5JCWA

Crystal structure of hgstp1-1 with glutathione adduct of phenethyl isothiocyanate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Irreversible Inhibition of Glutathione S-Transferase by Phenethyl Isothiocyanate (PEITC), a Dietary Cancer Chemopreventive Phytochemical.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5jcwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5jcwA01
3EYTA 2YV7A 2P0GA 1XOBA 4KA0A 4BWQA 2HYXA 4BL7B 2FY6A 2DC5A 3LXTA 4TKYA 5IMDA 2B6MA 4RI7A 2DJ0A 2V41A 3Q6OA 4MF5A 3QR6A 4FYCA 4HOJA 2IIYA 2WJUA 3VFIA 4J2FA 1GTIA 1ZCPA 4ZL8A 4WXTA 5CNWA 5ECRB 1C72A 1JZRA 5J4UA 1BX9A 1RQMA 3UIWA 2E0QA 1ZYEA 5A5KA 2HRKB 4LL4B 5B7CA 2GVPA 4WBJA 1JZOA 1GTAA 3QFAC 4IKHA 3TKSE 4MK3A 4NHZA 5J9BA 2MBTA 1S3DA 3FRCA 4LMVA 1QFNA 1ZL9A 2BMXA 3HVXA 4EDZA 3RBTA 2YWIA 2OE3A 3EC3A 2O87A 3I43A 4PGTA 1DUGA 3QD9A 3F6DA 4G0IA 1DBYA 2V2GA 2F8AA 4F82A 4GSTA 1XW9A 4PURA 2HI7A 3A2VA 4D73A 2E7PA 4NWYA 1SD8A 3M3MA 1UA5A 3FZAA 2A4VA 2GGTA 4HDEA 2IMDA 5JCGA 2H75A 3EMPA 1X5DA 5F05A 4LMWA 2YPMA 1GTBA 3PPUA 1Z9HA 5DDLA 2DJ2A 4N30A 1OVNA 4K6XA 1V2AA 4JE1A 3ZYWA 3VPQA 1ERUA 3DWVA 5CRWA 3TRPA 2GS3A 4JBBA 1FW1A 2PERA 2EIOA 3APQA 5A4VA 4KSMA 4O7HA 3O6TA 3UBLA 1O81A 4G9HA 3GIXA 1H4OA 1AQVA 1VRSD 2RIIA 3BJ5A 4ZBBA 3CTFA 1XWGA 4V2MA 3ZL5A 2VUPA 3R2QA 5D9VA 2H1DA 2WDUA 3GFKA 4PQHA 2KLXA 4DEJA 5HR0A 3QPMA 4PNGA 3D21A 5C00A 4MH2A 5IM9A 1EEJA 1VF2A 1S3AA 2O85A 4I8BA 2EC4A 3WT1A 3IHQA 2B7JA 1WPIA 3L9SA 5JWOB 4KSOA 1Y6EA 4MABA 3TUEA 1YY7A 3WGEA 4L0UA 1USBA 3C1RA 2H1BA 2BJXA 3W6GA 2RLIA 3E3EA 4KE3A 2YWNA 4GCIA 3D22A 1MDIA 4KF9A 2E2GA 2F8FA 4HUAA 4I5QA 3A2XA 3FYGA 3GL3A 1TU8A 2GDRA 4FQUA 1HYUA 1AUCA 2B5EA 1N2AA 2LV3A 3UJ1A 3GURA 5DQSA 1AQXA 3CYNA 2DJ1A 4XIHA 1WWJA 3VI7A 4PQ1A 1GUMA 5DALA 2HFDA 5IO0A 4JEDA 2FUG2 3A2WA 3D4TA 1O73A 2EIRA 3EU4A 1YEPA 3L4NA 3VWWA 2I3YA 3CXGA 3G7YA 3VURA 2JACA 2I81A 2VIMA 4K8MA 2YNXA 5G2ZA 1EV4A 1GSEA 3QDNA 3CRUA 4AGSA 5CREA 2XPEA 2NBSA 1T7PB 2CZ2A 2K6VA 2GSTA 2N5FA 18GSA 3ZITA 1PL1A 3C73A 1XW5A 4XS4A 2C0DA 2A2RA 1SD9A 4YQUA 2WB9A 2MMOA 3TKPA 1CQGA 4WF4A 1J08A 4POBA 2KP2A 1A23A 2C3NA 1HNAA 2VCXA 4ML6A 4GRFA 1GSSA 2VL9A 1X0RA 2LRTA 2VL2C 2G0FA 19GSA 2CX3A 3KIJA 3ZREA 2DJ3A 2M72A 1O8WA 1Z7RA 1GLPA 1M0UA 1VF4A 3IK7A 4IELA 3W8JA 2YJHA 3MSZA 4TRXA 5KN0A 13GSA 3ED3A 3UARA 4ZXGA 2H71A 2MMNA 1PX7A 1LU4A 4PUFC 1M2DA 2G2QA 1ZZYA 2VO4A 4OFMA 3MWHA 3RDWA 5CYYA 4TXOA 3OR5A 3BCIA 4POLA 1SKRB 4IGJA 1FG4A 5JWRB 3UL3A 4KDXA 3KTLA 1B4QA 1SKWB 2AB6A 2H01A 2H30A 2HSYA 1GUHA 2GSSA 3M8NA 2GZZA 3QAGA 4FO5A 5IPHA 4TOPA 5FHIA 1PN9A 5D8IA 2HSMA 4PXOA 4GSNA 5FWGA 4ID0A 4L8EA 2H0GA 2AYTA 4JU5A 4ECIA 5ECKB 5JCUA 3EU3A 5HR1A 2IN3A 2TRCP 1B9YC 1ZYQB 1SL0B 3FW2A 1KBNA 3HDCA 2K18A 2ZUPA 2PGTA 2HSHA 6GSTA 2J9HA 9GSSA 1TU7A 5DAKB 1PRXA 2HLSA 4I2UA 2H6XA 3RHBA 2IWTA 2LKUA 3LGCA 1SJZA 2VLUA 1A8YA 1XWKA 1Q4JA 3HJPA 2N5AA 4TR0A 4IQAA 3QAWA 4QL7A 3U5RE 5EL8A 1ERWA 3DVWA 3TDGA 1NHYA 4KX4A 2ES7A 1FB0A 1V9WA 1GSUA 2E2MA 3ZMLA 3VWUA 1SL2B 1OKDA 3DD3A 3WT2A 3IA1A 1SYRA 5CAXA 1XVQA 8GSSA 2JSZA 1GSQA 2R37A 3LFLA 5ECLB 3LXZA 2JU5A 2FWHA 1FAAA 5AIVA 1XWAA 1A24A 3IC8A 2R4VA 4BVYB 1VF3A 3ERFA 3IAM2 4DSSB 2H1AA 1E2YA 1GL8A 1THOA 1MD3A 4BVXB 5A4UA 5ELGA 1JZWA 2CAQA 1FO5A 2OBKA 2JSYA 1XVWA 2DMMA 1G7OA 1PKWA 3EWLA 5D96A 4EUYA 1W4VA 1M99A 3IE3A 3QOUA 3DEXA 2C1YA 2B3SA 5L71A 2XC2A 4GWRA 4IN0A 3MDKA 2WULA 4EXJA 3KEBA 4MLYA 1EGOA 2ON7A 2VD1A 12GSA 1MEKA 1SKSB 3C71A 3RHCA 3TOTA 4V1Ap 4CW9A 4YH2A 5LNKe 2UZ8A 3SWLA 4OD7A 4K7IA 4ZIJA 3HCZA 4YQVA 1KEBA 2F51A 2ZNMA 2JZRA 4F0CA 4X43A 5KN1A 4XS1A 5ID2A 1G0TA 5GSSA 3P90A 3CBUA 4G19A 3ZTLA 4MP4A 3WYWA 1XOAA 2L4CA 1ZMAA 1GTUA 4G10A 1X5EA 4X1UA 1Y25A 5IQYA 4EC0A 1XW6A 2AUVA 3HYPA 4RI6A 2NTOA 2A2SA 2KP1A 4ZL9A 5DVBA 4OFNA 3G9BA 1BJXA 3Q74A 2B5YA 2FCHA 2WZ9A 1TK8B 5DQYA 4K1FA 3F4TA 3IDVA 2C80A 5EY6A 1O6JA 1TJDA 2YZUA 4NHWA 2L59A 1GWCA 1SK1A 4PNFA 3M0FA 5IOXA 5CRGA 1UN2A 3WGDA 2BTOT 4MPFA 4WBRD 2CQ9A 2YWMA 4NV2A 3FR9A 1I9DA 2H6YA 2HZEA 4L5LA 3PH9A 3GNJA 3TOUA 1XFLA 5GAND 5G1LA 3ZZXA 2OBIA 2YJ7A 2P5QA 4GXZA 2H8LA 3VLNA 4RUVA 4X0XA 1QQ2A 3FZ9A 4AJ8A 1XBSA 4Q5RA 2HRAA 1F3BA 2X8GA 3TJJA 1SL1B 2HRKA 4MDCA 5HFIA 3J7Yb 4ML1A 1WE0A 5D73A 1GSFA 1OE7A 3HJOA 3VPTA 2OACA 3CSHA 2PMTA 5D93A 4ECJA 1VF1A 2YV9A 1XZOA 1GUKA 2FHEA 4ISDA 3M9KA 1R26A 4MJCA 4JR6A 2L6CA 3LORA 4IVFA 6GSXA 3D0ZA 3IV4A 5F0GA 3GTUA 2R3XA 4TXVA 3CTGA 1PGTA 2PVOC 4NV5A 2OADA 4N11A 1WOUA 4K0GA 3FKFA 2R5GA 3UEMA 5DBQA 3KD0A 2PN8A 4QL9A 2HRNA 5F06A 1XWBA 1CQHA 4IQ1A 6GSWA 2O8VB 2RUEA 1TTZA 3N5OA 3TCOA 3EE2A 3ZIVA 1TP9A 3APOA 3UVTA 2VLTA 4JR4A 3MNGA 4XRAA 3APSA 4NAXA 2AV4A 3BD2A 2Z9SA 1O85A 3GRXA 3LJRA 2L5OA 1YKAA 1YQ1A 5AGYA 16GSA 4FYUA 3US3A 3GX8A 4KCEA 3M9JA 1N8JA 3D4MA 2MBSA 2DLXA 3LG6A 3QCPA 4OWYA 1HNCA 3E9JB 3ME8A 2H1GA 4P3YB 1XIYA 1Z6NA 3C7MA 2HXKA 3F6FA 1PKZA 4BPYA 4PQIA 2AJQB 1YDKA 3G7JA 5ECHB 5H5SA 2LJKA 2V6OA 3W8SA 1G7EA 3WD6A 4K7NA 1PL2A 2CVDA 3EINA 1TI3A 4EL1A 4K2DA 4MZCA 5GAPD 3KP9A 3S9FA 4MMMA 2DIZA 4MF7A 4IS0A 4ZBAA 2CT6A 4ZL7A 1WMJA 3V1WA 2I1UA 5BMUA 3L78A 4MZWA 4OO5A 4RQXA 1F3AA 1R5PA 2QC7A 3DIEA 1T3BA 1GSDA 1YJ6A 2C8UA 3F0IA 3BCKA 2EIQA 3HA9A 4XTSA 3FR3A 2VM1A 2YCDA 1OC9B 1W89A 2QGVA 4GQCA 1ABAA 2V1MA 4F9ZA 5IO2A 3FHKA 4IP6A 4V2LA 2M80A 4V1Ag 4DSQA 2KOKA 2B7KA 2MMAA 4KB3A 1V98A 4IJ3A 4PX1A 1TRWA 3TRXA 3O76A 5ECQB 5ELAA 1TK5B 3FK8A 3UOMA 1YEXA 2MYGA 2LEGA 4EF0A 2NVLA 1EWXA 3TJFA 1H75A 3DKSA 4GTUA 2FD3A 1ST9A 1DE2A 3J7Yk 2XBQA 3TKQA 4L5OA 4EE0A 1OE8A 3RPNA 2VCTA 5J3RA 4TR1B 1X9MB 3KXOA 5HR2A 1WJKA 4YQMA 2TRXA 5B6NA 2PVQA 5F07A 1O8XA 3F3QA 1R7HA 2DBCA 1JFUA 4EVMA 2V6KA 5JCWA 3Q19A 1Z5YE 3LEFA 4HJMA 1JLVA 2FGXA 3HKRA 3HVSA 3LQ7A 4OMVA 2LQOA 1WIKA 2CVBA 3IAS2 1HD2A 4RQRA 4HQZA 5IMAA 3GV1A 1EP8A 4MJAA 3ZMKA 4L0WA 1TRUA 1OYJA 2FWEA 2JZSA 4O92A 5AISA 3IOSA 3GA4A 1BYEA 1QGVA 2NPBA 2C3TA 3K8NA 3VWVA 3QFBC 4K7OA 4ZB8A 5ECOB 4MA9A 2VAFA 2JL4A 1TDIA 1TRVA 2H76A 3ZFLA 2GSQA 1ILOA 2HNLA 2C4JA 4PTSA 3GKMA 2PBJA 1LJRA 5FT3A 3F4RA 3N9JA 2QSIA 1K0BA 3KJYA 2CV4A 1F6MC 4I2TA 5ABRA 2GQMA 3NOFA 4WR4A 3ISOA 2B1LA 4XRDA 5D9XA 3TKSC 3HD5A 2O7KA 1B9XC 2MZCA 2YN1A 3FZ5A 4K9ZA 5DAKA 4V2NA 3GH6A 1B48A 1K0OA 1MDKA 2FWGA 2TIRA 1V40A 1EOHA 1M9AA 2LJRA 1G6YA 1URMA 2X8HA 2IFQB 3GHAA 1LBKA 3GX0A 4TR3A 2CX4A 2HSNB 2L4QA 3AY8A 5AN1A 2XPDA 1AQWA 2L5LA 1OKTA 1MD4A 5GZZB 2AHEA 4BWSA 4HZ4A 5B8BA 3GMFA 5J5NA 2VM2A 3A3TA 5CRHA 4I97A 3GN3A 3TRQA 5CP1A 1SENA 2F9SA 1YF1A 3O3TA 3TB2A 5G30A 1U88A 3C1SA 2GLRA 5IOWA 1FB6A 5JWQB 2GTUA 2YWOA 5G5EA 1GH2A 5IMVA 4N0VA 2H73A 2PUKC 2J23A 2O89A 2RM5A 1J9BA 3F4SA 4KW6A 4FH8A 4H86A 4EKZA 4BVYA 3BBYA 1TW9A 2OJLA 1AAZA 5G1KA 4DSSA 3DMLA 1A0FA 4N10A 4O32A 5IPGA 1ZGNA 1Z7PA 1XPVA 4HQSA 1U3AA 5HQPA 6GSYA 4KUNA 4ZBDA 3RPPA 1V58A 1M7TA 2HZEB 1GNEA 11GSA 1TI1A 2OKAA 3E0UA 7GSSA 2REMA 4BA7A 4WR5A 3H93A 3WGXA 3KH7A 4OFTA 2LQQA 3HZ4A 3PINA 2N5BA 2FA8A 4HS1A 2DJKA 3TJGA 2HZFA 1A2LA 4I6XA 1IYHA 2X99A 4D73B 4GQFA 3DGQA 1JLWA 4Q5QA 2GQLA 2M46A 2XHFA 4DVCA 2V32A 1XXUA 4IHUA 2OE0A 3P7XA 4O5RA 5DCGA 3G7IA 1AIUA 2LS5A 1K3YA 3LYPA 3QAVA 5B6MA 1T4YA 2CAIA 4E8HA 3KMNA 1GULA 3LSZA 5E4WA 5ECMB 4ILFA 2AAWA 4BL7A 1WP0A 3D5JA 1VGLA 2LUSA 4F03A 2H70A 1UVZA 3TKRA 4ZILA 1B4PA 4YAVA 1QUWA 4LA1A 3FR6A 3IK9A 10GSA 1K3LA 3GTUB 3QMXA 2VCVA 3F3RA 1A2JA 4IBPA 2VD0A 3KTBA 3PGTA 2YOIA 4IJIA 5H5RA 2IMKA 6GSVA 1U3IA 3I6AA 3GL5A 1AW9A 1YZXA 3DYRA 5D9TA 5HFGA 2KHPA 4GLTA 1YF0A 1S3CA 3UAPA 1DSBA 1FOVA 5DJMA 1T8EB 1SU9A 4YAPA 5ECNB 22GSA 1U6TA 3H4KA 1UC7A 4PUAA 4LLRA 1YKCA 2DSAA 4FYBA 20GSA 1FVJA 3L9VA 3TKSA 1TXXA 5DJLA 3ZFBA 4Q5NA 5ECSA 4ACSA 3ZVJD 1T1VA 4JRRA 2PWJA 3M1GA 1JZDA 5CRDA 4G0KA 4POKA 4J57E 2GSRA 2IJYA 3CRTA 3L9UA 4XHMA 2P31A 4MJBA 4CDOA 1KTEA 5EVOA 1SYXA 5KEJA 2R2JA 4MJEA 3R3EA 3H1NA 4MPGA 2IMFA 4HEA2 1XCCA 5HFKA 4WEYA 2VCQA 2IMIA 3MAKA 4LL1B 1SK0A 1HNBA 2B1KA 1V57A 1F2EA 3FY7A 2VCZA 1X9SB 2PPTA 2GQKA 3UMAA 2DMLA 4KDYA 2H0HA 4KH7A 3PR8A 5DALB 2C3QA 1JHBA 4OO4A 1E6BA 1F37A 4XS6A 3VI5A 4JZQA 5AIXA 2LNSA 3IRAA 4J56E 2YANA 3A5WA 3ME7A 2VOCA 2I4AA 1NW2A 4XCSA 4E8EA 1K3OA 2OA7A 3VK9A 4HZ2A 2H0IA 4Z7XA 2DIYA 3CSJA 4GF0A 4IP1A 3UBKA 1EP7A 3GKXA 4AJ7A 4ULXA 1ERTA 4DSRA 2RM6A 4XS4B 4G2EA 2X64A 3IPZA 2YZHA 2OE1A 1NM3A 1RK4A 4K0NA 2K8VA 3HJMA 1QXHA 2LSTA 2GZPA 2H72A 4POMA 2H6ZA 3IBHA 2K8SA 2ZCTA 1WRYA 2B5XA 5J41A 1THXA 3KCMA 2JADA 1Z6MA 1BAYA 2XBIA 3DXBA 3H8QA 4G0LA 2YP6A 4MZBA 5IMFA 4TW5A 1NHOA 2LRNA 1Q98A 2I9HA 5CO3A 1SK2A 1M9BA 2PU9C 1MDJA 1ERVA 3FEUA 1U87A 5G31A 1K0NA 4AJ6A 3F8UA 4Q5FA 1PA3A 1PX6A 1F9MA 2LRCA 5LCZA 4TXOB 1TKDB 1EGRA 4N0ZA 2H66A 2GT5A 2ALBA 4NMUA 3CMIA 3P2AA 1O7UA 4TR4A 3JCML 4ECBA 4KNDA 1OC3A 1PMTA 1M2BA 2HSMB 2GZYA 5E59A 1ML6A 2L6DA 2X8CA 1QMVA 4TN8A 4WKWA 3GUSA 1NSWA 3NIVA 2HT9A 3GSSA 3KMOA 3TJBA 5LD0A 4KDUA 3TJKA 1OAZA 4F0BA 5EPFA 2IL3A 14GSA 2FA4A 5B8AA 3EVIA 5HR3A 3CSIA 4KAEA 2WS2A 3HY2A 2VL3A 2VCWA 2C0EA 3KM6A 3ERWA 4WETA 3EMXA 2GT6A 1KNGA 2CA8A 4KGIA 1OC9A 5DCHA 3GSTA 1A2MA 1TOFA 3NZNA 5H5QA 2VLVA 1K0MA 3HXSA 4GSSA 3EURA 1AC1A 1K0DA 1DE1A 4EDYA 1IYIA 3I69A 3D6IA 1MTCA 3IXRA 3DVXA 1XWCA 4HU7A 4QQ7A 2ON5A 4HU9A 1R4WA 3UVHA 3HZ8A 1EZKA 4IW9A 3I9V2 3HHVA 3P8WA 3KGKA 2QKEA 2K9FA 2WGRA 1PSQA 1ACVA 2HRFA 2CZ3A 3H79A 2HE3A 1AXDA 2WCIA 4TR1A 3GYKA 3IC4A 1K0AA 5KN2A 1TRSA 17GSA 2FLSA 1FHEA 3SBCA 1GSYA 2MMZA 3F9UA 3ZVJA 2LJAA 3GKNA 1ZOFA 1Z3EA 2R6KA 3IR4A 2C0GA 1TK0B 1I5GA 4OCEA 2FWFA 4ZB9A 3GH9A 4OCFA 1PD21 2C0FA 2WRTA 1EOGA 1HQOA 1BEDA 1OC8A 4ECCA 2IPAA 5INYA 5ECIB 3RAZA 4F2IA 1SJ6A 3LWAA 2IMEA 5GSTA 3Q18A 4WF5A 2CVKA 4EO3A 3LYKA 2DJJA 4HJ2A 4CHSA 5IMCA 2LNTA 5KN3A 1GLQA 1T00A 4NPBA 3KZQA 3ZRDA 4FIWA 1A0RP 1FVKA 4MH3A 4KCAA 3U6VA 3FZ4A 1SJIA 5F8BA 2HQTA 5D9WA 3HVVA 1BG5A 1T4ZA 2FNOA 2RUFA 5G5FA 1M2AA 1R5AA 1QK8A 2LTKA 5ID2B 3ZLPA 4MF6A 4TVEA 2H74A 1GP1A 4USSA 2WFCA 1ON4A 1PQNA 2F3MA 4ZB6A 2D2ZA 1GNWA 1GRXA 3ZIJA 5ECPB 6GSUA 3F63A 1X5CA 1EEMA 5COHA 1X9WB 3VWXA 5C04A 5ENUA 1K0CA 3DRNA 4NXIA 2P5RA 1BQ7A 3L0HA 5IIZA 2NDOA 4MCUA 2JZTA 5A4WA 3C8EA 4HI7A 1A8LA 5IMZA 3BOAA 2L57A 1B8XA 3KP8A 1RW1A 2H19A 6GSSA 4AF2A 2VL2A 3TGZA 1G6WA 2KUCA 4BVXA 3KH9A 5J9CA 1J0FA 3ERGA 1EV9A 2IFQA 3GKKA
