5KEJA

Crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
222
structure length
222
Chain Sequence
AKSDVKLLGAWPSPYVMRARITLNVKSVDYELLEETLGSKSDLLLKSNPVHKKIPVLIHNDKPICESLIIVHYIDEFWSSGPSILPSDPYDRAIARFWAAYLDEKWYPSLKGIASAQGEEAKKAAVDQVGESLALIEDTYVKLSKGKPFFGGEKIGYLDIAFGCFLGWLRVTEKTSGVKFLNEAKTPHLAKWAVRFCADPAVKDVMPETEKLAEFAKLLAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tau class glutathione S-transferase
publication title Insights into ligand binding to a glutathione S-transferase from mango: Structure, thermodynamics and kinetics.
pubmed doi rcsb
source organism Mangifera indica
total genus 75
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5kejA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kejA01
5DCHA 1M2AA 4RQXA 4TXOB 2CT6A 3VI5A 4FYBA 3EINA 1A0RP 1GUKA 2WJUA 2GZPA 2E7PA 3F9UA 2VM1A 3J7Yk 2YANA 4MK3A 4I6XA 3VWWA 1TKDB 5G1LA 1GSEA 4WETA 4CHSA 3LGCA 4TW5A 4DSQA 2H73A 5GSSA 2E2GA 2PPTA 2KOKA 3IR4A 2B7JA 4XRDA 5D8IA 5JCUA 3KP8A 4GRFA 3GL3A 3R2QA 3GYKA 1UN2A 4KDYA 3KH7A 5IPGA 4WXTA 1TRSA 2IWTA 3EU4A 2IMDA 3PH9A 2PN8A 4K7OA 4HJMA 3D4TA 3GX8A 3MNGA 2H71A 4O7HA 5J9CA 2YP6A 4Q5RA 6GSSA 2EC4A 12GSA 5G5EA 1XFLA 5D96A 5LD0A 2EIRA 1K0BA 2YJHA 1X5EA 4KE3A 4JRRA 5J5NA 4ZXGA 1XW5A 3PPUA 1M99A 3C1RA 1Z7PA 1X9WB 2JZSA 3KTBA 2I81A 1G6WA 2O8VB 5IMZA 2C8UA 2C0FA 3GHAA 5G30A 1X9SB 1R5AA 3C1SA 5HR1A 4PUAA 2HI7A 3W8SA 4KGIA 4ZBDA 2HE3A 5B6NA 1FB0A 2H0HA 5CRHA 3I6AA 3TDGA 2CX4A 2NPBA 1V9WA 2LS5A 5IOXA 4KSMA 3ISOA 1SL1B 2LQQA 1M2BA 4V1Ap 2B5XA 5IPHA 3KH9A 4F03A 5KN2A 4XRAA 1CQGA 3HYPA 4GXZA 4GSTA 2GLRA 1H4OA 2OKAA 2GQKA 3VLNA 2FUG2 1U87A 3UVTA 4TKYA 5KN1A 3RPNA 1K3OA 3FR6A 4E8EA 2H6ZA 4KW6A 4MH3A 1A2MA 5ECNB 1TK5B 3UBKA 4FQUA 2H1BA 1U88A 2PVQA 1A23A 2I3YA 3FZAA 3O6TA 1F37A 4MABA 1K0DA 3LSZA 2DBCA 4BL7A 2CZ2A 4PQHA 2KP1A 2VCTA 4HU9A 1K0NA 3QFAC 2IMIA 2LEGA 4ID0A 1XIYA 2C4JA 2CAQA 3HJOA 3DVXA 2FHEA 1Z6MA 2AYTA 4FYCA 2PGTA 3HXSA 2HSMB 2PUKC 3FRCA 1YDKA 1THXA 1EP8A 2A2RA 3LWAA 1R26A 3J7Yb 5ECMB 3M0FA 1AUCA 1O81A 1HNAA 2H19A 3BJ5A 3F3QA 1ILOA 4Q5FA 4GSNA 2VCWA 4ECCA 3CMIA 2L4QA 4N0ZA 4PURA 4LL1B 3VPTA 4DSSA 4LMWA 1ZZYA 2M46A 4OCFA 5E59A 4IKHA 1GTUA 2NVLA 2GZYA 1GUMA 3TJGA 2UZ8A 1TRWA 3BCKA 3I69A 1AIUA 1SJZA 3O76A 1EV9A 2J9HA 3HKRA 3HY2A 2FGXA 1PX6A 3QFBC 3IA1A 3EMPA 4G19A 1FVKA 4J56E 1K3LA 4O92A 1BG5A 3HDCA 5C04A 1WP0A 2N5AA 4KH7A 3TGZA 1SD9A 4ZL9A 3RAZA 3TRQA 1HD2A 2R2JA 1HNBA 2L57A 3QAWA 4KSOA 4NAXA 1EGOA 3LFLA 3E0UA 3GTUA 3GV1A 2YZUA 8GSSA 2ON5A 1AQXA 4MZCA 1GNWA 4MP4A 4L5LA 2NTOA 4HS1A 3L4NA 2IMFA 3BOAA 2JSYA 2IJYA 3TJFA 3C71A 3L9VA 1V98A 4EF0A 3WGXA 5F0GA 2F9SA 4L0WA 1GP1A 4I2UA 3APOA 1QK8A 1A2LA 4D73B 1GH2A 3LEFA 3US3A 1G7EA 4G0IA 1YF0A 2H6XA 3KGKA 2AHEA 3EMXA 2OADA 2C3QA 5EVOA 16GSA 5E4WA 2CVDA 4BVYA 2LRTA 2GSSA 1A0FA 2YZHA 1XPVA 4MLYA 3GKNA 2NDOA 2HRKA 5C00A 4DSRA 3EU3A 3WYWA 3KCMA 4GSSA 2GSTA 3A5WA 5HR3A 1THOA 4JR4A 1E6BA 3ZRDA 4I2TA 2DJ2A 3TRXA 3ERFA 2GZZA 3FY7A 4ML6A 1USBA 1WOUA 3SWLA 3ZVJD 1QXHA 5JWRB 1ZGNA 2AAWA 2B7KA 5IMAA 5ECQB 3KM6A 5DAKB 1T8EB 1URMA 2KHPA 1MTCA 2JSZA 4RUVA 3G9BA 3LYKA 2RIIA 4CDOA 3RPPA 6GSWA 2H74A 4G9HA 4O5RA 1GTIA 1OKTA 11GSA 2XC2A 3CXGA 1M9BA 4G10A 2E0QA 2PBJA 5ECPB 5ID2A 18GSA 4ZB8A 2HLSA 3QDNA 4FYUA 2C3TA 3KZQA 1GTAA 1BAYA 3PR8A 3CTGA 1TU7A 1FG4A 2GQLA 3FZ9A 1ZYQB 1JLVA 3QD9A 3DMLA 1GSQA 4TR1B 1QMVA 1K0MA 1NHYA 1GSUA 2N5BA 2VD1A 4RI6A 5F06A 3NIVA 1OC3A 1YY7A 4HQZA 3H4KA 3UJ1A 4L8EA 2WS2A 2VCVA 2V6KA 1MD4A 4EL1A 3DGQA 3ED3A 2YOIA 2LNTA 1XW9A 2B5YA 3VURA 1G6YA 1YF1A 2B3SA 4JU5A 2E2MA 1SKSB 4K7NA 2GT5A 3F8UA 4IN0A 3IHQA 3AY8A 4NPBA 1J0FA 4ECBA 2PMTA 2RUEA 4TXOA 3TKRA 5ECHB 4G0LA 4WR4A 3VPQA 1F9MA 4H86A 3U5RE 5BMUA 1DBYA 2B5EA 3PGTA 4J2FA 3D4MA 4EXJA 1MDKA 2HZFA 1K0CA 3C73A 2F51A 6GSUA 1M7TA 2IPAA 4EC0A 3FZ5A 4TRXA 2CV4A 3H93A 1W4VA 4OFNA 4PX1A 4IJIA 1XVQA 5JWOB 1TDIA 5KN0A 3WT1A 1PA3A 1V2AA 2F8AA 4XS6A 3RHBA 3ZREA 2DJ3A 2BJXA 3ZZXA 5DQYA 1SKRB 4ZL8A 1FO5A 5DVBA 3SBCA 1O8WA 20GSA 3A2VA 1EZKA 1SL0B 4YQUA 2QSIA 5F05A 2RM5A 1OC9A 1NW2A 1JLWA 1PN9A 1U6TA 2TRCP 1EWXA 1SL2B 4WR5A 4Q5QA 