA 3CQFA 2HZEB 1XG8A 3TOUA 4KSMA 5DQYA 1YEWC 5CP1A 2VL3A 3TKRA 4TR0A 5G1LA 1A8LA 2WZ9A 1LU4A 3PINA 2FNOA 1ZZYA 2O3EA 3C7MA 3S9FA 1EEMA 2ZCTA 3K8NA 2H73A 1CQGA 3TRXA 1PGTA 4EUYA 2GGTA 4E8EA 1PMTA 13GSA 4BVYA 2FD3A 2L6DA 2J23A 1AIUA 1O8WA 5G5EA 4NAXA 3UAPA 1GRXA 5D9TA 19GSA 5HR2A 1FVJA 2CZ3A 5CREA 4KF9A 5DCHA 2EFDA 5IPHA 3TU3B 1SYRA 1ERVA 5F07A 4K2XA 1B9YC 5IMZA 4JRRA 1Z7PA 1TOFA 2G2QA 4MCUA 3UVTA 1HD2A 3ZFBA 1VRSD 5H5RA 4BVYB 3APQA 4WF5A 1O81A 1SKSB 3ZIVA 3M0FA 2L5OA 3CXGA 4CY8A 1XFLA 4FO5A 4EDZA 7GSSA 4X0XA 1A8YA 1YY7A 5ECSA 3GKXA 2FWEA 2H70A 5AIVA 4WR4A 2WVXB 3D4TA 5F05A 3VK9A 3GV1A 2VCWA 1X5EA 3MWHA 1Z9HA 5J4VA 1U6TA 2IPAA 3IHGA 2VL9A 3GKKA 3F4SA 2GZYA 1MDKA 1XVQA 2ON5A 2K18A 3GNJA 1G7OA 2E0QA 2VCVA 3G7YA 3WT2A 1AQXA 4MLYA 2WW2A 2V6OA 2OE3A 2H6ZA 3FZ4A 4A5PA 1EOGA 3L4NA 4KDUA 4BWSA 2TRXA 4XHMA 2N5FA 4JR4A 4DSSA 4EIQA 3KH7A 3GUSA 2O87A 1M2AA 2KP1A 2DLXA 1U88A 4FYUA 3I6AA 3TGZA 3TB2A 4MZWA 1FAAA 4WEYA 3HA9A 2L6CA 4Q5RA 1F37A 2R2JA 1UC7A 1XW9A 2LQOA 3L9VA 3GFKA 1T7PB 2FY6A 2QA2A 5HQPA 4XRAA 3HVNA 1MD4A 1SK1A 3NIVA 14GSA 5HR3A 5FWGA 2DIYA 4HEA2 3VPTA 4PQHA 4DSSB 4G0LA 5CRWA 5CAXA 3KMOA 2YWIA 2K9FA 1XWGA 4MH3A 1RK4A 5ECKB 6GSSA 3CSJA 1WWJA 2FUG2 3TRQA 5ECLB 4WF4A 3KZQA 5HFGA 1XOBA 5DDLA 1Y6EA 4F0CA 4V1Ap 4EF0A 3FMWA 2H66A 2LJAA 4V1Ag 2HT9A 3L9SA 4F03A 4YQUA 2FGXA 1TRVA 3FHKA 3G9BA 3KTLA 2N5BA 2JACA 2MBSA 3GMFA 2D2ZA 3ZVJA 2CX3A 6GSXA 2H8LA 4GSNA 3F6DA 2M46A 5A1NA 2H0HA 4LLRA 2R5GA 1USBA 1GNWA 1TDIA 5KEJA 3MYDA 4POBA 2QC7A 4FXYP 5J41A 2K8SA 5J47A 2P5QA 2WVYA 4GQFA 3QAVA 4O5QA 4AJ8A 3DYRA 2EC4A 2H1LA 3ERWA 4RQRA 5JWQB 2PMTA 4MJBA 4P3YB 3TRPA 1M3IA 4JE1A 2IN3A 3GH9A 1NW2A 2R6KA 3IC8A 1AQWA 3QAGA 1SK2A 1W89A 3IA1A 1ZYNA 2NVLA 3F3RA 3QR6A 4GF0A 1FOHA 2B5XA 4ECJA 4QQ7A 1OC9A 1K0AA 2WS2A 2V1MA 3TJGA 1U3IA 1UN2A 3P8WA 1N8JA 4N30A 1M7TA 3HZ4A 4MJCA 1Z7RA 2A2RA 3LEFA 5B6MA 4NV5A 4F82A 4YAPA 2LRCA 1A23A 4G9HA 5DJMA 3E0UA 5IMFA 5J9BA 2H74A 1G7EA 3D4MA 3SBCA 2CQ9A 1T1VA 4EVMA 5CNWA 5IMVA 4IBPA 2HNLA 4K7IA 2O36A 3QFBC 1OC9B 2F8FA 2LSTA 3G7JA 4BVXA 1TRUA 3VPQA 4QL9A 4LMWA 5IMDA 1AXDA 2XBIA 1GUMA 3FR9A 5ID2A 1GSQA 4K7OA 1QQ2A 1F9MA 4MABA 3GURA 6GSYA 3KD0A 1GSDA 3HYPA 4PURA 3US3A 3ZREA 3ED3A 5DCGA 2B7JA 4ISDA 2H30A 3ZL5A 5AGYA 2C0GA 3RDWA 5GSTA 5EL8A 2CT6A 4HOJA 3Q74A 4ZXGA 4TR3A 2H76A 3PR8A 1F3BA 2C0EA 4BVXB 4PX1A 3CWGA 1BG1A 1T3BA 4K9ZA 1EGOA 3HY2A 1BEDA 2IMKA 3FR6A 4TRXA 4HDEA 3ZZXA 2REMA 3DMLA 3RGBC 2F8AA 2O85A 2CV4A 3CRUA 3IOSA 5JWRB 2OADA 3LXZA 6GSUA 5IO2A 2GSRA 2V6KA 3KXOA 3SWLA 3RHBA 4HU7A 3F0IA 1XWCA 5B8AA 4JEDA 1Z5YE 2B5YA 4X43A 1S4BP 3I69A 2JL4A 1TRSA 4LL4B 1TTZA 1YZXA 1TKDB 4DSQA 2GQMA 1SVLA 4K1FA 5FT3A 1XVWA 1KNGA 5B7CA 4FH8A 5DALB 4MZBA 3VWXA 2KHPA 4O7HA 1BF5A 4OMVA 2X4AA 1VF2A 2GQLA 4D73A 2CVDA 2C8UA 5EPFA 5BRTA 1Z6MA 1W4VA 3GX0A 1A2MA 4EIPA 2H1BA 4FIWA 3GL3A 1PKWA 5COHA 2DSAA 1AQVA 2H75A 1BQ7A 2HRAA 2E7PA 2IL3A 2OA7A 2LUSA 5F06A 4PUFC 10GSA 1HYUA 1OYJA 3TUEA 2HSMB 2Z9SA 5D96A 3KGKA 3DGQA 4Z2TA 3CSHA 4IJ3A 3W8SA 1K3YA 1AC1A 2DJKA 3DIEA 1FVKA 3EU3A 2XC2A 2FHEA 5KN1A 3M9JA 5DAKA 4WKWA 2H01A 2M80A 3DKSA 2P0GA 3LORA 2C3QA 3KM6A 1YEXA 4HJMA 2VCTA 4TXOA 4XRDA 3TOTA 4O5UA 3HCZA 3HVXA 2VKZG 1K3LA 4I6XA 3E3EA 4KA0A 1SKRB 3D21A 1XOAA 4IKHA 4GLTA 3LWAA 8GSSA 4RI7A 4L0UA 2L57A 1KBNA 4MH2A 2CA8A 2H1GA 2K6VA 2OKAA 2PPTA 3O3TA 3VI5A 4OFMA 4ZIJA 3TJBA 5DAKB 2I1UA 5J5NA 3NZNA 4WETA 4LMVA 3RFRC 1QK8A 1EGRA 5ECIB 3GH6A 1XPVA 2X99A 1GP1A 3UIWA 3HXSA 3I9V2 4TXOB 1YKAA 3CMIA 3KH9A 3U5RE 1PX6A 5G5FA 2OJLA 5KN3A 2EIOA 1SL0B 2ZNMA 3LQ7A 4KX4A 3ZMLA 3O6TA 4QMKA 2OACA 2E2GA 3A2WA 5EY6A 4ZL9A 4PI2C 4ZL7A 3O76A 4TN8A 4OCFA 4NHZA 3BD2A 1OKDA 1ZYQB 1X0RA 2M72A 1B9XC 3M1GA 1M99A 3HJMA 2RUEA 3MAKA 4ACSA 2IWTA 3ZLPA 2YZUA 2GS3A 1NHOA 17GSA 1PKZA 4WBRD 1ON4A 5IQYA 4KAEA 4K8MA 1GSSA 3F4TA 3FYGA 1TI1A 4NPBA 5DJLA 2R0GA 4EC0A 3F8UA 1WIKA 1WPIA 2RUFA 3EPTA 4MDCA 4NV2A 2CVBA 1JFUA 2AUVA 3LGCA 4KW6A 5HFIA 1YDKA 2IMEA 2ZUPA 3OR5A 1JLVA 4GRFA 1J0FA 1SJ6A
chains in the Genus database with same CATH topology
3W6GA 1QFNA 3C1SA 1M2BA 3VWUA 4YQMA 3ERGA 2EIRA 2F9SA 4K0NA 3HJPA 3LW9A 4G2EA 4PNFA 5ECOB 4JZQA 1BX9A 4ZL8A 5J4UA 1FOVA 4J57E 1WE0A 2YZHA 5L71A 2VM2A 3UBLA 3HKRA 18GSA 4IP6A 4ZILA 12GSA 1SVOA 1HQOA 2RIIA 2H19A 4POLA 1VGLA 5IMAA 3IAS2 4OO5A 3H1NA 1U87A 2R0CA 3GN3A 2GSTA 1UA5A 3C8EA 1X5CA 1V98A 1YF0A 3P7XA 5LNKe 1M9BA 4K7NA 3KMNA 5IOWA 1GUKA 2LRNA 4BA7A 3KTBA 3LYKA 1YVLA 3HZ8A 3TKQA 3CBUA 3V1WA 4N11A 4F9ZA 1K3OA 3N5OA 4PXOA 3CRTA 3NOFA 4Z2RA 4CHSA 1GTAA 5A4WA 4ML1A 3IHQA 3UVHA 2F3MA 4V2MA 5JCWA 2B3SA 3PGTA 4POMA 2YOIA 1GUHA 4EXJA 1FW1A 4OFNA 4KSOA 4Z2UA 4IGJA 2F51A 1PRXA 3IV4A 1ML6A 2HRKA 2MBTA 2DIZA 3FZ9A 3UEMA 1BJXA 4ECCA 5A34B 2C4JA 1ILOA 2ALBA 1M9AA 2I4AA 4NWYA 5LCZA 1RQMA 1XBSA 1LBKA 1PN9A 2YN1A 1EEJA 1UVZA 4IHUA 2LRTA 4OCEA 3IC4A 4PQ1A 3N9JA 4HQZA 3MNGA 2ON7A 2HRKB 2H0GA 3LXTA 1GL8A 1TU8A 1GSYA 2PUKC 2B7KA 2JADA 2WULA 4MF5A 2HSNA 1GULA 1TP9A 2H1AA 2CAIA 4E8HA 4Z7XA 2VD0A 3QMXA 3WGDA 2EIQA 2YP6A 4IP1A 2O89A 4IW9A 5BMUA 1BYEA 1FB0A 2GZPA 2YCDA 3HJOA 3DVWA 2KUCA 3LG6A 1A2LA 2YWOA 2AHEA 2HFDA 2DMMA 1M0UA 4O32A 3A2XA 3ZYWA 3GA4A 2OE0A 2FA4A 1AW9A 4ZB7A 4EO3A 2HSNB 4AKHA 4IJIA 2CAQA 4PQIA 1GWCA 4RI6A 1A0RP 1WMJA 5BMUB 5CO3A 5AN1A 1B48A 1EV4A 1PL1A 2OBKA 4KB3A 2V32A 2L5LA 4MA9A 1V9WA 2GDRA 1A24A 2HLSA 2LKUA 3F6FA 3JCML 3GKNA 4AJ7A 5HR0A 2UV8G 2C3TA 3RAZA 1PD21 3D5JA 2DKHA 1GSUA 1EV9A 4O5RA 2GTUA 2IMFA 2VLVA 4MF7A 4F0BA 3LFLA 5IMCA 1URMA 5ELGA 2HSHA 2IMIA 2WCIA 4MPGA 1TXXA 4GWRA 3MSZA 2I3YA 2YJ7A 3IE3A 2VL2C 1HNAA 2LS5A 4HU9A 1GTUA 2C1YA 3M8NA 1PA3A 4WBJA 5J4YA 4K5SA 2R3XA 5ECRB 4X1UA 2X8CA 2R0PA 2H71A 4L0WA 1TU7A 3VWVA 2JU5A 1V58A 3H4KA 1O73A 1YJ6A 1FG4A 5GZZB 2C3NA 1V2AA 2YNXA 2E2MA 1SYXA 4NHWA 1XWAA 1XWKA 3KP8A 1QMVA 1J9BA 2NTOA 4ID0A 2ES7A 5C00A 1R5PA 3Q6OA 1SL2B 2BJXA 1S3DA 2KLXA 1EZKA 5G30A 3ZVJD 4IVFA 1QUWA 2UZ8A 5ABRA 4ML6A 5AISA 3WD6A 3J7Yk 5DALA 5ECPB 1YF1A 4BPYA 3DD3A 2QA1A 4KCAA 3C73A 4HZ4A 2JZTA 4G19A 4N3ZA 4ZB9A 3CYNA 3ZTLA 3GL5A 16GSA 1U3AA 1DE1A 3C71A 1ERWA 3WGEA 2H0IA 4MPFA 1XW5A 3D22A 2K8VA 2VCXA 2GSQA 2AJQB 2JSZA 4CDOA 4IQ1A 1EOHA 4TR1A 4HS1A 4I5QA 1TRWA 1EP7A 3A2VA 3UL3A 2JZRA 1ZGNA 2VM1A 2HSMA 1SKWB 1S3AA 1K0MA 1MDIA 3GIXA 5GAPD 2GZZA 1SL1B 4CW9A 3FY7A 2VAFA 2A4VA 1JHBA 1JZWA 3TCOA 1ABAA 1GTIA 4MK3A 1TI3A 2PWJA 4CY6A 3D0ZA 1H4OA 3QD9A 2X49A 4AKIA 4G0KA 2G0FA 1HNCA 1EWXA 3WT1A 2PN8A 4TR1B 2DMLA 2B5EA 5KOWA 5KN0A 2KP2A 3GRXA 3CTFA 2R37A 2HYXA 1S3CA 1YEPA 2HZFA 1KEBA 4GTUA 4KDYA 3MDKA 2YWNA 4HQSA 5ECNB 4K6XA 3L9UA 2LNSA 4AKGA 1XXUA 3IPZA 3IK9A 2IIYA 6GSTA 2X8GA 2EFHA 4GCIA 4MJAA 4WXTA 1OVNA 1GSEA 2XPEA 4AJ6A 3EMPA 2CZ2A 5DQSA 3A5IA 1TK8B 2QSIA 1NM3A 2RM5A 3C1RA 4KUNA 1RW1A 1R7HA 1X9WB 4HJ2A 5JCUA 3ZITA 1T4ZA 3EVIA 5B6NA 5F0GA 2X64A 4ILFA 2VLUA 5KOXA 3U6VA 1TW9A 3I43A 3BBYA 3FZAA 1I5GA 5B8BA 3CTGA 2IMDA 3FK8A 3BJ5A 5D9XA 1VF4A 2WRTA 3H93A 5F8BA 3VWWA 4YH2A 5ECMB 1OC8A 11GSA 2P31A 2GSSA 5D9VA 3BOAA 1DE2A 5IPGA 4V2LA 1E2YA 5A5KA 2JZSA 1ACVA 2PERA 4EDYA 1V57A 2C80A 5D9WA 1O6JA 4YQVA 2IFQA 3HVVA 4TKYA 3FKFA 4EKZA 5AIXA 3L78A 2DJ3A 4EL1A 2VO4A 6GSWA 5CRDA 4N0VA 3R2QA 1O7UA 1THOA 3QDNA 1OAZA 4ECBA 4ZBAA 3F3QA 4XS4B 1ERUA 2GT6A 2KOKA 4FYBA 1F2EA 2HQTA 2RLIA 1NHYA 1R5AA 4KNDA 4XCSA 2H6XA 2FWFA 2NDOA 3RPNA 1QXHA 1R26A 2O5VA 1KTEA 2O8VB 3TKPA 3RPPA 4K5RA 1O8XA 4K0GA 1FHEA 1B8XA 2MMAA 5A5HA 1X9MB 4XS6A 2IFQB 4POKA 3TKSE 2AB6A 9GSSA 1XZOA 1FO5A 4PGTA 2YPMA 3EWLA 1WRYA 1A2JA 2I81A 4NXIA 4OWYA 1G0TA 2MMZA 3HD5A 1B4QA 3HMJG 