chains in the Genus database with same CATH superfamily
3EYTA 2YV7A 2P0GA 2HSNA 1XOBA 4KA0A 4BWQA 2HYXA 4BL7B 2FY6A 2DC5A 2R0GA 3LXTA 4X4JA 4TKYA 5IMDA 2B6MA 4RI7A 2DJ0A 2V41A 3Q6OA 4MF5A 3QR6A 4FYCA 4HOJA 2IIYA 2WJUA 3VFIA 4J2FA 1GTIA 1ZCPA 4ZL8A 4WXTA 5CNWA 5ECRB 1C72A 3CHXC 1JZRA 5J4UA 1BX9A 1RQMA 3UIWA 2E0QA 1ZYEA 5A5KA 2HRKB 4LL4B 5B7CA 2GVPA 4WBJA 1JZOA 1GTAA 3QFAC 4IKHA 3TKSE 4MK3A 4NHZA 5J9BA 2MBTA 1S3DA 3FRCA 4LMVA 1QFNA 1ZL9A 2BMXA 3HVXA 4EDZA 3RBTA 2YWIA 2OE3A 3EC3A 2O87A 3I43A 4PGTA 1DUGA 3QD9A 3F6DA 4G0IA 1DBYA 2V2GA 4MNNA 2F8AA 4F82A 4GSTA 1XW9A 4PURA 2HI7A 1YVLA 3A2VA 4YKFA 4ZB7A 4D73A 2E7PA 4NWYA 1SD8A 3M3MA 1UA5A 3FZAA 4E68A 2A4VA 2GGTA 4HDEA 2IMDA 5JCGA 2H75A 3EMPA 1X5DA 5F05A 4LMWA 2YPMA 1GTBA 3PPUA 1Z9HA 5DDLA 2DJ2A 4N30A 1OVNA 4K6XA 1V2AA 4JE1A 3ZYWA 3VPQA 1ERUA 3DWVA 5A5HA 5CRWA 3TRPA 2GS3A 4JBBA 1FW1A 2PERA 2EIOA 3APQA 5A4VA 4KSMA 4O7HA 3O6TA 3UBLA 1O81A 4G9HA 3GIXA 1H4OA 1AQVA 1VRSD 2RIIA 3BJ5A 4ZBBA 3CTFA 4PI0C 1XWGA 5A1NB 4V2MA 3ZL5A 2VUPA 3R2QA 5D9VA 2H1DA 2WDUA 3GFKA 4PQHA 2WW3A 5J40A 2KLXA 4DEJA 5HR0A 3QPMA 4PNGA 3D21A 5C00A 4CY8A 4MH2A 5IM9A 1EEJA 1VF2A 1S3AA 2O85A 4I8BA 2EC4A 3WT1A 3IHQA 2B7JA 1WPIA 3L9SA 5JWOB 4KSOA 1Y6EA 4MABA 5BMUB 3TUEA 1YY7A 3WGEA 4L0UA 1USBA 3C1RA 2H1BA 2BJXA 3W6GA 2RLIA 3E3EA 4KE3A 2YWNA 4GCIA 3D22A 1MDIA 4KF9A 2E2GA 2F8FA 4HUAA 4I5QA 3A2XA 3FYGA 3GL3A 1TU8A 2GDRA 4FQUA 1HYUA 1AUCA 2B5EA 1N2AA 2LV3A 3UJ1A 3GURA 5DQSA 1AQXA 3CYNA 2DJ1A 4XIHA 1BF5A 1WWJA 3VI7A 4PQ1A 1GUMA 5DALA 2HFDA 5IO0A 4JEDA 2FUG2 3A2WA 3D4TA 1O73A 2VKZG 4AKXB 2EIRA 3EU4A 1YEPA 3L4NA 2R0PA 3VWWA 2I3YA 3CXGA 3G7YA 3VURA 2JACA 2I81A 2VIMA 4K8MA 2YNXA 5G2ZA 1EV4A 1GSEA 3QDNA 3CRUA 4AGSA 5CREA 2XPEA 2NBSA 1T7PB 2CZ2A 2K6VA 2GSTA 2N5FA 18GSA 3ZITA 1PL1A 3C73A 1XW5A 4XS4A 2C0DA 2A2RA 1SD9A 4YQUA 2WB9A 2MMOA 3TKPA 1CQGA 4WF4A 1J08A 4POBA 2KP2A 1A23A 2C3NA 2X49A 1HNAA 2VCXA 2WW1A 4ML6A 4GRFA 1GSSA 2VL9A 1X0RA 2LRTA 2VL2C 2G0FA 19GSA 2CX3A 3KIJA 3ZREA 2DJ3A 2M72A 1O8WA 1Z7RA 1GLPA 1M0UA 1VF4A 3IK7A 4EIQA 4IELA 3W8JA 2YJHA 2X4AA 3MSZA 4TRXA 5KN0A 13GSA 3ED3A 3UARA 4ZXGA 2H71A 2MMNA 1PX7A 1LU4A 4PUFC 1M2DA 2G2QA 1ZZYA 2VO4A 4OFMA 3MWHA 3RDWA 5CYYA 4TXOA 3OR5A 3BCIA 4POLA 1SKRB 4IGJA 1FG4A 5JWRB 3UL3A 4KDXA 3KTLA 1B4QA 1SKWB 2AB6A 2H01A 2H30A 2HSYA 1GUHA 2GSSA 3M8NA 2GZZA 4N3ZA 3QAGA 4FO5A 5IPHA 4TOPA 5FHIA 1PN9A 5D8IA 2HSMA 4PXOA 4GSNA 5FWGA 4ID0A 4L8EA 5KOWA 2H0GA 2AYTA 4JU5A 4ECIA 5ECKB 5JCUA 3EU3A 5HR1A 2IN3A 2TRCP 1B9YC 1ZYQB 1SL0B 3FW2A 1KBNA 3HDCA 2K18A 2ZUPA 2PGTA 2HSHA 6GSTA 2J9HA 3MYDA 9GSSA 1TU7A 5DAKB 2WVXA 1PRXA 2HLSA 4I2UA 4Z2RA 2H6XA 3RHBA 2IWTA 2LKUA 3LGCA 1SJZA 2VLUA 2UV8G 1A8YA 1XWKA 1XG8A 1Q4JA 3HJPA 2N5AA 4TR0A 4IQAA 3QAWA 4QL7A 4PI2C 3U5RE 5EL8A 1ERWA 3DVWA 3TDGA 1NHYA 4KX4A 2ES7A 1FB0A 2WVYA 1V9WA 1GSUA 2E2MA 3ZMLA 3VWUA 1SL2B 1OKDA 3DD3A 3WT2A 3IA1A 1SYRA 5CAXA 1XVQA 8GSSA 2JSZA 1GSQA 2R37A 3LFLA 1ZYNA 5ECLB 3LXZA 4QMKA 2JU5A 1TXUA 2FWHA 1FAAA 5AIVA 1XWAA 4K2XA 1A24A 3IC8A 2R4VA 4BVYB 1VF3A 3ERFA 3IAM2 4DSSB 2H1AA 1E2YA 1GL8A 1THOA 1MD3A 4BVXB 5A4UA 5ELGA 1JZWA 2CAQA 1FO5A 2OBKA 2JSYA 1XVWA 2DMMA 1G7OA 1PKWA 3EWLA 5D96A 4EUYA 1W4VA 1M99A 3IE3A 3QOUA 3DEXA 3A5IA 2C1YA 2B3SA 5L71A 2XC2A 4GWRA 4IN0A 3MDKA 2WULA 4EXJA 3KEBA 3FMWA 4MLYA 1EGOA 2ON7A 2VD1A 12GSA 1MEKA 1SKSB 3C71A 3RHCA 3TOTA 4V1Ap 4CW9A 4YH2A 5LNKe 2UZ8A 3SWLA 4OD7A 4K7IA 4ZIJA 3HCZA 4YQVA 1KEBA 2F51A 2ZNMA 2JZRA 4F0CA 4X43A 5KN1A 4XS1A 5ID2A 1G0TA 5GSSA 3P90A 3CBUA 4G19A 2A4HA 3ZTLA 4MP4A 3WYWA 1XOAA 4G01A 2L4CA 1ZMAA 1GTUA 4G10A 1X5EA 4X1UA 1Y25A 4PHZC 5IQYA 4EC0A 1XW6A 3HVNA 2AUVA 3HYPA 4RI6A 2NTOA 2A2SA 2KP1A 4ZL9A 5DVBA 2QA2A 4AKIA 4OFNA 3G9BA 1BJXA 3MIXA 3Q74A 2B5YA 1SVOA 2FCHA 2WZ9A 5DQYA 1TK8B 4K1FA 3F4TA 3IDVA 2C80A 1PFOA 5EY6A 1O6JA 1TJDA 2YZUA 4NHWA 2L59A 1GWCA 1SK1A 2DKIA 1N25A 4PNFA 3M0FA 5IOXA 5CRGA 1UN2A 3WGDA 2BTOT 4MPFA 4WBRD 2CQ9A 2YWMA 4NV2A 3FR9A 1I9DA 2H6YA 2HZEA 4L5LA 3PH9A 3GNJA 3TOUA 1XFLA 5GAND 5G1LA 3ZZXA 2OBIA 2YJ7A 2P5QA 4GXZA 2H8LA 3VLNA 4RUVA 4X0XA 1QQ2A 3FZ9A 4AJ8A 1XBSA 4Q5RA 2HRAA 1F3BA 2X8GA 3TJJA 1SL1B 2HRKA 4MDCA 5HFIA 3J7Yb 3LW9A 2QA1A 4ML1A 1WE0A 5D73A 1GSFA 2WW2A 1OE7A 3HJOA 3VPTA 2OACA 3CSHA 3HMJG 2PMTA 5D93A 4ECJA 1VF1A 2YV9A 1XZOA 1GUKA 2FHEA 4ISDA 3M9KA 1R26A 4MJCA 4JR6A 2L6CA 3LORA 4IVFA 6GSXA 3D0ZA 4O5UA 3IV4A 5F0GA 3GTUA 2R3XA 4TXVA 3CTGA 1PGTA 2PVOC 4NV5A 2OADA 4N11A 1WOUA 4K0GA 3FKFA 2R5GA 3UEMA 5DBQA 3KD0A 2PN8A 4QL9A 2HRNA 5F06A 1XWBA 1CQHA 4IQ1A 6GSWA 2O8VB 2RUEA 4YKGA 1TTZA 3N5OA 3TCOA 3EE2A 3ZIVA 1TP9A 3APOA 3UVTA 2VLTA 4JR4A 3MNGA 4XRAA 3APSA 4NAXA 2AV4A 3BD2A 2Z9SA 1O85A 3GRXA 3LJRA 2L5OA 1YKAA 1YQ1A 5AGYA 16GSA 4FYUA 3US3A 3GX8A 4KCEA 3M9JA 2EFEA 1N8JA 3D4MA 2MBSA 2DLXA 3LG6A 3QCPA 4OWYA 1HNCA 3E9JB 3ME8A 2H1GA 4P3YB 1XIYA 1Z6NA 3C7MA 2HXKA 3F6FA 5A1NA 1PKZA 4BPYA 4PQIA 2AJQB 1YDKA 3G7JA 5ECHB 5H5SA 2LJKA 3TU3B 2V6OA 3W8SA 1G7EA 4W66A 3WD6A 1SVLA 4K7NA 1PL2A 2CVDA 4K5SA 3EINA 1TI3A 4EL1A 2WVZA 3EPTA 4K2DA 4MZCA 5GAPD 3KP9A 3S9FA 4MMMA 2DIZA 4MF7A 4IS0A 4ZBAA 2CT6A 4ZL7A 1WMJA 3V1WA 2I1UA 5BMUA 5A34A 3L78A 4MZWA 4OO5A 4RQXA 1F3AA 1R5PA 2QC7A 3DIEA 1T3BA 1GSDA 1YJ6A 2C8UA 2EFCA 4FXYP 3F0IA 3BCKA 2EIQA 3HA9A 4XTSA 3FR3A 2VM1A 2YCDA 1OC9B 1W89A 2QGVA 4GQCA 1ABAA 2V1MA 4F9ZA 5IO2A 3FHKA 4IP6A 4V2LA 2M80A 4V1Ag 4DSQA 2KOKA 2B7KA 2MMAA 3IHGA 4KB3A 1V98A 3RFRC 4IJ3A 4PX1A 1TRWA 3TRXA 3O76A 5ECQB 5ELAA 1TK5B 3FK8A 3UOMA 1YEXA 2MYGA 2LEGA 4EF0A 2NVLA 1EWXA 3TJFA 1H75A 3DKSA 4GTUA 2FD3A 1ST9A 1DE2A 3J7Yk 1Y1UA 2XBQA 3TKQA 4L5OA 4EE0A 1OE8A 3RPNA 2VCTA 5J3RA 4TR1B 1X9MB 3KXOA 5HR2A 1WJKA 4YQMA 2WVXB 2TRXA 5B6NA 2PVQA 5F07A 4ICYA 3CWGA 1O8XA 3F3QA 1R7HA 2DBCA 1JFUA 4EVMA 2V6KA 5JCWA 3Q19A 4K5RA 1Z5YE 3LEFA 4HJMA 1BG1A 4Z2UA 1JLVA 2FGXA 3HKRA 4O5QA 3HVSA 1ZYPA 3LQ7A 4OMVA 2LQOA 1WIKA 2CVBA 3IAS2 1HD2A 4RQRA 4HQZA 5IMAA 3GV1A 1EP8A 4MJAA 3ZMKA 4L0WA 1TRUA 1OYJA 2FWEA 4HSCX 2JZSA 4O92A 5AISA 3IOSA 3GA4A 1BYEA 1QGVA 2NPBA 2C3TA 3K8NA 3VWVA 3QFBC 4K7OA 4ZB8A 5ECOB 4MA9A 2VAFA 2JL4A 1TDIA 1TRVA 2H76A 3ZFLA 2GSQA 1ILOA 2HNLA 2C4JA 4PTSA 3GKMA 2PBJA 1LJRA 4BIKA 5FT3A 3F4RA 3N9JA 2QSIA 1K0BA 3KJYA 2CV4A 1F6MC 4I2TA 5ABRA 2WZSA 2GQMA 3NOFA 4WR4A 3CQFA 3ISOA 2B1LA 2O5VA 4XRDA 5D9XA 3TKSC 3HD5A 2O7KA 1B9XC 2MZCA 2YN1A 3FZ5A 4K9ZA 1S3RA 5DAKA 4V2NA 3GH6A 1B48A 1K0OA 1MDKA 2FWGA 2TIRA 1V40A 1EOHA 1M9AA 2LJRA 1G6YA 1URMA 2X8HA 2IFQB 1M3IA 3GHAA 1LBKA 3RGBC 3GX0A 4TR3A 2CX4A 2HSNB 2L4QA 3AY8A 5AN1A 2XPDA 1AQWA 2L5LA 2A2PA 1OKTA 1MD4A 5GZZB 2AHEA 4BWSA 4HZ4A 2R0CA 5B8BA 3GMFA 5J5NA 2VM2A 3A3TA 5CRHA 4I97A 3GN3A 3TRQA 5CP1A 1SENA 2F9SA 1YF1A 3O3TA 3TB2A 5G30A 1U88A 3C1SA 2GLRA 5IOWA 1FB6A 5JWQB 2GTUA 2YWOA 5G5EA 1GH2A 5IMVA 4N0VA 2H73A 2PUKC 2J23A 2O89A 2RM5A 1J9BA 3F4SA 4KW6A 4FH8A 4H86A 4EKZA 4BVYA 3BBYA 1TW9A 2OJLA 1AAZA 5G1KA 4DSSA 3DMLA 1A0FA 4N10A 4O32A 5IPGA 1ZGNA 1Z7PA 1XPVA 4HQSA 1U3AA 5HQPA 6GSYA 4KUNA 4ZBDA 3RPPA 1V58A 1M7TA 2HZEB 1GNEA 11GSA 1TI1A 2OKAA 3E0UA 7GSSA 2REMA 4Z2TA 4BA7A 4WR5A 1M3JA 1I1IP 3H93A 3WGXA 3KH7A 2WW0A 4OFTA 2LQQA 3HZ4A 3PINA 2N5BA 2FA8A 4HS1A 2DJKA 3TJGA 2HZFA 1A2LA 4I6XA 1IYHA 2X99A 4D73B 4GQFA 3DGQA 1JLWA 4Q5QA 2GQLA 2M46A 2XHFA 4DVCA 2V32A 1XXUA 4IHUA 2OE0A 3P7XA 4O5RA 5DCGA 3G7IA 1AIUA 2LS5A 1K3YA 3LYPA 3QAVA 5B6MA 1T4YA 2CAIA 4E8HA 3KMNA 1GULA 5J4VA 3LSZA 5E4WA 5ECMB 4ILFA 2AAWA 5A5HB 4BL7A 1WP0A 3D5JA 1VGLA 2LUSA 4F03A 2H70A 1UVZA 3TKRA 4ZILA 1B4PA 4YAVA 1QUWA 4LA1A 3FR6A 3IK9A 10GSA 1K3LA 3GTUB 3QMXA 2VCVA 3F3RA 1A2JA 4IBPA 5J47A 2VD0A 3KTBA 4AI6A 3PGTA 2YOIA 4IJIA 5H5RA 2IMKA 6GSVA 1U3IA 3I6AA 3GL5A 1AW9A 1YZXA 3DYRA 5D9TA 5HFGA 2KHPA 4GLTA 1YF0A 1S3CA 3UAPA 1DSBA 1FOVA 5DJMA 1T8EB 1SVMA 1SU9A 4YAPA 5ECNB 22GSA 1U6TA 3H4KA 1UC7A 4PUAA 4LLRA 1YKCA 2DSAA 4FYBA 20GSA 1FVJA 3L9VA 3TKSA 1TXXA 5DJLA 3ZFBA 4Q5NA 5ECSA 4ACSA 3ZVJD 1T1VA 4JRRA 2PWJA 3M1GA 1FOHA 1JZDA 5CRDA 4G0KA 4POKA 4J57E 2GSRA 2IJYA 3CRTA 3L9UA 4XHMA 2P31A 4MJBA 4CDOA 1KTEA 5EVOA 1SYXA 5KEJA 4CY6A 2R2JA 4MJEA 3R3EA 3H1NA 4MPGA 2IMFA 4HEA2 1XCCA 5HFKA 4WEYA 2VCQA 2IMIA 3MAKA 4LL1B 1SK0A 1HNBA 2B1KA 1V57A 1F2EA 3FY7A 2VCZA 1X9SB 2PPTA 2GQKA 3UMAA 2DMLA 4KDYA 2H0HA 4KH7A 5KOXA 3PR8A 5DALB 2C3QA 1JHBA 4OO4A 1E6BA 5J4YA 1F37A 4XS6A 3VI5A 4JZQA 5AIXA 2LNSA 3IRAA 4J56E 2YANA 3A5WA 3ME7A 2VOCA 2I4AA 1NW2A 1YEWC 4XCSA 4E8EA 4GDFA 1K3OA 2OA7A 3VK9A 4HZ2A 2H0IA 4Z7XA 2DIYA 3CSJA 4GF0A 4IP1A 5A34B 3UBKA 1EP7A 3GKXA 4AJ7A 4ULXA 1ERTA 4DSRA 2RM6A 4XS4B 4G2EA 2X64A 3IPZA 2H1LA 2YZHA 2OE1A 1NM3A 1RK4A 4K0NA 2K8VA 3HJMA 1QXHA 2LSTA 2GZPA 2H72A 4POMA 2H6ZA 2EFDA 3IBHA 2K8SA 2ZCTA 1WRYA 2B5XA 5J41A 1THXA 3KCMA 2JADA 1Z6MA 1BAYA 2XBIA 3DXBA 3H8QA 4G0LA 2YP6A 4MZBA 5IMFA 4TW5A 1NHOA 2LRNA 1Q98A 2I9HA 4A5PA 5CO3A 1SK2A 1M9BA 2PU9C 1MDJA 1ERVA 3FEUA 1U87A 5G31A 1K0NA 4AJ6A 3F8UA 4Q5FA 1PA3A 1PX6A 1F9MA 2LRCA 5LCZA 4TXOB 1TKDB 1EGRA 4N0ZA 2H66A 2DKHA 2GT5A 4AKGA 2ALBA 4NMUA 3CMIA 3P2AA 1O7UA 4TR4A 3JCML 4ECBA 4KNDA 1OC3A 1PMTA 4EIPA 1M2BA 2HSMB 2GZYA 5E59A 1ML6A 2L6DA 2X8CA 1QMVA 4TN8A 4WKWA 3GUSA 1NSWA 3NIVA 2HT9A 3GSSA 3KMOA 3TJBA 5LD0A 4KDUA 3TJKA 1OAZA 5BRTA 4F0BA 5EPFA 2IL3A 14GSA 2FA4A 5B8AA 3EVIA 5HR3A 3CSIA 4KAEA 2WS2A 3HY2A 2VL3A 2VCWA 2C0EA 3KM6A 3ERWA 4WETA 3EMXA 2GT6A 1KNGA 2CA8A 1PN0A 4KGIA 1OC9A 5DCHA 3GSTA 1A2MA 1TOFA 3NZNA 5H5QA 2VLVA 1K0MA 3HXSA 4GSSA 3EURA 1AC1A 1K0DA 1DE1A 4EDYA 1IYIA 3I69A 3D6IA 1MTCA 3IXRA 3DVXA 1XWCA 4HU7A 4QQ7A 2ON5A 4HU9A 2O3EA 1R4WA 3UVHA 3HZ8A 1EZKA 4IW9A 3I9V2 3HHVA 3P8WA 3KGKA 2QKEA 2K9FA 2WGRA 1PSQA 1ACVA 2HRFA 2CZ3A 3H79A 2HE3A 1AXDA 2WCIA 4TR1A 3GYKA 3IC4A 1K0AA 5KN2A 1TRSA 17GSA 2FLSA 1FHEA 3SBCA 1GSYA 2MMZA 2OT3A 3F9UA 3ZVJA 2LJAA 3GKNA 2O36A 1ZOFA 1Z3EA 2R6KA 3IR4A 2C0GA 1TK0B 1I5GA 4OCEA 2FWFA 4ZB9A 3GH9A 4OCFA 1PD21 2C0FA 2WRTA 1EOGA 1HQOA 1BEDA 1OC8A 4ECCA 2IPAA 5INYA 5ECIB 3RAZA 4F2IA 1SJ6A 3LWAA 2IMEA 5GSTA 3Q18A 4WF5A 2CVKA 4EO3A 3LYKA 2DJJA 4HJ2A 4CHSA 5IMCA 2LNTA 5KN3A 1GLQA 1T00A 4NPBA 3KZQA 3ZRDA 4FIWA 1A0RP 1FVKA 4MH3A 4KCAA 3U6VA 3FZ4A 1SJIA 5F8BA 2HQTA 5D9WA 3HVVA 1BG5A 1T4ZA 2FNOA 2RUFA 5G5FA 1M2AA 1R5AA 1QK8A 2LTKA 5ID2B 3ZLPA 4MF6A 4TVEA 2H74A 1GP1A 4USSA 2WFCA 1ON4A 1PQNA 2F3MA 4ZB6A 2D2ZA 1GNWA 1GRXA 3ZIJA 1S4BP 5ECPB 6GSUA 3F63A 1X5CA 1EEMA 5COHA 1X9WB 3VWXA 5C04A 5ENUA 1K0CA 3DRNA 4NXIA 2P5RA 1BQ7A 2EFHA 3L0HA 5IIZA 2NDOA 4MCUA 2JZTA 5A4WA 3C8EA 4HI7A 1A8LA 5IMZA 3BOAA 2L57A 1B8XA 3KP8A 1RW1A 2H19A 6GSSA 4AF2A 2VL2A 3TGZA 1G6WA 2KUCA 4BVXA 3KH9A 5J9CA 1J0FA 3ERGA 1EV9A 4AKHA 2IFQA 3GKKA