2DJ0A 2TRXA 4I97A 5DCGA 6GSXA 3TOTA 1DE2A 2V32A 2R37A 2A2SA 5ENUA 19GSA 1TRVA 2VCXA 3D22A 3L78A 2WGRA 3CRTA 3CSHA 4MZWA 3TKSC 10GSA 4MZBA 6GSVA 1S3DA 3LG6A 4IGJA 2H75A 4WF5A 5F8BA 5B7CA 4HEA2 3ME7A 1B48A 1QFNA 2GVPA 3P2AA 3VI7A 2WZ9A 5CP1A 3APSA 4IHUA 3FW2A 3UIWA 2EIOA 3W8JA 1A8LA 1U3IA 2I1UA 1IYHA 5GAPD 3FR9A 5D9XA 1ZMAA 4I8BA 1B4PA 1N2AA 3ZTLA 3CTFA 1XZOA 3HVXA 1CQHA 5HQPA 2A4VA 5D73A 1GNEA 4MJEA 1RW1A 4CW9A 5B8BA 2LSTA 4ZILA 5IMVA 1TW9A 5ECSA 3CBUA 3LXTA 2HSHA 5ECLB 1FVJA 2VLUA 2HRFA 4OO4A 4F0CA 1O85A 2X8GA 1EV4A 2HSMA 2PVOC 3GFKA 2OJLA 2CVKA 3UARA 2C1YA 2HZEA 5LNKe 5G1KA 1K0OA 3KTLA 4GQCA 1QGVA 3GUSA 1GULA 1LBKA 1PKZA 1GUHA 4F82A 2F3MA 2HRNA 2OE0A 2FY6A 4ZBAA 1SD8A 3BD2A 1Z7RA 2H6YA 2RUFA 2YWOA 5HFGA 4KDUA 3KMNA 4FIWA 3H1NA 3Q6OA 3N9JA 1S3CA 5CO3A 1DE1A 5GZZB 3L9SA 4X43A 4IQAA 1X0RA 3GSSA 2GQMA 5ECRB 2LKUA 2C0DA 4EVMA 1R5PA 1OKDA 2YCDA 1SK0A 3KMOA 5DBQA 3GMFA 2P5RA 2IIYA 3KJYA 2C0EA 3IDVA 2HNLA 3GKXA 4WEYA 4X1UA 4L5OA 1WPIA 3A3TA 3TKQA 3H79A 3WGEA 3GURA 1TI3A 1O73A 3TCOA 2WCIA 4TVEA 5IM9A 1FOVA 5JCGA 4MF6A 1VF4A 5B6MA 1KEBA 5IO2A 3F4TA 2VOCA 5HR2A 2I4AA 2MMOA 2O85A 2WRTA 4J57E 4JEDA 2Z9SA 3QR6A 3MWHA 4D73A 1GWCA 4ML1A 1ERTA 3GX0A 5CAXA 3R3EA 1SU9A 3Q19A 2KLXA 4NV5A 2H30A 3CRUA 4LLRA 1O7UA 5D9VA 3F63A 4KUNA 1NSWA 4HI7A 2OE1A 5G2ZA 4XCSA 3KIJA 2H76A 3IXRA 4N10A 2OE3A 1XOBA 2D2ZA 2TIRA 2EIQA 4MPFA 3F4SA 3GN3A 4N11A 4OFMA 3GL5A 1T7PB 2DSAA 1I9DA 2FWHA 2K8VA 1B9XC 3KD0A 1YKCA 1H75A 1M0UA 2FLSA 4ZB9A 3DYRA 2XHFA 3ZMLA 5JCWA 13GSA 2IFQB 1PSQA 5DAKA 3ME8A 5INYA 1HYUA 1Y25A 5A4VA 3ZFBA 4IW9A 1OVNA 3UVHA 1XWCA 3IAS2 4V1Ag 3IK7A 4GQFA 3IE3A 2CAIA 2BTOT 1HNCA 1TJDA 2DJKA 1AXDA 1GSSA 3I9V2 3GSTA 3VWVA 3FEUA 1S3AA 2JZRA 4OCEA 4Z7XA 1GL8A 1PGTA 3CSIA 3KEBA 3PINA 3FK8A 1SYXA 2K9FA 4NMUA 3QPMA 1BX9A 3P90A 4QL7A 2CZ3A 2VIMA 1A24A 4L0UA 4XS4B 1R7HA 2OACA 1XVWA 1F2EA 1DUGA 1HQOA 1O6JA 2LJAA 2VUPA 1F3BA 3DXBA 3F6DA 4O32A 4NHWA 3QAVA 3F6FA 4ZBBA 2M72A 3LJRA 4KAEA 2WDUA 1XOAA 2VL2C 5G5FA 2HT9A 2O87A 3D21A 2DJ1A 1Y6EA 2OBKA 1B4QA 2V41A 4MH2A 1X9MB 4BPYA 1EGRA 4KCAA 3ZVJA 2NBSA 3TKSA 1PQNA 2ZUPA 3F4RA 2DIZA 2K18A 1SK1A 2QKEA 1WRYA 3IC4A 3ZLPA 3GNJA 1OAZA 4AJ8A 4ACSA 5EY6A 2F8FA 3W6GA 3EVIA 4HDEA 4GTUA 4MCUA 2L6DA 3GIXA 5DJLA 1W89A 1T3BA 3TKPA 1EP7A 1G7OA 2KUCA 2YWNA 3C8EA 4HZ4A 3WD6A 2WULA 2C3NA 5DALB 1XBSA 3DIEA 5IO0A 2IL3A 2L59A 2CQ9A 2IMEA 1U3AA 4ZB6A 4IELA 5H5RA 5CRWA 4GF0A 2YN1A 2J23A 4GLTA 1TU8A 4N30A 4QQ7A 5AN1A 2ZCTA 2HRKB 2X8HA 1V40A 2RLIA 4MF5A 1OE8A 4PNGA 4HJ2A 2C0GA 3G7YA 2K8SA 1XWBA 3EURA 5L71A 2R5GA 3GKKA 2JU5A 4IP6A 2I9HA 1PKWA 1GSDA 1I5GA 3CSJA 1AW9A 4N0VA 4ILFA 1WE0A 1ZYEA 1PMTA 4BWQA 3GA4A 1SYRA 1FB6A 2O89A 3QAGA 2XPEA 2K6VA 4NHZA 2ES7A 3EYTA 1IYIA 3G7IA 3M3MA 5A4WA 4POLA 1PL1A 1YZXA 2DJJA 1QUWA 2HSNB 4TOPA 3FR3A 4BA7A 3VWXA 1TK8B 1J08A 3TJKA 3UAPA 2YV7A 4EUYA 3IBHA 4KDXA 4EKZA 5D9WA 4PQ1A 4LMVA 1PRXA 1TXXA 5JWQB 4ZL7A 3U6VA 3ERGA 1ABAA 4DVCA 3GRXA 4OMVA 1F6MC 4ECJA 1XWKA 1MDIA 2HQTA 3HVSA 1XCCA 3F3RA 5CRDA 3Q74A 1PD21 3HJMA 4K7IA 4RI7A 1ON4A 1DSBA 3LQ7A 4AGSA 1T00A 2HXKA 2QGVA 1MEKA 2L5OA 1RQMA 3E3EA 2H70A 2ON7A 3NZNA 2LRCA 2RM6A 2VL9A 2AB6A 4BVXB 1XXUA 1GLPA 2GDRA 4MA9A 2GSQA 4TXVA 4YAPA 1Z3EA 2FD3A 1NHOA 3V1WA 3LXZA 4KNDA 1XWAA 5FHIA 2B6MA 2C80A 1EEJA 1A8YA 4IQ1A 2FNOA 3APQA 1TTZA 4WBRD 1NM3A 1PX7A 3M9KA 4KX4A 5EPFA 5G31A 1Q98A 4AF2A 4IJ3A 3GH9A 1UA5A 1XW6A 1SENA 3FYGA 4ZIJA 4PTSA 4F2IA 4NV2A 2JACA 5J4UA 4K2DA 1VGLA 17GSA 2DLXA 2YPMA 1ZL9A 1B8XA 1OC8A 3L0HA 2FWGA 1FHEA 2OBIA 3TUEA 3HA9A 1X5DA 1K3YA 1OC9B 3HCZA 3HZ4A 5ECKB 2H1GA 3HJPA 1TP9A 4K8MA 3BBYA 3TRPA 2VLTA 2FWEA 4G2EA 2PERA 3HZ8A 1ZCPA 2LRNA 2JL4A 5AIXA 2VAFA 3QMXA 4OD7A 3MAKA 1AC1A 5EL8A 4KF9A 1TOFA 2G2QA 3UEMA 3DEXA 2FCHA 3CYNA 5ABRA 2FA4A 2P31A 2ZNMA 2LJKA 2FA8A 1FW1A 5AIVA 1VF2A 1VRSD 1Z9HA 5IQYA 4WBJA 4USSA 3ZL5A 4FH8A 4EO3A 2YV9A 4LL4B 2XBIA 1GSYA 6GSYA 2HFDA 4K6XA 1T4ZA 2P5QA 4MMMA 2PWJA 4ECIA 4HUAA 3TJBA 5CNWA 4OWYA 2MZCA 4ULXA 3JCML 4AJ7A 3FKFA 3UL3A 1SJ6A 5DDLA 4GCIA 4YAVA 2OA7A 4MF7A 2VL2A 2MBSA 2H0GA 4XIHA 1TI1A 1V57A 2R4VA 2M80A 3N5OA 