3VURA 2MYGA 3QFAC 3APOA 1VF3A 5A5HB 3GSSA 5CRHA 2YV9A 2GLRA 1O85A 4I8BA 2VIMA 2DJ2A 4J56E 3D6IA 3WGXA 2FWHA 3TJKA 3RBTA 1GLQA 4TR4A 2GQKA 2VCZA 1X5DA 1OE8A 2PU9C 2AYTA 2X8HA 4NMUA 4Q5NA 2IJYA 3FW2A 4TVEA 1T00A 3PH9A 4N10A 4ZB6A 3F4RA 4N0ZA 5DVBA 3EE2A 2DJ0A 5GAND 2I9HA 3BCIA 2MMNA 3KEBA 3ZRDA 4GXZA 2VD1A 4HUAA 5IM9A 5H5SA 2PGTA 5A34A 1JZOA 3RHCA 2RM6A 1WOUA 4IQAA 2OT3A 4BL7A 1SENA 4LL1B 4AI6A 2A2SA 4HZ2A 1Q4JA 3UMAA 4Q5FA 4KCEA 3M3MA 3Q18A 1Y1UA 1K0BA 5G1KA 2PBJA 5KN2A 2WGRA 3P2AA 3IK7A 2O7KA 1PL2A 2P5RA 3GX8A 5D73A 2LEGA 3AY8A 1ZL9A 1NSWA 3R3EA 3DXBA 1N2AA 2WB9A 4I97A 1XCCA 4W66A 1IYHA 4BL7B 1YQ1A 4AF2A 2V2GA 1MTCA 5A4VA 2L4CA 3ME7A 1Y25A 2B6MA 3ME8A 3ERFA 4USSA 4RUVA 1EP8A 2DJJA 2PVOC 5ECQB 3F9UA 3GKMA 1AUCA 1T8EB 1OE7A 4JR6A 3DVXA 6GSVA 4ECIA 4XTSA 1BG5A 1SJZA 2HE3A 3LYPA 3VI7A 1V40A 4ULXA 2PVQA 1GH2A 5HR1A 2HXKA 5E59A 1PSQA 1Z3EA 2NPBA 3QCPA 3IXRA 1SU9A 4PUAA 1XWBA 2XHFA 1E6BA 3GSTA 1C72A 5LD0A 3L0HA 4KDXA 5ECHB 1TK5B 3HDCA 3KCMA 3P90A 2FLSA 2FCHA 4ZBDA 2CVKA 1T4YA 3UBKA 5HFKA 2MZCA 1GSFA 3ZFLA 5DBQA 3EURA 1F6MC 4TOPA 1K0CA 2V41A 3ZMKA 3WYWA 3APSA 1AAZA 3ZIJA 2TRCP 5IIZA 4ZBBA 5JCGA 5IO0A 1GNEA 3TJFA 4RQXA 1F3AA 4X4JA 1K0DA 5GSSA 4IELA 4MMMA 1PN0A 4YAVA 1X9SB 3GHAA 2FA8A 1DSBA 2LNTA 3FEUA 5E4WA 3UARA 5A1NB 3QPMA 5CRGA 1CQHA 2OBIA 1B4PA 1G6WA 3TJJA 2NBSA 4OFTA 2EFEA 2GVPA 2L4QA 3IDVA 2YANA 5J3RA 4ZB8A 4KH7A 5CYYA 3FR3A 2DJ1A 1OC3A 4DVCA 3TKSC 1BAYA 1SVMA 1N25A 5IOXA 3VLNA 2VCQA 5G2ZA 4IS0A 2J9HA 2WDUA 1JZDA 3FRCA 4JBBA 4XIHA 1SD9A 4L5LA 2YJHA 2LJRA 1MDJA 2YWMA 1Q98A 3QAWA 1VF1A 1ZYPA 3KP9A 4DEJA 1ZOFA 2C0FA 2XBQA 1HNBA 3EC3A 2GT5A 4OO4A 4QL7A 1A0FA 3MIXA 3W8JA 1GTBA 3PPUA 1MEKA 2JSYA 4LA1A 2AAWA 5ID2B 1SK0A 4FQUA 3EYTA 4MF6A 3CSIA 1M2DA 4YKGA 5J9CA 3HVSA 2LJKA 4J2FA 2FWGA 3UOMA 1IYIA 1FB6A 2DKIA 4L8EA 4TW5A 1JZRA 4Q5QA 2C0DA 1LJRA 2HRNA 4AKXB 2VOCA 4AGSA 2QGVA 1XIYA 4BWQA 4WR5A 3GTUA 3H8QA 3QOUA 2B1LA 3IR4A 4GDFA 5H5QA 1MD3A 2L59A 3DWVA 4MZCA 2QKEA 3E9JB 4MJEA 2CX4A 3A3TA 3IAM2 4PTSA 1J08A 2WFCA 2DBCA 1TXUA 1Z6NA 5INYA 4E68A 2A4HA 3BCKA 5G31A 4GSTA 2LV3A 22GSA 3DRNA 2YV7A 3GTUB 5C04A 1WP0A 3G7IA 2BMXA 4KGIA 5D93A 3TDGA 4JU5A 4EE0A 2H1DA 5FHIA 4G0IA 4G01A 1JLWA 2EFCA 1SD8A 2OE1A 1PX7A 4D73B 3M9KA 2VUPA 3HHVA 5D8IA 1ST9A 1OKTA 3FZ5A 4MNNA 1ZMAA 20GSA 5ENUA 2H72A 2R4VA 1R4WA 1DBYA 3EINA 5EVOA 1G6YA 4DSRA 4GQCA 3UJ1A 2HRFA 2BTOT 3LSZA 2HSYA 4OD7A 1ERTA 3KJYA 2LTKA 4MP4A 1H75A 2A2PA 4V2NA 4F2IA 1K0NA 2VL2A 2HI7A 4ICYA 3TKSA 2WJUA 1XW6A 3Q19A 4L5OA 2AV4A 1YKCA 3IRAA 5ELAA 1GLPA 3F63A 3DEXA 3EU4A 5JWOB 4FYCA 3IBHA 1K0OA 4TXVA 4XS4A 4GSSA 3J7Yb 1PQNA 2MMOA 3H79A 2HZEA 4HI7A 1SJIA 1THXA 2TIRA 2B1KA 4KE3A 4YKFA 1WJKA 4K2DA 3EMXA 4O92A 2LQQA 5A4UA 4I2UA 4I2TA 1ZCPA 3GYKA 4H86A 1DUGA 3KIJA 3ISOA 1QGVA 1ZYEA 4PNGA 4IN0A 2DC5A 4G10A 3LJRA 3A5WA 3VFIA 1TK0B 2VLTA 1I9DA 2H6YA 2N5AA 1TJDA 4XS1A 5J40A 2XPDA 2HZEB 3TOUA 4KSMA 5DQYA 5CP1A 3TKRA 2VL3A 4TR0A 5G1LA 1A8LA 2WZ9A 1LU4A 3PINA 2FNOA 1ZZYA 3C7MA 3S9FA 1EEMA 2ZCTA 3K8NA 2H73A 1CQGA 3TRXA 1PGTA 4EUYA 2GGTA 4E8EA 1PMTA 13GSA 4BVYA 2FD3A 2L6DA 2J23A 1AIUA 1O8WA 5G5EA 4NAXA 3UAPA 1GRXA 5D9TA 19GSA 5HR2A 1FVJA 2CZ3A 5CREA 4KF9A 5DCHA 2EFDA 5IPHA 3TU3B 1SYRA 1ERVA 5F07A 4K2XA 1B9YC 5IMZA 4JRRA 1Z7PA 1TOFA 2G2QA 4MCUA 3UVTA 1HD2A 3ZFBA 1VRSD 5H5RA 4BVYB 3APQA 4WF5A 1O81A 1SKSB 3ZIVA 3M0FA 2L5OA 3CXGA 4CY8A 1XFLA 4FO5A 4EDZA 7GSSA 4X0XA 1A8YA 1YY7A 5ECSA 3GKXA 2FWEA 2H70A 5AIVA 4WR4A 3D4TA 5F05A 3VK9A 3GV1A 2VCWA 1X5EA 3MWHA 1Z9HA 5J4VA 1U6TA 2IPAA 3IHGA 2VL9A 3GKKA 3F4SA 2GZYA 1MDKA 1XVQA 2ON5A 2K18A 3GNJA 1G7OA 2E0QA 2VCVA 3G7YA 3WT2A 1AQXA 4MLYA 2V6OA 2OE3A 2H6ZA 3FZ4A 4A5PA 1EOGA 3L4NA 4KDUA 4BWSA 2TRXA 4XHMA 2N5FA 4JR4A 4DSSA 4EIQA 3KH7A 3GUSA 2O87A 1M2AA 2KP1A 2DLXA 1U88A 4FYUA 3I6AA 3TGZA 3TB2A 4MZWA 1FAAA 4WEYA 3HA9A 2L6CA 4Q5RA 1F37A 2R2JA 1UC7A 1XW9A 2LQOA 3L9VA 3GFKA 1T7PB 2FY6A 2QA2A 5HQPA 4XRAA 1MD4A 1SK1A 3NIVA 14GSA 5HR3A 5FWGA 2DIYA 4HEA2 3VPTA 4PQHA 4DSSB 4G0LA 5CRWA 5CAXA 3KMOA 2YWIA 2K9FA 1XWGA 4MH3A 1RK4A 5ECKB 6GSSA 3CSJA 1WWJA 2FUG2 3TRQA 5ECLB 4WF4A 3KZQA 5HFGA 1XOBA 5DDLA 1Y6EA 4F0CA 4V1Ap 4EF0A 3FMWA 2H66A 2LJAA 4V1Ag 2HT9A 3L9SA 4F03A 4YQUA 2FGXA 1TRVA 3FHKA 3G9BA 3KTLA 2N5BA 2JACA 2MBSA 3GMFA 2D2ZA 3ZVJA 2CX3A 6GSXA 2H8LA 4GSNA 3F6DA 2M46A 5A1NA 2H0HA 4LLRA 2R5GA 1USBA 1GNWA 1TDIA 5KEJA 3MYDA 4POBA 2QC7A 5J41A 2K8SA 5J47A 2P5QA 4GQFA 3QAVA 4O5QA 4AJ8A 3DYRA 2EC4A 2H1LA 3ERWA 4RQRA 5JWQB 2PMTA 4MJBA 4P3YB 3TRPA 4JE1A 2IN3A 3GH9A 1NW2A 2R6KA 3IC8A 1AQWA 3QAGA 1SK2A 1W89A 3IA1A 1ZYNA 2NVLA 3F3RA 3QR6A 4GF0A 1FOHA 2B5XA 4ECJA 4QQ7A 1OC9A 1K0AA 2WS2A 2V1MA 3TJGA 1U3IA 1UN2A 3P8WA 1N8JA 4N30A 1M7TA 3HZ4A 4MJCA 1Z7RA 2A2RA 3LEFA 5B6MA 4NV5A 4F82A 4YAPA 2LRCA 1A23A 4G9HA 5DJMA 3E0UA 5IMFA 5J9BA 2H74A 1G7EA 3D4MA 3SBCA 2CQ9A 1T1VA 4EVMA 5CNWA 5IMVA 4IBPA 2HNLA 4K7IA 3QFBC 1OC9B 2F8FA 2LSTA 3G7JA 4BVXA 1TRUA 3VPQA 4QL9A 4LMWA 5IMDA 1AXDA 2XBIA 1GUMA 3FR9A 5ID2A 1GSQA 4K7OA 1QQ2A 1F9MA 4MABA 3GURA 6GSYA 3KD0A 1GSDA 3HYPA 4PURA 3US3A 3ZREA 3ED3A 5DCGA 2B7JA 4ISDA 2H30A 3ZL5A 5AGYA 2C0GA 3RDWA 5GSTA 5EL8A 2CT6A 4HOJA 3Q74A 4ZXGA 4TR3A 2H76A 3PR8A 1F3BA 2C0EA 4BVXB 4PX1A 3CWGA 1BG1A 1T3BA 4K9ZA 1EGOA 3HY2A 1BEDA 2IMKA 3FR6A 4TRXA 4HDEA 3ZZXA 2REMA 3DMLA 2F8AA 2O85A 2CV4A 3CRUA 3IOSA 5JWRB 2OADA 3LXZA 6GSUA 5IO2A 2GSRA 2V6KA 3KXOA 3SWLA 3RHBA 4HU7A 3F0IA 1XWCA 5B8AA 4JEDA 1Z5YE 2B5YA 4X43A 3I69A 2JL4A 1TRSA 4LL4B 1TTZA 1YZXA 1TKDB 4DSQA 2GQMA 1SVLA 4K1FA 5FT3A 1XVWA 1KNGA 5B7CA 4FH8A 5DALB 4MZBA 3VWXA 2KHPA 4O7HA 1BF5A 4OMVA 2X4AA 1VF2A 2GQLA 4D73A 2CVDA 2C8UA 5EPFA 5BRTA 1Z6MA 1W4VA 3GX0A 1A2MA 4EIPA 2H1BA 4FIWA 3GL3A 1PKWA 5COHA 2DSAA 1AQVA 2H75A 1BQ7A 2HRAA 2E7PA 2IL3A 2OA7A 2LUSA 5F06A 4PUFC 10GSA 1HYUA 1OYJA 3TUEA 2HSMB 2Z9SA 5D96A 3KGKA 3DGQA 4Z2TA 3CSHA 4IJ3A 3W8SA 1K3YA 1AC1A 2DJKA 3DIEA 1FVKA 3EU3A 2XC2A 2FHEA 5KN1A 3M9JA 5DAKA 4WKWA 2H01A 2M80A 3DKSA 2P0GA 3LORA 2C3QA 3KM6A 1YEXA 4HJMA 2VCTA 4TXOA 4XRDA 3TOTA 4O5UA 3HCZA 3HVXA 2VKZG 1K3LA 4I6XA 3E3EA 4KA0A 1SKRB 3D21A 1XOAA 4IKHA 4GLTA 3LWAA 8GSSA 4RI7A 4L0UA 2L57A 1KBNA 4MH2A 2CA8A 2H1GA 2K6VA 2OKAA 2PPTA 3O3TA 3VI5A 4OFMA 4ZIJA 3TJBA 5DAKB 2I1UA 5J5NA 3NZNA 4WETA 4LMVA 1QK8A 1EGRA 5ECIB 3GH6A 1XPVA 2X99A 1GP1A 3UIWA 3HXSA 3I9V2 4TXOB 1YKAA 3CMIA 3KH9A 3U5RE 1PX6A 5G5FA 2OJLA 5KN3A 2EIOA 1SL0B 2ZNMA 3LQ7A 4KX4A 3ZMLA 3O6TA 4QMKA 2OACA 2E2GA 3A2WA 5EY6A 4ZL9A 4ZL7A 3O76A 4TN8A 4OCFA 4NHZA 3BD2A 1OKDA 1ZYQB 1X0RA 2M72A 1B9XC 3M1GA 1M99A 3HJMA 2RUEA 3MAKA 4ACSA 2IWTA 3ZLPA 2YZUA 2GS3A 1NHOA 17GSA 1PKZA 4WBRD 1ON4A 5IQYA 4KAEA 4K8MA 1GSSA 3F4TA 3FYGA 1TI1A 4NPBA 5DJLA 2R0GA 4EC0A 3F8UA 1WIKA 1WPIA 2RUFA 3EPTA 4MDCA 4NV2A 2CVBA 1JFUA 2AUVA 3LGCA 4KW6A 5HFIA 1YDKA 2IMEA 2ZUPA 3OR5A 1JLVA 4GRFA 1J0FA 1SJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6G A;  1QFN A;  3C1S A;  1M2B A;  3VWU A;  4YQM A;  3ERG A;  2EIR A;  2F9S A;  4K0N A;  3HJP A;  4G2E A;  4PNF A;  5ECO B;  4JZQ A;  1BX9 A;  4ZL8 A;  5J4U A;  1FOV A;  4J57 E;  1WE0 A;  2YZH A;  5L71 A;  2VM2 A;  3UBL A;  3HKR A;  18GS A;  4IP6 A;  4ZIL A;  12GS A;  1HQO A;  2RII A;  2H19 A;  4POL A;  1VGL A;  5IMA A;  3IAS 2;  4OO5 A;  3H1N A;  1U87 A;  3GN3 A;  2GST A;  1UA5 A;  3C8E A;  1X5C A;  1V98 A;  1YF0 A;  3P7X A;  5LNK e;  1M9B A;  4K7N A;  3KMN A;  5IOW A;  1GUK A;  2LRN A;  4BA7 A;  3KTB A;  3LYK A;  3HZ8 A;  3TKQ A;  3CBU A;  3V1W A;  4N11 A;  4F9Z A;  1K3O A;  3N5O A;  4PXO A;  3CRT A;  3NOF A;  4CHS A;  1GTA A;  5A4W