chains in the Genus database with same CATH topology
3EYTA 2YV7A 2P0GA 2HSNA 1XOBA 4KA0A 4BWQA 2HYXA 4BL7B 2FY6A 2DC5A 2R0GA 3LXTA 4X4JA 4TKYA 5IMDA 2B6MA 4RI7A 2DJ0A 2V41A 3Q6OA 4MF5A 3QR6A 4FYCA 4HOJA 2IIYA 2WJUA 3VFIA 4J2FA 1GTIA 1ZCPA 4ZL8A 4WXTA 5CNWA 5ECRB 1C72A 1JZRA 5J4UA 1BX9A 1RQMA 3UIWA 2E0QA 1ZYEA 5A5KA 2HRKB 4LL4B 5B7CA 2GVPA 4WBJA 1JZOA 1GTAA 3QFAC 4IKHA 3TKSE 4MK3A 4NHZA 5J9BA 2MBTA 1S3DA 3FRCA 4LMVA 1QFNA 1ZL9A 2BMXA 3HVXA 4EDZA 3RBTA 2YWIA 2OE3A 3EC3A 2O87A 3I43A 4PGTA 1DUGA 3QD9A 3F6DA 4G0IA 1DBYA 2V2GA 4MNNA 2F8AA 4F82A 4GSTA 1XW9A 4PURA 2HI7A 1YVLA 3A2VA 4YKFA 4ZB7A 4D73A 2E7PA 4NWYA 1SD8A 3M3MA 1UA5A 3FZAA 4E68A 2A4VA 2GGTA 4HDEA 2IMDA 5JCGA 2H75A 3EMPA 1X5DA 5F05A 4LMWA 2YPMA 1GTBA 3PPUA 1Z9HA 5DDLA 2DJ2A 4N30A 1OVNA 4K6XA 1V2AA 4JE1A 3ZYWA 3VPQA 1ERUA 3DWVA 5A5HA 5CRWA 3TRPA 2GS3A 4JBBA 1FW1A 2PERA 2EIOA 3APQA 5A4VA 4KSMA 4O7HA 3O6TA 3UBLA 1O81A 4G9HA 3GIXA 1H4OA 1AQVA 1VRSD 2RIIA 3BJ5A 4ZBBA 3CTFA 1XWGA 5A1NB 4V2MA 3ZL5A 2VUPA 3R2QA 5D9VA 2H1DA 2WDUA 3GFKA 4PQHA 5J40A 2KLXA 4DEJA 5HR0A 3QPMA 4PNGA 3D21A 5C00A 4CY8A 4MH2A 5IM9A 1EEJA 1VF2A 1S3AA 2O85A 4I8BA 2EC4A 3WT1A 3IHQA 2B7JA 1WPIA 3L9SA 5JWOB 4KSOA 1Y6EA 4MABA 5BMUB 3TUEA 1YY7A 3WGEA 4L0UA 1USBA 3C1RA 2H1BA 2BJXA 3W6GA 2RLIA 3E3EA 4KE3A 2YWNA 4GCIA 3D22A 1MDIA 4KF9A 2E2GA 2F8FA 4HUAA 4I5QA 3A2XA 3FYGA 3GL3A 1TU8A 2GDRA 4FQUA 1HYUA 1AUCA 2B5EA 1N2AA 2LV3A 3UJ1A 3GURA 5DQSA 1AQXA 3CYNA 2DJ1A 4XIHA 1BF5A 1WWJA 3VI7A 4PQ1A 1GUMA 5DALA 2HFDA 5IO0A 4JEDA 2FUG2 3A2WA 3D4TA 1O73A 2VKZG 4AKXB 2EIRA 3EU4A 1YEPA 3L4NA 2R0PA 3VWWA 2I3YA 3CXGA 3G7YA 3VURA 2JACA 2I81A 2VIMA 4K8MA 2YNXA 5G2ZA 1EV4A 1GSEA 3QDNA 3CRUA 4AGSA 5CREA 2XPEA 2NBSA 1T7PB 2CZ2A 2K6VA 2GSTA 2N5FA 18GSA 3ZITA 1PL1A 3C73A 1XW5A 4XS4A 2C0DA 2A2RA 1SD9A 4YQUA 2WB9A 2MMOA 3TKPA 1CQGA 4WF4A 1J08A 4POBA 2KP2A 1A23A 2C3NA 2X49A 1HNAA 2VCXA 4ML6A 4GRFA 1GSSA 2VL9A 1X0RA 2LRTA 2VL2C 2G0FA 19GSA 2CX3A 3KIJA 3ZREA 2DJ3A 2M72A 1O8WA 1Z7RA 1GLPA 1M0UA 1VF4A 3IK7A 4EIQA 4IELA 3W8JA 2YJHA 2X4AA 3MSZA 4TRXA 5KN0A 13GSA 3ED3A 3UARA 4ZXGA 2H71A 2MMNA 1PX7A 1LU4A 4PUFC 1M2DA 2G2QA 1ZZYA 2VO4A 4OFMA 3MWHA 3RDWA 5CYYA 4TXOA 3OR5A 3BCIA 4POLA 1SKRB 4IGJA 1FG4A 5JWRB 3UL3A 4KDXA 3KTLA 1B4QA 1SKWB 2AB6A 2H01A 2H30A 2HSYA 1GUHA 2GSSA 3M8NA 2GZZA 4N3ZA 3QAGA 4FO5A 5IPHA 4TOPA 5FHIA 1PN9A 5D8IA 2HSMA 4PXOA 4GSNA 5FWGA 4ID0A 4L8EA 5KOWA 2H0GA 2AYTA 4JU5A 4ECIA 5ECKB 5JCUA 3EU3A 5HR1A 2IN3A 2TRCP 1B9YC 1ZYQB 1SL0B 3FW2A 1KBNA 3HDCA 2K18A 2ZUPA 2PGTA 2HSHA 6GSTA 2J9HA 3MYDA 9GSSA 1TU7A 5DAKB 1PRXA 2HLSA 4I2UA 4Z2RA 2H6XA 3RHBA 2IWTA 2LKUA 3LGCA 1SJZA 2VLUA 2UV8G 1A8YA 1XWKA 1Q4JA 3HJPA 2N5AA 4TR0A 4IQAA 3QAWA 4QL7A 3U5RE 5EL8A 1ERWA 3DVWA 3TDGA 1NHYA 4KX4A 2ES7A 1FB0A 1V9WA 1GSUA 2E2MA 3ZMLA 3VWUA 1SL2B 1OKDA 3DD3A 3WT2A 3IA1A 1SYRA 5CAXA 1XVQA 8GSSA 2JSZA 1GSQA 2R37A 3LFLA 1ZYNA 5ECLB 3LXZA 4QMKA 2JU5A 1TXUA 2FWHA 1FAAA 5AIVA 1XWAA 4K2XA 1A24A 3IC8A 2R4VA 4BVYB 1VF3A 3ERFA 3IAM2 4DSSB 2H1AA 1E2YA 1GL8A 1THOA 1MD3A 4BVXB 5A4UA 5ELGA 1JZWA 2CAQA 1FO5A 2OBKA 2JSYA 1XVWA 2DMMA 1G7OA 1PKWA 3EWLA 5D96A 4EUYA 1W4VA 1M99A 3IE3A 3QOUA 3DEXA 3A5IA 2C1YA 2B3SA 5L71A 2XC2A 4GWRA 4IN0A 3MDKA 2WULA 4EXJA 3KEBA 3FMWA 4MLYA 1EGOA 2ON7A 2VD1A 12GSA 1MEKA 1SKSB 3C71A 3RHCA 3TOTA 4V1Ap 4CW9A 4YH2A 5LNKe 2UZ8A 3SWLA 4OD7A 4K7IA 4ZIJA 3HCZA 4YQVA 1KEBA 2F51A 2ZNMA 2JZRA 4F0CA 4X43A 5KN1A 4XS1A 5ID2A 1G0TA 5GSSA 3P90A 3CBUA 4G19A 2A4HA 3ZTLA 4MP4A 3WYWA 1XOAA 4G01A 2L4CA 1ZMAA 1GTUA 4G10A 1X5EA 4X1UA 1Y25A 5IQYA 4EC0A 1XW6A 2AUVA 3HYPA 4RI6A 2NTOA 2A2SA 2KP1A 4ZL9A 5DVBA 2QA2A 4AKIA 4OFNA 3G9BA 1BJXA 3MIXA 3Q74A 2B5YA 1SVOA 2FCHA 2WZ9A 5DQYA 1TK8B 4K1FA 3F4TA 3IDVA 2C80A 5EY6A 1O6JA 1TJDA 2YZUA 4NHWA 2L59A 1GWCA 1SK1A 2DKIA 1N25A 4PNFA 3M0FA 5IOXA 5CRGA 1UN2A 3WGDA 2BTOT 4MPFA 4WBRD 2CQ9A 2YWMA 4NV2A 3FR9A 1I9DA 2H6YA 2HZEA 4L5LA 3PH9A 3GNJA 3TOUA 1XFLA 5GAND 5G1LA 3ZZXA 2OBIA 2YJ7A 2P5QA 4GXZA 2H8LA 3VLNA 4RUVA 4X0XA 1QQ2A 3FZ9A 4AJ8A 1XBSA 4Q5RA 2HRAA 1F3BA 2X8GA 3TJJA 1SL1B 2HRKA 4MDCA 5HFIA 3J7Yb 3LW9A 2QA1A 4ML1A 1WE0A 5D73A 1GSFA 1OE7A 3HJOA 3VPTA 2OACA 3CSHA 3HMJG 2PMTA 5D93A 4ECJA 1VF1A 2YV9A 1XZOA 1GUKA 2FHEA 4ISDA 3M9KA 1R26A 4MJCA 4JR6A 2L6CA 3LORA 4IVFA 6GSXA 3D0ZA 4O5UA 3IV4A 5F0GA 3GTUA 2R3XA 4TXVA 3CTGA 1PGTA 2PVOC 4NV5A 2OADA 4N11A 1WOUA 4K0GA 3FKFA 2R5GA 3UEMA 5DBQA 3KD0A 2PN8A 4QL9A 2HRNA 5F06A 1XWBA 1CQHA 4IQ1A 6GSWA 2O8VB 2RUEA 4YKGA 1TTZA 3N5OA 3TCOA 3EE2A 3ZIVA 1TP9A 3APOA 3UVTA 2VLTA 4JR4A 3MNGA 4XRAA 3APSA 4NAXA 2AV4A 3BD2A 2Z9SA 1O85A 3GRXA 3LJRA 2L5OA 1YKAA 1YQ1A 5AGYA 16GSA 4FYUA 3US3A 3GX8A 4KCEA 3M9JA 2EFEA 1N8JA 3D4MA 2MBSA 2DLXA 3LG6A 3QCPA 4OWYA 1HNCA 3E9JB 3ME8A 2H1GA 4P3YB 1XIYA 1Z6NA 3C7MA 2HXKA 3F6FA 5A1NA 1PKZA 4BPYA 4PQIA 2AJQB 1YDKA 3G7JA 5ECHB 5H5SA 2LJKA 3TU3B 2V6OA 3W8SA 1G7EA 4W66A 3WD6A 1SVLA 4K7NA 1PL2A 2CVDA 4K5SA 3EINA 1TI3A 4EL1A 3EPTA 4K2DA 4MZCA 5GAPD 3KP9A 3S9FA 4MMMA 2DIZA 4MF7A 4IS0A 4ZBAA 2CT6A 4ZL7A 1WMJA 3V1WA 2I1UA 5BMUA 5A34A 3L78A 4MZWA 4OO5A 4RQXA 1F3AA 1R5PA 2QC7A 3DIEA 1T3BA 1GSDA 1YJ6A 2C8UA 2EFCA 3F0IA 3BCKA 2EIQA 3HA9A 4XTSA 3FR3A 2VM1A 2YCDA 1OC9B 1W89A 2QGVA 4GQCA 1ABAA 2V1MA 4F9ZA 5IO2A 3FHKA 4IP6A 4V2LA 2M80A 4V1Ag 4DSQA 2KOKA 2B7KA 2MMAA 3IHGA 4KB3A 1V98A 4IJ3A 4PX1A 1TRWA 3TRXA 3O76A 5ECQB 5ELAA 1TK5B 3FK8A 3UOMA 1YEXA 2MYGA 2LEGA 4EF0A 2NVLA 1EWXA 3TJFA 1H75A 3DKSA 4GTUA 2FD3A 1ST9A 1DE2A 3J7Yk 1Y1UA 2XBQA 3TKQA 4L5OA 4EE0A 1OE8A 3RPNA 2VCTA 5J3RA 4TR1B 1X9MB 3KXOA 5HR2A 1WJKA 4YQMA 2TRXA 5B6NA 2PVQA 5F07A 4ICYA 3CWGA 1O8XA 3F3QA 1R7HA 2DBCA 1JFUA 4EVMA 2V6KA 5JCWA 3Q19A 4K5RA 1Z5YE 3LEFA 4HJMA 1BG1A 4Z2UA 1JLVA 2FGXA 3HKRA 4O5QA 3HVSA 1ZYPA 3LQ7A 4OMVA 2LQOA 1WIKA 2CVBA 3IAS2 1HD2A 4RQRA 4HQZA 5IMAA 3GV1A 1EP8A 4MJAA 3ZMKA 4L0WA 1TRUA 1OYJA 2FWEA 2JZSA 4O92A 5AISA 3IOSA 3GA4A 1BYEA 1QGVA 2NPBA 2C3TA 3K8NA 3VWVA 3QFBC 4K7OA 4ZB8A 5ECOB 4MA9A 2VAFA 2JL4A 1TDIA 1TRVA 2H76A 3ZFLA 2GSQA 1ILOA 2HNLA 2C4JA 4PTSA 3GKMA 2PBJA 1LJRA 5FT3A 3F4RA 3N9JA 2QSIA 1K0BA 3KJYA 2CV4A 1F6MC 4I2TA 5ABRA 2GQMA 3NOFA 4WR4A 3ISOA 2B1LA 2O5VA 4XRDA 5D9XA 3TKSC 3HD5A 2O7KA 1B9XC 2MZCA 2YN1A 3FZ5A 4K9ZA 5DAKA 4V2NA 3GH6A 1B48A 1K0OA 1MDKA 2FWGA 2TIRA 1V40A 1EOHA 1M9AA 2LJRA 1G6YA 1URMA 2X8HA 2IFQB 3GHAA 1LBKA 3GX0A 4TR3A 2CX4A 2HSNB 2L4QA 3AY8A 5AN1A 2XPDA 1AQWA 2L5LA 2A2PA 1OKTA 1MD4A 5GZZB 2AHEA 4BWSA 4HZ4A 2R0CA 5B8BA 3GMFA 5J5NA 2VM2A 3A3TA 5CRHA 4I97A 3GN3A 3TRQA 5CP1A 1SENA 2F9SA 1YF1A 3O3TA 3TB2A 5G30A 1U88A 3C1SA 2GLRA 5IOWA 1FB6A 5JWQB 2GTUA 2YWOA 5G5EA 1GH2A 5IMVA 4N0VA 2H73A 2PUKC 2J23A 2O89A 2RM5A 1J9BA 3F4SA 4KW6A 4FH8A 4H86A 4EKZA 4BVYA 3BBYA 1TW9A 2OJLA 1AAZA 5G1KA 4DSSA 3DMLA 1A0FA 4N10A 4O32A 5IPGA 1ZGNA 1Z7PA 1XPVA 4HQSA 1U3AA 5HQPA 6GSYA 4KUNA 4ZBDA 3RPPA 1V58A 1M7TA 2HZEB 1GNEA 11GSA 1TI1A 2OKAA 3E0UA 7GSSA 2REMA 4Z2TA 4BA7A 4WR5A 3H93A 3WGXA 3KH7A 4OFTA 2LQQA 3HZ4A 3PINA 2N5BA 2FA8A 4HS1A 2DJKA 3TJGA 2HZFA 1A2LA 4I6XA 1IYHA 2X99A 4D73B 4GQFA 3DGQA 1JLWA 4Q5QA 2GQLA 2M46A 2XHFA 4DVCA 2V32A 1XXUA 4IHUA 2OE0A 3P7XA 4O5RA 5DCGA 3G7IA 1AIUA 2LS5A 1K3YA 3LYPA 3QAVA 5B6MA 1T4YA 2CAIA 4E8HA 3KMNA 1GULA 5J4VA 3LSZA 5E4WA 5ECMB 4ILFA 2AAWA 5A5HB 4BL7A 1WP0A 3D5JA 1VGLA 2LUSA 4F03A 2H70A 1UVZA 3TKRA 4ZILA 1B4PA 4YAVA 1QUWA 4LA1A 3FR6A 3IK9A 10GSA 1K3LA 3GTUB 3QMXA 2VCVA 3F3RA 1A2JA 4IBPA 5J47A 2VD0A 3KTBA 4AI6A 3PGTA 2YOIA 4IJIA 5H5RA 2IMKA 6GSVA 1U3IA 3I6AA 3GL5A 1AW9A 1YZXA 3DYRA 5D9TA 5HFGA 2KHPA 4GLTA 1YF0A 1S3CA 3UAPA 1DSBA 1FOVA 5DJMA 1T8EB 1SVMA 1SU9A 4YAPA 5ECNB 22GSA 1U6TA 3H4KA 1UC7A 4PUAA 4LLRA 1YKCA 2DSAA 4FYBA 20GSA 1FVJA 3L9VA 3TKSA 1TXXA 5DJLA 3ZFBA 4Q5NA 5ECSA 4ACSA 3ZVJD 1T1VA 4JRRA 2PWJA 3M1GA 1FOHA 1JZDA 5CRDA 4G0KA 4POKA 4J57E 2GSRA 2IJYA 3CRTA 3L9UA 4XHMA 2P31A 4MJBA 4CDOA 1KTEA 5EVOA 1SYXA 5KEJA 4CY6A 2R2JA 4MJEA 3R3EA 3H1NA 4MPGA 2IMFA 4HEA2 1XCCA 5HFKA 4WEYA 2VCQA 2IMIA 3MAKA 4LL1B 1SK0A 1HNBA 2B1KA 1V57A 1F2EA 3FY7A 2VCZA 1X9SB 2PPTA 2GQKA 3UMAA 2DMLA 4KDYA 2H0HA 4KH7A 5KOXA 3PR8A 5DALB 2C3QA 1JHBA 4OO4A 1E6BA 5J4YA 1F37A 4XS6A 3VI5A 4JZQA 5AIXA 2LNSA 3IRAA 4J56E 2YANA 3A5WA 3ME7A 2VOCA 2I4AA 1NW2A 4XCSA 4E8EA 4GDFA 