4JE1A 1AQWA 5KN3A 1MD3A 3BCIA 3A2XA 5H5SA 4G0KA 3EE2A 3C7MA 2IFQA 1SKWB 1UVZA 5D9TA 3VWUA 3F0IA 4AJ6A 4MJBA 4PGTA 2MMNA 1Q4JA 1V58A 2LJRA 3QOUA 4DEJA 2P0GA 1AAZA 2KP2A 1WMJA 2VL3A 4NWYA 3ERWA 1YEXA 2HZEB 2X64A 6GSTA 3M8NA 2LQOA 3EC3A 5J41A 4KB3A 5IMFA 2LNSA 5DJMA 3DRNA 1WIKA 1YJ6A 1JZDA 3HD5A 1OYJA 2X99A 2FWFA 4JZQA 2VO4A 3D0ZA 3TJJA 4XS4A 4EE0A 2HYXA 1TK0B 1ERWA 3ZMKA 1Z5YE 4KA0A 1EOGA 3ZYWA 5IOWA 3QCPA 1LU4A 1PL2A 3IK9A 5J9BA 2LTKA 4IS0A 4K0NA 3HHVA 4EDYA 2L5LA 2O7KA 4E8HA 1WJKA 2YNXA 1BQ7A 4YQMA 4BL7B 4EDZA 3LYPA 3IC8A 2G0FA 2JZTA 2V1MA 4HZ2A 3TKSE 1VF1A 5AGYA 3M9JA 5J3RA 3DWVA 2H0IA 5IIZA 2HSYA 4F9ZA 1JHBA 4WKWA 1GRXA 3M1GA 2VCQA 3ZIJA 4V2MA 1O8XA 5ECIB 2GSRA 1BEDA 1GLQA 3P8WA 5ELGA 1FAAA 7GSSA 3IAM2 2DC5A 3O3TA 1EEMA 5DALA 3GH6A 4DSSB 3OR5A 2GT6A 1E2YA 1AQVA 3UOMA 4BWSA 1ACVA 2GGTA 2H72A 2MMZA 1Z6NA 1F3AA 4TR1A 4HOJA 1GSFA 4P3YB 1JFUA 1N8JA 2N5FA 3ZIVA 1JZRA 1ERUA 3FHKA 5B8AA 2B1LA 1ZOFA 4YQVA 5ELAA 2H8LA 2B1KA 4V2NA 2X8CA 2XPDA 5AISA 2CA8A 2LUSA 2PU9C 3WGDA 4XHMA 2H1AA 4TN8A 2V2GA 2MMAA 4NXIA 2YWMA 5KEJA 14GSA 5GSTA 4TR0A 4POMA 2AV4A 2L6CA 3DKSA 22GSA 5A4UA 3IOSA 1VF3A 1ST9A 5HFKA 1A2JA 2VLVA 3UMAA 3KP9A 1G0TA 1RK4A 3GTUB 1KTEA 2H66A 3ZITA 2R3XA 1K0AA 2ALBA 9GSSA 4K0GA 4FO5A 2DMLA 1QQ2A 5LCZA 2AJQB 1T1VA 1B9YC 4V2LA 4TR3A 4F0BA 4MJAA 4MDCA 2REMA 3E9JB 3L9UA 4JBBA 1M9AA 2DMMA 3D5JA 3DVWA 5CRGA 5H5QA 3A2WA 1YQ1A 4Q5NA 4ISDA 1OE7A 2LV3A 4PXOA 4MJCA 3G7JA 3VK9A 1C72A 3IV4A 4MPGA 4BVYB 4IP1A 4POBA 1SK2A 4IBPA 3DD3A 3EWLA 1J9BA 2VD0A 1UC7A 5CREA 1KBNA 3RBTA 4QL9A 5D93A 3RHCA 5ECOB 1YKAA 4K1FA 1XWGA 1BYEA 5IMCA 2R6KA 5F07A 1TRUA 2CX3A 3K8NA 4KCEA 2MBTA 2GTUA 2JADA 4PNFA 2QC7A 4K9ZA 4POKA 2YJ7A 4BVXA 4X0XA 2VM2A 4TR4A 5DQSA 4IVFA 1YEPA 4HU7A 1GTBA 3GKMA 2HRAA 2L4CA 3Q18A 1T4YA 4PQIA 2YWIA 1WWJA 3LORA 2AUVA 3HVVA 3H8QA 1KNGA 2IN3A 1ERVA 3IRAA 4XTSA 1JZOA 3KXOA 5ID2B 5GAND 1R4WA 3S9FA 3MSZA 3RDWA 3I43A 2H01A 1X5CA 3TB2A 4I5QA 2XBQA 3TOUA 1ML6A 3ZFLA 5HR0A 3WT2A 4JR6A 4HQSA 5FWGA 3P7XA 3D6IA 5FT3A 2BMXA 2H1DA 4RQRA 4PUFC 2MYGA 4LA1A 3VFIA 3FZ4A 4OFTA 2DIYA 1M2DA 5HFIA 2IMKA 5A5KA 1EOHA 5COHA 4YH2A 4XS1A 4OO5A 1LJRA 3NOFA 3IPZA 1BJXA 3MDKA 5IMDA 2VCZA 5CYYA 1JZWA 2CVBA 3UBLA 2V6OA 1MDJA 2GS3A 2WB9A 4GWRA 4WF4A 1SJIA 2WFCA
chains in the Genus database with same CATH superfamily
5DCHA 1M2AA 4RQXA 4TXOB 2CT6A 3VI5A 4FYBA 3EINA 4K2XA 1A0RP 1GUKA 5BMUB 2WJUA 2GZPA 2E7PA 3F9UA 2VM1A 3J7Yk 2YANA 4MK3A 4I6XA 3VWWA 1TKDB 5G1LA 1GSEA 4WETA 4CHSA 3LGCA 4TW5A 4DSQA 2H73A 5GSSA 2E2GA 2PPTA 2KOKA 1N25A 3IR4A 2B7JA 4XRDA 5D8IA 5JCUA 3KP8A 4GRFA 3GL3A 3R2QA 3GYKA 1UN2A 4KDYA 3KH7A 5IPGA 4WXTA 1TRSA 2IWTA 3EU4A 2IMDA 3PH9A 2PN8A 4K7OA 4HJMA 3D4TA 3GX8A 3MNGA 2H71A 4O7HA 5A1NB 5J9CA 2YP6A 4Q5RA 6GSSA 2EC4A 12GSA 5G5EA 1XFLA 5D96A 5LD0A 2EIRA 1K0BA 2YJHA 1X5EA 4KE3A 4JRRA 5J5NA 4ZXGA 1XW5A 2DKHA 3PPUA 1M99A 3C1RA 1Z7PA 1X9WB 2JZSA 3KTBA 2I81A 1G6WA 2O8VB 5IMZA 1ZYNA 2C8UA 5J40A 2C0FA 3GHAA 5G30A 1TXUA 1X9SB 1R5AA 3C1SA 5HR1A 4PUAA 2HI7A 3W8SA 4KGIA 4ZBDA 2HE3A 5B6NA 1FB0A 2H0HA 5CRHA 3I6AA 3TDGA 2CX4A 2NPBA 1V9WA 2LS5A 5IOXA 4KSMA 3ISOA 1SL1B 5A34B 2LQQA 1M2BA 4V1Ap 2B5XA 5IPHA 3KH9A 4F03A 5KN2A 4XRAA 1CQGA 3HYPA 4GXZA 4GSTA 2GLRA 1H4OA 2OKAA 2GQKA 3VLNA 2FUG2 1U87A 4AKXB 3UVTA 4TKYA 5KN1A 3RPNA 1K3OA 3FR6A 4E8EA 2H6ZA 4KW6A 4MH3A 1A2MA 5ECNB 1TK5B 2A4HA 3UBKA 4FQUA 2H1BA 1U88A 2PVQA 1A23A 2I3YA 3FZAA 3O6TA 1F37A 4MABA 1K0DA 3LSZA 4QMKA 2DBCA 4BL7A 2CZ2A 4PQHA 2KP1A 2VCTA 4HU9A 1K0NA 2O5VA 3QFAC 2IMIA 2LEGA 4ID0A 1XIYA 2C4JA 2CAQA 3HJOA 3DVXA 2FHEA 1SVMA 1Z6MA 2AYTA 4FYCA 2PGTA 3HXSA 2HSMB 2PUKC 3FRCA 1YDKA 1THXA 1EP8A 1M3JA 2A2RA 3LWAA 1R26A 4Z2UA 3J7Yb 5ECMB 3M0FA 1AUCA 1O81A 1HNAA 2H19A 3BJ5A 3F3QA 1ILOA 4Q5FA 4GSNA 2VCWA 4ECCA 2EFEA 3CMIA 2L4QA 2QA1A 4N0ZA 4PURA 4LL1B 3VPTA 4DSSA 4LMWA 1ZZYA 2M46A 4OCFA 5E59A 3CQFA 4IKHA 1GTUA 2NVLA 2GZYA 1GUMA 3TJGA 2UZ8A 1TRWA 3BCKA 3I69A 1AIUA 1SJZA 3O76A 1EV9A 2J9HA 3HKRA 3HY2A 2FGXA 1PX6A 3QFBC 3IA1A 3EMPA 4G19A 1FVKA 4J56E 1K3LA 4O92A 1BG5A 2R0PA 3HDCA 5C04A 1WP0A 2N5AA 4KH7A 3TGZA 