A;  4ML1 A;  3IHQ A;  3UVH A;  2F3M A;  4V2M A;  5JCW A;  2B3S A;  3PGT A;  4POM A;  2YOI A;  1GUH A;  4EXJ A;  1FW1 A;  4OFN A;  4KSO A;  4IGJ A;  2F51 A;  1PRX A;  3IV4 A;  1ML6 A;  2HRK A;  2MBT A;  2DIZ A;  3FZ9 A;  3UEM A;  1BJX A;  4ECC A;  2C4J A;  1ILO A;  2ALB A;  1M9A A;  2I4A A;  4NWY A;  5LCZ A;  1RQM A;  1XBS A;  1LBK A;  1PN9 A;  2YN1 A;  1EEJ A;  1UVZ A;  4IHU A;  2LRT A;  4OCE A;  3IC4 A;  4PQ1 A;  3N9J A;  4HQZ A;  3MNG A;  2ON7 A;  2HRK B;  2H0G A;  3LXT A;  1GL8 A;  1TU8 A;  1GSY A;  2PUK C;  2B7K A;  2JAD A;  2WUL A;  4MF5 A;  1GUL A;  1TP9 A;  2H1A A;  2CAI A;  4E8H A;  4Z7X A;  2VD0 A;  3QMX A;  3WGD A;  2EIQ A;  2YP6 A;  4IP1 A;  2O89 A;  4IW9 A;  5BMU A;  1BYE A;  1FB0 A;  2GZP A;  2YCD A;  3HJO A;  3DVW A;  2KUC A;  3LG6 A;  1A2L A;  2YWO A;  2AHE A;  2HFD A;  2DMM A;  1M0U A;  4O32 A;  3A2X A;  3ZYW A;  3GA4 A;  2OE0 A;  2FA4 A;  1AW9 A;  4EO3 A;  2HSN B;  4IJI A;  2CAQ A;  4PQI A;  1GWC A;  4RI6 A;  1A0R P;  1WMJ A;  5CO3 A;  5AN1 A;  1B48 A;  1EV4 A;  1PL1 A;  2OBK A;  4KB3 A;  2V32 A;  2L5L A;  4MA9 A;  1V9W A;  2GDR A;  1A24 A;  2HLS A;  2LKU A;  3F6F A;  3JCM L;  3GKN A;  4AJ7 A;  5HR0 A;  2C3T A;  3RAZ A;  1PD2 1;  3D5J A;  1GSU A;  1EV9 A;  4O5R A;  2GTU A;  2IMF A;  2VLV A;  4MF7 A;  4F0B A;  3LFL A;  5IMC A;  1URM A;  5ELG A;  2HSH A;  2IMI A;  2WCI A;  4MPG A;  1TXX A;  4GWR A;  3MSZ A;  2I3Y A;  2YJ7 A;  3IE3 A;  2VL2 C;  1HNA A;  2LS5 A;  4HU9 A;  1GTU A;  2C1Y A;  3M8N A;  1PA3 A;  4WBJ A;  2R3X A;  5ECR B;  4X1U A;  2X8C A;  2H71 A;  4L0W A;  1TU7 A;  3VWV A;  2JU5 A;  1V58 A;  3H4K A;  1O73 A;  1YJ6 A;  1FG4 A;  5GZZ B;  2C3N A;  1V2A A;  2YNX A;  2E2M A;  1SYX A;  4NHW A;  1XWA A;  1XWK A;  3KP8 A;  1QMV A;  1J9B A;  2NTO A;  4ID0 A;  2ES7 A;  5C00 A;  1R5P A;  3Q6O A;  1SL2 B;  2BJX A;  1S3D A;  2KLX A;  1EZK A;  5G30 A;  3ZVJ D;  4IVF A;  1QUW A;  2UZ8 A;  5ABR A;  4ML6 A;  5AIS A;  3WD6 A;  3J7Y k;  5DAL A;  5ECP B;  1YF1 A;  4BPY A;  3DD3 A;  4KCA A;  3C73 A;  4HZ4 A;  2JZT A;  4G19 A;  4ZB9 A;  3CYN A;  3ZTL A;  3GL5 A;  16GS A;  1U3A A;  1DE1 A;  3C71 A;  1ERW A;  3WGE A;  2H0I A;  4MPF A;  1XW5 A;  3D22 A;  2K8V A;  2VCX A;  2GSQ A;  2AJQ B;  2JSZ A;  4CDO A;  4IQ1 A;  1EOH A;  4TR1 A;  4HS1 A;  4I5Q A;  1TRW A;  1EP7 A;  3A2V A;  3UL3 A;  2JZR A;  1ZGN A;  2VM1 A;  2HSM A;  1SKW B;  1S3A A;  1K0M A;  1MDI A;  3GIX A;  5GAP D;  2GZZ A;  1SL1 B;  4CW9 A;  3FY7 A;  2VAF A;  2A4V A;  1JHB A;  1JZW A;  3TCO A;  1ABA A;  1GTI A;  4MK3 A;  1TI3 A;  2PWJ A;  3D0Z A;  1H4O A;  3QD9 A;  4G0K A;  2G0F A;  1HNC A;  1EWX A;  3WT1 A;  2PN8 A;  4TR1 B;  2DML A;  2B5E A;  5KN0 A;  2KP2 A;  3GRX A;  3CTF A;  2R37 A;  2HYX A;  1S3C A;  1YEP A;  2HZF A;  1KEB A;  4GTU A;  4KDY A;  3MDK A;  2YWN A;  4HQS A;  5ECN B;  4K6X A;  3L9U A;  2LNS A;  1XXU A;  3IPZ A;  3IK9 A;  2IIY A;  6GST A;  2X8G A;  4GCI A;  4MJA A;  4WXT A;  1OVN A;  1GSE A;  2XPE A;  4AJ6 A;  3EMP A;  2CZ2 A;  5DQS A;  1TK8 B;  2QSI A;  1NM3 A;  2RM5 A;  3C1R A;  4KUN A;  1RW1 A;  1R7H A;  1X9W B;  4HJ2 A;  5JCU A;  3ZIT A;  1T4Z A;  3EVI A;  5B6N A;  5F0G A;  2X64 A;  4ILF A;  2VLU A;  3U6V A;  1TW9 A;  3I43 A;  3BBY A;  3FZA A;  1I5G A;  5B8B A;  3CTG A;  2IMD A;  3FK8 A;  3BJ5 A;  5D9X A;  1VF4 A;  2WRT A;  3H93 A;  5F8B A;  3VWW A;  4YH2 A;  5ECM B;  1OC8 A;  11GS A;  2P31 A;  2GSS A;  5D9V A;  3BOA A;  1DE2 A;  5IPG A;  4V2L A;  1E2Y A;  5A5K A;  2JZS A;  1ACV A;  2PER A;  4EDY A;  1V57 A;  2C80 A;  5D9W A;  1O6J A;  4YQV A;  2IFQ A;  3HVV A;  4TKY A;  3FKF A;  4EKZ A;  5AIX A;  3L78 A;  2DJ3 A;  4EL1 A;  2VO4 A;  6GSW A;  5CRD A;  4N0V A;  3R2Q A;  1O7U A;  1THO A;  3QDN A;  1OAZ A;  4ECB A;  4ZBA A;  3F3Q A;  4XS4 B;  1ERU A;  2GT6 A;  2KOK A;  4FYB A;  1F2E A;  2HQT A;  2RLI A;  1NHY A;  1R5A A;  4KND A;  4XCS A;  2H6X A;  2FWF A;  2NDO A;  3RPN A;  1QXH A;  1R26 A;  1KTE A;  2O8V B;  3TKP A;  3RPP A;  1O8X A;  4K0G A;  1FHE A;  1B8X A;  2MMA A;  1X9M B;  4XS6 A;  2IFQ B;  4POK A;  3TKS E;  2AB6 A;  9GSS A;  1XZO A;  1FO5 A;  4PGT A;  2YPM A;  3EWL A;  1WRY A;  1A2J A;  2I81 A;  4NXI A;  4OWY A;  1G0T A;  2MMZ A;  3HD5 A;  1B4Q A;  3VUR A;  2MYG A;  3QFA C;  3APO A;  1VF3 A;  3GSS A;  5CRH A;  2YV9 A;  2GLR A;  1O85 A;  4I8B A;  2VIM A;  2DJ2 A;  4J56 E;  3D6I A;  3WGX A;  2FWH A;  3TJK A;  3RBT A;  1GLQ A;  4TR4 A;  2GQK A;  2VCZ A;  1X5D A;  1OE8 A;  2PU9 C;  2AYT A;  2X8H A;  4NMU A;  4Q5N A;  2IJY A;  3FW2 A;  4TVE A;  1T00 A;  3PH9 A;  4N10 A;  4ZB6 A;  3F4R A;  4N0Z A;  5DVB A;  3EE2 A;  2DJ0 A;  5GAN D;  2I9H A;  3BCI A;  2MMN A;  3KEB A;  3ZRD A;  4GXZ A;  2VD1 A;  4HUA A;  5IM9 A;  5H5S A;  2PGT A;  1JZO A;  3RHC A;  2RM6 A;  1WOU A;  4IQA A;  4BL7 A;  1SEN A;  4LL1 B;  2A2S A;  4HZ2 A;  1Q4J A;  3UMA A;  4Q5F A;  4KCE A;  3M3M A;  3Q18 A;  1K0B A;  5G1K A;  2PBJ A;  5KN2 A;  2WGR A;  3P2A A;  3IK7 A;  2O7K A;  1PL2 A;  2P5R A;  3GX8 A;  5D73 A;  2LEG A;  3AY8 A;  1ZL9 A;  1NSW A;  3R3E A;  3DXB A;  1N2A A;  2WB9 A;  4I97 A;  1XCC A;  1IYH A;  4BL7 B;  1YQ1 A;  4AF2 A;  2V2G A;  1MTC A;  5A4V A;  2L4C A;  3ME7 A;  1Y25 A;  2B6M A;  3ME8 A;  3ERF A;  4USS A;  4RUV A;  1EP8 A;  2DJJ A;  2PVO C;  5ECQ B;  3F9U A;  3GKM A;  1AUC A;  1T8E B;  1OE7 A;  4JR6 A;  3DVX A;  6GSV A;  4ECI A;  4XTS A;  1BG5 A;  1SJZ A;  2HE3 A;  3LYP A;  3VI7 A;  1V40 A;  4ULX A;  2PVQ A;  1GH2 A;  5HR1 A;  2HXK A;  5E59 A;  1PSQ A;  1Z3E A;  2NPB A;  3QCP A;  3IXR A;  1SU9 A;  4PUA A;  1XWB A;  2XHF A;  1E6B A;  3GST A;  1C72 A;  5LD0 A;  3L0H A;  4KDX A;  5ECH B;  1TK5 B;  3HDC A;  3KCM A;  3P90 A;  2FLS A;  2FCH A;  4ZBD A;  2CVK A;  1T4Y A;  3UBK A;  5HFK A;  2MZC A;  1GSF A;  3ZFL A;  5DBQ A;  3EUR A;  1F6M C;  4TOP A;  1K0C A;  2V41 A;  3ZMK A;  3WYW A;  3APS A;  1AAZ A;  3ZIJ A;  2TRC P;  5IIZ A;  4ZBB A;  5JCG A;  5IO0 A;  1GNE A;  3TJF A;  4RQX A;  1F3A A;  1K0D A;  5GSS A;  4IEL A;  4MMM A;  4YAV A;  1X9S B;  3GHA A;  2FA8 A;  1DSB A;  2LNT A;  3FEU A;  5E4W A;  3UAR A;  3QPM A;  5CRG A;  1CQH A;  2OBI A;  1B4P A;  1G6W A;  3TJJ A;  2NBS A;  4OFT A;  2GVP A;  2L4Q A;  3IDV A;  2YAN A;  5J3R A;  4ZB8 A;  4KH7 A;  5CYY A;  3FR3 A;  2DJ1 A;  1OC3 A;  4DVC A;  3TKS C;  1BAY A;  5IOX A;  3VLN A;  2VCQ A;  5G2Z A;  4IS0 A;  2J9H A;  2WDU A;  1JZD A;  3FRC A;  4JBB A;  4XIH A;  1SD9 A;  4L5L A;  2YJH A;  2LJR A;  1MDJ A;  2YWM A;  1Q98 A;  3QAW A;  1VF1 A;  3KP9 A;  4DEJ A;  1ZOF A;  2C0F A;  2XBQ A;  1HNB A;  3EC3 A;  2GT5 A;  4OO4 A;  4QL7 A;  1A0F A;  3W8J A;  1GTB A;  3PPU A;  1MEK A;  2JSY A;  4LA1 A;  2AAW A;  5ID2 B;  1SK0 A;  4FQU A;  3EYT A;  4MF6 A;  3CSI A;  1M2D A;  5J9C A;  3HVS A;  2LJK A;  4J2F A;  2FWG A;  3UOM A;  1IYI A;  1FB6 A;  4L8E A;  4TW5 A;  1JZR A;  4Q5Q A;  2C0D A;  1LJR A;  2HRN A;  2VOC A;  4AGS A;  2QGV A;  1XIY A;  4BWQ A;  4WR5 A;  3GTU A;  3H8Q A;  3QOU A;  2B1L A;  3IR4 A;  5H5Q A;  1MD3 A;  2L59 A;  3DWV A;  4MZC A;  2QKE A;  3E9J B;  4MJE A;  2CX4 A;  3A3T A;  3IAM 2;  4PTS A;  1J08 A;  2WFC A;  2DBC A;  1Z6N A;  5INY A;  3BCK A;  5G31 A;  4GST A;  2LV3 A;  22GS A;  3DRN A;  2YV7 A;  3GTU B;  5C04 A;  1WP0 A;  3G7I A;  2BMX A;  4KGI A;  5D93 A;  3TDG A;  4JU5 A;  4EE0 A;  2H1D A;  5FHI A;  4G0I A;  1JLW A;  2OE1 A;  1SD8 A;  1PX7 A;  4D73 B;  3M9K A;  2VUP A;  3HHV A;  5D8I A;  1ST9 A;  1OKT A;  3FZ5 A;  1ZMA A;  20GS A;  5ENU A;  2H72 A;  2R4V A;  1R4W