1K3OA 2OA7A 3VK9A 4HZ2A 2H0IA 4Z7XA 2DIYA 3CSJA 4GF0A 4IP1A 5A34B 3UBKA 1EP7A 3GKXA 4AJ7A 4ULXA 1ERTA 4DSRA 2RM6A 4XS4B 4G2EA 2X64A 3IPZA 2H1LA 2YZHA 2OE1A 1NM3A 1RK4A 4K0NA 2K8VA 3HJMA 1QXHA 2LSTA 2GZPA 2H72A 4POMA 2H6ZA 2EFDA 3IBHA 2K8SA 2ZCTA 1WRYA 2B5XA 5J41A 1THXA 3KCMA 2JADA 1Z6MA 1BAYA 2XBIA 3DXBA 3H8QA 4G0LA 2YP6A 4MZBA 5IMFA 4TW5A 1NHOA 2LRNA 1Q98A 2I9HA 4A5PA 5CO3A 1SK2A 1M9BA 2PU9C 1MDJA 1ERVA 3FEUA 1U87A 5G31A 1K0NA 4AJ6A 3F8UA 4Q5FA 1PA3A 1PX6A 1F9MA 2LRCA 5LCZA 4TXOB 1TKDB 1EGRA 4N0ZA 2H66A 2DKHA 2GT5A 4AKGA 2ALBA 4NMUA 3CMIA 3P2AA 1O7UA 4TR4A 3JCML 4ECBA 4KNDA 1OC3A 1PMTA 4EIPA 1M2BA 2HSMB 2GZYA 5E59A 1ML6A 2L6DA 2X8CA 1QMVA 4TN8A 4WKWA 3GUSA 1NSWA 3NIVA 2HT9A 3GSSA 3KMOA 3TJBA 5LD0A 4KDUA 3TJKA 1OAZA 5BRTA 4F0BA 5EPFA 2IL3A 14GSA 2FA4A 5B8AA 3EVIA 5HR3A 3CSIA 4KAEA 2WS2A 3HY2A 2VL3A 2VCWA 2C0EA 3KM6A 3ERWA 4WETA 3EMXA 2GT6A 1KNGA 2CA8A 1PN0A 4KGIA 1OC9A 5DCHA 3GSTA 1A2MA 1TOFA 3NZNA 5H5QA 2VLVA 1K0MA 3HXSA 4GSSA 3EURA 1AC1A 1K0DA 1DE1A 4EDYA 1IYIA 3I69A 3D6IA 1MTCA 3IXRA 3DVXA 1XWCA 4HU7A 4QQ7A 2ON5A 4HU9A 1R4WA 3UVHA 3HZ8A 1EZKA 4IW9A 3I9V2 3HHVA 3P8WA 3KGKA 2QKEA 2K9FA 2WGRA 1PSQA 1ACVA 2HRFA 2CZ3A 3H79A 2HE3A 1AXDA 2WCIA 4TR1A 3GYKA 3IC4A 1K0AA 5KN2A 1TRSA 17GSA 2FLSA 1FHEA 3SBCA 1GSYA 2MMZA 2OT3A 3F9UA 3ZVJA 2LJAA 3GKNA 1ZOFA 1Z3EA 2R6KA 3IR4A 2C0GA 1TK0B 1I5GA 4OCEA 2FWFA 4ZB9A 3GH9A 4OCFA 1PD21 2C0FA 2WRTA 1EOGA 1HQOA 1BEDA 1OC8A 4ECCA 2IPAA 5INYA 5ECIB 3RAZA 4F2IA 1SJ6A 3LWAA 2IMEA 5GSTA 3Q18A 4WF5A 2CVKA 4EO3A 3LYKA 2DJJA 4HJ2A 4CHSA 5IMCA 2LNTA 5KN3A 1GLQA 1T00A 4NPBA 3KZQA 3ZRDA 4FIWA 1A0RP 1FVKA 4MH3A 4KCAA 3U6VA 3FZ4A 1SJIA 5F8BA 2HQTA 5D9WA 3HVVA 1BG5A 1T4ZA 2FNOA 2RUFA 5G5FA 1M2AA 1R5AA 1QK8A 2LTKA 5ID2B 3ZLPA 4MF6A 4TVEA 2H74A 1GP1A 4USSA 2WFCA 1ON4A 1PQNA 2F3MA 4ZB6A 2D2ZA 1GNWA 1GRXA 3ZIJA 5ECPB 6GSUA 3F63A 1X5CA 1EEMA 5COHA 1X9WB 3VWXA 5C04A 5ENUA 1K0CA 3DRNA 4NXIA 2P5RA 1BQ7A 2EFHA 3L0HA 5IIZA 2NDOA 4MCUA 2JZTA 5A4WA 3C8EA 4HI7A 1A8LA 5IMZA 3BOAA 2L57A 1B8XA 3KP8A 1RW1A 2H19A 6GSSA 4AF2A 2VL2A 3TGZA 1G6WA 2KUCA 4BVXA 3KH9A 5J9CA 1J0FA 3ERGA 1EV9A 4AKHA 2IFQA 3GKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYT A;  2YV7 A;  2P0G A;  1XOB A;  4KA0 A;  4BWQ A;  2HYX A;  4BL7 B;  2FY6 A;  2DC5 A;  3LXT A;  4TKY A;  5IMD A;  2B6M A;  4RI7 A;  2DJ0 A;  2V41 A;  3Q6O A;  4MF5 A;  3QR6 A;  4FYC A;  4HOJ A;  2IIY A;  2WJU A;  3VFI A;  4J2F A;  1GTI A;  1ZCP A;  4ZL8 A;  4WXT A;  5CNW A;  5ECR B;  1C72 A;  1JZR A;  5J4U A;  1BX9 A;  1RQM A;  3UIW A;  2E0Q A;  1ZYE A;  5A5K A;  2HRK B;  4LL4 B;  5B7C A;  2GVP A;  4WBJ A;  1JZO A;  1GTA A;  3QFA C;  4IKH A;  3TKS E;  4MK3 A;  4NHZ A;  5J9B A;  2MBT A;  1S3D A;  3FRC A;  4LMV A;  1QFN A;  1ZL9 A;  2BMX A;  3HVX A;  4EDZ A;  3RBT A;  2YWI A;  2OE3 A;  3EC3 A;  2O87 A;  3I43 A;  4PGT A;  1DUG A;  3QD9 A;  3F6D A;  4G0I A;  1DBY A;  2V2G A;  2F8A A;  4F82 A;  4GST A;  1XW9 A;  4PUR A;  2HI7 A;  3A2V A;  4D73 A;  2E7P A;  4NWY A;  1SD8 A;  3M3M A;  1UA5 A;  3FZA A;  2A4V A;  2GGT A;  4HDE A;  2IMD A;  5JCG A;  2H75 A;  3EMP A;  1X5D A;  5F05 A;  4LMW A;  2YPM A;  1GTB A;  3PPU A;  1Z9H A;  5DDL A;  2DJ2 A;  4N30 A;  1OVN A;  4K6X A;  1V2A A;  4JE1 A;  3ZYW A;  3VPQ A;  1ERU A;  3DWV A;  5CRW A;  3TRP A;  2GS3 A;  4JBB A;  1FW1 A;  2PER A;  2EIO A;  3APQ A;  5A4V A;  4KSM A;  4O7H A;  3O6T A;  3UBL A;  1O81 A;  4G9H A;  3GIX A;  1H4O A;  1AQV A;  1VRS D;  2RII A;  3BJ5 A;  4ZBB A;  3CTF A;  1XWG A;  4V2M A;  3ZL5 A;  2VUP A;  3R2Q A;  5D9V A;  2H1D A;  2WDU A;  3GFK A;  4PQH A;  2KLX A;  4DEJ A;  5HR0 A;  3QPM A;  4PNG A;  3D21 A;  5C00 A;  4MH2 A;  5IM9 A;  1EEJ A;  1VF2 A;  1S3A A;  2O85 A;  4I8B A;  2EC4 A;  3WT1 A;  3IHQ A;  2B7J A;  1WPI A;  3L9S A;  5JWO B;  4KSO A;  1Y6E A;  4MAB A;  3TUE A;  1YY7 A;  3WGE A;  4L0U A;  1USB A;  3C1R A;  2H1B A;  2BJX A;  3W6G A;  2RLI A;  3E3E A;  4KE3 A;  2YWN A;  4GCI A;  3D22 A;  1MDI A;  4KF9 A;  2E2G A;  2F8F A;  4HUA A;  4I5Q A;  3A2X A;  3FYG A;  3GL3 A;  1TU8 A;  2GDR A;  4FQU A;  1HYU A;  1AUC A;  2B5E A;  1N2A A;  2LV3 A;  3UJ1 A;  3GUR A;  5DQS A;  1AQX A;  3CYN A;  2DJ1 A;  4XIH A;  1WWJ A;  3VI7 A;  4PQ1 A;  1GUM A;  5DAL A;  2HFD A;  5IO0 A;  4JED A;  2FUG 2;  3A2W A;  3D4T A;  1O73 A;  2EIR A;  3EU4 A;  1YEP A;  3L4N A;  3VWW A;  2I3Y A;  3CXG A;  3G7Y A;  3VUR A;  2JAC A;  2I81 A;  2VIM A;  4K8M A;  2YNX A;  5G2Z A;  1EV4 A;  1GSE A;  3QDN A;  3CRU A;  4AGS A;  5CRE A;  2XPE A;  2NBS A;  1T7P B;  2CZ2 A;  2K6V A;  2GST A;  2N5F A;  18GS A;  3ZIT A;  1PL1 A;  3C73 A;  1XW5 A;  4XS4 A;  2C0D A;  2A2R A;  1SD9 A;  4YQU A;  2WB9 A;  2MMO A;  3TKP A;  1CQG A;  4WF4 A;  1J08 A;  4POB A;  2KP2 A;  1A23 A;  2C3N A;  1HNA A;  2VCX A;  4ML6 A;  4GRF A;  1GSS A;  2VL9 A;  1X0R A;  2LRT A;  2VL2 C;  2G0F A;  19GS A;  2CX3 A;  3KIJ A;  3ZRE A;  2DJ3 A;  2M72 A;  1O8W A;  1Z7R A;  1GLP A;  1M0U A;  1VF4 A;  3IK7 A;  4IEL A;  3W8J A;  2YJH A;  3MSZ A;  4TRX A;  5KN0 A;  13GS A;  3ED3 A;  3UAR A;  4ZXG A;  2H71 A;  2MMN A;  1PX7 A;  1LU4 A;  4PUF C;  1M2D A;  2G2Q A;  1ZZY A;  2VO4 A;  4OFM A;  3MWH A;  3RDW A;  5CYY A;  4TXO A;  3OR5 A;  3BCI A;  4POL A;  1SKR B;  4IGJ A;  1FG4 A;  5JWR B;  3UL3 A;  4KDX A;  3KTL A;  1B4Q A;  1SKW B;  2AB6 A;  2H01 A;  2H30 A;  2HSY A;  1GUH A;  2GSS A;  3M8N A;  2GZZ A;  3QAG A;  4FO5 A;  5IPH A;  4TOP A;  5FHI A;  1PN9 A;  5D8I A;  2HSM A;  4PXO A;  4GSN A;  5FWG A;  4ID0 A;  4L8E A;  2H0G A;  2AYT A;  4JU5 A;  4ECI A;  5ECK B;  5JCU A;  3EU3 A;  5HR1 A;  2IN3 A;  2TRC P;  1B9Y C;  1ZYQ B;  1SL0 B;  3FW2 A;  1KBN A;  3HDC A;  2K18 A;  2ZUP A;  2PGT A;  2HSH A;  6GST A;  2J9H A;  9GSS A;  1TU7 A;  5DAK B;  1PRX A;  2HLS A;  4I2U A;  2H6X A;  3RHB A;  2IWT A;  2LKU A;  3LGC A;  1SJZ A;  2VLU A;  1A8Y A;  1XWK A;  1Q4J A;  3HJP A;  2N5A A;  4TR0 A;  4IQA A;  3QAW A;  4QL7 A;  3U5R E;  5EL8 A;  1ERW A;  3DVW A;  3TDG A;  1NHY A;  4KX4 A;  2ES7 A;  1FB0 A;  1V9W A;  1GSU A;  2E2M A;  3ZML A;  3VWU A;  1SL2 B;  1OKD A;  3DD3 A;  3WT2 A;  3IA1 A;  1SYR A;  5CAX A;  1XVQ A;  8GSS A;  2JSZ A;  1GSQ A;  2R37 A;  3LFL A;  5ECL B;  3LXZ A;  2JU5 A;  2FWH A;  1FAA A;  5AIV A;  1XWA A;  1A24 A;  3IC8 A;  2R4V A;  4BVY B;  1VF3 A;  3ERF A;  3IAM 2;  4DSS B;  2H1A A;  1E2Y A;  1GL8 A;  1THO A;  1MD3 A;  4BVX B;  5A4U A;  5ELG A;  1JZW A;  2CAQ A;  1FO5 A;  2OBK A;  2JSY A;  1XVW A;  2DMM A;  1G7O A;  1PKW A;  3EWL A;  5D96 A;  4EUY A;  1W4V A;  1M99 A;  3IE3 A;  3QOU A;  3DEX A;  2C1Y A;  2B3S A;  5L71 A;  2XC2 A;  4GWR A;  4IN0 A;  3MDK A;  2WUL A;  4EXJ A;  3KEB A;  4MLY A;  1EGO A;  2ON7 A;  2VD1 A;  12GS A;  1MEK A;  1SKS B;  3C71 A;  3RHC A;  3TOT A;  4V1A p;  4CW9 A;  4YH2 A;  5LNK e;  2UZ8 A;  3SWL A;  4OD7 A;  4K7I A;  4ZIJ A;  3HCZ A;  4YQV A;  1KEB A;  2F51 A;  2ZNM A;  2JZR A;  4F0C A;  4X43 A;  5KN1 A;  4XS1 A;  5ID2 A;  1G0T A;  5GSS A;  3P90 A;  3CBU A;  4G19 A;  3ZTL A;  4MP4 A;  3WYW A;  1XOA A;  2L4C A;  1ZMA A;  1GTU A;  4G10 A;  1X5E A;  4X1U A;  1Y25 A;  5IQY A;  4EC0 A;  1XW6 A;  2AUV A;  3HYP A;  4RI6 A;  2NTO A;  2A2S A;  2KP1 A;  4ZL9 A;  5DVB A;  4OFN A;  3G9B A;  1BJX A;  3Q74 A;  2B5Y A;  2FCH A;  2WZ9 A;  1TK8 B;  5DQY A;  4K1F A;  3F4T A;  3IDV A;  2C80 A;  5EY6 A;  1O6J A;  1TJD A;  2YZU A;  4NHW A;  2L59 A;  1GWC A;  1SK1 A;  4PNF A;  3M0F A;  5IOX A;  5CRG A;  1UN2 A;  3WGD A;  2BTO T;  4MPF A;  4WBR D;  2CQ9 A;  2YWM A;  4NV2 A;  3FR9 A;  1I9D A;  2H6Y A;  2HZE A;  4L5L A;  3PH9 A;  3GNJ A;  3TOU A;  1XFL A;  5GAN D;  5G1L A;  3ZZX A;  2OBI A;  2YJ7 A;  2P5Q A;  4GXZ A;  2H8L A;  3VLN A;  4RUV A;  4X0X A;  1QQ2 A;  3FZ9 A;  4AJ8 A;  1XBS A;  4Q5R A;  2HRA A;  1F3B A;  2X8G A;  3TJJ A;  1SL1 B;  2HRK A;  4MDC A;  5HFI A;  3J7Y b;  4ML1 A;  1WE0 A;  5D73 A;  1GSF A;  1OE7 A;  3HJO A;  3VPT A;  2OAC A;  3CSH A;  2PMT A;  5D93 A;  4ECJ A;  1VF1 A;  2YV9 A;  1XZO A;  1GUK A;  2FHE A;  4ISD A;  3M9K A;  1R26 A;  4MJC A;  4JR6 A;  2L6C A;  3LOR A;  4IVF A;  6GSX A;  3D0Z A;  3IV4 A;  5F0G A;  3GTU A;  2R3X A;  4TXV A;  3CTG A;  1PGT A;  2PVO C;  4NV5 A;  2OAD A;  4N11 A;  1WOU A;  4K0G A;  3FKF A;  2R5G A;  3UEM A;  5DBQ A;  3KD0 A;  2PN8 A;  4QL9 A;  2HRN A;  5F06 A;  1XWB A;  1CQH A;  4IQ1 A;  6GSW A;  2O8V B;  2RUE A;  1TTZ A;  3N5O A;  3TCO A;  3EE2 A;  3ZIV A;  1TP9 A;  3APO A;  3UVT A;  2VLT A;  4JR4 A;  3MNG A;  4XRA A;  3APS A;  4NAX A;  2AV4 A;  3BD2 A;  2Z9S A;  1O85 A;  3GRX A;  3LJR A;  2L5O A;  1YKA A;  1YQ1 A;  5AGY A;  16GS A;  4FYU A;  3US3 A;  3GX8 A;  4KCE A;  3M9J A;  1N8J A;  3D4M A;  2MBS A;  2DLX A;  3LG6 A;  3QCP A;  4OWY A;  1HNC A;  3E9J B;  3ME8 A;  2H1G A;  4P3Y B;  1XIY A;  1Z6N A;  3C7M A;  2HXK A;  3F6F A;  1PKZ A;  4BPY A;  4PQI A;  2AJQ B;  1YDK A;  3G7J A;  5ECH B;  5H5S A;  2LJK A;  2V6O A;  3W8S A;  1G7E A;  3WD6 A;  4K7N A;  1PL2 A;  2CVD A;  3EIN A;  1TI3 A;  4EL1 A;  4K2D A;  4MZC A;  5GAP D;  3KP9 A;  3S9F A;  4MMM A;  2DIZ A;  4MF7 A;  4IS0 A;  4ZBA A;  2CT6 A;  4ZL7 A;  1WMJ A;  3V1W A;  2I1U A;  5BMU A;  3L78 A;  4MZW A;  4OO5 A;  4RQX A;  1F3A A;  1R5P A;  2QC7 A;  3DIE A;  1T3B A;  1GSD A;  1YJ6 A;  2C8U A;  3F0I A;  3BCK A;  2EIQ A;  3HA9 A;  4XTS A;  3FR3 A;  2VM1 A;  2YCD A;  1OC9 B;  1W89 A;  2QGV A;  4GQC A;  1ABA A;  2V1M A;  4F9Z A;  5IO2 A;  3FHK A;  4IP6 A;  4V2L A;  2M80 A;  4V1A g;  4DSQ A;  2KOK A;  2B7K A;  2MMA A;  4KB3 A;  1V98 A;  4IJ3 A;  4PX1 A;  1TRW A;  3TRX A;  3O76 A;  5ECQ B;  5ELA