1SD9A 4ZL9A 3RAZA 3TRQA 1HD2A 2R2JA 1HNBA 2L57A 3QAWA 4KSOA 4NAXA 1EGOA 5A5HB 2WVZA 3LFLA 3E0UA 3GTUA 3GV1A 2YZUA 8GSSA 2ON5A 1AQXA 4MZCA 1GNWA 4MP4A 1FOHA 4L5LA 2NTOA 4HS1A 3L4NA 2IMFA 3BOAA 2JSYA 2IJYA 3TJFA 4O5QA 3C71A 3L9VA 4K5SA 1V98A 4EF0A 3WGXA 5F0GA 2F9SA 4L0WA 1GP1A 4I2UA 3APOA 1QK8A 1A2LA 4D73B 1GH2A 3LEFA 3US3A 1G7EA 4G0IA 1YF0A 2H6XA 3KGKA 2AHEA 3EMXA 2OADA 2C3QA 5EVOA 16GSA 5E4WA 2CVDA 2WZSA 4BVYA 2LRTA 2GSSA 1A0FA 2YZHA 1XPVA 4MLYA 3GKNA 2NDOA 2HRKA 5C00A 4DSRA 3EU3A 3WYWA 3KCMA 4GSSA 2GSTA 3A5WA 5HR3A 1THOA 4JR4A 4AKHA 1E6BA 3ZRDA 4I2TA 2DJ2A 3TRXA 3ERFA 2GZZA 3FY7A 4ML6A 1USBA 1WOUA 3SWLA 3ZVJD 1QXHA 5JWRB 1ZGNA 2AAWA 4N3ZA 2B7KA 5IMAA 4E68A 5ECQB 3KM6A 3LW9A 5DAKB 1T8EB 1URMA 2KHPA 1MTCA 2JSZA 4RUVA 3G9BA 3LYKA 2RIIA 1I1IP 4CDOA 3RPPA 6GSWA 2H74A 4G9HA 4O5RA 1GTIA 1OKTA 11GSA 2XC2A 3CXGA 1M9BA 4G10A 2E0QA 2PBJA 5ECPB 5ID2A 18GSA 4CY8A 4ZB8A 2HLSA 3QDNA 4FYUA 2C3TA 3KZQA 2OT3A 1GTAA 1BAYA 3PR8A 3CTGA 1TU7A 1FG4A 2GQLA 3FZ9A 1ZYQB 1JLVA 3QD9A 3DMLA 1GSQA 4TR1B 1QMVA 1K0MA 1NHYA 1GSUA 2N5BA 2VD1A 4RI6A 5F06A 3NIVA 1M3IA 1OC3A 1YY7A 4HQZA 3H4KA 3UJ1A 4L8EA 5KOXA 2WS2A 2VCVA 2V6KA 1MD4A 2WW0A 4EL1A 4Z2RA 3DGQA 5KOWA 3ED3A 2YOIA 2LNTA 1XW9A 2B5YA 3VURA 1G6YA 1YF1A 2B3SA 4JU5A 2E2MA 1SKSB 4K7NA 2GT5A 3F8UA 4IN0A 3IHQA 3AY8A 4NPBA 1J0FA 1ZYPA 4ECBA 2PMTA 2RUEA 4TXOA 3TKRA 5ECHB 4G0LA 4WR4A 3VPQA 1F9MA 4H86A 3U5RE 5BMUA 1DBYA 2B5EA 3PGTA 4J2FA 3D4MA 4EXJA 1MDKA 2HZFA 1K0CA 3C73A 2F51A 6GSUA 1M7TA 2IPAA 4EC0A 3FZ5A 4TRXA 4K5RA 1S4BP 2CV4A 3H93A 1W4VA 4OFNA 4PX1A 4IJIA 1XVQA 5JWOB 1TDIA 5KN0A 3WT1A 1PA3A 1V2AA 2F8AA 3HVNA 4XS6A 3RHBA 3ZREA 2DJ3A 2BJXA 3ZZXA 5A1NA 5DQYA 1SKRB 4ZL8A 1FO5A 5DVBA 3SBCA 1O8WA 20GSA 3A2VA 1EZKA 1SL0B 4YQUA 2QSIA 5F05A 2RM5A 1OC9A 1NW2A 1JLWA 1PN9A 1U6TA 2TRCP 1EWXA 1SL2B 4WR5A 4Q5QA 2DJ0A 2TRXA 4I97A 5DCGA 6GSXA 3TOTA 4BIKA 1DE2A 2V32A 2R37A 2A2SA 5ENUA 19GSA 1TRVA 1PN0A 2VCXA 3D22A 3L78A 2WGRA 3CRTA 3CSHA 4MZWA 3TKSC 10GSA 4MZBA 6GSVA 1S3DA 3LG6A 4IGJA 2H75A 4WF5A 5A34A 5F8BA 5B7CA 4HEA2 3ME7A 1B48A 1QFNA 2GVPA 3P2AA 3VI7A 2WZ9A 3IHGA 5CP1A 2X4AA 3APSA 4IHUA 3FW2A 3UIWA 2EIOA 1YEWC 3W8JA 1A8LA 1U3IA 2I1UA 1IYHA 4ICYA 5GAPD 3FR9A 5D9XA 1ZMAA 4I8BA 1B4PA 1N2AA 3ZTLA 3CTFA 1XZOA 3HVXA 3A5IA 1CQHA 5HQPA 2A4VA 5D73A 1GNEA 4MJEA 1RW1A 4CW9A 5B8BA 2LSTA 4ZILA 5IMVA 1TW9A 4EIQA 5ECSA 3CBUA 3LXTA 2HSHA 5ECLB 1FVJA 2VLUA 2HRFA 4OO4A 4F0CA 1O85A 2X8GA 1EV4A 2HSMA 2PVOC 2O36A 3GFKA 2OJLA 2CVKA 3UARA 2C1YA 2HZEA 5LNKe 5G1KA 1K0OA 3KTLA 4GQCA 1QGVA 3GUSA 1GULA 1LBKA 1PKZA 1GUHA 4F82A 2F3MA 2HRNA 2R0GA 2OE0A 2FY6A 4ZBAA 1SD8A 4HSCX 3BD2A 1Z7RA 2H6YA 2RUFA 2YWOA 5HFGA 4KDUA 3KMNA 4FIWA 3H1NA 3Q6OA 3N9JA 1S3CA 5CO3A 1DE1A 4AKIA 5GZZB 3L9SA 4X43A 4IQAA 1X0RA 3GSSA 2GQMA 5ECRB 2LKUA 2C0DA 4EVMA 1R5PA 1OKDA 2YCDA 1SK0A 3KMOA 5DBQA 3GMFA 2WVXB 2P5RA 2IIYA 3KJYA 2C0EA 3IDVA 2HNLA 3GKXA 4WEYA 4X1UA 4L5OA 1WPIA 3A3TA 3TKQA 3H79A 3WGEA 2WVYA 5A5HA 3GURA 1TI3A 1O73A 3TCOA 2WCIA 4TVEA 4O5UA 5IM9A 1FOVA 5JCGA 4MF6A 1VF4A 5B6MA 1KEBA 5IO2A 3F4TA 2VOCA 5HR2A 2I4AA 2MMOA 2O85A 2EFHA 2WRTA 4J57E 4JEDA 3HMJG 4X4JA 2Z9SA 3QR6A 3MWHA 4D73A 1GWCA 4ML1A 1ERTA 3GX0A 5CAXA 3R3EA 1SU9A 3Q19A 2KLXA 4NV5A 2H30A 3CRUA 4LLRA 1O7UA 5D9VA 3F63A 4KUNA 5J4VA 1NSWA 4HI7A 2OE1A 5G2ZA 4XCSA 3KIJA 2H76A 3IXRA 4N10A 2OE3A 1XOBA 2D2ZA 2WW1A 2TIRA 2EIQA 4MPFA 3F4SA 3GN3A 4N11A 4OFMA 3GL5A 1T7PB 2DSAA 1I9DA 2FWHA 2K8VA 1B9XC 3KD0A 1YKCA 1H75A 1M0UA 2FLSA 2DKIA 4ZB9A 3DYRA 2XHFA 3ZMLA 5JCWA 13GSA 2IFQB 2R0CA 1PSQA 5DAKA 3ME8A 5INYA 1HYUA 1Y25A 5A4VA 3ZFBA 4IW9A 1OVNA 3UVHA 1XWCA 3IAS2 4V1Ag 3IK7A 4GQFA 3IE3A 2CAIA 2BTOT 1HNCA 1TJDA 4PI0C 2DJKA 1AXDA 1GSSA 3I9V2 3GSTA 3VWVA 3FEUA 1BG1A 1S3AA 2JZRA 4OCEA 4Z7XA 1GL8A 1PGTA 3CSIA 3KEBA 3PINA 3FK8A 1SYXA 2K9FA 4NMUA 3QPMA 3CWGA 1BX9A 3P90A 4QL7A 2CZ3A 2VIMA 1A24A 4L0UA 4XS4B 1R7HA 2OACA 1XVWA 1F2EA 1DUGA 1HQOA 4PI2C 1O6JA 2LJAA 2VUPA 1F3BA 3DXBA 3F6DA 4O32A 4NHWA 3QAVA 3F6FA 4ZBBA 2M72A 3LJRA 4KAEA 2WDUA 1XOAA 2EFDA 2VL2C 5G5FA 2HT9A 2O87A 3D21A 2DJ1A 1Y6EA 2OBKA 1B4QA 2V41A 4MH2A 