A;  1DBY A;  3EIN A;  5EVO A;  1G6Y A;  4DSR A;  4GQC A;  3UJ1 A;  2HRF A;  2BTO T;  3LSZ A;  2HSY A;  4OD7 A;  1ERT A;  3KJY A;  2LTK A;  4MP4 A;  1H75 A;  4V2N A;  4F2I A;  1K0N A;  2VL2 A;  2HI7 A;  3TKS A;  2WJU A;  1XW6 A;  3Q19 A;  4L5O A;  2AV4 A;  1YKC A;  3IRA A;  5ELA A;  1GLP A;  3F63 A;  3DEX A;  3EU4 A;  5JWO B;  4FYC A;  3IBH A;  1K0O A;  4TXV A;  4XS4 A;  4GSS A;  3J7Y b;  1PQN A;  2MMO A;  3H79 A;  2HZE A;  4HI7 A;  1SJI A;  1THX A;  2TIR A;  2B1K A;  4KE3 A;  1WJK A;  4K2D A;  3EMX A;  4O92 A;  2LQQ A;  5A4U A;  4I2U A;  4I2T A;  1ZCP A;  3GYK A;  4H86 A;  1DUG A;  3KIJ A;  3ISO A;  1QGV A;  1ZYE A;  4PNG A;  4IN0 A;  2DC5 A;  4G10 A;  3LJR A;  3A5W A;  3VFI A;  1TK0 B;  2VLT A;  1I9D A;  2H6Y A;  2N5A A;  1TJD A;  4XS1 A;  2XPD A;  2HZE B;  3TOU A;  4KSM A;  5DQY A;  5CP1 A;  3TKR A;  2VL3 A;  4TR0 A;  5G1L A;  1A8L A;  2WZ9 A;  1LU4 A;  3PIN A;  2FNO A;  1ZZY A;  3C7M A;  3S9F A;  1EEM A;  2ZCT A;  3K8N A;  2H73 A;  1CQG A;  3TRX A;  1PGT A;  4EUY A;  2GGT A;  4E8E A;  1PMT A;  13GS A;  4BVY A;  2FD3 A;  2L6D A;  2J23 A;  1AIU A;  1O8W A;  5G5E A;  4NAX A;  3UAP A;  1GRX A;  5D9T A;  19GS A;  5HR2 A;  1FVJ A;  2CZ3 A;  5CRE A;  4KF9 A;  5DCH A;  5IPH A;  1SYR A;  1ERV A;  5F07 A;  1B9Y C;  5IMZ A;  4JRR A;  1Z7P A;  1TOF A;  2G2Q A;  4MCU A;  3UVT A;  1HD2 A;  3ZFB A;  1VRS D;  5H5R A;  4BVY B;  3APQ A;  4WF5 A;  1O81 A;  1SKS B;  3ZIV A;  3M0F A;  2L5O A;  3CXG A;  1XFL A;  4FO5 A;  4EDZ A;  7GSS A;  4X0X A;  1A8Y A;  1YY7 A;  5ECS A;  3GKX A;  2FWE A;  2H70 A;  5AIV A;  4WR4 A;  3D4T A;  5F05 A;  3VK9 A;  3GV1 A;  2VCW A;  1X5E A;  3MWH A;  1Z9H A;  1U6T A;  2IPA A;  2VL9 A;  3GKK A;  3F4S A;  2GZY A;  1MDK A;  1XVQ A;  2ON5 A;  2K18 A;  3GNJ A;  1G7O A;  2E0Q A;  2VCV A;  3G7Y A;  3WT2 A;  1AQX A;  4MLY A;  2V6O A;  2OE3 A;  2H6Z A;  3FZ4 A;  1EOG A;  3L4N A;  4KDU A;  4BWS A;  2TRX A;  4XHM A;  2N5F A;  4JR4 A;  4DSS A;  3KH7 A;  3GUS A;  2O87 A;  1M2A A;  2KP1 A;  2DLX A;  1U88 A;  4FYU A;  3I6A A;  3TGZ A;  3TB2 A;  4MZW A;  1FAA A;  4WEY A;  3HA9 A;  2L6C A;  4Q5R A;  1F37 A;  2R2J A;  1UC7 A;  1XW9 A;  2LQO A;  3L9V A;  3GFK A;  1T7P B;  2FY6 A;  5HQP A;  4XRA A;  1MD4 A;  1SK1 A;  3NIV A;  14GS A;  5HR3 A;  5FWG A;  2DIY A;  4HEA 2;  3VPT A;  4PQH A;  4DSS B;  4G0L A;  5CRW A;  5CAX A;  3KMO A;  2YWI A;  2K9F A;  1XWG A;  4MH3 A;  1RK4 A;  5ECK B;  6GSS A;  3CSJ A;  1WWJ A;  2FUG 2;  3TRQ A;  5ECL B;  4WF4 A;  3KZQ A;  5HFG A;  1XOB A;  5DDL A;  1Y6E A;  4F0C A;  4V1A p;  4EF0 A;  2H66 A;  2LJA A;  4V1A g;  2HT9 A;  3L9S A;  4F03 A;  4YQU A;  2FGX A;  1TRV A;  3FHK A;  3G9B A;  3KTL A;  2N5B A;  2JAC A;  2MBS A;  3GMF A;  2D2Z A;  3ZVJ A;  2CX3 A;  6GSX A;  2H8L A;  4GSN A;  3F6D A;  2M46 A;  2H0H A;  4LLR A;  2R5G A;  1USB A;  1GNW A;  1TDI A;  5KEJ A;  4POB A;  2QC7 A;  5J41 A;  2K8S A;  2P5Q A;  4GQF A;  3QAV A;  4AJ8 A;  3DYR A;  2EC4 A;  3ERW A;  4RQR A;  5JWQ B;  2PMT A;  4MJB A;  4P3Y B;  3TRP A;  4JE1 A;  2IN3 A;  3GH9 A;  1NW2 A;  2R6K A;  3IC8 A;  1AQW A;  3QAG A;  1SK2 A;  1W89 A;  3IA1 A;  2NVL A;  3F3R A;  3QR6 A;  4GF0 A;  2B5X A;  4ECJ A;  4QQ7 A;  1OC9 A;  1K0A A;  2WS2 A;  2V1M A;  3TJG A;  1U3I A;  1UN2 A;  3P8W A;  1N8J A;  4N30 A;  1M7T A;  3HZ4 A;  4MJC A;  1Z7R A;  2A2R A;  3LEF A;  5B6M A;  4NV5 A;  4F82 A;  4YAP A;  2LRC A;  1A23 A;  4G9H A;  5DJM A;  3E0U A;  5IMF A;  5J9B A;  2H74 A;  1G7E A;  3D4M A;  3SBC A;  2CQ9 A;  1T1V A;  4EVM A;  5CNW A;  5IMV A;  4IBP A;  2HNL A;  4K7I A;  3QFB C;  1OC9 B;  2F8F A;  2LST A;  3G7J A;  4BVX A;  1TRU A;  3VPQ A;  4QL9 A;  4LMW A;  5IMD A;  1AXD A;  2XBI A;  1GUM A;  3FR9 A;  5ID2 A;  1GSQ A;  4K7O A;  1QQ2 A;  1F9M A;  4MAB A;  3GUR A;  6GSY A;  3KD0 A;  1GSD A;  3HYP A;  4PUR A;  3US3 A;  3ZRE A;  3ED3 A;  5DCG A;  2B7J A;  4ISD A;  2H30 A;  3ZL5 A;  5AGY A;  2C0G A;  3RDW A;  5GST A;  5EL8 A;  2CT6 A;  4HOJ A;  3Q74 A;  4ZXG A;  4TR3 A;  2H76 A;  3PR8 A;  1F3B A;  2C0E A;  4BVX B;  4PX1 A;  1T3B A;  4K9Z A;  1EGO A;  3HY2 A;  1BED A;  2IMK A;  3FR6 A;  4TRX A;  4HDE A;  3ZZX A;  2REM A;  3DML A;  2F8A A;  2O85 A;  2CV4 A;  3CRU A;  3IOS A;  5JWR B;  2OAD A;  3LXZ A;  6GSU A;  5IO2 A;  2GSR A;  2V6K A;  3KXO A;  3SWL A;  3RHB A;  4HU7 A;  3F0I A;  1XWC A;  5B8A A;  4JED A;  1Z5Y E;  2B5Y A;  4X43 A;  3I69 A;  2JL4 A;  1TRS A;  4LL4 B;  1TTZ A;  1YZX A;  1TKD B;  4DSQ A;  2GQM A;  4K1F A;  5FT3 A;  1XVW A;  1KNG A;  5B7C A;  4FH8 A;  5DAL B;  4MZB A;  3VWX A;  2KHP A;  4O7H A;  4OMV A;  1VF2 A;  2GQL A;  4D73 A;  2CVD A;  2C8U A;  5EPF A;  1Z6M A;  1W4V A;  3GX0 A;  1A2M A;  2H1B A;  4FIW A;  3GL3 A;  1PKW A;  5COH A;  2DSA A;  1AQV A;  2H75 A;  1BQ7 A;  2HRA A;  2E7P A;  2IL3 A;  2OA7 A;  2LUS A;  5F06 A;  4PUF C;  10GS A;  1HYU A;  1OYJ A;  3TUE A;  2HSM B;  2Z9S A;  5D96 A;  3KGK A;  3DGQ A;  3CSH A;  4IJ3 A;  3W8S A;  1K3Y A;  1AC1 A;  2DJK A;  3DIE A;  1FVK A;  3EU3 A;  2XC2 A;  2FHE A;  5KN1 A;  3M9J A;  5DAK A;  4WKW A;  2H01 A;  2M80 A;  3DKS A;  2P0G A;  3LOR A;  2C3Q A;  3KM6 A;  1YEX A;  4HJM A;  2VCT A;  4TXO A;  4XRD A;  3TOT A;  3HCZ A;  3HVX A;  1K3L A;  4I6X A;  3E3E A;  4KA0 A;  1SKR B;  3D21 A;  1XOA A;  4IKH A;  4GLT A;  3LWA A;  8GSS A;  4RI7 A;  4L0U A;  2L57 A;  1KBN A;  4MH2 A;  2CA8 A;  2H1G A;  2K6V A;  2OKA A;  2PPT A;  3O3T A;  3VI5 A;  4OFM A;  4ZIJ A;  3TJB A;  5DAK B;  2I1U A;  5J5N A;  3NZN A;  4WET A;  4LMV A;  1QK8 A;  1EGR A;  5ECI B;  3GH6 A;  1XPV A;  2X99 A;  1GP1 A;  3UIW A;  3HXS A;  3I9V 2;  4TXO B;  1YKA A;  3CMI A;  3KH9 A;  3U5R E;  1PX6 A;  5G5F A;  2OJL A;  5KN3 A;  2EIO A;  1SL0 B;  2ZNM A;  3LQ7 A;  4KX4 A;  3ZML A;  3O6T A;  2OAC A;  2E2G A;  3A2W A;  5EY6 A;  4ZL9 A;  4ZL7 A;  3O76 A;  4TN8 A;  4OCF A;  4NHZ A;  3BD2 A;  1OKD A;  1ZYQ B;  1X0R A;  2M72 A;  1B9X C;  3M1G A;  1M99 A;  3HJM A;  2RUE A;  3MAK A;  4ACS A;  2IWT A;  3ZLP A;  2YZU A;  2GS3 A;  1NHO A;  17GS A;  1PKZ A;  4WBR D;  1ON4 A;  5IQY A;  4KAE A;  4K8M A;  1GSS A;  3F4T A;  3FYG A;  1TI1 A;  4NPB A;  5DJL A;  4EC0 A;  3F8U A;  1WIK A;  1WPI A;  2RUF A;  4MDC A;  4NV2 A;  2CVB A;  1JFU A;  2AUV A;  3LGC A;  4KW6 A;  5HFI A;  1YDK A;  2IME A;  2ZUP A;  3OR5 A;  1JLV A;  4GRF A;  1J0F A;  1SJ6 A; 
#chains in the Genus database with same CATH topology