A;  1TK5 B;  3FK8 A;  3UOM A;  1YEX A;  2MYG A;  2LEG A;  4EF0 A;  2NVL A;  1EWX A;  3TJF A;  1H75 A;  3DKS A;  4GTU A;  2FD3 A;  1ST9 A;  1DE2 A;  3J7Y k;  2XBQ A;  3TKQ A;  4L5O A;  4EE0 A;  1OE8 A;  3RPN A;  2VCT A;  5J3R A;  4TR1 B;  1X9M B;  3KXO A;  5HR2 A;  1WJK A;  4YQM A;  2TRX A;  5B6N A;  2PVQ A;  5F07 A;  1O8X A;  3F3Q A;  1R7H A;  2DBC A;  1JFU A;  4EVM A;  2V6K A;  5JCW A;  3Q19 A;  1Z5Y E;  3LEF A;  4HJM A;  1JLV A;  2FGX A;  3HKR A;  3HVS A;  3LQ7 A;  4OMV A;  2LQO A;  1WIK A;  2CVB A;  3IAS 2;  1HD2 A;  4RQR A;  4HQZ A;  5IMA A;  3GV1 A;  1EP8 A;  4MJA A;  3ZMK A;  4L0W A;  1TRU A;  1OYJ A;  2FWE A;  2JZS A;  4O92 A;  5AIS A;  3IOS A;  3GA4 A;  1BYE A;  1QGV A;  2NPB A;  2C3T A;  3K8N A;  3VWV A;  3QFB C;  4K7O A;  4ZB8 A;  5ECO B;  4MA9 A;  2VAF A;  2JL4 A;  1TDI A;  1TRV A;  2H76 A;  3ZFL A;  2GSQ A;  1ILO A;  2HNL A;  2C4J A;  4PTS A;  3GKM A;  2PBJ A;  1LJR A;  5FT3 A;  3F4R A;  3N9J A;  2QSI A;  1K0B A;  3KJY A;  2CV4 A;  1F6M C;  4I2T A;  5ABR A;  2GQM A;  3NOF A;  4WR4 A;  3ISO A;  2B1L A;  4XRD A;  5D9X A;  3TKS C;  3HD5 A;  2O7K A;  1B9X C;  2MZC A;  2YN1 A;  3FZ5 A;  4K9Z A;  5DAK A;  4V2N A;  3GH6 A;  1B48 A;  1K0O A;  1MDK A;  2FWG A;  2TIR A;  1V40 A;  1EOH A;  1M9A A;  2LJR A;  1G6Y A;  1URM A;  2X8H A;  2IFQ B;  3GHA A;  1LBK A;  3GX0 A;  4TR3 A;  2CX4 A;  2HSN B;  2L4Q A;  3AY8 A;  5AN1 A;  2XPD A;  1AQW A;  2L5L A;  1OKT A;  1MD4 A;  5GZZ B;  2AHE A;  4BWS A;  4HZ4 A;  5B8B A;  3GMF A;  5J5N A;  2VM2 A;  3A3T A;  5CRH A;  4I97 A;  3GN3 A;  3TRQ A;  5CP1 A;  1SEN A;  2F9S A;  1YF1 A;  3O3T A;  3TB2 A;  5G30 A;  1U88 A;  3C1S A;  2GLR A;  5IOW A;  1FB6 A;  5JWQ B;  2GTU A;  2YWO A;  5G5E A;  1GH2 A;  5IMV A;  4N0V A;  2H73 A;  2PUK C;  2J23 A;  2O89 A;  2RM5 A;  1J9B A;  3F4S A;  4KW6 A;  4FH8 A;  4H86 A;  4EKZ A;  4BVY A;  3BBY A;  1TW9 A;  2OJL A;  1AAZ A;  5G1K A;  4DSS A;  3DML A;  1A0F A;  4N10 A;  4O32 A;  5IPG A;  1ZGN A;  1Z7P A;  1XPV A;  4HQS A;  1U3A A;  5HQP A;  6GSY A;  4KUN A;  4ZBD A;  3RPP A;  1V58 A;  1M7T A;  2HZE B;  1GNE A;  11GS A;  1TI1 A;  2OKA A;  3E0U A;  7GSS A;  2REM A;  4BA7 A;  4WR5 A;  3H93 A;  3WGX A;  3KH7 A;  4OFT A;  2LQQ A;  3HZ4 A;  3PIN A;  2N5B A;  2FA8 A;  4HS1 A;  2DJK A;  3TJG A;  2HZF A;  1A2L A;  4I6X A;  1IYH A;  2X99 A;  4D73 B;  4GQF A;  3DGQ A;  1JLW A;  4Q5Q A;  2GQL A;  2M46 A;  2XHF A;  4DVC A;  2V32 A;  1XXU A;  4IHU A;  2OE0 A;  3P7X A;  4O5R A;  5DCG A;  3G7I A;  1AIU A;  2LS5 A;  1K3Y A;  3LYP A;  3QAV A;  5B6M A;  1T4Y A;  2CAI A;  4E8H A;  3KMN A;  1GUL A;  3LSZ A;  5E4W A;  5ECM B;  4ILF A;  2AAW A;  4BL7 A;  1WP0 A;  3D5J A;  1VGL A;  2LUS A;  4F03 A;  2H70 A;  1UVZ A;  3TKR A;  4ZIL A;  1B4P A;  4YAV A;  1QUW A;  4LA1 A;  3FR6 A;  3IK9 A;  10GS A;  1K3L A;  3GTU B;  3QMX A;  2VCV A;  3F3R A;  1A2J A;  4IBP A;  2VD0 A;  3KTB A;  3PGT A;  2YOI A;  4IJI A;  5H5R A;  2IMK A;  6GSV A;  1U3I A;  3I6A A;  3GL5 A;  1AW9 A;  1YZX A;  3DYR A;  5D9T A;  5HFG A;  2KHP A;  4GLT A;  1YF0 A;  1S3C A;  3UAP A;  1DSB A;  1FOV A;  5DJM A;  1T8E B;  1SU9 A;  4YAP A;  5ECN B;  22GS A;  1U6T A;  3H4K A;  1UC7 A;  4PUA A;  4LLR A;  1YKC A;  2DSA A;  4FYB A;  20GS A;  1FVJ A;  3L9V A;  3TKS A;  1TXX A;  5DJL A;  3ZFB A;  4Q5N A;  5ECS A;  4ACS A;  3ZVJ D;  1T1V A;  4JRR A;  2PWJ A;  3M1G A;  1JZD A;  5CRD A;  4G0K A;  4POK A;  4J57 E;  2GSR A;  2IJY A;  3CRT A;  3L9U A;  4XHM A;  2P31 A;  4MJB A;  4CDO A;  1KTE A;  5EVO A;  1SYX A;  5KEJ A;  2R2J A;  4MJE A;  3R3E A;  3H1N A;  4MPG A;  2IMF A;  4HEA 2;  1XCC A;  5HFK A;  4WEY A;  2VCQ A;  2IMI A;  3MAK A;  4LL1 B;  1SK0 A;  1HNB A;  2B1K A;  1V57 A;  1F2E A;  3FY7 A;  2VCZ A;  1X9S B;  2PPT A;  2GQK A;  3UMA A;  2DML A;  4KDY A;  2H0H A;  4KH7 A;  3PR8 A;  5DAL B;  2C3Q A;  1JHB A;  4OO4 A;  1E6B A;  1F37 A;  4XS6 A;  3VI5 A;  4JZQ A;  5AIX A;  2LNS A;  3IRA A;  4J56 E;  2YAN A;  3A5W A;  3ME7 A;  2VOC A;  2I4A A;  1NW2 A;  4XCS A;  4E8E A;  1K3O A;  2OA7 A;  3VK9 A;  4HZ2 A;  2H0I A;  4Z7X A;  2DIY A;  3CSJ A;  4GF0 A;  4IP1 A;  3UBK A;  1EP7 A;  3GKX A;  4AJ7 A;  4ULX A;  1ERT A;  4DSR A;  2RM6 A;  4XS4 B;  4G2E A;  2X64 A;  3IPZ A;  2YZH A;  2OE1 A;  1NM3 A;  1RK4 A;  4K0N A;  2K8V A;  3HJM A;  1QXH A;  2LST A;  2GZP A;  2H72 A;  4POM A;  2H6Z A;  3IBH A;  2K8S A;  2ZCT A;  1WRY A;  2B5X A;  5J41 A;  1THX A;  3KCM A;  2JAD A;  1Z6M A;  1BAY A;  2XBI A;  3DXB A;  3H8Q A;  4G0L A;  2YP6 A;  4MZB A;  5IMF A;  4TW5 A;  1NHO A;  2LRN A;  1Q98 A;  2I9H A;  5CO3 A;  1SK2 A;  1M9B A;  2PU9 C;  1MDJ A;  1ERV A;  3FEU A;  1U87 A;  5G31 A;  1K0N A;  4AJ6 A;  3F8U A;  4Q5F A;  1PA3 A;  1PX6 A;  1F9M A;  2LRC A;  5LCZ A;  4TXO B;  1TKD B;  1EGR A;  4N0Z A;  2H66 A;  2GT5 A;  2ALB A;  4NMU A;  3CMI A;  3P2A A;  1O7U A;  4TR4 A;  3JCM L;  4ECB A;  4KND A;  1OC3 A;  1PMT A;  1M2B A;  2HSM B;  2GZY A;  5E59 A;  1ML6 A;  2L6D A;  2X8C A;  1QMV A;  4TN8 A;  4WKW A;  3GUS A;  1NSW A;  3NIV A;  2HT9 A;  3GSS A;  3KMO A;  3TJB A;  5LD0 A;  4KDU A;  3TJK A;  1OAZ A;  4F0B A;  5EPF A;  2IL3 A;  14GS A;  2FA4 A;  5B8A A;  3EVI A;  5HR3 A;  3CSI A;  4KAE A;  2WS2 A;  3HY2 A;  2VL3 A;  2VCW A;  2C0E A;  3KM6 A;  3ERW A;  4WET A;  3EMX A;  2GT6 A;  1KNG A;  2CA8 A;  4KGI A;  1OC9 A;  5DCH A;  3GST A;  1A2M A;  1TOF A;  3NZN A;  5H5Q A;  2VLV A;  1K0M A;  3HXS A;  4GSS A;  3EUR A;  1AC1 A;  1K0D A;  1DE1 A;  4EDY A;  1IYI A;  3I69 A;  3D6I A;  1MTC A;  3IXR A;  3DVX A;  1XWC A;  4HU7 A;  4QQ7 A;  2ON5 A;  4HU9 A;  1R4W A;  3UVH A;  3HZ8 A;  1EZK A;  4IW9 A;  3I9V 2;  3HHV A;  3P8W A;  3KGK A;  2QKE A;  2K9F A;  2WGR A;  1PSQ A;  1ACV A;  2HRF A;  2CZ3 A;  3H79 A;  2HE3 A;  1AXD A;  2WCI A;  4TR1 A;  3GYK A;  3IC4 A;  1K0A A;  5KN2 A;  1TRS A;  17GS A;  2FLS A;  1FHE A;  3SBC A;  1GSY A;  2MMZ A;  3F9U A;  3ZVJ A;  2LJA A;  3GKN A;  1ZOF A;  1Z3E A;  2R6K A;  3IR4 A;  2C0G A;  1TK0 B;  1I5G A;  4OCE A;  2FWF A;  4ZB9 A;  3GH9 A;  4OCF A;  1PD2 1;  2C0F A;  2WRT A;  1EOG A;  1HQO A;  1BED A;  1OC8 A;  4ECC A;  2IPA A;  5INY A;  5ECI B;  3RAZ A;  4F2I A;  1SJ6 A;  3LWA A;  2IME A;  5GST A;  3Q18 A;  4WF5 A;  2CVK A;  4EO3 A;  3LYK A;  2DJJ A;  4HJ2 A;  4CHS A;  5IMC A;  2LNT A;  5KN3 A;  1GLQ A;  1T00 A;  4NPB A;  3KZQ A;  3ZRD A;  4FIW A;  1A0R P;  1FVK A;  4MH3 A;  4KCA A;  3U6V A;  3FZ4 A;  1SJI A;  5F8B A;  2HQT A;  5D9W A;  3HVV A;  1BG5 A;  1T4Z A;  2FNO A;  2RUF A;  5G5F A;  1M2A A;  1R5A A;  1QK8 A;  2LTK A;  5ID2 B;  3ZLP A;  4MF6 A;  4TVE A;  2H74 A;  1GP1 A;  4USS A;  2WFC A;  1ON4 A;  1PQN A;  2F3M A;  4ZB6 A;  2D2Z A;  1GNW A;  1GRX A;  3ZIJ A;  5ECP B;  6GSU A;  3F63 A;  1X5C A;  1EEM A;  5COH A;  1X9W B;  3VWX A;  5C04 A;  5ENU A;  1K0C A;  3DRN A;  4NXI A;  2P5R A;  1BQ7 A;  3L0H A;  5IIZ A;  2NDO A;  4MCU A;  2JZT A;  5A4W A;  3C8E A;  4HI7 A;  1A8L A;  5IMZ A;  3BOA A;  2L57 A;  1B8X A;  3KP8 A;  1RW1 A;  2H19 A;  6GSS A;  4AF2 A;  2VL2 A;  3TGZ A;  1G6W A;  2KUC A;  4BVX A;  3KH9 A;  5J9C A;  1J0F A;  3ERG A;  1EV9 A;  2IFQ A;  3GKK A; 
#chains in the Genus database with same CATH topology
 3EYT A;  2YV7 A;  2P0G A;  2HSN A;  1XOB A;  4KA0 A;  4BWQ A;  2HYX A;  4BL7 B;  2FY6 A;  2DC5 A;  2R0G A;  3LXT A;  4X4J A;  4TKY A;  5IMD A;  2B6M A;  4RI7 A;  2DJ0 A;  2V41 A;  3Q6O A;  4MF5 A;  3QR6 A;  4FYC A;  4HOJ A;  2IIY A;  2WJU A;  3VFI A;  4J2F A;  1GTI A;  1ZCP A;  4ZL8 A;  4WXT A;  5CNW A;  5ECR B;  1C72 A;  3CHX C;  1JZR A;  5J4U A;  1BX9 A;  1RQM A;  3UIW A;  2E0Q A;  1ZYE A;  5A5K A;  2HRK B;  4LL4 B;  5B7C A;  2GVP A;  4WBJ A;  1JZO A;  1GTA A;  3QFA C;  4IKH A;  3TKS E;  4MK3 A;  4NHZ A;  5J9B A;  2MBT A;  1S3D A;  3FRC A;  4LMV A;  1QFN A;  1ZL9 A;  2BMX A;  3HVX A;  4EDZ A;  3RBT A;  2YWI A;  2OE3 A;  3EC3 A;  2O87 A;  3I43 A;  4PGT A;  1DUG A;  3QD9 A;  3F6D A;  4G0I A;  1DBY A;  2V2G A;  4MNN A;  2F8A A;  4F82 A;  4GST A;  1XW9 A;  4PUR A;  2HI7 A;  1YVL A;  3A2V A;  4YKF A;  4ZB7 A;  4D73 A;  2E7P A;  4NWY A;  1SD8 A;  3M3M A;  1UA5 A;  3FZA A;  4E68 A;  2A4V A;  2GGT A;  4HDE A;  2IMD A;  5JCG A;  2H75 A;  3EMP A;  1X5D A;  5F05 A;  4LMW A;  2YPM A;  1GTB A;  3PPU A;  1Z9H A;  5DDL A;  2DJ2 A;  4N30 A;  1OVN A;  4K6X A;  1V2A A;  4JE1 A;  3ZYW A;  3VPQ A;  1ERU A;  3DWV A;  5A5H A;  5CRW A;  3TRP A;  2GS3 A;  4JBB A;  1FW1 A;  2PER A;  2EIO A;  3APQ A;  5A4V A;  4KSM A;  4O7H A;  3O6T A;  3UBL A;  1O81 A;  4G9H A;  3GIX A;  1H4O A;  1AQV A;  1VRS D;  2RII A;  3BJ5 A;  4ZBB A;  3CTF A;  4PI0 C;  1XWG A;  5A1N B;  4V2M A;  3ZL5 A;  2VUP A;  3R2Q A;  5D9V A;  2H1D A;  2WDU A;  3GFK A;  4PQH A;  2WW3 A;  5J40 A;  2KLX A;  4DEJ A;  5HR0 A;  3QPM A;  4PNG A;  3D21 A;  5C00 A;  4CY8 A;  4MH2 A;  5IM9 A;  1EEJ A;  1VF2 A;  1S3A A;  2O85 A;  4I8B A;  2EC4 A;  3WT1 A;  3IHQ A;  2B7J A;  1WPI A;  3L9S A;  5JWO B;  4KSO A;  1Y6E A;  4MAB A;  5BMU B;  3TUE A;  1YY7 A;  3WGE A;  4L0U A;  1USB A;  3C1R A;  2H1B A;  2BJX A;  3W6G A;  2RLI A;  3E3E A;  4KE3 A;  2YWN A;  4GCI A;  3D22 A;  1MDI A;  4KF9 A;  2E2G A;  2F8F A;  4HUA A;  4I5Q A;  3A2X A;  3FYG A;  3GL3 A;  1TU8 A;  2GDR A;  4FQU A;  1HYU A;  1AUC A;  2B5E A;  1N2A A;  2LV3 A;  3UJ1 A;  3GUR A;  5DQS A;  1AQX A;  3CYN A;  2DJ1 A;  4XIH A;  1BF5 A;  1WWJ A;  3VI7 A;  4PQ1 A;  1GUM A;  5DAL A;  2HFD A;  5IO0 A;  4JED A;  2FUG 2;  3A2W A;  3D4T A;  1O73 A;  2VKZ G;  4AKX B;  2EIR A;  3EU4 A;  1YEP A;  3L4N A;  2R0P A;  3VWW A;  2I3Y A;  3CXG A;  3G7Y