1X9MB 4BPYA 3MYDA 1EGRA 4KCAA 3ZVJA 2NBSA 3TKSA 1PQNA 2ZUPA 3F4RA 2DIZA 2K18A 1SK1A 2QKEA 1WRYA 3IC4A 3ZLPA 3GNJA 1OAZA 4AJ8A 4ACSA 4G01A 5EY6A 2F8FA 3W6GA 3EVIA 4HDEA 4GTUA 4MCUA 2L6DA 3GIXA 5DJLA 1W89A 2H1LA 1T3BA 3TKPA 1EP7A 1G7OA 2KUCA 2YWNA 3C8EA 4HZ4A 3WD6A 2WULA 2C3NA 5DALB 1XBSA 3DIEA 5IO0A 2IL3A 2L59A 2CQ9A 2IMEA 1U3AA 4ZB6A 1XG8A 4IELA 5H5RA 5CRWA 4GF0A 2YN1A 2J23A 4GLTA 1TU8A 4N30A 4QQ7A 5AN1A 2ZCTA 2HRKB 2X8HA 1V40A 2RLIA 4MF5A 1OE8A 4PNGA 4HJ2A 2C0GA 3G7YA 2K8SA 1XWBA 3EURA 5L71A 2R5GA 3GKKA 2JU5A 3RGBC 4IP6A 2I9HA 1PKWA 1GSDA 1I5GA 3CSJA 1AW9A 4N0VA 4ILFA 1WE0A 1ZYEA 1PMTA 4BWQA 3GA4A 1SYRA 1FB6A 2O89A 3QAGA 2XPEA 2K6VA 4NHZA 2ES7A 3EYTA 1IYIA 3G7IA 3M3MA 5A4WA 4POLA 1PL1A 1YZXA 2DJJA 1QUWA 2HSNB 4TOPA 3FR3A 4BA7A 3VWXA 2VKZG 1TK8B 1J08A 3TJKA 3UAPA 2YV7A 4EUYA 3IBHA 4KDXA 2X49A 4EKZA 5D9WA 4PQ1A 4LMVA 1PRXA 1TXXA 5JWQB 4ZL7A 3U6VA 3ERGA 1ABAA 4DVCA 3GRXA 4OMVA 1F6MC 4ECJA 1XWKA 4EIPA 4ZB7A 1MDIA 2HQTA 3HVSA 1XCCA 3F3RA 5CRDA 3Q74A 1PD21 3HJMA 5J4YA 4K7IA 4RI7A 1ON4A 1DSBA 3LQ7A 4AGSA 1T00A 2HXKA 2QGVA 1MEKA 2L5OA 1SVOA 1RQMA 3E3EA 3RFRC 2H70A 2ON7A 3NZNA 2LRCA 2RM6A 2VL9A 2AB6A 4BVXB 1XXUA 1GLPA 2GDRA 4MA9A 2GSQA 3EPTA 4TXVA 4YAPA 1Z3EA 2FD3A 1NHOA 3V1WA 3LXZA 4KNDA 1XWAA 5FHIA 2B6MA 2C80A 1EEJA 1A8YA 2EFCA 4IQ1A 2FNOA 3APQA 1TTZA 4WBRD 1NM3A 1PX7A 3M9KA 4KX4A 5EPFA 5G31A 2WVXA 1Q98A 4AF2A 4IJ3A 4AKGA 3GH9A 1UA5A 1XW6A 1SENA 3FYGA 4ZIJA 4PTSA 4F2IA 4NV2A 2JACA 5J4UA 4K2DA 1VGLA 17GSA 2DLXA 2YPMA 1ZL9A 1B8XA 1OC8A 3L0HA 2FWGA 1FHEA 2OBIA 5BRTA 3TUEA 3HA9A 1X5DA 1K3YA 1OC9B 3HCZA 3HZ4A 5ECKB 2H1GA 3HJPA 1TP9A 4K8MA 4AI6A 3BBYA 3TRPA 2VLTA 2FWEA 4G2EA 2PERA 3HZ8A 1ZCPA 3FMWA 2LRNA 2JL4A 5AIXA 2VAFA 3QMXA 4OD7A 3MAKA 1AC1A 5EL8A 4KF9A 1TOFA 2G2QA 3UEMA 3DEXA 2FCHA 3CYNA 5ABRA 4W66A 2FA4A 2P31A 2ZNMA 2LJKA 2FA8A 1FW1A 5AIVA 1VF2A 1VRSD 1Z9HA 5IQYA 4WBJA 4USSA 3ZL5A 4FH8A 4EO3A 2YV9A 4LL4B 4MNNA 2XBIA 3MIXA 1GSYA 4GDFA 6GSYA 2HFDA 4K6XA 1T4ZA 2P5QA 4MMMA 2PWJA 4ECIA 2QA2A 4HUAA 3TJBA 5CNWA 4OWYA 2MZCA 4ULXA 3JCML 4AJ7A 3FKFA 3UL3A 1SJ6A 5DDLA 4GCIA 4YAVA 2OA7A 4MF7A 2VL2A 2MBSA 2H0GA 4XIHA 1TI1A 1V57A 2R4VA 2M80A 3N5OA 4JE1A 1AQWA 5KN3A 1MD3A 3BCIA 3A2XA 5H5SA 4G0KA 3EE2A 3C7MA 2IFQA 1SKWB 1UVZA 5D9TA 3VWUA 3F0IA 4AJ6A 4MJBA 4PGTA 2MMNA 4PHZC 1Q4JA 1V58A 2LJRA 3QOUA 4DEJA 2P0GA 2WW2A 1AAZA 2KP2A 1WMJA 2VL3A 4NWYA 3ERWA 1YEXA 2HZEB 2X64A 6GSTA 3M8NA 2LQOA 3EC3A 5J41A 4KB3A 5IMFA 2LNSA 5DJMA 3DRNA 1WIKA 1YJ6A 1JZDA 3HD5A 1OYJA 2X99A 2FWFA 4JZQA 2VO4A 3D0ZA 3TJJA 4XS4A 4EE0A 2HYXA 1TK0B 1ERWA 3ZMKA 1Z5YE 4KA0A 1EOGA 3ZYWA 4Z2TA 5IOWA 3QCPA 1LU4A 1PL2A 3IK9A 4CY6A 5J9BA 2LTKA 4IS0A 4K0NA 3HHVA 4EDYA 2L5LA 2O7KA 4E8HA 1WJKA 2YNXA 1BQ7A 4YQMA 4BL7B 4EDZA 3LYPA 1BF5A 3IC8A 2G0FA 2JZTA 2V1MA 5J47A 4HZ2A 3TKSE 1VF1A 5AGYA 3M9JA 5J3RA 3DWVA 2H0IA 5IIZA 2HSYA 4F9ZA 1JHBA 4WKWA 1GRXA 3M1GA 2VCQA 3ZIJA 4V2MA 1O8XA 5ECIB 2GSRA 1BEDA 1GLQA 3P8WA 5ELGA 1FAAA 4FXYP 7GSSA 3IAM2 2DC5A 3O3TA 4YKGA 1EEMA 5DALA 2O3EA 3GH6A 4DSSB 3OR5A 2GT6A 1E2YA 1AQVA 3UOMA 4BWSA 1ACVA 2GGTA 2H72A 2MMZA 1Z6NA 1F3AA 4TR1A 1S3RA 4HOJA 1GSFA 4P3YB 2WW3A 1JFUA 1N8JA 2N5FA 3ZIVA 1JZRA 3CHXC 1ERUA 3FHKA 5B8AA 2B1LA 1ZOFA 4YQVA 5ELAA 2H8LA 2B1KA 4V2NA 2X8CA 2XPDA 5AISA 2CA8A 1PFOA 2LUSA 2PU9C 3WGDA 4XHMA 2H1AA 4TN8A 2V2GA 2MMAA 4NXIA 2YWMA 5KEJA 14GSA 5GSTA 4TR0A 4POMA 2AV4A 2L6CA 3DKSA 22GSA 5A4UA 3IOSA 1VF3A 1ST9A 5HFKA 1A2JA 2VLVA 3UMAA 3KP9A 1G0TA 1RK4A 3GTUB 1KTEA 2H66A 3ZITA 2R3XA 1K0AA 2ALBA 9GSSA 4K0GA 4FO5A 2DMLA 3TU3B 1QQ2A 5LCZA 2AJQB 1T1VA 2HSNA 1B9YC 4V2LA 4TR3A 4F0BA 4MJAA 1Y1UA 4MDCA 2REMA 3E9JB 3L9UA 4JBBA 1M9AA 2DMMA 3D5JA 3DVWA 5CRGA 5H5QA 3A2WA 1YQ1A 4Q5NA 2A2PA 4ISDA 1OE7A 2LV3A 4PXOA 4MJCA 4A5PA 3G7JA 2UV8G 3VK9A 1C72A 3IV4A 4MPGA 4BVYB 4IP1A 4POBA 1SK2A 4IBPA 3DD3A 3EWLA 1J9BA 2VD0A 1UC7A 5CREA 1KBNA 3RBTA 4QL9A 5D93A 3RHCA 5ECOB 1YKAA 4K1FA 1YVLA 1XWGA 1BYEA 5IMCA 2R6KA 5F07A 1TRUA 2CX3A 3K8NA 4KCEA 2MBTA 2GTUA 2JADA 4PNFA 2QC7A 4K9ZA 4POKA 2YJ7A 4BVXA 4X0XA 2VM2A 4TR4A 5DQSA 4IVFA 1YEPA 4HU7A 1GTBA 3GKMA 2HRAA 2L4CA 3Q18A 1T4YA 4PQIA 2YWIA 1WWJA 3LORA 2AUVA 3HVVA 3H8QA 1KNGA 2IN3A 1ERVA 3IRAA 4XTSA 1JZOA 3KXOA 5ID2B 5GAND 1R4WA 3S9FA 3MSZA 3RDWA 3I43A 2H01A 1X5CA 3TB2A 4I5QA 2XBQA 3TOUA 1ML6A 3ZFLA 5HR0A 3WT2A 4JR6A 4HQSA 5FWGA 3P7XA 3D6IA 5FT3A 2BMXA 2H1DA 4RQRA 4PUFC 2MYGA 4LA1A 3VFIA 3FZ4A 4OFTA 2DIYA 1M2DA 5HFIA 2IMKA 5A5KA 1EOHA 1SVLA 5COHA 4YH2A 4XS1A 4OO5A 1LJRA 3NOFA 3IPZA 1BJXA 3MDKA 5IMDA 2VCZA 5CYYA 1JZWA 2CVBA 3UBLA 2V6OA 1MDJA 2GS3A 2WB9A 4GWRA 4YKFA 4WF4A 1SJIA 2WFCA