 3W6G A;  1QFN A;  3C1S A;  1M2B A;  3VWU A;  2WVX A;  4YQM A;  3ERG A;  2EIR A;  2F9S A;  4K0N A;  3HJP A;  3LW9 A;  4G2E A;  4PNF A;  5ECO B;  4JZQ A;  1BX9 A;  4ZL8 A;  5J4U A;  1FOV A;  4J57 E;  1WE0 A;  2YZH A;  5L71 A;  2VM2 A;  3UBL A;  3HKR A;  18GS A;  4IP6 A;  4ZIL A;  12GS A;  1SVO A;  1HQO A;  2RII A;  2H19 A;  4POL A;  1VGL A;  5IMA A;  3IAS 2;  4OO5 A;  3H1N A;  1U87 A;  2R0C A;  3GN3 A;  2GST A;  1I1I P;  1UA5 A;  3C8E A;  1X5C A;  1V98 A;  1YF0 A;  3P7X A;  5LNK e;  1M9B A;  4K7N A;  3KMN A;  5IOW A;  1GUK A;  2LRN A;  4BA7 A;  3KTB A;  3LYK A;  1YVL A;  3HZ8 A;  3TKQ A;  3CBU A;  3V1W A;  4N11 A;  4F9Z A;  1K3O A;  3N5O A;  4PXO A;  3CRT A;  3NOF A;  4Z2R A;  4CHS A;  1GTA A;  5A4W A;  2WW1 A;  4ML1 A;  3IHQ A;  3UVH A;  2F3M A;  4V2M A;  5JCW A;  2B3S A;  3PGT A;  4POM A;  2YOI A;  1GUH A;  4EXJ A;  1FW1 A;  4OFN A;  4KSO A;  4Z2U A;  4IGJ A;  2F51 A;  1PRX A;  3IV4 A;  1ML6 A;  2HRK A;  2MBT A;  2DIZ A;  3FZ9 A;  3UEM A;  1BJX A;  4ECC A;  5A34 B;  2C4J A;  1ILO A;  2ALB A;  1M9A A;  2I4A A;  4NWY A;  5LCZ A;  1RQM A;  1XBS A;  1LBK A;  1PN9 A;  2YN1 A;  1EEJ A;  1UVZ A;  4IHU A;  2LRT A;  4OCE A;  3IC4 A;  4PQ1 A;  3N9J A;  4HQZ A;  3MNG A;  2ON7 A;  2HRK B;  2H0G A;  3LXT A;  1GL8 A;  1TU8 A;  2WZS A;  1GSY A;  2PUK C;  2B7K A;  2JAD A;  2WUL A;  4MF5 A;  2HSN A;  1GUL A;  1TP9 A;  2H1A A;  2CAI A;  4E8H A;  4Z7X A;  4BIK A;  2VD0 A;  3QMX A;  3WGD A;  2EIQ A;  2YP6 A;  3CHX C;  4IP1 A;  2O89 A;  4IW9 A;  5BMU A;  1BYE A;  1FB0 A;  2GZP A;  2YCD A;  3HJO A;  3DVW A;  2KUC A;  3LG6 A;  1A2L A;  2YWO A;  2AHE A;  2HFD A;  2DMM A;  1M0U A;  4O32 A;  3A2X A;  3ZYW A;  3GA4 A;  2OE0 A;  2FA4 A;  1AW9 A;  4ZB7 A;  4EO3 A;  2HSN B;  4AKH A;  4IJI A;  2CAQ A;  4PQI A;  1GWC A;  4RI6 A;  1A0R P;  1WMJ A;  5BMU B;  5CO3 A;  5AN1 A;  1B48 A;  1EV4 A;  1PL1 A;  2OBK A;  4KB3 A;  2V32 A;  2L5L A;  4MA9 A;  1V9W A;  2GDR A;  1A24 A;  2HLS A;  2LKU A;  3F6F A;  3JCM L;  3GKN A;  4AJ7 A;  5HR0 A;  2UV8 G;  2C3T A;  3RAZ A;  1PD2 1;  3D5J A;  2DKH A;  1GSU A;  1EV9 A;  4O5R A;  2GTU A;  2IMF A;  2VLV A;  4MF7 A;  4F0B A;  3LFL A;  5IMC A;  1URM A;  5ELG A;  2HSH A;  2IMI A;  2WCI A;  4MPG A;  1TXX A;  4GWR A;  3MSZ A;  2I3Y A;  2YJ7 A;  3IE3 A;  2VL2 C;  1HNA A;  2LS5 A;  4HU9 A;  1GTU A;  2C1Y A;  3M8N A;  1PA3 A;  4WBJ A;  5J4Y A;  4K5S A;  2R3X A;  5ECR B;  4X1U A;  2X8C A;  2R0P A;  2H71 A;  4L0W A;  1TU7 A;  3VWV A;  2JU5 A;  1V58 A;  3H4K A;  1O73 A;  1YJ6 A;  1FG4 A;  5GZZ B;  2C3N A;  1V2A A;  2YNX A;  2E2M A;  1SYX A;  4NHW A;  1XWA A;  1XWK A;  3KP8 A;  1QMV A;  1J9B A;  2NTO A;  4ID0 A;  2ES7 A;  5C00 A;  1R5P A;  3Q6O A;  1SL2 B;  2BJX A;  1S3D A;  2KLX A;  1EZK A;  5G30 A;  3ZVJ D;  4IVF A;  1QUW A;  2UZ8 A;  5ABR A;  4ML6 A;  5AIS A;  3WD6 A;  3J7Y k;  5DAL A;  5ECP B;  1YF1 A;  4BPY A;  3DD3 A;  2QA1 A;  4KCA A;  3C73 A;  4HZ4 A;  2JZT A;  4G19 A;  4N3Z A;  4ZB9 A;  3CYN A;  3ZTL A;  3GL5 A;  16GS A;  1U3A A;  1DE1 A;  3C71 A;  1ERW A;  3WGE A;  2H0I A;  4MPF A;  1XW5 A;  3D22 A;  2K8V A;  2VCX A;  2GSQ A;  2AJQ B;  2JSZ A;  4CDO A;  4IQ1 A;  1EOH A;  4TR1 A;  4HS1 A;  4I5Q A;  1TRW A;  1EP7 A;  3A2V A;  3UL3 A;  2JZR A;  1ZGN A;  2VM1 A;  2HSM A;  1SKW B;  1S3A A;  1K0M A;  1MDI A;  3GIX A;  5GAP D;  2GZZ A;  1SL1 B;  4CW9 A;  3FY7 A;  2VAF A;  2A4V A;  1JHB A;  1JZW A;  3TCO A;  1ABA A;  1GTI A;  4MK3 A;  1TI3 A;  2PWJ A;  4CY6 A;  3D0Z A;  1H4O A;  3QD9 A;  2X49 A;  4AKI A;  4G0K A;  2G0F A;  1HNC A;  1EWX A;  3WT1 A;  2PN8 A;  4TR1 B;  2DML A;  2B5E A;  5KOW A;  5KN0 A;  2KP2 A;  3GRX A;  3CTF A;  2R37 A;  2HYX A;  1S3C A;  1YEP A;  2HZF A;  1KEB A;  4GTU A;  4KDY A;  2WVZ A;  3MDK A;  2YWN A;  4HQS A;  5ECN B;  4K6X A;  3L9U A;  2LNS A;  4AKG A;  1XXU A;  3IPZ A;  3IK9 A;  2IIY A;  6GST A;  2X8G A;  2EFH A;  4GCI A;  4MJA A;  4WXT A;  1OVN A;  1GSE A;  2XPE A;  4AJ6 A;  3EMP A;  2CZ2 A;  5DQS A;  3A5I A;  1TK8 B;  2QSI A;  1NM3 A;  2RM5 A;  3C1R A;  4KUN A;  1RW1 A;  1R7H A;  1X9W B;  4HJ2 A;  5JCU A;  3ZIT A;  1T4Z A;  3EVI A;  5B6N A;  5F0G A;  2X64 A;  4ILF A;  2VLU A;  5KOX A;  3U6V A;  1TW9 A;  3I43 A;  3BBY A;  3FZA A;  1I5G A;  5B8B A;  3CTG A;  2IMD A;  3FK8 A;  3BJ5 A;  5D9X A;  1VF4 A;  2WRT A;  3H93 A;  5F8B A;  3VWW A;  4YH2 A;  5ECM B;  1OC8 A;  11GS A;  2P31 A;  2GSS A;  5D9V A;  3BOA A;  1DE2 A;  5IPG A;  4V2L A;  1E2Y A;  5A5K A;  2JZS A;  1ACV A;  2PER A;  4EDY A;  1V57 A;  2C80 A;  5D9W A;  1O6J A;  4YQV A;  2IFQ A;  3HVV A;  4TKY A;  3FKF A;  4EKZ A;  5AIX A;  3L78 A;  2DJ3 A;  4EL1 A;  2VO4 A;  6GSW A;  5CRD A;  4N0V A;  3R2Q A;  1O7U A;  1THO A;  3QDN A;  1OAZ A;  4ECB A;  4ZBA A;  3F3Q A;  4XS4 B;  4PHZ C;  1ERU A;  2GT6 A;  2KOK A;  4FYB A;  1F2E A;  2HQT A;  2RLI A;  1NHY A;  1R5A A;  4KND A;  4XCS A;  2H6X A;  2FWF A;  2NDO A;  3RPN A;  1QXH A;  1R26 A;  2O5V A;  1KTE A;  2O8V B;  3TKP A;  3RPP A;  4K5R A;  1O8X A;  4K0G A;  1FHE A;  1B8X A;  2MMA A;  5A5H A;  1X9M B;  4XS6 A;  2IFQ B;  4POK A;  3TKS E;  2AB6 A;  9GSS A;  1XZO A;  1FO5 A;  4PGT A;  2YPM A;  3EWL A;  1WRY A;  1A2J A;  2I81 A;  4NXI A;  4OWY A;  1G0T A;  2MMZ A;  3HD5 A;  1B4Q A;  3HMJ G;  3VUR A;  2MYG A;  4PI0 C;  3QFA C;  3APO A;  1VF3 A;  5A5H B;  3GSS A;  5CRH A;  2YV9 A;  2GLR A;  1O85 A;  4I8B A;  2VIM A;  2DJ2 A;  4J56 E;  3D6I A;  3WGX A;  2FWH A;  3TJK A;  3RBT A;  1GLQ A;  4TR4 A;  2GQK A;  2VCZ A;  1X5D A;  1OE8 A;  2PU9 C;  2AYT A;  2X8H A;  4NMU A;  4Q5N A;  2IJY A;  3FW2 A;  4TVE A;  1T00 A;  3PH9 A;  4N10 A;  4ZB6 A;  3F4R A;  4N0Z A;  5DVB A;  3EE2 A;  2DJ0 A;  5GAN D;  2I9H A;  3BCI A;  2MMN A;  3KEB A;  3ZRD A;  4GXZ A;  2VD1 A;  4HUA A;  5IM9 A;  5H5S A;  2PGT A;  5A34 A;  1JZO A;  3RHC A;  2RM6 A;  1WOU A;  4IQA A;  2OT3 A;  4BL7 A;  1SEN A;  4LL1 B;  4AI6 A;  2A2S A;  4HZ2 A;  1Q4J A;  3UMA A;  4Q5F A;  4KCE A;  3M3M A;  3Q18 A;  1Y1U A;  1K0B A;  5G1K A;  2PBJ A;  5KN2 A;  2WGR A;  2WW0 A;  3P2A A;  3IK7 A;  2O7K A;  1PL2 A;  2P5R A;  3GX8 A;  5D73 A;  2LEG A;  3AY8 A;  1ZL9 A;  1NSW A;  3R3E A;  3DXB A;  1N2A A;  2WB9 A;  4I97 A;  1XCC A;  4W66 A;  1IYH A;  4BL7 B;  1YQ1 A;  4AF2 A;  2V2G A;  1MTC A;  5A4V A;  2L4C A;  3ME7 A;  1Y25 A;  2B6M A;  3ME8 A;  3ERF A;  4USS A;  4RUV A;  1EP8 A;  2DJJ A;  2PVO C;  5ECQ B;  3F9U A;  3GKM A;  1AUC A;  1T8E B;  1OE7 A;  4JR6 A;  3DVX A;  6GSV A;  4ECI A;  4XTS A;  1BG5 A;  1SJZ A;  2HE3 A;  3LYP A;  3VI7 A;  1V40 A;  4ULX A;  2PVQ A;  1GH2 A;  5HR1 A;  2HXK A;  5E59 A;  1PSQ A;  1Z3E A;  2NPB A;  3QCP A;  3IXR A;  1SU9 A;  4PUA A;  1XWB A;  2XHF A;  1E6B A;  3GST A;  1C72 A;  5LD0 A;  3L0H A;  4KDX A;  5ECH B;  1TK5 B;  2WW3 A;  3HDC A;  3KCM A;  3P90 A;  2FLS A;  2FCH A;  4ZBD A;  2CVK A;  1T4Y A;  3UBK A;  5HFK A;  2MZC A;  1GSF A;  3ZFL A;  5DBQ A;  3EUR A;  1F6M C;  4TOP A;  1K0C A;  2V41 A;  3ZMK A;  3WYW A;  3APS A;  1AAZ A;  3ZIJ A;  2TRC P;  5IIZ A;  4ZBB A;  5JCG A;  5IO0 A;  1GNE A;  3TJF A;  4RQX A;  1F3A A;  4X4J A;  1K0D A;  5GSS A;  4IEL A;  4MMM A;  1PN0 A;  4YAV A;  1X9S B;  3GHA A;  2FA8 A;  1DSB A;  2LNT A;  3FEU A;  5E4W A;  3UAR A;  5A1N B;  3QPM A;  5CRG A;  1CQH A;  2OBI A;  1B4P A;  1G6W A;  3TJJ A;  2NBS A;  4OFT A;  2EFE A;  2GVP A;  2L4Q A;  3IDV A;  2YAN A;  5J3R A;  4ZB8 A;  4KH7 A;  5CYY A;  3FR3 A;  2DJ1 A;  1OC3 A;  4DVC A;  3TKS C;  1BAY A;  1SVM A;  1N25 A;  5IOX A;  3VLN A;  2VCQ A;  5G2Z A;  4IS0 A;  2J9H A;  2WDU A;  1JZD A;  3FRC A;  4JBB A;  4XIH A;  1SD9 A;  4L5L A;  1M3J A;  2YJH A;  2LJR A;  1MDJ A;  2YWM A;  1Q98 A;  3QAW A;  1VF1 A;  1ZYP A;  3KP9 A;  4DEJ A;  1ZOF A;  2C0F A;  2XBQ A;  1HNB A;  3EC3 A;  2GT5 A;  4OO4 A;  4QL7 A;  1A0F A;  3MIX A;  3W8J A;  1GTB A;  3PPU A;  1MEK A;  2JSY A;  4LA1 A;  2AAW A;  5ID2 B;  1SK0 A;  4FQU A;  3EYT A;  4MF6 A;  3CSI A;  1M2D A;  4YKG A;  5J9C A;  3HVS A;  2LJK A;  4J2F A;  2FWG A;  3UOM A;  1IYI A;  1FB6 A;  2DKI A;  4L8E A;  4TW5 A;  1JZR A;  4Q5Q A;  2C0D A;  1LJR A;  2HRN A;  4AKX B;  2VOC A;  4AGS A;  2QGV A;  1XIY A;  4BWQ A;  4WR5 A;  3GTU A;  3H8Q A;  3QOU A;  2B1L A;  3IR4 A;  4GDF A;  5H5Q A;  1MD3 A;  2L59 A;  3DWV A;  4MZC A;  2QKE A;  3E9J B;  4MJE A;  2CX4 A;  3A3T A;  3IAM 2;  4PTS A;  1J08 A;  2WFC A;  1PFO A;  2DBC A;  1TXU A;  1Z6N A;  5INY A;  4E68 A;  2A4H A;  3BCK A;  5G31 A;  4GST A;  2LV3 A;  22GS A;  3DRN A;  2YV7 A;  3GTU B;  5C04 A;  1WP0 A;  3G7I A;  2BMX A;  4KGI A;  5D93 A;  3TDG A;  4JU5 A;  4EE0 A;  2H1D A;  5FHI