A;  3VUR A;  2JAC A;  2I81 A;  2VIM A;  4K8M A;  2YNX A;  5G2Z A;  1EV4 A;  1GSE A;  3QDN A;  3CRU A;  4AGS A;  5CRE A;  2XPE A;  2NBS A;  1T7P B;  2CZ2 A;  2K6V A;  2GST A;  2N5F A;  18GS A;  3ZIT A;  1PL1 A;  3C73 A;  1XW5 A;  4XS4 A;  2C0D A;  2A2R A;  1SD9 A;  4YQU A;  2WB9 A;  2MMO A;  3TKP A;  1CQG A;  4WF4 A;  1J08 A;  4POB A;  2KP2 A;  1A23 A;  2C3N A;  2X49 A;  1HNA A;  2VCX A;  2WW1 A;  4ML6 A;  4GRF A;  1GSS A;  2VL9 A;  1X0R A;  2LRT A;  2VL2 C;  2G0F A;  19GS A;  2CX3 A;  3KIJ A;  3ZRE A;  2DJ3 A;  2M72 A;  1O8W A;  1Z7R A;  1GLP A;  1M0U A;  1VF4 A;  3IK7 A;  4EIQ A;  4IEL A;  3W8J A;  2YJH A;  2X4A A;  3MSZ A;  4TRX A;  5KN0 A;  13GS A;  3ED3 A;  3UAR A;  4ZXG A;  2H71 A;  2MMN A;  1PX7 A;  1LU4 A;  4PUF C;  1M2D A;  2G2Q A;  1ZZY A;  2VO4 A;  4OFM A;  3MWH A;  3RDW A;  5CYY A;  4TXO A;  3OR5 A;  3BCI A;  4POL A;  1SKR B;  4IGJ A;  1FG4 A;  5JWR B;  3UL3 A;  4KDX A;  3KTL A;  1B4Q A;  1SKW B;  2AB6 A;  2H01 A;  2H30 A;  2HSY A;  1GUH A;  2GSS A;  3M8N A;  2GZZ A;  4N3Z A;  3QAG A;  4FO5 A;  5IPH A;  4TOP A;  5FHI A;  1PN9 A;  5D8I A;  2HSM A;  4PXO A;  4GSN A;  5FWG A;  4ID0 A;  4L8E A;  5KOW A;  2H0G A;  2AYT A;  4JU5 A;  4ECI A;  5ECK B;  5JCU A;  3EU3 A;  5HR1 A;  2IN3 A;  2TRC P;  1B9Y C;  1ZYQ B;  1SL0 B;  3FW2 A;  1KBN A;  3HDC A;  2K18 A;  2ZUP A;  2PGT A;  2HSH A;  6GST A;  2J9H A;  3MYD A;  9GSS A;  1TU7 A;  5DAK B;  2WVX A;  1PRX A;  2HLS A;  4I2U A;  4Z2R A;  2H6X A;  3RHB A;  2IWT A;  2LKU A;  3LGC A;  1SJZ A;  2VLU A;  2UV8 G;  1A8Y A;  1XWK A;  1XG8 A;  1Q4J A;  3HJP A;  2N5A A;  4TR0 A;  4IQA A;  3QAW A;  4QL7 A;  4PI2 C;  3U5R E;  5EL8 A;  1ERW A;  3DVW A;  3TDG A;  1NHY A;  4KX4 A;  2ES7 A;  1FB0 A;  2WVY A;  1V9W A;  1GSU A;  2E2M A;  3ZML A;  3VWU A;  1SL2 B;  1OKD A;  3DD3 A;  3WT2 A;  3IA1 A;  1SYR A;  5CAX A;  1XVQ A;  8GSS A;  2JSZ A;  1GSQ A;  2R37 A;  3LFL A;  1ZYN A;  5ECL B;  3LXZ A;  4QMK A;  2JU5 A;  1TXU A;  2FWH A;  1FAA A;  5AIV A;  1XWA A;  4K2X A;  1A24 A;  3IC8 A;  2R4V A;  4BVY B;  1VF3 A;  3ERF A;  3IAM 2;  4DSS B;  2H1A A;  1E2Y A;  1GL8 A;  1THO A;  1MD3 A;  4BVX B;  5A4U A;  5ELG A;  1JZW A;  2CAQ A;  1FO5 A;  2OBK A;  2JSY A;  1XVW A;  2DMM A;  1G7O A;  1PKW A;  3EWL A;  5D96 A;  4EUY A;  1W4V A;  1M99 A;  3IE3 A;  3QOU A;  3DEX A;  3A5I A;  2C1Y A;  2B3S A;  5L71 A;  2XC2 A;  4GWR A;  4IN0 A;  3MDK A;  2WUL A;  4EXJ A;  3KEB A;  3FMW A;  4MLY A;  1EGO A;  2ON7 A;  2VD1 A;  12GS A;  1MEK A;  1SKS B;  3C71 A;  3RHC A;  3TOT A;  4V1A p;  4CW9 A;  4YH2 A;  5LNK e;  2UZ8 A;  3SWL A;  4OD7 A;  4K7I A;  4ZIJ A;  3HCZ A;  4YQV A;  1KEB A;  2F51 A;  2ZNM A;  2JZR A;  4F0C A;  4X43 A;  5KN1 A;  4XS1 A;  5ID2 A;  1G0T A;  5GSS A;  3P90 A;  3CBU A;  4G19 A;  2A4H A;  3ZTL A;  4MP4 A;  3WYW A;  1XOA A;  4G01 A;  2L4C A;  1ZMA A;  1GTU A;  4G10 A;  1X5E A;  4X1U A;  1Y25 A;  4PHZ C;  5IQY A;  4EC0 A;  1XW6 A;  3HVN A;  2AUV A;  3HYP A;  4RI6 A;  2NTO A;  2A2S A;  2KP1 A;  4ZL9 A;  5DVB A;  2QA2 A;  4AKI A;  4OFN A;  3G9B A;  1BJX A;  3MIX A;  3Q74 A;  2B5Y A;  1SVO A;  2FCH A;  2WZ9 A;  5DQY A;  1TK8 B;  4K1F A;  3F4T A;  3IDV A;  2C80 A;  1PFO A;  5EY6 A;  1O6J A;  1TJD A;  2YZU A;  4NHW A;  2L59 A;  1GWC A;  1SK1 A;  2DKI A;  1N25 A;  4PNF A;  3M0F A;  5IOX A;  5CRG A;  1UN2 A;  3WGD A;  2BTO T;  4MPF A;  4WBR D;  2CQ9 A;  2YWM A;  4NV2 A;  3FR9 A;  1I9D A;  2H6Y A;  2HZE A;  4L5L A;  3PH9 A;  3GNJ A;  3TOU A;  1XFL A;  5GAN D;  5G1L A;  3ZZX A;  2OBI A;  2YJ7 A;  2P5Q A;  4GXZ A;  2H8L A;  3VLN A;  4RUV A;  4X0X A;  1QQ2 A;  3FZ9 A;  4AJ8 A;  1XBS A;  4Q5R A;  2HRA A;  1F3B A;  2X8G A;  3TJJ A;  1SL1 B;  2HRK A;  4MDC A;  5HFI A;  3J7Y b;  3LW9 A;  2QA1 A;  4ML1 A;  1WE0 A;  5D73 A;  1GSF A;  2WW2 A;  1OE7 A;  3HJO A;  3VPT A;  2OAC A;  3CSH A;  3HMJ G;  2PMT A;  5D93 A;  4ECJ A;  1VF1 A;  2YV9 A;  1XZO A;  1GUK A;  2FHE A;  4ISD A;  3M9K A;  1R26 A;  4MJC A;  4JR6 A;  2L6C A;  3LOR A;  4IVF A;  6GSX A;  3D0Z A;  4O5U A;  3IV4 A;  5F0G A;  3GTU A;  2R3X A;  4TXV A;  3CTG A;  1PGT A;  2PVO C;  4NV5 A;  2OAD A;  4N11 A;  1WOU A;  4K0G A;  3FKF A;  2R5G A;  3UEM A;  5DBQ A;  3KD0 A;  2PN8 A;  4QL9 A;  2HRN A;  5F06 A;  1XWB A;  1CQH A;  4IQ1 A;  6GSW A;  2O8V B;  2RUE A;  4YKG A;  1TTZ A;  3N5O A;  3TCO A;  3EE2 A;  3ZIV A;  1TP9 A;  3APO A;  3UVT A;  2VLT A;  4JR4 A;  3MNG A;  4XRA A;  3APS A;  4NAX A;  2AV4 A;  3BD2 A;  2Z9S A;  1O85 A;  3GRX A;  3LJR A;  2L5O A;  1YKA A;  1YQ1 A;  5AGY A;  16GS A;  4FYU A;  3US3 A;  3GX8 A;  4KCE A;  3M9J A;  2EFE A;  1N8J A;  3D4M A;  2MBS A;  2DLX A;  3LG6 A;  3QCP A;  4OWY A;  1HNC A;  3E9J B;  3ME8 A;  2H1G A;  4P3Y B;  1XIY A;  1Z6N A;  3C7M A;  2HXK A;  3F6F A;  5A1N A;  1PKZ A;  4BPY A;  4PQI A;  2AJQ B;  1YDK A;  3G7J A;  5ECH B;  5H5S A;  2LJK A;  3TU3 B;  2V6O A;  3W8S A;  1G7E A;  4W66 A;  3WD6 A;  1SVL A;  4K7N A;  1PL2 A;  2CVD A;  4K5S A;  3EIN A;  1TI3 A;  4EL1 A;  2WVZ A;  3EPT A;  4K2D A;  4MZC A;  5GAP D;  3KP9 A;  3S9F A;  4MMM A;  2DIZ A;  4MF7 A;  4IS0 A;  4ZBA A;  2CT6 A;  4ZL7 A;  1WMJ A;  3V1W A;  2I1U A;  5BMU A;  5A34 A;  3L78 A;  4MZW A;  4OO5 A;  4RQX A;  1F3A A;  1R5P A;  2QC7 A;  3DIE A;  1T3B A;  1GSD A;  1YJ6 A;  2C8U A;  2EFC A;  4FXY P;  3F0I A;  3BCK A;  2EIQ A;  3HA9 A;  4XTS A;  3FR3 A;  2VM1 A;  2YCD A;  1OC9 B;  1W89 A;  2QGV A;  4GQC A;  1ABA A;  2V1M A;  4F9Z A;  5IO2 A;  3FHK A;  4IP6 A;  4V2L A;  2M80 A;  4V1A g;  4DSQ A;  2KOK A;  2B7K A;  2MMA A;  3IHG A;  4KB3 A;  1V98 A;  3RFR C;  4IJ3 A;  4PX1 A;  1TRW A;  3TRX A;  3O76 A;  5ECQ B;  5ELA A;  1TK5 B;  3FK8 A;  3UOM A;  1YEX A;  2MYG A;  2LEG A;  4EF0 A;  2NVL A;  1EWX A;  3TJF A;  1H75 A;  3DKS A;  4GTU A;  2FD3 A;  1ST9 A;  1DE2 A;  3J7Y k;  1Y1U A;  2XBQ A;  3TKQ A;  4L5O A;  4EE0 A;  1OE8 A;  3RPN A;  2VCT A;  5J3R A;  4TR1 B;  1X9M B;  3KXO A;  5HR2 A;  1WJK A;  4YQM A;  2WVX B;  2TRX A;  5B6N A;  2PVQ A;  5F07 A;  4ICY A;  3CWG A;  1O8X A;  3F3Q A;  1R7H A;  2DBC A;  1JFU A;  4EVM A;  2V6K A;  5JCW A;  3Q19 A;  4K5R A;  1Z5Y E;  3LEF A;  4HJM A;  1BG1 A;  4Z2U A;  1JLV A;  2FGX A;  3HKR A;  4O5Q A;  3HVS A;  1ZYP A;  3LQ7 A;  4OMV A;  2LQO A;  1WIK A;  2CVB A;  3IAS 2;  1HD2 A;  4RQR A;  4HQZ A;  5IMA A;  3GV1 A;  1EP8 A;  4MJA A;  3ZMK A;  4L0W A;  1TRU A;  1OYJ A;  2FWE A;  4HSC X;  2JZS A;  4O92 A;  5AIS A;  3IOS A;  3GA4 A;  1BYE A;  1QGV A;  2NPB A;  2C3T A;  3K8N A;  3VWV A;  3QFB C;  4K7O A;  4ZB8 A;  5ECO B;  4MA9 A;  2VAF A;  2JL4 A;  1TDI A;  1TRV A;  2H76 A;  3ZFL A;  2GSQ A;  1ILO A;  2HNL A;  2C4J A;  4PTS A;  3GKM A;  2PBJ A;  1LJR A;  4BIK A;  5FT3 A;  3F4R A;  3N9J A;  2QSI A;  1K0B A;  3KJY A;  2CV4 A;  1F6M C;  4I2T A;  5ABR A;  2WZS A;  2GQM A;  3NOF A;  4WR4 A;  3CQF A;  3ISO A;  2B1L A;  2O5V A;  4XRD A;  5D9X A;  3TKS C;  3HD5 A;  2O7K A;  1B9X C;  2MZC A;  2YN1 A;  3FZ5 A;  4K9Z A;  1S3R A;  5DAK A;  4V2N A;  3GH6 A;  1B48 A;  1K0O A;  1MDK A;  2FWG A;  2TIR A;  1V40 A;  1EOH A;  1M9A A;  2LJR A;  1G6Y A;  1URM A;  2X8H A;  2IFQ B;  1M3I A;  3GHA A;  1LBK A;  3RGB C;  3GX0 A;  4TR3 A;  2CX4 A;  2HSN B;  2L4Q A;  3AY8 A;  5AN1 A;  2XPD A;  1AQW A;  2L5L A;  2A2P A;  1OKT A;  1MD4 A;  5GZZ B;  2AHE A;  4BWS A;  4HZ4 A;  2R0C A;  5B8B A;  3GMF A;  5J5N A;  2VM2 A;  3A3T A;  5CRH A;  4I97 A;  3GN3 A;  3TRQ A;  5CP1 A;  1SEN A;  2F9S A;  1YF1 A;  3O3T A;  3TB2 A;  5G30 A;  1U88 A;  3C1S A;  2GLR A;  5IOW A;  1FB6 A;  5JWQ B;  2GTU A;  2YWO A;  5G5E A;  1GH2 A;  5IMV A;  4N0V A;  2H73 A;  2PUK C;  2J23 A;  2O89 A;  2RM5 A;  1J9B A;  3F4S A;  4KW6 A;  4FH8 A;  4H86 A;  4EKZ A;  4BVY A;  3BBY A;  1TW9 A;  2OJL A;  1AAZ A;  5G1K A;  4DSS A;  3DML A;  1A0F A;  4N10 A;  4O32 A;  5IPG A;  1ZGN A;  1Z7P A;  1XPV A;  4HQS A;  1U3A A;  5HQP A;  6GSY A;  4KUN A;  4ZBD A;  3RPP A;  1V58 A;  1M7T A;  2HZE B;  1GNE A;  11GS A;  1TI1 A;  2OKA A;  3E0U A;  7GSS A;  2REM A;  4Z2T A;  4BA7 A;  4WR5 A;  1M3J A;  1I1I P;  3H93 A;  3WGX A;  3KH7 A;  2WW0 A;  4OFT A;  2LQQ A;  3HZ4 A;  3PIN A;  2N5B A;  2FA8 A;  4HS1 A;  2DJK A;  3TJG A;  2HZF A;  1A2L A;  4I6X A;  1IYH A;  2X99 A;  4D73 B;  4GQF A;  3DGQ A;  1JLW A;  4Q5Q A;  2GQL A;  2M46 A;  2XHF A;  4DVC A;  2V32 A;  1XXU A;  4IHU A;  2OE0 A;  3P7X A;  4O5R A;  5DCG A;  3G7I A;  1AIU A;  2LS5 A;  1K3Y A;  3LYP A;  3QAV A;  5B6M A;  1T4Y A;  2CAI A;  4E8H A;  3KMN A;  1GUL A;  5J4V A;  3LSZ A;  5E4W A;  5ECM B;  4ILF A;  2AAW A;  5A5H B;  4BL7 A;  1WP0 A;  3D5J A;  1VGL A;  2LUS A;  4F03 A;  2H70 A;  1UVZ A;  3TKR A;  4ZIL A;  1B4P A;  4YAV A;  1QUW A;  4LA1 A;  3FR6 A;  3IK9 A;  10GS A;  1K3L A;  3GTU B;  3QMX A;  2VCV A;  3F3R A;  1A2J A;  4IBP A;  5J47 A;  2VD0 A;  3KTB A;  4AI6 A;  3PGT A;  2YOI A;  4IJI A;  5H5R A;  2IMK A;  6GSV A;  1U3I A;  3I6A A;  3GL5 A;  1AW9 A;  1YZX A;  3DYR A;  5D9T A;  5HFG A;  2KHP A;  4GLT A;  1YF0 A;  1S3C A;  3UAP A;  1DSB A;  1FOV A;  5DJM A;  1T8E B;  1SVM A;  1SU9 A;  4YAP A;  5ECN B;  22GS A;  1U6T A;  3H4K A;  1UC7 A;  4PUA A;  4LLR A;  1YKC A;  2DSA A;  4FYB A;  20GS A;  1FVJ A;  3L9V A;  3TKS A;  1TXX A;  5DJL A;  3ZFB A;  4Q5N A;  5ECS A;  4ACS A;  3ZVJ D;  1T1V A;  4JRR A;  2PWJ A;  3M1G A;  1FOH A;  1JZD A;  5CRD A;  4G0K A;  4POK A;  4J57 E;  2GSR A;  2IJY A;  3CRT A;  3L9U A;  4XHM A;  2P31 A;  4MJB A;  4CDO A;  1KTE A;  5EVO A;  1SYX A;  5KEJ A;  4CY6 A;  2R2J A;  4MJE A;  3R3E A;  3H1N A;  4MPG A;  2IMF A;  4HEA 2;  1XCC A;  5HFK