chains in the Genus database with same CATH topology
5DCHA 1M2AA 4RQXA 4TXOB 2CT6A 3VI5A 4FYBA 3EINA 4K2XA 1A0RP 1GUKA 5BMUB 2WJUA 2GZPA 2E7PA 3F9UA 2VM1A 3J7Yk 2YANA 4MK3A 4I6XA 3VWWA 1TKDB 5G1LA 1GSEA 4WETA 4CHSA 3LGCA 4TW5A 4DSQA 2H73A 5GSSA 2E2GA 2PPTA 2KOKA 1N25A 3IR4A 2B7JA 4XRDA 5D8IA 5JCUA 3KP8A 4GRFA 3GL3A 3R2QA 3GYKA 1UN2A 4KDYA 3KH7A 5IPGA 4WXTA 1TRSA 2IWTA 3EU4A 2IMDA 3PH9A 2PN8A 4K7OA 4HJMA 3D4TA 3GX8A 3MNGA 2H71A 4O7HA 5A1NB 5J9CA 2YP6A 4Q5RA 6GSSA 2EC4A 12GSA 5G5EA 1XFLA 5D96A 5LD0A 2EIRA 1K0BA 2YJHA 1X5EA 4KE3A 4JRRA 5J5NA 4ZXGA 1XW5A 2DKHA 3PPUA 1M99A 3C1RA 1Z7PA 1X9WB 2JZSA 3KTBA 2I81A 1G6WA 2O8VB 5IMZA 1ZYNA 2C8UA 5J40A 2C0FA 3GHAA 5G30A 1TXUA 1X9SB 1R5AA 3C1SA 5HR1A 4PUAA 2HI7A 3W8SA 4KGIA 4ZBDA 2HE3A 5B6NA 1FB0A 2H0HA 5CRHA 3I6AA 3TDGA 2CX4A 2NPBA 1V9WA 2LS5A 5IOXA 4KSMA 3ISOA 1SL1B 5A34B 2LQQA 1M2BA 4V1Ap 2B5XA 5IPHA 3KH9A 4F03A 5KN2A 4XRAA 1CQGA 3HYPA 4GXZA 4GSTA 2GLRA 1H4OA 2OKAA 2GQKA 3VLNA 2FUG2 1U87A 4AKXB 3UVTA 4TKYA 5KN1A 3RPNA 1K3OA 3FR6A 4E8EA 2H6ZA 4KW6A 4MH3A 1A2MA 5ECNB 1TK5B 2A4HA 3UBKA 4FQUA 2H1BA 1U88A 2PVQA 1A23A 2I3YA 3FZAA 3O6TA 1F37A 4MABA 1K0DA 3LSZA 4QMKA 2DBCA 4BL7A 2CZ2A 4PQHA 2KP1A 2VCTA 4HU9A 1K0NA 2O5VA 3QFAC 2IMIA 2LEGA 4ID0A 1XIYA 2C4JA 2CAQA 3HJOA 3DVXA 2FHEA 1SVMA 1Z6MA 2AYTA 4FYCA 2PGTA 3HXSA 2HSMB 2PUKC 3FRCA 1YDKA 1THXA 1EP8A 2A2RA 3LWAA 1R26A 4Z2UA 3J7Yb 5ECMB 3M0FA 1AUCA 1O81A 1HNAA 2H19A 3BJ5A 3F3QA 1ILOA 4Q5FA 4GSNA 2VCWA 4ECCA 2EFEA 3CMIA 2L4QA 2QA1A 4N0ZA 4PURA 4LL1B 3VPTA 4DSSA 4LMWA 1ZZYA 2M46A 4OCFA 5E59A 4IKHA 1GTUA 2NVLA 2GZYA 1GUMA 3TJGA 2UZ8A 1TRWA 3BCKA 3I69A 1AIUA 1SJZA 3O76A 1EV9A 2J9HA 3HKRA 3HY2A 2FGXA 1PX6A 3QFBC 3IA1A 3EMPA 4G19A 1FVKA 4J56E 1K3LA 4O92A 1BG5A 2R0PA 3HDCA 5C04A 1WP0A 2N5AA 4KH7A 3TGZA 1SD9A 4ZL9A 3RAZA 3TRQA 1HD2A 2R2JA 1HNBA 2L57A 3QAWA 4KSOA 4NAXA 1EGOA 5A5HB 3LFLA 3E0UA 3GTUA 3GV1A 2YZUA 8GSSA 2ON5A 1AQXA 4MZCA 1GNWA 4MP4A 1FOHA 4L5LA 2NTOA 4HS1A 3L4NA 2IMFA 3BOAA 2JSYA 2IJYA 3TJFA 4O5QA 3C71A 3L9VA 4K5SA 1V98A 4EF0A 3WGXA 5F0GA 2F9SA 4L0WA 1GP1A 4I2UA 3APOA 1QK8A 1A2LA 4D73B 1GH2A 3LEFA 3US3A 1G7EA 4G0IA 1YF0A 2H6XA 3KGKA 2AHEA 3EMXA 2OADA 2C3QA 5EVOA 16GSA 5E4WA 2CVDA 4BVYA 2LRTA 2GSSA 1A0FA 2YZHA 1XPVA 4MLYA 3GKNA 2NDOA 2HRKA 5C00A 4DSRA 3EU3A 3WYWA 3KCMA 4GSSA 2GSTA 3A5WA 5HR3A 1THOA 4JR4A 4AKHA 1E6BA 3ZRDA 4I2TA 2DJ2A 3TRXA 3ERFA 2GZZA 3FY7A 4ML6A 1USBA 1WOUA 3SWLA 3ZVJD 1QXHA 5JWRB 1ZGNA 2AAWA 4N3ZA 2B7KA 5IMAA 4E68A 5ECQB 3KM6A 3LW9A 5DAKB 1T8EB 1URMA 2KHPA 1MTCA 2JSZA 4RUVA 3G9BA 3LYKA 2RIIA 4CDOA 3RPPA 6GSWA 2H74A 4G9HA 4O5RA 1GTIA 1OKTA 11GSA 2XC2A 3CXGA 1M9BA 4G10A 2E0QA 2PBJA 5ECPB 5ID2A 18GSA 4CY8A 4ZB8A 2HLSA 3QDNA 4FYUA 2C3TA 3KZQA 2OT3A 1GTAA 1BAYA 3PR8A 3CTGA 1TU7A 1FG4A 2GQLA 3FZ9A 1ZYQB 1JLVA 3QD9A 3DMLA 1GSQA 4TR1B 1QMVA 1K0MA 1NHYA 1GSUA 2N5BA 2VD1A 4RI6A 5F06A 3NIVA 1OC3A 1YY7A 4HQZA 3H4KA 3UJ1A 4L8EA 5KOXA 2WS2A 2VCVA 2V6KA 1MD4A 4EL1A 4Z2RA 3DGQA 5KOWA 3ED3A 2YOIA 2LNTA 1XW9A 2B5YA 3VURA 1G6YA 1YF1A 2B3SA 4JU5A 2E2MA 1SKSB 4K7NA 2GT5A 3F8UA 4IN0A 3IHQA 3AY8A 4NPBA 1J0FA 1ZYPA 4ECBA 2PMTA 2RUEA 4TXOA 3TKRA 5ECHB 4G0LA 4WR4A 3VPQA 1F9MA 4H86A 3U5RE 5BMUA 1DBYA 2B5EA 3PGTA 4J2FA 3D4MA 4EXJA 1MDKA 2HZFA 1K0CA 3C73A 2F51A 6GSUA 1M7TA 2IPAA 4EC0A 3FZ5A 4TRXA 4K5RA 2CV4A 3H93A 1W4VA 4OFNA 4PX1A 4IJIA 1XVQA 5JWOB 1TDIA 5KN0A 3WT1A 1PA3A 1V2AA 2F8AA 4XS6A 3RHBA 3ZREA 2DJ3A 2BJXA 3ZZXA 5A1NA 5DQYA 1SKRB 4ZL8A 1FO5A 5DVBA 3SBCA 1O8WA 20GSA 3A2VA 1EZKA 1SL0B 4YQUA 2QSIA 5F05A 2RM5A 1OC9A 1NW2A 1JLWA 1PN9A 1U6TA 2TRCP 1EWXA 1SL2B 4WR5A 