A;  4G0I A;  4G01 A;  1JLW A;  2EFC A;  1SD8 A;  2OE1 A;  1PX7 A;  4D73 B;  3M9K A;  2VUP A;  3HHV A;  5D8I A;  1ST9 A;  1OKT A;  3FZ5 A;  4MNN A;  1ZMA A;  20GS A;  5ENU A;  2H72 A;  2R4V A;  1R4W A;  1DBY A;  3EIN A;  5EVO A;  1G6Y A;  4DSR A;  4GQC A;  3UJ1 A;  2HRF A;  2BTO T;  3LSZ A;  2HSY A;  4OD7 A;  1ERT A;  3KJY A;  2LTK A;  4MP4 A;  1H75 A;  2A2P A;  4V2N A;  4F2I A;  1K0N A;  2VL2 A;  2HI7 A;  4ICY A;  3TKS A;  2WJU A;  1XW6 A;  3Q19 A;  4L5O A;  1S3R A;  2AV4 A;  1YKC A;  3IRA A;  5ELA A;  1GLP A;  3F63 A;  3DEX A;  3EU4 A;  5JWO B;  4FYC A;  3IBH A;  1K0O A;  4TXV A;  4XS4 A;  4GSS A;  3J7Y b;  1PQN A;  2MMO A;  3H79 A;  2HZE A;  4HI7 A;  1SJI A;  1THX A;  2TIR A;  2B1K A;  4KE3 A;  4YKF A;  4HSC X;  1WJK A;  4K2D A;  3EMX A;  4O92 A;  2LQQ A;  5A4U A;  4I2U A;  4I2T A;  1ZCP A;  3GYK A;  4H86 A;  1DUG A;  3KIJ A;  3ISO A;  1QGV A;  1ZYE A;  4PNG A;  4IN0 A;  2DC5 A;  4G10 A;  3LJR A;  3A5W A;  3VFI A;  1TK0 B;  2VLT A;  1I9D A;  2H6Y A;  2N5A A;  1TJD A;  4XS1 A;  5J40 A;  2XPD A;  3CQF A;  2HZE B;  1XG8 A;  3TOU A;  4KSM A;  5DQY A;  1YEW C;  5CP1 A;  2VL3 A;  3TKR A;  4TR0 A;  5G1L A;  1A8L A;  2WZ9 A;  1LU4 A;  3PIN A;  2FNO A;  1ZZY A;  2O3E A;  3C7M A;  3S9F A;  1EEM A;  2ZCT A;  3K8N A;  2H73 A;  1CQG A;  3TRX A;  1PGT A;  4EUY A;  2GGT A;  4E8E A;  1PMT A;  13GS A;  4BVY A;  2FD3 A;  2L6D A;  2J23 A;  1AIU A;  1O8W A;  5G5E A;  4NAX A;  3UAP A;  1GRX A;  5D9T A;  19GS A;  5HR2 A;  1FVJ A;  2CZ3 A;  5CRE A;  4KF9 A;  5DCH A;  2EFD A;  5IPH A;  3TU3 B;  1SYR A;  1ERV A;  5F07 A;  4K2X A;  1B9Y C;  5IMZ A;  4JRR A;  1Z7P A;  1TOF A;  2G2Q A;  4MCU A;  3UVT A;  1HD2 A;  3ZFB A;  1VRS D;  5H5R A;  4BVY B;  3APQ A;  4WF5 A;  1O81 A;  1SKS B;  3ZIV A;  3M0F A;  2L5O A;  3CXG A;  4CY8 A;  1XFL A;  4FO5 A;  4EDZ A;  7GSS A;  4X0X A;  1A8Y A;  1YY7 A;  5ECS A;  3GKX A;  2FWE A;  2H70 A;  5AIV A;  4WR4 A;  2WVX B;  3D4T A;  5F05 A;  3VK9 A;  3GV1 A;  2VCW A;  1X5E A;  3MWH A;  1Z9H A;  5J4V A;  1U6T A;  2IPA A;  3IHG A;  2VL9 A;  3GKK A;  3F4S A;  2GZY A;  1MDK A;  1XVQ A;  2ON5 A;  2K18 A;  3GNJ A;  1G7O A;  2E0Q A;  2VCV A;  3G7Y A;  3WT2 A;  1AQX A;  4MLY A;  2WW2 A;  2V6O A;  2OE3 A;  2H6Z A;  3FZ4 A;  4A5P A;  1EOG A;  3L4N A;  4KDU A;  4BWS A;  2TRX A;  4XHM A;  2N5F A;  4JR4 A;  4DSS A;  4EIQ A;  3KH7 A;  3GUS A;  2O87 A;  1M2A A;  2KP1 A;  2DLX A;  1U88 A;  4FYU A;  3I6A A;  3TGZ A;  3TB2 A;  4MZW A;  1FAA A;  4WEY A;  3HA9 A;  2L6C A;  4Q5R A;  1F37 A;  2R2J A;  1UC7 A;  1XW9 A;  2LQO A;  3L9V A;  3GFK A;  1T7P B;  2FY6 A;  2QA2 A;  5HQP A;  4XRA A;  3HVN A;  1MD4 A;  1SK1 A;  3NIV A;  14GS A;  5HR3 A;  5FWG A;  2DIY A;  4HEA 2;  3VPT A;  4PQH A;  4DSS B;  4G0L A;  5CRW A;  5CAX A;  3KMO A;  2YWI A;  2K9F A;  1XWG A;  4MH3 A;  1RK4 A;  5ECK B;  6GSS A;  3CSJ A;  1WWJ A;  2FUG 2;  3TRQ A;  5ECL B;  4WF4 A;  3KZQ A;  5HFG A;  1XOB A;  5DDL A;  1Y6E A;  4F0C A;  4V1A p;  4EF0 A;  3FMW A;  2H66 A;  2LJA A;  4V1A g;  2HT9 A;  3L9S A;  4F03 A;  4YQU A;  2FGX A;  1TRV A;  3FHK A;  3G9B A;  3KTL A;  2N5B A;  2JAC A;  2MBS A;  3GMF A;  2D2Z A;  3ZVJ A;  2CX3 A;  6GSX A;  2H8L A;  4GSN A;  3F6D A;  2M46 A;  5A1N A;  2H0H A;  4LLR A;  2R5G A;  1USB A;  1GNW A;  1TDI A;  5KEJ A;  3MYD A;  4POB A;  2QC7 A;  4FXY P;  5J41 A;  2K8S A;  5J47 A;  2P5Q A;  2WVY A;  4GQF A;  3QAV A;  4O5Q A;  4AJ8 A;  3DYR A;  2EC4 A;  2H1L A;  3ERW A;  4RQR A;  5JWQ B;  2PMT A;  4MJB A;  4P3Y B;  3TRP A;  1M3I A;  4JE1 A;  2IN3 A;  3GH9 A;  1NW2 A;  2R6K A;  3IC8 A;  1AQW A;  3QAG A;  1SK2 A;  1W89 A;  3IA1 A;  1ZYN A;  2NVL A;  3F3R A;  3QR6 A;  4GF0 A;  1FOH A;  2B5X A;  4ECJ A;  4QQ7 A;  1OC9 A;  1K0A A;  2WS2 A;  2V1M A;  3TJG A;  1U3I A;  1UN2 A;  3P8W A;  1N8J A;  4N30 A;  1M7T A;  3HZ4 A;  4MJC A;  1Z7R A;  2A2R A;  3LEF A;  5B6M A;  4NV5 A;  4F82 A;  4YAP A;  2LRC A;  1A23 A;  4G9H A;  5DJM A;  3E0U A;  5IMF A;  5J9B A;  2H74 A;  1G7E A;  3D4M A;  3SBC A;  2CQ9 A;  1T1V A;  4EVM A;  5CNW A;  5IMV A;  4IBP A;  2HNL A;  4K7I A;  2O36 A;  3QFB C;  1OC9 B;  2F8F A;  2LST A;  3G7J A;  4BVX A;  1TRU A;  3VPQ A;  4QL9 A;  4LMW A;  5IMD A;  1AXD A;  2XBI A;  1GUM A;  3FR9 A;  5ID2 A;  1GSQ A;  4K7O A;  1QQ2 A;  1F9M A;  4MAB A;  3GUR A;  6GSY A;  3KD0 A;  1GSD A;  3HYP A;  4PUR A;  3US3 A;  3ZRE A;  3ED3 A;  5DCG A;  2B7J A;  4ISD A;  2H30 A;  3ZL5 A;  5AGY A;  2C0G A;  3RDW A;  5GST A;  5EL8 A;  2CT6 A;  4HOJ A;  3Q74 A;  4ZXG A;  4TR3 A;  2H76 A;  3PR8 A;  1F3B A;  2C0E A;  4BVX B;  4PX1 A;  3CWG A;  1BG1 A;  1T3B A;  4K9Z A;  1EGO A;  3HY2 A;  1BED A;  2IMK A;  3FR6 A;  4TRX A;  4HDE A;  3ZZX A;  2REM A;  3DML A;  3RGB C;  2F8A A;  2O85 A;  2CV4 A;  3CRU A;  3IOS A;  5JWR B;  2OAD A;  3LXZ A;  6GSU A;  5IO2 A;  2GSR A;  2V6K A;  3KXO A;  3SWL A;  3RHB A;  4HU7 A;  3F0I A;  1XWC A;  5B8A A;  4JED A;  1Z5Y E;  2B5Y A;  4X43 A;  1S4B P;  3I69 A;  2JL4 A;  1TRS A;  4LL4 B;  1TTZ A;  1YZX A;  1TKD B;  4DSQ A;  2GQM A;  1SVL A;  4K1F A;  5FT3 A;  1XVW A;  1KNG A;  5B7C A;  4FH8 A;  5DAL B;  4MZB A;  3VWX A;  2KHP A;  4O7H A;  1BF5 A;  4OMV A;  2X4A A;  1VF2 A;  2GQL A;  4D73 A;  2CVD A;  2C8U A;  5EPF A;  5BRT A;  1Z6M A;  1W4V A;  3GX0 A;  1A2M A;  4EIP A;  2H1B A;  4FIW A;  3GL3 A;  1PKW A;  5COH A;  2DSA A;  1AQV A;  2H75 A;  1BQ7 A;  2HRA A;  2E7P A;  2IL3 A;  2OA7 A;  2LUS A;  5F06 A;  4PUF C;  10GS A;  1HYU A;  1OYJ A;  3TUE A;  2HSM B;  2Z9S A;  5D96 A;  3KGK A;  3DGQ A;  4Z2T A;  3CSH A;  4IJ3 A;  3W8S A;  1K3Y A;  1AC1 A;  2DJK A;  3DIE A;  1FVK A;  3EU3 A;  2XC2 A;  2FHE A;  5KN1 A;  3M9J A;  5DAK A;  4WKW A;  2H01 A;  2M80 A;  3DKS A;  2P0G A;  3LOR A;  2C3Q A;  3KM6 A;  1YEX A;  4HJM A;  2VCT A;  4TXO A;  4XRD A;  3TOT A;  4O5U A;  3HCZ A;  3HVX A;  2VKZ G;  1K3L A;  4I6X A;  3E3E A;  4KA0 A;  1SKR B;  3D21 A;  1XOA A;  4IKH A;  4GLT A;  3LWA A;  8GSS A;  4RI7 A;  4L0U A;  2L57 A;  1KBN A;  4MH2 A;  2CA8 A;  2H1G A;  2K6V A;  2OKA A;  2PPT A;  3O3T A;  3VI5 A;  4OFM A;  4ZIJ A;  3TJB A;  5DAK B;  2I1U A;  5J5N A;  3NZN A;  4WET A;  4LMV A;  3RFR C;  1QK8 A;  1EGR A;  5ECI B;  3GH6 A;  1XPV A;  2X99 A;  1GP1 A;  3UIW A;  3HXS A;  3I9V 2;  4TXO B;  1YKA A;  3CMI A;  3KH9 A;  3U5R E;  1PX6 A;  5G5F A;  2OJL A;  5KN3 A;  2EIO A;  1SL0 B;  2ZNM A;  3LQ7 A;  4KX4 A;  3ZML A;  3O6T A;  4QMK A;  2OAC A;  2E2G A;  3A2W A;  5EY6 A;  4ZL9 A;  4PI2 C;  4ZL7 A;  3O76 A;  4TN8 A;  4OCF A;  4NHZ A;  3BD2 A;  1OKD A;  1ZYQ B;  1X0R A;  2M72 A;  1B9X C;  3M1G A;  1M99 A;  3HJM A;  2RUE A;  3MAK A;  4ACS A;  2IWT A;  3ZLP A;  2YZU A;  2GS3 A;  1NHO A;  17GS A;  1PKZ A;  4WBR D;  1ON4 A;  5IQY A;  4KAE A;  4K8M A;  1GSS A;  3F4T A;  3FYG A;  1TI1 A;  4NPB A;  5DJL A;  2R0G A;  4EC0 A;  3F8U A;  1WIK A;  1WPI A;  2RUF A;  3EPT A;  4MDC A;  4NV2 A;  2CVB A;  1JFU A;  2AUV A;  3LGC A;  4KW6 A;  5HFI A;  1YDK A;  2IME A;  2ZUP A;  3OR5 A;  1JLV A;  4GRF A;  1J0F A;  1SJ6 A; 
#chains in the Genus database with same CATH homology