A;  4WEY A;  2VCQ A;  2IMI A;  3MAK A;  4LL1 B;  1SK0 A;  1HNB A;  2B1K A;  1V57 A;  1F2E A;  3FY7 A;  2VCZ A;  1X9S B;  2PPT A;  2GQK A;  3UMA A;  2DML A;  4KDY A;  2H0H A;  4KH7 A;  5KOX A;  3PR8 A;  5DAL B;  2C3Q A;  1JHB A;  4OO4 A;  1E6B A;  5J4Y A;  1F37 A;  4XS6 A;  3VI5 A;  4JZQ A;  5AIX A;  2LNS A;  3IRA A;  4J56 E;  2YAN A;  3A5W A;  3ME7 A;  2VOC A;  2I4A A;  1NW2 A;  1YEW C;  4XCS A;  4E8E A;  4GDF A;  1K3O A;  2OA7 A;  3VK9 A;  4HZ2 A;  2H0I A;  4Z7X A;  2DIY A;  3CSJ A;  4GF0 A;  4IP1 A;  5A34 B;  3UBK A;  1EP7 A;  3GKX A;  4AJ7 A;  4ULX A;  1ERT A;  4DSR A;  2RM6 A;  4XS4 B;  4G2E A;  2X64 A;  3IPZ A;  2H1L A;  2YZH A;  2OE1 A;  1NM3 A;  1RK4 A;  4K0N A;  2K8V A;  3HJM A;  1QXH A;  2LST A;  2GZP A;  2H72 A;  4POM A;  2H6Z A;  2EFD A;  3IBH A;  2K8S A;  2ZCT A;  1WRY A;  2B5X A;  5J41 A;  1THX A;  3KCM A;  2JAD A;  1Z6M A;  1BAY A;  2XBI A;  3DXB A;  3H8Q A;  4G0L A;  2YP6 A;  4MZB A;  5IMF A;  4TW5 A;  1NHO A;  2LRN A;  1Q98 A;  2I9H A;  4A5P A;  5CO3 A;  1SK2 A;  1M9B A;  2PU9 C;  1MDJ A;  1ERV A;  3FEU A;  1U87 A;  5G31 A;  1K0N A;  4AJ6 A;  3F8U A;  4Q5F A;  1PA3 A;  1PX6 A;  1F9M A;  2LRC A;  5LCZ A;  4TXO B;  1TKD B;  1EGR A;  4N0Z A;  2H66 A;  2DKH A;  2GT5 A;  4AKG A;  2ALB A;  4NMU A;  3CMI A;  3P2A A;  1O7U A;  4TR4 A;  3JCM L;  4ECB A;  4KND A;  1OC3 A;  1PMT A;  4EIP A;  1M2B A;  2HSM B;  2GZY A;  5E59 A;  1ML6 A;  2L6D A;  2X8C A;  1QMV A;  4TN8 A;  4WKW A;  3GUS A;  1NSW A;  3NIV A;  2HT9 A;  3GSS A;  3KMO A;  3TJB A;  5LD0 A;  4KDU A;  3TJK A;  1OAZ A;  5BRT A;  4F0B A;  5EPF A;  2IL3 A;  14GS A;  2FA4 A;  5B8A A;  3EVI A;  5HR3 A;  3CSI A;  4KAE A;  2WS2 A;  3HY2 A;  2VL3 A;  2VCW A;  2C0E A;  3KM6 A;  3ERW A;  4WET A;  3EMX A;  2GT6 A;  1KNG A;  2CA8 A;  1PN0 A;  4KGI A;  1OC9 A;  5DCH A;  3GST A;  1A2M A;  1TOF A;  3NZN A;  5H5Q A;  2VLV A;  1K0M A;  3HXS A;  4GSS A;  3EUR A;  1AC1 A;  1K0D A;  1DE1 A;  4EDY A;  1IYI A;  3I69 A;  3D6I A;  1MTC A;  3IXR A;  3DVX A;  1XWC A;  4HU7 A;  4QQ7 A;  2ON5 A;  4HU9 A;  2O3E A;  1R4W A;  3UVH A;  3HZ8 A;  1EZK A;  4IW9 A;  3I9V 2;  3HHV A;  3P8W A;  3KGK A;  2QKE A;  2K9F A;  2WGR A;  1PSQ A;  1ACV A;  2HRF A;  2CZ3 A;  3H79 A;  2HE3 A;  1AXD A;  2WCI A;  4TR1 A;  3GYK A;  3IC4 A;  1K0A A;  5KN2 A;  1TRS A;  17GS A;  2FLS A;  1FHE A;  3SBC A;  1GSY A;  2MMZ A;  2OT3 A;  3F9U A;  3ZVJ A;  2LJA A;  3GKN A;  2O36 A;  1ZOF A;  1Z3E A;  2R6K A;  3IR4 A;  2C0G A;  1TK0 B;  1I5G A;  4OCE A;  2FWF A;  4ZB9 A;  3GH9 A;  4OCF A;  1PD2 1;  2C0F A;  2WRT A;  1EOG A;  1HQO A;  1BED A;  1OC8 A;  4ECC A;  2IPA A;  5INY A;  5ECI B;  3RAZ A;  4F2I A;  1SJ6 A;  3LWA A;  2IME A;  5GST A;  3Q18 A;  4WF5 A;  2CVK A;  4EO3 A;  3LYK A;  2DJJ A;  4HJ2 A;  4CHS A;  5IMC A;  2LNT A;  5KN3 A;  1GLQ A;  1T00 A;  4NPB A;  3KZQ A;  3ZRD A;  4FIW A;  1A0R P;  1FVK A;  4MH3 A;  4KCA A;  3U6V A;  3FZ4 A;  1SJI A;  5F8B A;  2HQT A;  5D9W A;  3HVV A;  1BG5 A;  1T4Z A;  2FNO A;  2RUF A;  5G5F A;  1M2A A;  1R5A A;  1QK8 A;  2LTK A;  5ID2 B;  3ZLP A;  4MF6 A;  4TVE A;  2H74 A;  1GP1 A;  4USS A;  2WFC A;  1ON4 A;  1PQN A;  2F3M A;  4ZB6 A;  2D2Z A;  1GNW A;  1GRX A;  3ZIJ A;  1S4B P;  5ECP B;  6GSU A;  3F63 A;  1X5C A;  1EEM A;  5COH A;  1X9W B;  3VWX A;  5C04 A;  5ENU A;  1K0C A;  3DRN A;  4NXI A;  2P5R A;  1BQ7 A;  2EFH A;  3L0H A;  5IIZ A;  2NDO A;  4MCU A;  2JZT A;  5A4W A;  3C8E A;  4HI7 A;  1A8L A;  5IMZ A;  3BOA A;  2L57 A;  1B8X A;  3KP8 A;  1RW1 A;  2H19 A;  6GSS A;  4AF2 A;  2VL2 A;  3TGZ A;  1G6W A;  2KUC A;  4BVX A;  3KH9 A;  5J9C A;  1J0F A;  3ERG A;  1EV9 A;  4AKH A;  2IFQ A;  3GKK A; 
#chains in the Genus database with same CATH homology
 3EYT A;  2YV7 A;  2P0G A;  2HSN A;  1XOB A;  4KA0 A;  4BWQ A;  2HYX A;  4BL7 B;  2FY6 A;  2DC5 A;  2R0G A;  3LXT A;  4X4J A;  4TKY A;  5IMD A;  2B6M A;  4RI7 A;  2DJ0 A;  2V41 A;  3Q6O A;  4MF5 A;  3QR6 A;  4FYC A;  4HOJ A;  2IIY A;  2WJU A;  3VFI A;  4J2F A;  1GTI A;  1ZCP A;  4ZL8 A;  4WXT A;  5CNW A;  5ECR B;  1C72 A;  1JZR A;  5J4U A;  1BX9 A;  1RQM A;  3UIW A;  2E0Q A;  1ZYE A;  5A5K A;  2HRK B;  4LL4 B;  5B7C A;  2GVP A;  4WBJ A;  1JZO A;  1GTA A;  3QFA C;  4IKH A;  3TKS E;  4MK3 A;  4NHZ A;  5J9B A;  2MBT A;  1S3D A;  3FRC A;  4LMV A;  1QFN A;  1ZL9 A;  2BMX A;  3HVX A;  4EDZ A;  3RBT A;  2YWI A;  2OE3 A;  3EC3 A;  2O87 A;  3I43 A;  4PGT A;  1DUG A;  3QD9 A;  3F6D A;  4G0I A;  1DBY A;  2V2G A;  4MNN A;  2F8A A;  4F82 A;  4GST A;  1XW9 A;  4PUR A;  2HI7 A;  1YVL A;  3A2V A;  4YKF A;  4ZB7 A;  4D73 A;  2E7P A;  4NWY A;  1SD8 A;  3M3M A;  1UA5 A;  3FZA A;  4E68 A;  2A4V A;  2GGT A;  4HDE A;  2IMD A;  5JCG A;  2H75 A;  3EMP A;  1X5D A;  5F05 A;  4LMW A;  2YPM A;  1GTB A;  3PPU A;  1Z9H A;  5DDL A;  2DJ2 A;  4N30 A;  1OVN A;  4K6X A;  1V2A A;  4JE1 A;  3ZYW A;  3VPQ A;  1ERU A;  3DWV A;  5A5H A;  5CRW A;  3TRP A;  2GS3 A;  4JBB A;  1FW1 A;  2PER A;  2EIO A;  3APQ A;  5A4V A;  4KSM A;  4O7H A;  3O6T A;  3UBL A;  1O81 A;  4G9H A;  3GIX A;  1H4O A;  1AQV A;  1VRS D;  2RII A;  3BJ5 A;  4ZBB A;  3CTF A;  1XWG A;  5A1N B;  4V2M A;  3ZL5 A;  2VUP A;  3R2Q A;  5D9V A;  2H1D A;  2WDU A;  3GFK A;  4PQH A;  5J40 A;  2KLX A;  4DEJ A;  5HR0 A;  3QPM A;  4PNG A;  3D21 A;  5C00 A;  4CY8 A;  4MH2 A;  5IM9 A;  1EEJ A;  1VF2 A;  1S3A A;  2O85 A;  4I8B A;  2EC4 A;  3WT1 A;  3IHQ A;  2B7J A;  1WPI A;  3L9S A;  5JWO B;  4KSO A;  1Y6E A;  4MAB A;  5BMU B;  3TUE A;  1YY7 A;  3WGE A;  4L0U A;  1USB A;  3C1R A;  2H1B A;  2BJX A;  3W6G A;  2RLI A;  3E3E A;  4KE3 A;  2YWN A;  4GCI A;  3D22 A;  1MDI A;  4KF9 A;  2E2G A;  2F8F A;  4HUA A;  4I5Q A;  3A2X A;  3FYG A;  3GL3 A;  1TU8 A;  2GDR A;  4FQU A;  1HYU A;  1AUC A;  2B5E A;  1N2A A;  2LV3 A;  3UJ1 A;  3GUR A;  5DQS A;  1AQX A;  3CYN A;  2DJ1 A;  4XIH A;  1BF5 A;  1WWJ A;  3VI7 A;  4PQ1 A;  1GUM A;  5DAL A;  2HFD A;  5IO0 A;  4JED A;  2FUG 2;  3A2W A;  3D4T A;  1O73 A;  2VKZ G;  4AKX B;  2EIR A;  3EU4 A;  1YEP A;  3L4N A;  2R0P A;  3VWW A;  2I3Y A;  3CXG A;  3G7Y A;  3VUR A;  2JAC A;  2I81 A;  2VIM A;  4K8M A;  2YNX A;  5G2Z A;  1EV4 A;  1GSE A;  3QDN A;  3CRU A;  4AGS A;  5CRE A;  2XPE A;  2NBS A;  1T7P B;  2CZ2 A;  2K6V A;  2GST A;  2N5F A;  18GS A;  3ZIT A;  1PL1 A;  3C73 A;  1XW5 A;  4XS4 A;  2C0D A;  2A2R A;  1SD9 A;  4YQU A;  2WB9 A;  2MMO A;  3TKP A;  1CQG A;  4WF4 A;  1J08 A;  4POB A;  2KP2 A;  1A23 A;  2C3N A;  2X49 A;  1HNA A;  2VCX A;  4ML6 A;  4GRF A;  1GSS A;  2VL9 A;  1X0R A;  2LRT A;  2VL2 C;  2G0F A;  19GS A;  2CX3 A;  3KIJ A;  3ZRE A;  2DJ3 A;  2M72 A;  1O8W A;  1Z7R A;  1GLP A;  1M0U A;  1VF4 A;  3IK7 A;  4EIQ A;  4IEL A;  3W8J A;  2YJH A;  2X4A A;  3MSZ A;  4TRX A;  5KN0 A;  13GS A;  3ED3 A;  3UAR A;  4ZXG A;  2H71 A;  2MMN A;  1PX7 A;  1LU4 A;  4PUF C;  1M2D A;  2G2Q A;  1ZZY A;  2VO4 A;  4OFM A;  3MWH A;  3RDW A;  5CYY A;  4TXO A;  3OR5 A;  3BCI A;  4POL A;  1SKR B;  4IGJ A;  1FG4 A;  5JWR B;  3UL3 A;  4KDX A;  3KTL A;  1B4Q A;  1SKW B;  2AB6 A;  2H01 A;  2H30 A;  2HSY A;  1GUH A;  2GSS A;  3M8N A;  2GZZ A;  4N3Z A;  3QAG A;  4FO5 A;  5IPH A;  4TOP A;  5FHI A;  1PN9 A;  5D8I A;  2HSM A;  4PXO A;  4GSN A;  5FWG A;  4ID0 A;  4L8E A;  5KOW A;  2H0G A;  2AYT A;  4JU5 A;  4ECI A;  5ECK B;  5JCU A;  3EU3 A;  5HR1 A;  2IN3 A;  2TRC P;  1B9Y C;  1ZYQ B;  1SL0 B;  3FW2 A;  1KBN A;  3HDC A;  2K18 A;  2ZUP A;  2PGT A;  2HSH A;  6GST A;  2J9H A;  3MYD A;  9GSS A;  1TU7 A;  5DAK B;  1PRX A;  2HLS A;  4I2U A;  4Z2R A;  2H6X A;  3RHB A;  2IWT A;  2LKU A;  3LGC A;  1SJZ A;  2VLU A;  2UV8 G;  1A8Y A;  1XWK A;  1Q4J A;  3HJP A;  2N5A A;  4TR0 A;  4IQA A;  3QAW A;  4QL7 A;  3U5R E;  5EL8 A;  1ERW A;  3DVW A;  3TDG A;  1NHY A;  4KX4 A;  2ES7 A;  1FB0 A;  1V9W A;  1GSU A;  2E2M A;  3ZML A;  3VWU A;  1SL2 B;  1OKD A;  3DD3 A;  3WT2 A;  3IA1 A;  1SYR A;  5CAX A;  1XVQ A;  8GSS A;  2JSZ A;  1GSQ A;  2R37 A;  3LFL A;  1ZYN A;  5ECL B;  3LXZ A;  4QMK A;  2JU5 A;  1TXU A;  2FWH A;  1FAA A;  5AIV A;  1XWA A;  4K2X A;  1A24 A;  3IC8 A;  2R4V A;  4BVY B;  1VF3 A;  3ERF A;  3IAM 2;  4DSS B;  2H1A A;  1E2Y A;  1GL8 A;  1THO A;  1MD3 A;  4BVX B;  5A4U A;  5ELG A;  1JZW A;  2CAQ A;  1FO5 A;  2OBK A;  2JSY A;  1XVW A;  2DMM A;  1G7O A;  1PKW A;  3EWL A;  5D96 A;  4EUY A;  1W4V A;  1M99 A;  3IE3 A;  3QOU A;  3DEX A;  3A5I A;  2C1Y A;  2B3S A;  5L71 A;  2XC2 A;  4GWR A;  4IN0 A;  3MDK A;  2WUL A;  4EXJ A;  3KEB A;  3FMW A;  4MLY A;  1EGO A;  2ON7 A;  2VD1 A;  12GS A;  1MEK A;  1SKS B;  3C71 A;  3RHC A;  3TOT A;  4V1A p;  4CW9 A;  4YH2 A;  5LNK e;  2UZ8 A;  3SWL A;  4OD7 A;  4K7I A;  4ZIJ A;  3HCZ A;  4YQV A;  1KEB A;  2F51 A;  2ZNM A;  2JZR A;  4F0C A;  4X43 A;  5KN1 A;  4XS1 A;  5ID2 A;  1G0T A;  5GSS A;  3P90 A;  3CBU A;  4G19 A;  2A4H A;  3ZTL A;  4MP4 A;  3WYW A;  1XOA A;  4G01 A;  2L4C A;  1ZMA A;  1GTU A;  4G10 A;  1X5E A;  4X1U A;  1Y25 A;  5IQY A;  4EC0 A;  1XW6 A;  2AUV A;  3HYP A;  4RI6 A;  2NTO A;  2A2S A;  2KP1 A;  4ZL9 A;  5DVB A;  2QA2 A;  4AKI A;  4OFN A;  3G9B A;  1BJX A;  3MIX A;  3Q74 A;  2B5Y A;  1SVO A;  2FCH A;  2WZ9 A;  5DQY A;  1TK8 B;  4K1F A;  3F4T A;  3IDV A;  2C80 A;  5EY6 A;  1O6J A;  1TJD A;  2YZU A;  4NHW A;  2L59 A;  1GWC A;  1SK1 A;  2DKI A;  1N25 A;  4PNF A;  3M0F A;  5IOX A;  5CRG A;  1UN2 A;  3WGD A;  2BTO T;  4MPF A;  4WBR D;  2CQ9 A;  2YWM A;  4NV2 A;  3FR9 A;  1I9D A;  2H6Y A;  2HZE A;  4L5L A;  3PH9 A;  3GNJ A;  3TOU A;  1XFL A;  5GAN D;  5G1L A;  3ZZX A;  2OBI A;  2YJ7 A;  2P5Q