4Q5QA 2DJ0A 2TRXA 4I97A 5DCGA 6GSXA 3TOTA 1DE2A 2V32A 2R37A 2A2SA 5ENUA 19GSA 1TRVA 1PN0A 2VCXA 3D22A 3L78A 2WGRA 3CRTA 3CSHA 4MZWA 3TKSC 10GSA 4MZBA 6GSVA 1S3DA 3LG6A 4IGJA 2H75A 4WF5A 5A34A 5F8BA 5B7CA 4HEA2 3ME7A 1B48A 1QFNA 2GVPA 3P2AA 3VI7A 2WZ9A 3IHGA 5CP1A 2X4AA 3APSA 4IHUA 3FW2A 3UIWA 2EIOA 3W8JA 1A8LA 1U3IA 2I1UA 1IYHA 4ICYA 5GAPD 3FR9A 5D9XA 1ZMAA 4I8BA 1B4PA 1N2AA 3ZTLA 3CTFA 1XZOA 3HVXA 3A5IA 1CQHA 5HQPA 2A4VA 5D73A 1GNEA 4MJEA 1RW1A 4CW9A 5B8BA 2LSTA 4ZILA 5IMVA 1TW9A 4EIQA 5ECSA 3CBUA 3LXTA 2HSHA 5ECLB 1FVJA 2VLUA 2HRFA 4OO4A 4F0CA 1O85A 2X8GA 1EV4A 2HSMA 2PVOC 3GFKA 2OJLA 2CVKA 3UARA 2C1YA 2HZEA 5LNKe 5G1KA 1K0OA 3KTLA 4GQCA 1QGVA 3GUSA 1GULA 1LBKA 1PKZA 1GUHA 4F82A 2F3MA 2HRNA 2R0GA 2OE0A 2FY6A 4ZBAA 1SD8A 3BD2A 1Z7RA 2H6YA 2RUFA 2YWOA 5HFGA 4KDUA 3KMNA 4FIWA 3H1NA 3Q6OA 3N9JA 1S3CA 5CO3A 1DE1A 4AKIA 5GZZB 3L9SA 4X43A 4IQAA 1X0RA 3GSSA 2GQMA 5ECRB 2LKUA 2C0DA 4EVMA 1R5PA 1OKDA 2YCDA 1SK0A 3KMOA 5DBQA 3GMFA 2P5RA 2IIYA 3KJYA 2C0EA 3IDVA 2HNLA 3GKXA 4WEYA 4X1UA 4L5OA 1WPIA 3A3TA 3TKQA 3H79A 3WGEA 5A5HA 3GURA 1TI3A 1O73A 3TCOA 2WCIA 4TVEA 4O5UA 5IM9A 1FOVA 5JCGA 4MF6A 1VF4A 5B6MA 1KEBA 5IO2A 3F4TA 2VOCA 5HR2A 2I4AA 2MMOA 2O85A 2EFHA 2WRTA 4J57E 4JEDA 3HMJG 4X4JA 2Z9SA 3QR6A 3MWHA 4D73A 1GWCA 4ML1A 1ERTA 3GX0A 5CAXA 3R3EA 1SU9A 3Q19A 2KLXA 4NV5A 2H30A 3CRUA 4LLRA 1O7UA 5D9VA 3F63A 4KUNA 5J4VA 1NSWA 4HI7A 2OE1A 5G2ZA 4XCSA 3KIJA 2H76A 3IXRA 4N10A 2OE3A 1XOBA 2D2ZA 2TIRA 2EIQA 4MPFA 3F4SA 3GN3A 4N11A 4OFMA 3GL5A 1T7PB 2DSAA 1I9DA 2FWHA 2K8VA 1B9XC 3KD0A 1YKCA 1H75A 1M0UA 2FLSA 2DKIA 4ZB9A 3DYRA 2XHFA 3ZMLA 5JCWA 13GSA 2IFQB 2R0CA 1PSQA 5DAKA 3ME8A 5INYA 1HYUA 1Y25A 5A4VA 3ZFBA 4IW9A 1OVNA 3UVHA 1XWCA 3IAS2 4V1Ag 3IK7A 4GQFA 3IE3A 2CAIA 2BTOT 1HNCA 1TJDA 2DJKA 1AXDA 1GSSA 3I9V2 3GSTA 3VWVA 3FEUA 1BG1A 1S3AA 2JZRA 4OCEA 4Z7XA 1GL8A 1PGTA 3CSIA 3KEBA 3PINA 3FK8A 1SYXA 2K9FA 4NMUA 3QPMA 3CWGA 1BX9A 3P90A 4QL7A 2CZ3A 2VIMA 1A24A 4L0UA 4XS4B 1R7HA 2OACA 1XVWA 1F2EA 1DUGA 1HQOA 1O6JA 2LJAA 2VUPA 1F3BA 3DXBA 3F6DA 4O32A 4NHWA 3QAVA 3F6FA 4ZBBA 2M72A 3LJRA 4KAEA 2WDUA 1XOAA 2EFDA 2VL2C 5G5FA 2HT9A 2O87A 3D21A 2DJ1A 1Y6EA 2OBKA 1B4QA 2V41A 4MH2A 1X9MB 4BPYA 3MYDA 1EGRA 4KCAA 3ZVJA 2NBSA 3TKSA 1PQNA 2ZUPA 3F4RA 2DIZA 2K18A 1SK1A 2QKEA 1WRYA 3IC4A 3ZLPA 3GNJA 1OAZA 4AJ8A 4ACSA 4G01A 5EY6A 2F8FA 3W6GA 3EVIA 4HDEA 4GTUA 4MCUA 2L6DA 3GIXA 5DJLA 1W89A 2H1LA 1T3BA 3TKPA 1EP7A 1G7OA 2KUCA 2YWNA 3C8EA 4HZ4A 3WD6A 2WULA 2C3NA 5DALB 1XBSA 3DIEA 5IO0A 2IL3A 2L59A 2CQ9A 2IMEA 1U3AA 4ZB6A 4IELA 5H5RA 5CRWA 4GF0A 2YN1A 2J23A 4GLTA 1TU8A 4N30A 4QQ7A 5AN1A 2ZCTA 2HRKB 2X8HA 1V40A 2RLIA 4MF5A 1OE8A 4PNGA 4HJ2A 2C0GA 3G7YA 2K8SA 1XWBA 3EURA 5L71A 2R5GA 3GKKA 2JU5A 4IP6A 2I9HA 1PKWA 1GSDA 1I5GA 3CSJA 1AW9A 4N0VA 4ILFA 1WE0A 1ZYEA 1PMTA 4BWQA 3GA4A 1SYRA 1FB6A 2O89A 3QAGA 2XPEA 2K6VA 4NHZA 2ES7A 3EYTA 1IYIA 3G7IA 3M3MA 5A4WA 4POLA 1PL1A 1YZXA 2DJJA 1QUWA 2HSNB 4TOPA 3FR3A 4BA7A 3VWXA 2VKZG 1TK8B 1J08A 3TJKA 3UAPA 2YV7A 4EUYA 3IBHA 4KDXA 2X49A 4EKZA 5D9WA 4PQ1A 4LMVA 1PRXA 1TXXA 5JWQB 4ZL7A 3U6VA 3ERGA 1ABAA 4DVCA 3GRXA 4OMVA 1F6MC 4ECJA 1XWKA 4EIPA 4ZB7A 1MDIA 2HQTA 3HVSA 1XCCA 3F3RA 5CRDA 3Q74A 1PD21 3HJMA 5J4YA 4K7IA 4RI7A 1ON4A 1DSBA 3LQ7A 4AGSA 1T00A 2HXKA 2QGVA 1MEKA 2L5OA 1SVOA 1RQMA 3E3EA 2H70A 2ON7A 3NZNA 2LRCA 2RM6A 2VL9A 2AB6A 4BVXB 1XXUA 1GLPA 2GDRA 4MA9A 2GSQA 3EPTA 4TXVA 4YAPA 1Z3EA 2FD3A 1NHOA 3V1WA 3LXZA 4KNDA 1XWAA 5FHIA 2B6MA 2C80A 1EEJA 1A8YA 2EFCA 4IQ1A 2FNOA 3APQA 1TTZA 4WBRD 1NM3A 1PX7A 3M9KA 4KX4A 5EPFA 5G31A 1Q98A 4AF2A 4IJ3A 4AKGA 3GH9A 1UA5A 1XW6A 1SENA 3FYGA 4ZIJA 4PTSA 4F2IA 4NV2A 2JACA 5J4UA 4K2DA 1VGLA 17GSA 2DLXA 2YPMA 1ZL9A 1B8XA 1OC8A 3L0HA 2FWGA 1FHEA 2OBIA 5BRTA 3TUEA 3HA9A 1X5DA 1K3YA 1OC9B 3HCZA 3HZ4A 5ECKB 2H1GA 3HJPA 1TP9A 4K8MA 4AI6A 3BBYA 3TRPA 2VLTA 2FWEA 4G2EA 2PERA 3HZ8A 1ZCPA 3FMWA 2LRNA 2JL4A 5AIXA 2VAFA 3QMXA 4OD7A 3MAKA 1AC1A 5EL8A 4KF9A 1TOFA 2G2QA 3UEMA 3DEXA 2FCHA 3CYNA 5ABRA 4W66A 2FA4A 2P31A 2ZNMA 2LJKA 2FA8A 1FW1A 5AIVA 1VF2A 1VRSD 1Z9HA 5IQYA 4WBJA 4USSA 3ZL5A 4FH8A 