 3W6G A;  1QFN A;  3C1S A;  1M2B A;  3VWU A;  4YQM A;  3ERG A;  2EIR A;  2F9S A;  4K0N A;  3HJP A;  3LW9 A;  4G2E A;  4PNF A;  5ECO B;  4JZQ A;  1BX9 A;  4ZL8 A;  5J4U A;  1FOV A;  4J57 E;  1WE0 A;  2YZH A;  5L71 A;  2VM2 A;  3UBL A;  3HKR A;  18GS A;  4IP6 A;  4ZIL A;  12GS A;  1SVO A;  1HQO A;  2RII A;  2H19 A;  4POL A;  1VGL A;  5IMA A;  3IAS 2;  4OO5 A;  3H1N A;  1U87 A;  2R0C A;  3GN3 A;  2GST A;  1UA5 A;  3C8E A;  1X5C A;  1V98 A;  1YF0 A;  3P7X A;  5LNK e;  1M9B A;  4K7N A;  3KMN A;  5IOW A;  1GUK A;  2LRN A;  4BA7 A;  3KTB A;  3LYK A;  1YVL A;  3HZ8 A;  3TKQ A;  3CBU A;  3V1W A;  4N11 A;  4F9Z A;  1K3O A;  3N5O A;  4PXO A;  3CRT A;  3NOF A;  4Z2R A;  4CHS A;  1GTA A;  5A4W A;  4ML1 A;  3IHQ A;  3UVH A;  2F3M A;  4V2M A;  5JCW A;  2B3S A;  3PGT A;  4POM A;  2YOI A;  1GUH A;  4EXJ A;  1FW1 A;  4OFN A;  4KSO A;  4Z2U A;  4IGJ A;  2F51 A;  1PRX A;  3IV4 A;  1ML6 A;  2HRK A;  2MBT A;  2DIZ A;  3FZ9 A;  3UEM A;  1BJX A;  4ECC A;  5A34 B;  2C4J A;  1ILO A;  2ALB A;  1M9A A;  2I4A A;  4NWY A;  5LCZ A;  1RQM A;  1XBS A;  1LBK A;  1PN9 A;  2YN1 A;  1EEJ A;  1UVZ A;  4IHU A;  2LRT A;  4OCE A;  3IC4 A;  4PQ1 A;  3N9J A;  4HQZ A;  3MNG A;  2ON7 A;  2HRK B;  2H0G A;  3LXT A;  1GL8 A;  1TU8 A;  1GSY A;  2PUK C;  2B7K A;  2JAD A;  2WUL A;  4MF5 A;  2HSN A;  1GUL A;  1TP9 A;  2H1A A;  2CAI A;  4E8H A;  4Z7X A;  2VD0 A;  3QMX A;  3WGD A;  2EIQ A;  2YP6 A;  4IP1 A;  2O89 A;  4IW9 A;  5BMU A;  1BYE A;  1FB0 A;  2GZP A;  2YCD A;  3HJO A;  3DVW A;  2KUC A;  3LG6 A;  1A2L A;  2YWO A;  2AHE A;  2HFD A;  2DMM A;  1M0U A;  4O32 A;  3A2X A;  3ZYW A;  3GA4 A;  2OE0 A;  2FA4 A;  1AW9 A;  4ZB7 A;  4EO3 A;  2HSN B;  4AKH A;  4IJI A;  2CAQ A;  4PQI A;  1GWC A;  4RI6 A;  1A0R P;  1WMJ A;  5BMU B;  5CO3 A;  5AN1 A;  1B48 A;  1EV4 A;  1PL1 A;  2OBK A;  4KB3 A;  2V32 A;  2L5L A;  4MA9 A;  1V9W A;  2GDR A;  1A24 A;  2HLS A;  2LKU A;  3F6F A;  3JCM L;  3GKN A;  4AJ7 A;  5HR0 A;  2UV8 G;  2C3T A;  3RAZ A;  1PD2 1;  3D5J A;  2DKH A;  1GSU A;  1EV9 A;  4O5R A;  2GTU A;  2IMF A;  2VLV A;  4MF7 A;  4F0B A;  3LFL A;  5IMC A;  1URM A;  5ELG A;  2HSH A;  2IMI A;  2WCI A;  4MPG A;  1TXX A;  4GWR A;  3MSZ A;  2I3Y A;  2YJ7 A;  3IE3 A;  2VL2 C;  1HNA A;  2LS5 A;  4HU9 A;  1GTU A;  2C1Y A;  3M8N A;  1PA3 A;  4WBJ A;  5J4Y A;  4K5S A;  2R3X A;  5ECR B;  4X1U A;  2X8C A;  2R0P A;  2H71 A;  4L0W A;  1TU7 A;  3VWV A;  2JU5 A;  1V58 A;  3H4K A;  1O73 A;  1YJ6 A;  1FG4 A;  5GZZ B;  2C3N A;  1V2A A;  2YNX A;  2E2M A;  1SYX A;  4NHW A;  1XWA A;  1XWK A;  3KP8 A;  1QMV A;  1J9B A;  2NTO A;  4ID0 A;  2ES7 A;  5C00 A;  1R5P A;  3Q6O A;  1SL2 B;  2BJX A;  1S3D A;  2KLX A;  1EZK A;  5G30 A;  3ZVJ D;  4IVF A;  1QUW A;  2UZ8 A;  5ABR A;  4ML6 A;  5AIS A;  3WD6 A;  3J7Y k;  5DAL A;  5ECP B;  1YF1 A;  4BPY A;  3DD3 A;  2QA1 A;  4KCA A;  3C73 A;  4HZ4 A;  2JZT A;  4G19 A;  4N3Z A;  4ZB9 A;  3CYN A;  3ZTL A;  3GL5 A;  16GS A;  1U3A A;  1DE1 A;  3C71 A;  1ERW A;  3WGE A;  2H0I A;  4MPF A;  1XW5 A;  3D22 A;  2K8V A;  2VCX A;  2GSQ A;  2AJQ B;  2JSZ A;  4CDO A;  4IQ1 A;  1EOH A;  4TR1 A;  4HS1 A;  4I5Q A;  1TRW A;  1EP7 A;  3A2V A;  3UL3 A;  2JZR A;  1ZGN A;  2VM1 A;  2HSM A;  1SKW B;  1S3A A;  1K0M A;  1MDI A;  3GIX A;  5GAP D;  2GZZ A;  1SL1 B;  4CW9 A;  3FY7 A;  2VAF A;  2A4V A;  1JHB A;  1JZW A;  3TCO A;  1ABA A;  1GTI A;  4MK3 A;  1TI3 A;  2PWJ A;  4CY6 A;  3D0Z A;  1H4O A;  3QD9 A;  2X49 A;  4AKI A;  4G0K A;  2G0F A;  1HNC A;  1EWX A;  3WT1 A;  2PN8 A;  4TR1 B;  2DML A;  2B5E A;  5KOW A;  5KN0 A;  2KP2 A;  3GRX A;  3CTF A;  2R37 A;  2HYX A;  1S3C A;  1YEP A;  2HZF A;  1KEB A;  4GTU A;  4KDY A;  3MDK A;  2YWN A;  4HQS A;  5ECN B;  4K6X A;  3L9U A;  2LNS A;  4AKG A;  1XXU A;  3IPZ A;  3IK9 A;  2IIY A;  6GST A;  2X8G A;  2EFH A;  4GCI A;  4MJA A;  4WXT A;  1OVN A;  1GSE A;  2XPE A;  4AJ6 A;  3EMP A;  2CZ2 A;  5DQS A;  3A5I A;  1TK8 B;  2QSI A;  1NM3 A;  2RM5 A;  3C1R A;  4KUN A;  1RW1 A;  1R7H A;  1X9W B;  4HJ2 A;  5JCU A;  3ZIT A;  1T4Z A;  3EVI A;  5B6N A;  5F0G A;  2X64 A;  4ILF A;  2VLU A;  5KOX A;  3U6V A;  1TW9 A;  3I43 A;  3BBY A;  3FZA A;  1I5G A;  5B8B A;  3CTG A;  2IMD A;  3FK8 A;  3BJ5 A;  5D9X A;  1VF4 A;  2WRT A;  3H93 A;  5F8B A;  3VWW A;  4YH2 A;  5ECM B;  1OC8 A;  11GS A;  2P31 A;  2GSS A;  5D9V A;  3BOA A;  1DE2 A;  5IPG A;  4V2L A;  1E2Y A;  5A5K A;  2JZS A;  1ACV A;  2PER A;  4EDY A;  1V57 A;  2C80 A;  5D9W A;  1O6J A;  4YQV A;  2IFQ A;  3HVV A;  4TKY A;  3FKF A;  4EKZ A;  5AIX A;  3L78 A;  2DJ3 A;  4EL1 A;  2VO4 A;  6GSW A;  5CRD A;  4N0V A;  3R2Q A;  1O7U A;  1THO A;  3QDN A;  1OAZ A;  4ECB A;  4ZBA A;  3F3Q A;  4XS4 B;  1ERU A;  2GT6 A;  2KOK A;  4FYB A;  1F2E A;  2HQT A;  2RLI A;  1NHY A;  1R5A A;  4KND A;  4XCS A;  2H6X A;  2FWF A;  2NDO A;  3RPN A;  1QXH A;  1R26 A;  2O5V A;  1KTE A;  2O8V B;  3TKP A;  3RPP A;  4K5R A;  1O8X A;  4K0G A;  1FHE A;  1B8X A;  2MMA A;  5A5H A;  1X9M B;  4XS6 A;  2IFQ B;  4POK A;  3TKS E;  2AB6 A;  9GSS A;  1XZO A;  1FO5 A;  4PGT A;  2YPM A;  3EWL A;  1WRY A;  1A2J A;  2I81 A;  4NXI A;  4OWY A;  1G0T A;  2MMZ A;  3HD5 A;  1B4Q A;  3HMJ G;  3VUR A;  2MYG A;  3QFA C;  3APO A;  1VF3 A;  5A5H B;  3GSS A;  5CRH A;  2YV9 A;  2GLR A;  1O85 A;  4I8B A;  2VIM A;  2DJ2 A;  4J56 E;  3D6I A;  3WGX A;  2FWH A;  3TJK A;  3RBT A;  1GLQ A;  4TR4 A;  2GQK A;  2VCZ A;  1X5D A;  1OE8 A;  2PU9 C;  2AYT A;  2X8H A;  4NMU A;  4Q5N A;  2IJY A;  3FW2 A;  4TVE A;  1T00 A;  3PH9 A;  4N10 A;  4ZB6 A;  3F4R A;  4N0Z A;  5DVB A;  3EE2 A;  2DJ0 A;  5GAN D;  2I9H A;  3BCI A;  2MMN A;  3KEB A;  3ZRD A;  4GXZ A;  2VD1 A;  4HUA A;  5IM9 A;  5H5S A;  2PGT A;  5A34 A;  1JZO A;  3RHC A;  2RM6 A;  1WOU A;  4IQA A;  2OT3 A;  4BL7 A;  1SEN A;  4LL1 B;  4AI6 A;  2A2S A;  4HZ2 A;  1Q4J A;  3UMA A;  4Q5F A;  4KCE A;  3M3M A;  3Q18 A;  1Y1U A;  1K0B A;  5G1K A;  2PBJ A;  5KN2 A;  2WGR A;  3P2A A;  3IK7 A;  2O7K A;  1PL2 A;  2P5R A;  3GX8 A;  5D73 A;  2LEG A;  3AY8 A;  1ZL9 A;  1NSW A;  3R3E A;  3DXB A;  1N2A A;  2WB9 A;  4I97 A;  1XCC A;  4W66 A;  1IYH A;  4BL7 B;  1YQ1 A;  4AF2 A;  2V2G A;  1MTC A;  5A4V A;  2L4C A;  3ME7 A;  1Y25 A;  2B6M A;  3ME8 A;  3ERF A;  4USS A;  4RUV A;  1EP8 A;  2DJJ A;  2PVO C;  5ECQ B;  3F9U A;  3GKM A;  1AUC A;  1T8E B;  1OE7 A;  4JR6 A;  3DVX A;  6GSV A;  4ECI A;  4XTS A;  1BG5 A;  1SJZ A;  2HE3 A;  3LYP A;  3VI7 A;  1V40 A;  4ULX A;  2PVQ A;  1GH2 A;  5HR1 A;  2HXK A;  5E59 A;  1PSQ A;  1Z3E A;  2NPB A;  3QCP A;  3IXR A;  1SU9 A;  4PUA A;  1XWB A;  2XHF A;  1E6B A;  3GST A;  1C72 A;  5LD0 A;  3L0H A;  4KDX A;  5ECH B;  1TK5 B;  3HDC A;  3KCM A;  3P90 A;  2FLS A;  2FCH A;  4ZBD A;  2CVK A;  1T4Y A;  3UBK A;  5HFK A;  2MZC A;  1GSF A;  3ZFL A;  5DBQ A;  3EUR A;  1F6M C;  4TOP A;  1K0C A;  2V41 A;  3ZMK A;  3WYW A;  3APS A;  1AAZ A;  3ZIJ A;  2TRC P;  5IIZ A;  4ZBB A;  5JCG A;  5IO0 A;  1GNE A;  3TJF A;  4RQX A;  1F3A A;  4X4J A;  1K0D A;  5GSS A;  4IEL A;  4MMM A;  1PN0 A;  4YAV A;  1X9S B;  3GHA A;  2FA8 A;  1DSB A;  2LNT A;  3FEU A;  5E4W A;  3UAR A;  5A1N B;  3QPM A;  5CRG A;  1CQH A;  2OBI A;  1B4P A;  1G6W A;  3TJJ A;  2NBS A;  4OFT A;  2EFE A;  2GVP A;  2L4Q A;  3IDV A;  2YAN A;  5J3R A;  4ZB8 A;  4KH7 A;  5CYY A;  3FR3 A;  2DJ1 A;  1OC3 A;  4DVC A;  3TKS C;  1BAY A;  1SVM A;  1N25 A;  5IOX A;  3VLN A;  2VCQ A;  5G2Z A;  4IS0 A;  2J9H A;  2WDU A;  1JZD A;  3FRC A;  4JBB A;  4XIH A;  1SD9 A;  4L5L A;  2YJH A;  2LJR A;  1MDJ A;  2YWM A;  1Q98 A;  3QAW A;  1VF1 A;  1ZYP A;  3KP9 A;  4DEJ A;  1ZOF A;  2C0F A;  2XBQ A;  1HNB A;  3EC3 A;  2GT5 A;  4OO4 A;  4QL7 A;  1A0F A;  3MIX A;  3W8J A;  1GTB A;  3PPU A;  1MEK A;  2JSY A;  4LA1 A;  2AAW A;  5ID2 B;  1SK0 A;  4FQU A;  3EYT A;  4MF6 A;  3CSI A;  1M2D A;  4YKG A;  5J9C A;  3HVS A;  2LJK A;  4J2F A;  2FWG A;  3UOM A;  1IYI A;  