A;  4GXZ A;  2H8L A;  3VLN A;  4RUV A;  4X0X A;  1QQ2 A;  3FZ9 A;  4AJ8 A;  1XBS A;  4Q5R A;  2HRA A;  1F3B A;  2X8G A;  3TJJ A;  1SL1 B;  2HRK A;  4MDC A;  5HFI A;  3J7Y b;  3LW9 A;  2QA1 A;  4ML1 A;  1WE0 A;  5D73 A;  1GSF A;  1OE7 A;  3HJO A;  3VPT A;  2OAC A;  3CSH A;  3HMJ G;  2PMT A;  5D93 A;  4ECJ A;  1VF1 A;  2YV9 A;  1XZO A;  1GUK A;  2FHE A;  4ISD A;  3M9K A;  1R26 A;  4MJC A;  4JR6 A;  2L6C A;  3LOR A;  4IVF A;  6GSX A;  3D0Z A;  4O5U A;  3IV4 A;  5F0G A;  3GTU A;  2R3X A;  4TXV A;  3CTG A;  1PGT A;  2PVO C;  4NV5 A;  2OAD A;  4N11 A;  1WOU A;  4K0G A;  3FKF A;  2R5G A;  3UEM A;  5DBQ A;  3KD0 A;  2PN8 A;  4QL9 A;  2HRN A;  5F06 A;  1XWB A;  1CQH A;  4IQ1 A;  6GSW A;  2O8V B;  2RUE A;  4YKG A;  1TTZ A;  3N5O A;  3TCO A;  3EE2 A;  3ZIV A;  1TP9 A;  3APO A;  3UVT A;  2VLT A;  4JR4 A;  3MNG A;  4XRA A;  3APS A;  4NAX A;  2AV4 A;  3BD2 A;  2Z9S A;  1O85 A;  3GRX A;  3LJR A;  2L5O A;  1YKA A;  1YQ1 A;  5AGY A;  16GS A;  4FYU A;  3US3 A;  3GX8 A;  4KCE A;  3M9J A;  2EFE A;  1N8J A;  3D4M A;  2MBS A;  2DLX A;  3LG6 A;  3QCP A;  4OWY A;  1HNC A;  3E9J B;  3ME8 A;  2H1G A;  4P3Y B;  1XIY A;  1Z6N A;  3C7M A;  2HXK A;  3F6F A;  5A1N A;  1PKZ A;  4BPY A;  4PQI A;  2AJQ B;  1YDK A;  3G7J A;  5ECH B;  5H5S A;  2LJK A;  3TU3 B;  2V6O A;  3W8S A;  1G7E A;  4W66 A;  3WD6 A;  1SVL A;  4K7N A;  1PL2 A;  2CVD A;  4K5S A;  3EIN A;  1TI3 A;  4EL1 A;  3EPT A;  4K2D A;  4MZC A;  5GAP D;  3KP9 A;  3S9F A;  4MMM A;  2DIZ A;  4MF7 A;  4IS0 A;  4ZBA A;  2CT6 A;  4ZL7 A;  1WMJ A;  3V1W A;  2I1U A;  5BMU A;  5A34 A;  3L78 A;  4MZW A;  4OO5 A;  4RQX A;  1F3A A;  1R5P A;  2QC7 A;  3DIE A;  1T3B A;  1GSD A;  1YJ6 A;  2C8U A;  2EFC A;  3F0I A;  3BCK A;  2EIQ A;  3HA9 A;  4XTS A;  3FR3 A;  2VM1 A;  2YCD A;  1OC9 B;  1W89 A;  2QGV A;  4GQC A;  1ABA A;  2V1M A;  4F9Z A;  5IO2 A;  3FHK A;  4IP6 A;  4V2L A;  2M80 A;  4V1A g;  4DSQ A;  2KOK A;  2B7K A;  2MMA A;  3IHG A;  4KB3 A;  1V98 A;  4IJ3 A;  4PX1 A;  1TRW A;  3TRX A;  3O76 A;  5ECQ B;  5ELA A;  1TK5 B;  3FK8 A;  3UOM A;  1YEX A;  2MYG A;  2LEG A;  4EF0 A;  2NVL A;  1EWX A;  3TJF A;  1H75 A;  3DKS A;  4GTU A;  2FD3 A;  1ST9 A;  1DE2 A;  3J7Y k;  1Y1U A;  2XBQ A;  3TKQ A;  4L5O A;  4EE0 A;  1OE8 A;  3RPN A;  2VCT A;  5J3R A;  4TR1 B;  1X9M B;  3KXO A;  5HR2 A;  1WJK A;  4YQM A;  2TRX A;  5B6N A;  2PVQ A;  5F07 A;  4ICY A;  3CWG A;  1O8X A;  3F3Q A;  1R7H A;  2DBC A;  1JFU A;  4EVM A;  2V6K A;  5JCW A;  3Q19 A;  4K5R A;  1Z5Y E;  3LEF A;  4HJM A;  1BG1 A;  4Z2U A;  1JLV A;  2FGX A;  3HKR A;  4O5Q A;  3HVS A;  1ZYP A;  3LQ7 A;  4OMV A;  2LQO A;  1WIK A;  2CVB A;  3IAS 2;  1HD2 A;  4RQR A;  4HQZ A;  5IMA A;  3GV1 A;  1EP8 A;  4MJA A;  3ZMK A;  4L0W A;  1TRU A;  1OYJ A;  2FWE A;  2JZS A;  4O92 A;  5AIS A;  3IOS A;  3GA4 A;  1BYE A;  1QGV A;  2NPB A;  2C3T A;  3K8N A;  3VWV A;  3QFB C;  4K7O A;  4ZB8 A;  5ECO B;  4MA9 A;  2VAF A;  2JL4 A;  1TDI A;  1TRV A;  2H76 A;  3ZFL A;  2GSQ A;  1ILO A;  2HNL A;  2C4J A;  4PTS A;  3GKM A;  2PBJ A;  1LJR A;  5FT3 A;  3F4R A;  3N9J A;  2QSI A;  1K0B A;  3KJY A;  2CV4 A;  1F6M C;  4I2T A;  5ABR A;  2GQM A;  3NOF A;  4WR4 A;  3ISO A;  2B1L A;  2O5V A;  4XRD A;  5D9X A;  3TKS C;  3HD5 A;  2O7K A;  1B9X C;  2MZC A;  2YN1 A;  3FZ5 A;  4K9Z A;  5DAK A;  4V2N A;  3GH6 A;  1B48 A;  1K0O A;  1MDK A;  2FWG A;  2TIR A;  1V40 A;  1EOH A;  1M9A A;  2LJR A;  1G6Y A;  1URM A;  2X8H A;  2IFQ B;  3GHA A;  1LBK A;  3GX0 A;  4TR3 A;  2CX4 A;  2HSN B;  2L4Q A;  3AY8 A;  5AN1 A;  2XPD A;  1AQW A;  2L5L A;  2A2P A;  1OKT A;  1MD4 A;  5GZZ B;  2AHE A;  4BWS A;  4HZ4 A;  2R0C A;  5B8B A;  3GMF A;  5J5N A;  2VM2 A;  3A3T A;  5CRH A;  4I97 A;  3GN3 A;  3TRQ A;  5CP1 A;  1SEN A;  2F9S A;  1YF1 A;  3O3T A;  3TB2 A;  5G30 A;  1U88 A;  3C1S A;  2GLR A;  5IOW A;  1FB6 A;  5JWQ B;  2GTU A;  2YWO A;  5G5E A;  1GH2 A;  5IMV A;  4N0V A;  2H73 A;  2PUK C;  2J23 A;  2O89 A;  2RM5 A;  1J9B A;  3F4S A;  4KW6 A;  4FH8 A;  4H86 A;  4EKZ A;  4BVY A;  3BBY A;  1TW9 A;  2OJL A;  1AAZ A;  5G1K A;  4DSS A;  3DML A;  1A0F A;  4N10 A;  4O32 A;  5IPG A;  1ZGN A;  1Z7P A;  1XPV A;  4HQS A;  1U3A A;  5HQP A;  6GSY A;  4KUN A;  4ZBD A;  3RPP A;  1V58 A;  1M7T A;  2HZE B;  1GNE A;  11GS A;  1TI1 A;  2OKA A;  3E0U A;  7GSS A;  2REM A;  4Z2T A;  4BA7 A;  4WR5 A;  3H93 A;  3WGX A;  3KH7 A;  4OFT A;  2LQQ A;  3HZ4 A;  3PIN A;  2N5B A;  2FA8 A;  4HS1 A;  2DJK A;  3TJG A;  2HZF A;  1A2L A;  4I6X A;  1IYH A;  2X99 A;  4D73 B;  4GQF A;  3DGQ A;  1JLW A;  4Q5Q A;  2GQL A;  2M46 A;  2XHF A;  4DVC A;  2V32 A;  1XXU A;  4IHU A;  2OE0 A;  3P7X A;  4O5R A;  5DCG A;  3G7I A;  1AIU A;  2LS5 A;  1K3Y A;  3LYP A;  3QAV A;  5B6M A;  1T4Y A;  2CAI A;  4E8H A;  3KMN A;  1GUL A;  5J4V A;  3LSZ A;  5E4W A;  5ECM B;  4ILF A;  2AAW A;  5A5H B;  4BL7 A;  1WP0 A;  3D5J A;  1VGL A;  2LUS A;  4F03 A;  2H70 A;  1UVZ A;  3TKR A;  4ZIL A;  1B4P A;  4YAV A;  1QUW A;  4LA1 A;  3FR6 A;  3IK9 A;  10GS A;  1K3L A;  3GTU B;  3QMX A;  2VCV A;  3F3R A;  1A2J A;  4IBP A;  5J47 A;  2VD0 A;  3KTB A;  4AI6 A;  3PGT A;  2YOI A;  4IJI A;  5H5R A;  2IMK A;  6GSV A;  1U3I A;  3I6A A;  3GL5 A;  1AW9 A;  1YZX A;  3DYR A;  5D9T A;  5HFG A;  2KHP A;  4GLT A;  1YF0 A;  1S3C A;  3UAP A;  1DSB A;  1FOV A;  5DJM A;  1T8E B;  1SVM A;  1SU9 A;  4YAP A;  5ECN B;  22GS A;  1U6T A;  3H4K A;  1UC7 A;  4PUA A;  4LLR A;  1YKC A;  2DSA A;  4FYB A;  20GS A;  1FVJ A;  3L9V A;  3TKS A;  1TXX A;  5DJL A;  3ZFB A;  4Q5N A;  5ECS A;  4ACS A;  3ZVJ D;  1T1V A;  4JRR A;  2PWJ A;  3M1G A;  1FOH A;  1JZD A;  5CRD A;  4G0K A;  4POK A;  4J57 E;  2GSR A;  2IJY A;  3CRT A;  3L9U A;  4XHM A;  2P31 A;  4MJB A;  4CDO A;  1KTE A;  5EVO A;  1SYX A;  5KEJ A;  4CY6 A;  2R2J A;  4MJE A;  3R3E A;  3H1N A;  4MPG A;  2IMF A;  4HEA 2;  1XCC A;  5HFK A;  4WEY A;  2VCQ A;  2IMI A;  3MAK A;  4LL1 B;  1SK0 A;  1HNB A;  2B1K A;  1V57 A;  1F2E A;  3FY7 A;  2VCZ A;  1X9S B;  2PPT A;  2GQK A;  3UMA A;  2DML A;  4KDY A;  2H0H A;  4KH7 A;  5KOX A;  3PR8 A;  5DAL B;  2C3Q A;  1JHB A;  4OO4 A;  1E6B A;  5J4Y A;  1F37 A;  4XS6 A;  3VI5 A;  4JZQ A;  5AIX A;  2LNS A;  3IRA A;  4J56 E;  2YAN A;  3A5W A;  3ME7 A;  2VOC A;  2I4A A;  1NW2 A;  4XCS A;  4E8E A;  4GDF A;  1K3O A;  2OA7 A;  3VK9 A;  4HZ2 A;  2H0I A;  4Z7X A;  2DIY A;  3CSJ A;  4GF0 A;  4IP1 A;  5A34 B;  3UBK A;  1EP7 A;  3GKX A;  4AJ7 A;  4ULX A;  1ERT A;  4DSR A;  2RM6 A;  4XS4 B;  4G2E A;  2X64 A;  3IPZ A;  2H1L A;  2YZH A;  2OE1 A;  1NM3 A;  1RK4 A;  4K0N A;  2K8V A;  3HJM A;  1QXH A;  2LST A;  2GZP A;  2H72 A;  4POM A;  2H6Z A;  2EFD A;  3IBH A;  2K8S A;  2ZCT A;  1WRY A;  2B5X A;  5J41 A;  1THX A;  3KCM A;  2JAD A;  1Z6M A;  1BAY A;  2XBI A;  3DXB A;  3H8Q A;  4G0L A;  2YP6 A;  4MZB A;  5IMF A;  4TW5 A;  1NHO A;  2LRN A;  1Q98 A;  2I9H A;  4A5P A;  5CO3 A;  1SK2 A;  1M9B A;  2PU9 C;  1MDJ A;  1ERV A;  3FEU A;  1U87 A;  5G31 A;  1K0N A;  4AJ6 A;  3F8U A;  4Q5F A;  1PA3 A;  1PX6 A;  1F9M A;  2LRC A;  5LCZ A;  4TXO B;  1TKD B;  1EGR A;  4N0Z A;  2H66 A;  2DKH A;  2GT5 A;  4AKG A;  2ALB A;  4NMU A;  3CMI A;  3P2A A;  1O7U A;  4TR4 A;  3JCM L;  4ECB A;  4KND A;  1OC3 A;  1PMT A;  4EIP A;  1M2B A;  2HSM B;  2GZY A;  5E59 A;  1ML6 A;  2L6D A;  2X8C A;  1QMV A;  4TN8 A;  4WKW A;  3GUS A;  1NSW A;  3NIV A;  2HT9 A;  3GSS A;  3KMO A;  3TJB A;  5LD0 A;  4KDU A;  3TJK A;  1OAZ A;  5BRT A;  4F0B A;  5EPF A;  2IL3 A;  14GS A;  2FA4 A;  5B8A A;  3EVI A;  5HR3 A;  3CSI A;  4KAE A;  2WS2 A;  3HY2 A;  2VL3 A;  2VCW A;  2C0E A;  3KM6 A;  3ERW A;  4WET A;  3EMX A;  2GT6 A;  1KNG A;  2CA8 A;  1PN0 A;  4KGI A;  1OC9 A;  5DCH A;  3GST A;  1A2M A;  1TOF A;  3NZN A;  5H5Q A;  2VLV A;  1K0M A;  3HXS A;  4GSS A;  3EUR A;  1AC1 A;  1K0D A;  1DE1 A;  4EDY A;  1IYI A;  3I69 A;  3D6I A;  1MTC A;  3IXR A;  3DVX A;  1XWC A;  4HU7 A;  4QQ7 A;  2ON5 A;  4HU9 A;  1R4W A;  3UVH A;  3HZ8 A;  1EZK A;  4IW9 A;  3I9V 2;  3HHV A;  3P8W A;  3KGK A;  2QKE A;  2K9F A;  2WGR A;  1PSQ A;  1ACV A;  2HRF A;  2CZ3 A;  3H79 A;  2HE3 A;  1AXD A;  2WCI A;  4TR1 A;  3GYK A;  3IC4 A;  1K0A A;  5KN2 A;  1TRS A;  17GS A;  2FLS A;  1FHE A;  3SBC A;  1GSY A;  2MMZ A;  2OT3 A;  3F9U A;  3ZVJ A;  2LJA A;  3GKN A;  1ZOF A;  1Z3E A;  2R6K A;  3IR4 A;  2C0G A;  1TK0 B;  1I5G A;  4OCE A;  2FWF A;  4ZB9 A;  3GH9 A;  4OCF A;  1PD2 1;  2C0F A;  2WRT A;  1EOG A;  1HQO A;  1BED A;  1OC8 A;  4ECC A;  2IPA A;  5INY A;  5ECI B;  3RAZ A;  4F2I A;  1SJ6 A;  3LWA A;  2IME A;  5GST A;  3Q18 A;  4WF5 A;  2CVK A;  4EO3 A;  3LYK A;  2DJJ A;  4HJ2 A;  4CHS A;  5IMC A;  2LNT A;  5KN3 A;  1GLQ A;  1T00 A;  4NPB A;  3KZQ A;  3ZRD A;  4FIW A;  1A0R P;  1FVK A;  4MH3 A;  4KCA A;  3U6V A;  3FZ4 A;  1SJI A;  5F8B A;  2HQT A;  5D9W A;  3HVV A;  1BG5 A;  1T4Z A;  2FNO A;  2RUF A;  5G5F A;  1M2A A;  1R5A A;  1QK8 A;  2LTK A;  5ID2 B;  3ZLP A;  4MF6 A;  4TVE A;  2H74 A;  1GP1 A;  4USS A;  2WFC A;  1ON4 A;  1PQN A;  2F3M A;  4ZB6 A;  2D2Z A;  1GNW A;  1GRX A;  3ZIJ A;  5ECP B;  6GSU A;  3F63 A;  1X5C A;  1EEM A;  5COH A;  1X9W B;  3VWX A;  5C04 A;  5ENU A;  1K0C A;  3DRN A;  4NXI A;  2P5R A;  1BQ7 A;  2EFH A;  3L0H A;  5IIZ A;  2NDO A;  4MCU A;  2JZT A;  5A4W A;  3C8E A;  4HI7 A;  1A8L A;  5IMZ A;  3BOA A;  2L57 A;  1B8X A;  3KP8 A;  1RW1 A;  2H19 A;  6GSS A;  4AF2 A;  2VL2 A;  3TGZ A;  1G6W A;  2KUC A;  4BVX A;  3KH9 A;  5J9C A;  1J0F A;  3ERG A;  1EV9 A;  4AKH A;  2IFQ A;  3GKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...