1FB6 A;  2DKI A;  4L8E A;  4TW5 A;  1JZR A;  4Q5Q A;  2C0D A;  1LJR A;  2HRN A;  4AKX B;  2VOC A;  4AGS A;  2QGV A;  1XIY A;  4BWQ A;  4WR5 A;  3GTU A;  3H8Q A;  3QOU A;  2B1L A;  3IR4 A;  4GDF A;  5H5Q A;  1MD3 A;  2L59 A;  3DWV A;  4MZC A;  2QKE A;  3E9J B;  4MJE A;  2CX4 A;  3A3T A;  3IAM 2;  4PTS A;  1J08 A;  2WFC A;  2DBC A;  1TXU A;  1Z6N A;  5INY A;  4E68 A;  2A4H A;  3BCK A;  5G31 A;  4GST A;  2LV3 A;  22GS A;  3DRN A;  2YV7 A;  3GTU B;  5C04 A;  1WP0 A;  3G7I A;  2BMX A;  4KGI A;  5D93 A;  3TDG A;  4JU5 A;  4EE0 A;  2H1D A;  5FHI A;  4G0I A;  4G01 A;  1JLW A;  2EFC A;  1SD8 A;  2OE1 A;  1PX7 A;  4D73 B;  3M9K A;  2VUP A;  3HHV A;  5D8I A;  1ST9 A;  1OKT A;  3FZ5 A;  4MNN A;  1ZMA A;  20GS A;  5ENU A;  2H72 A;  2R4V A;  1R4W A;  1DBY A;  3EIN A;  5EVO A;  1G6Y A;  4DSR A;  4GQC A;  3UJ1 A;  2HRF A;  2BTO T;  3LSZ A;  2HSY A;  4OD7 A;  1ERT A;  3KJY A;  2LTK A;  4MP4 A;  1H75 A;  2A2P A;  4V2N A;  4F2I A;  1K0N A;  2VL2 A;  2HI7 A;  4ICY A;  3TKS A;  2WJU A;  1XW6 A;  3Q19 A;  4L5O A;  2AV4 A;  1YKC A;  3IRA A;  5ELA A;  1GLP A;  3F63 A;  3DEX A;  3EU4 A;  5JWO B;  4FYC A;  3IBH A;  1K0O A;  4TXV A;  4XS4 A;  4GSS A;  3J7Y b;  1PQN A;  2MMO A;  3H79 A;  2HZE A;  4HI7 A;  1SJI A;  1THX A;  2TIR A;  2B1K A;  4KE3 A;  4YKF A;  1WJK A;  4K2D A;  3EMX A;  4O92 A;  2LQQ A;  5A4U A;  4I2U A;  4I2T A;  1ZCP A;  3GYK A;  4H86 A;  1DUG A;  3KIJ A;  3ISO A;  1QGV A;  1ZYE A;  4PNG A;  4IN0 A;  2DC5 A;  4G10 A;  3LJR A;  3A5W A;  3VFI A;  1TK0 B;  2VLT A;  1I9D A;  2H6Y A;  2N5A A;  1TJD A;  4XS1 A;  5J40 A;  2XPD A;  2HZE B;  3TOU A;  4KSM A;  5DQY A;  5CP1 A;  3TKR A;  2VL3 A;  4TR0 A;  5G1L A;  1A8L A;  2WZ9 A;  1LU4 A;  3PIN A;  2FNO A;  1ZZY A;  3C7M A;  3S9F A;  1EEM A;  2ZCT A;  3K8N A;  2H73 A;  1CQG A;  3TRX A;  1PGT A;  4EUY A;  2GGT A;  4E8E A;  1PMT A;  13GS A;  4BVY A;  2FD3 A;  2L6D A;  2J23 A;  1AIU A;  1O8W A;  5G5E A;  4NAX A;  3UAP A;  1GRX A;  5D9T A;  19GS A;  5HR2 A;  1FVJ A;  2CZ3 A;  5CRE A;  4KF9 A;  5DCH A;  2EFD A;  5IPH A;  3TU3 B;  1SYR A;  1ERV A;  5F07 A;  4K2X A;  1B9Y C;  5IMZ A;  4JRR A;  1Z7P A;  1TOF A;  2G2Q A;  4MCU A;  3UVT A;  1HD2 A;  3ZFB A;  1VRS D;  5H5R A;  4BVY B;  3APQ A;  4WF5 A;  1O81 A;  1SKS B;  3ZIV A;  3M0F A;  2L5O A;  3CXG A;  4CY8 A;  1XFL A;  4FO5 A;  4EDZ A;  7GSS A;  4X0X A;  1A8Y A;  1YY7 A;  5ECS A;  3GKX A;  2FWE A;  2H70 A;  5AIV A;  4WR4 A;  3D4T A;  5F05 A;  3VK9 A;  3GV1 A;  2VCW A;  1X5E A;  3MWH A;  1Z9H A;  5J4V A;  1U6T A;  2IPA A;  3IHG A;  2VL9 A;  3GKK A;  3F4S A;  2GZY A;  1MDK A;  1XVQ A;  2ON5 A;  2K18 A;  3GNJ A;  1G7O A;  2E0Q A;  2VCV A;  3G7Y A;  3WT2 A;  1AQX A;  4MLY A;  2V6O A;  2OE3 A;  2H6Z A;  3FZ4 A;  4A5P A;  1EOG A;  3L4N A;  4KDU A;  4BWS A;  2TRX A;  4XHM A;  2N5F A;  4JR4 A;  4DSS A;  4EIQ A;  3KH7 A;  3GUS A;  2O87 A;  1M2A A;  2KP1 A;  2DLX A;  1U88 A;  4FYU A;  3I6A A;  3TGZ A;  3TB2 A;  4MZW A;  1FAA A;  4WEY A;  3HA9 A;  2L6C A;  4Q5R A;  1F37 A;  2R2J A;  1UC7 A;  1XW9 A;  2LQO A;  3L9V A;  3GFK A;  1T7P B;  2FY6 A;  2QA2 A;  5HQP A;  4XRA A;  1MD4 A;  1SK1 A;  3NIV A;  14GS A;  5HR3 A;  5FWG A;  2DIY A;  4HEA 2;  3VPT A;  4PQH A;  4DSS B;  4G0L A;  5CRW A;  5CAX A;  3KMO A;  2YWI A;  2K9F A;  1XWG A;  4MH3 A;  1RK4 A;  5ECK B;  6GSS A;  3CSJ A;  1WWJ A;  2FUG 2;  3TRQ A;  5ECL B;  4WF4 A;  3KZQ A;  5HFG A;  1XOB A;  5DDL A;  1Y6E A;  4F0C A;  4V1A p;  4EF0 A;  3FMW A;  2H66 A;  2LJA A;  4V1A g;  2HT9 A;  3L9S A;  4F03 A;  4YQU A;  2FGX A;  1TRV A;  3FHK A;  3G9B A;  3KTL A;  2N5B A;  2JAC A;  2MBS A;  3GMF A;  2D2Z A;  3ZVJ A;  2CX3 A;  6GSX A;  2H8L A;  4GSN A;  3F6D A;  2M46 A;  5A1N A;  2H0H A;  4LLR A;  2R5G A;  1USB A;  1GNW A;  1TDI A;  5KEJ A;  3MYD A;  4POB A;  2QC7 A;  5J41 A;  2K8S A;  5J47 A;  2P5Q A;  4GQF A;  3QAV A;  4O5Q A;  4AJ8 A;  3DYR A;  2EC4 A;  2H1L A;  3ERW A;  4RQR A;  5JWQ B;  2PMT A;  4MJB A;  4P3Y B;  3TRP A;  4JE1 A;  2IN3 A;  3GH9 A;  1NW2 A;  2R6K A;  3IC8 A;  1AQW A;  3QAG A;  1SK2 A;  1W89 A;  3IA1 A;  1ZYN A;  2NVL A;  3F3R A;  3QR6 A;  4GF0 A;  1FOH A;  2B5X A;  4ECJ A;  4QQ7 A;  1OC9 A;  1K0A A;  2WS2 A;  2V1M A;  3TJG A;  1U3I A;  1UN2 A;  3P8W A;  1N8J A;  4N30 A;  1M7T A;  3HZ4 A;  4MJC A;  1Z7R A;  2A2R A;  3LEF A;  5B6M A;  4NV5 A;  4F82 A;  4YAP A;  2LRC A;  1A23 A;  4G9H A;  5DJM A;  3E0U A;  5IMF A;  5J9B A;  2H74 A;  1G7E A;  3D4M A;  3SBC A;  2CQ9 A;  1T1V A;  4EVM A;  5CNW A;  5IMV A;  4IBP A;  2HNL A;  4K7I A;  3QFB C;  1OC9 B;  2F8F A;  2LST A;  3G7J A;  4BVX A;  1TRU A;  3VPQ A;  4QL9 A;  4LMW A;  5IMD A;  1AXD A;  2XBI A;  1GUM A;  3FR9 A;  5ID2 A;  1GSQ A;  4K7O A;  1QQ2 A;  1F9M A;  4MAB A;  3GUR A;  6GSY A;  3KD0 A;  1GSD A;  3HYP A;  4PUR A;  3US3 A;  3ZRE A;  3ED3 A;  5DCG A;  2B7J A;  4ISD A;  2H30 A;  3ZL5 A;  5AGY A;  2C0G A;  3RDW A;  5GST A;  5EL8 A;  2CT6 A;  4HOJ A;  3Q74 A;  4ZXG A;  4TR3 A;  2H76 A;  3PR8 A;  1F3B A;  2C0E A;  4BVX B;  4PX1 A;  3CWG A;  1BG1 A;  1T3B A;  4K9Z A;  1EGO A;  3HY2 A;  1BED A;  2IMK A;  3FR6 A;  4TRX A;  4HDE A;  3ZZX A;  2REM A;  3DML A;  2F8A A;  2O85 A;  2CV4 A;  3CRU A;  3IOS A;  5JWR B;  2OAD A;  3LXZ A;  6GSU A;  5IO2 A;  2GSR A;  2V6K A;  3KXO A;  3SWL A;  3RHB A;  4HU7 A;  3F0I A;  1XWC A;  5B8A A;  4JED A;  1Z5Y E;  2B5Y A;  4X43 A;  3I69 A;  2JL4 A;  1TRS A;  4LL4 B;  1TTZ A;  1YZX A;  1TKD B;  4DSQ A;  2GQM A;  1SVL A;  4K1F A;  5FT3 A;  1XVW A;  1KNG A;  5B7C A;  4FH8 A;  5DAL B;  4MZB A;  3VWX A;  2KHP A;  4O7H A;  1BF5 A;  4OMV A;  2X4A A;  1VF2 A;  2GQL A;  4D73 A;  2CVD A;  2C8U A;  5EPF A;  5BRT A;  1Z6M A;  1W4V A;  3GX0 A;  1A2M A;  4EIP A;  2H1B A;  4FIW A;  3GL3 A;  1PKW A;  5COH A;  2DSA A;  1AQV A;  2H75 A;  1BQ7 A;  2HRA A;  2E7P A;  2IL3 A;  2OA7 A;  2LUS A;  5F06 A;  4PUF C;  10GS A;  1HYU A;  1OYJ A;  3TUE A;  2HSM B;  2Z9S A;  5D96 A;  3KGK A;  3DGQ A;  4Z2T A;  3CSH A;  4IJ3 A;  3W8S A;  1K3Y A;  1AC1 A;  2DJK A;  3DIE A;  1FVK A;  3EU3 A;  2XC2 A;  2FHE A;  5KN1 A;  3M9J A;  5DAK A;  4WKW A;  2H01 A;  2M80 A;  3DKS A;  2P0G A;  3LOR A;  2C3Q A;  3KM6 A;  1YEX A;  4HJM A;  2VCT A;  4TXO A;  4XRD A;  3TOT A;  4O5U A;  3HCZ A;  3HVX A;  2VKZ G;  1K3L A;  4I6X A;  3E3E A;  4KA0 A;  1SKR B;  3D21 A;  1XOA A;  4IKH A;  4GLT A;  3LWA A;  8GSS A;  4RI7 A;  4L0U A;  2L57 A;  1KBN A;  4MH2 A;  2CA8 A;  2H1G A;  2K6V A;  2OKA A;  2PPT A;  3O3T A;  3VI5 A;  4OFM A;  4ZIJ A;  3TJB A;  5DAK B;  2I1U A;  5J5N A;  3NZN A;  4WET A;  4LMV A;  1QK8 A;  1EGR A;  5ECI B;  3GH6 A;  1XPV A;  2X99 A;  1GP1 A;  3UIW A;  3HXS A;  3I9V 2;  4TXO B;  1YKA A;  3CMI A;  3KH9 A;  3U5R E;  1PX6 A;  5G5F A;  2OJL A;  5KN3 A;  2EIO A;  1SL0 B;  2ZNM A;  3LQ7 A;  4KX4 A;  3ZML A;  3O6T A;  4QMK A;  2OAC A;  2E2G A;  3A2W A;  5EY6 A;  4ZL9 A;  4ZL7 A;  3O76 A;  4TN8 A;  4OCF A;  4NHZ A;  3BD2 A;  1OKD A;  1ZYQ B;  1X0R A;  2M72 A;  1B9X C;  3M1G A;  1M99 A;  3HJM A;  2RUE A;  3MAK A;  4ACS A;  2IWT A;  3ZLP A;  2YZU A;  2GS3 A;  1NHO A;  17GS A;  1PKZ A;  4WBR D;  1ON4 A;  5IQY A;  4KAE A;  4K8M A;  1GSS A;  3F4T A;  3FYG A;  1TI1 A;  4NPB A;  5DJL A;  2R0G A;  4EC0 A;  3F8U A;  1WIK A;  1WPI A;  2RUF A;  3EPT A;  4MDC A;  4NV2 A;  2CVB A;  1JFU A;  2AUV A;  3LGC A;  4KW6 A;  5HFI A;  1YDK A;  2IME A;  2ZUP A;  3OR5 A;  1JLV A;  4GRF A;  1J0F A;  1SJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...