4EO3A 2YV9A 4LL4B 4MNNA 2XBIA 3MIXA 1GSYA 4GDFA 6GSYA 2HFDA 4K6XA 1T4ZA 2P5QA 4MMMA 2PWJA 4ECIA 2QA2A 4HUAA 3TJBA 5CNWA 4OWYA 2MZCA 4ULXA 3JCML 4AJ7A 3FKFA 3UL3A 1SJ6A 5DDLA 4GCIA 4YAVA 2OA7A 4MF7A 2VL2A 2MBSA 2H0GA 4XIHA 1TI1A 1V57A 2R4VA 2M80A 3N5OA 4JE1A 1AQWA 5KN3A 1MD3A 3BCIA 3A2XA 5H5SA 4G0KA 3EE2A 3C7MA 2IFQA 1SKWB 1UVZA 5D9TA 3VWUA 3F0IA 4AJ6A 4MJBA 4PGTA 2MMNA 1Q4JA 1V58A 2LJRA 3QOUA 4DEJA 2P0GA 1AAZA 2KP2A 1WMJA 2VL3A 4NWYA 3ERWA 1YEXA 2HZEB 2X64A 6GSTA 3M8NA 2LQOA 3EC3A 5J41A 4KB3A 5IMFA 2LNSA 5DJMA 3DRNA 1WIKA 1YJ6A 1JZDA 3HD5A 1OYJA 2X99A 2FWFA 4JZQA 2VO4A 3D0ZA 3TJJA 4XS4A 4EE0A 2HYXA 1TK0B 1ERWA 3ZMKA 1Z5YE 4KA0A 1EOGA 3ZYWA 4Z2TA 5IOWA 3QCPA 1LU4A 1PL2A 3IK9A 4CY6A 5J9BA 2LTKA 4IS0A 4K0NA 3HHVA 4EDYA 2L5LA 2O7KA 4E8HA 1WJKA 2YNXA 1BQ7A 4YQMA 4BL7B 4EDZA 3LYPA 1BF5A 3IC8A 2G0FA 2JZTA 2V1MA 5J47A 4HZ2A 3TKSE 1VF1A 5AGYA 3M9JA 5J3RA 3DWVA 2H0IA 5IIZA 2HSYA 4F9ZA 1JHBA 4WKWA 1GRXA 3M1GA 2VCQA 3ZIJA 4V2MA 1O8XA 5ECIB 2GSRA 1BEDA 1GLQA 3P8WA 5ELGA 1FAAA 7GSSA 3IAM2 2DC5A 3O3TA 4YKGA 1EEMA 5DALA 3GH6A 4DSSB 3OR5A 2GT6A 1E2YA 1AQVA 3UOMA 4BWSA 1ACVA 2GGTA 2H72A 2MMZA 1Z6NA 1F3AA 4TR1A 4HOJA 1GSFA 4P3YB 1JFUA 1N8JA 2N5FA 3ZIVA 1JZRA 1ERUA 3FHKA 5B8AA 2B1LA 1ZOFA 4YQVA 5ELAA 2H8LA 2B1KA 4V2NA 2X8CA 2XPDA 5AISA 2CA8A 2LUSA 2PU9C 3WGDA 4XHMA 2H1AA 4TN8A 2V2GA 2MMAA 4NXIA 2YWMA 5KEJA 14GSA 5GSTA 4TR0A 4POMA 2AV4A 2L6CA 3DKSA 22GSA 5A4UA 3IOSA 1VF3A 1ST9A 5HFKA 1A2JA 2VLVA 3UMAA 3KP9A 1G0TA 1RK4A 3GTUB 1KTEA 2H66A 3ZITA 2R3XA 1K0AA 2ALBA 9GSSA 4K0GA 4FO5A 2DMLA 3TU3B 1QQ2A 5LCZA 2AJQB 1T1VA 2HSNA 1B9YC 4V2LA 4TR3A 4F0BA 4MJAA 1Y1UA 4MDCA 2REMA 3E9JB 3L9UA 4JBBA 1M9AA 2DMMA 3D5JA 3DVWA 5CRGA 5H5QA 3A2WA 1YQ1A 4Q5NA 2A2PA 4ISDA 1OE7A 2LV3A 4PXOA 4MJCA 4A5PA 3G7JA 2UV8G 3VK9A 1C72A 3IV4A 4MPGA 4BVYB 4IP1A 4POBA 1SK2A 4IBPA 3DD3A 3EWLA 1J9BA 2VD0A 1UC7A 5CREA 1KBNA 3RBTA 4QL9A 5D93A 3RHCA 5ECOB 1YKAA 4K1FA 1YVLA 1XWGA 1BYEA 5IMCA 2R6KA 5F07A 1TRUA 2CX3A 3K8NA 4KCEA 2MBTA 2GTUA 2JADA 4PNFA 2QC7A 4K9ZA 4POKA 2YJ7A 4BVXA 4X0XA 2VM2A 4TR4A 5DQSA 4IVFA 1YEPA 4HU7A 1GTBA 3GKMA 2HRAA 2L4CA 3Q18A 1T4YA 4PQIA 2YWIA 1WWJA 3LORA 2AUVA 3HVVA 3H8QA 1KNGA 2IN3A 1ERVA 3IRAA 4XTSA 1JZOA 3KXOA 5ID2B 5GAND 1R4WA 3S9FA 3MSZA 3RDWA 3I43A 2H01A 1X5CA 3TB2A 4I5QA 2XBQA 3TOUA 1ML6A 3ZFLA 5HR0A 3WT2A 4JR6A 4HQSA 5FWGA 3P7XA 3D6IA 5FT3A 2BMXA 2H1DA 4RQRA 4PUFC 2MYGA 4LA1A 3VFIA 3FZ4A 4OFTA 2DIYA 1M2DA 5HFIA 2IMKA 5A5KA 1EOHA 1SVLA 5COHA 4YH2A 4XS1A 4OO5A 1LJRA 3NOFA 3IPZA 1BJXA 3MDKA 5IMDA 2VCZA 5CYYA 1JZWA 2CVBA 3UBLA 2V6OA 1MDJA 2GS3A 2WB9A 4GWRA 4YKFA 4WF4A 1SJIA 2WFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCH A;  1M2A A;  4RQX A;  4TXO B;  2CT6 A;  3VI5 A;  4FYB A;  3EIN A;  1A0R P;  1GUK A;  2WJU A;  2GZP A;  2E7P A;  3F9U A;  2VM1 A;  3J7Y k;  2YAN A;  4MK3 A;  4I6X A;  3VWW A;  1TKD B;  5G1L A;  1GSE A;  4WET A;  4CHS A;  3LGC A;  4TW5 A;  4DSQ A;  2H73 A;  5GSS A;  2E2G A;  2PPT A;  2KOK A;  3IR4 A;  2B7J A;  4XRD A;  5D8I A;  5JCU A;  3KP8 A;  4GRF A;  3GL3 A;  3R2Q A;  3GYK A;  1UN2 A;  4KDY A;  3KH7 A;  5IPG A;  4WXT A;  1TRS A;  2IWT A;  3EU4 A;  2IMD A;  3PH9 A;  2PN8 A;  4K7O A;  4HJM A;  3D4T A;  3GX8 A;  3MNG A;  2H71 A;  4O7H A;  5J9C A;  2YP6 A;  4Q5R A;  6GSS A;  2EC4 A;  12GS A;  5G5E A;  1XFL A;  5D96 A;  5LD0 A;  2EIR A;  1K0B A;  2YJH A;  1X5E A;  4KE3 A;  4JRR A;  5J5N A;  4ZXG A;  1XW5 A;  3PPU A;  1M99 A;  3C1R A;  1Z7P A;  1X9W B;  2JZS A;  3KTB A;  2I81 A;  1G6W A;  2O8V B;  5IMZ A;  2C8U A;  2C0F A;  3GHA A;  5G30 A;  1X9S B;  1R5A A;  3C1S A;  5HR1 A;  4PUA A;  2HI7 A;  3W8S A;  4KGI A;  4ZBD A;  2HE3 A;  5B6N A;  1FB0 A;  2H0H A;  5CRH A;  3I6A A;  3TDG A;  2CX4 A;  2NPB A;  1V9W A;  2LS5 A;  5IOX A;  4KSM A;  3ISO A;  1SL1 B;  2LQQ A;  1M2B A;  4V1A p;  2B5X A;  5IPH A;  3KH9 A;  4F03 A;  5KN2 A;  4XRA A;  1CQG A;  3HYP A;  4GXZ A;  4GST A;  2GLR A;  1H4O A;  2OKA A;  2GQK A;  3VLN A;  2FUG 2;  1U87 A;  3UVT A;  4TKY A;  5KN1 A;  3RPN A;  1K3O A;  3FR6 A;  4E8E A;  2H6Z A;  4KW6 A;  4MH3 A;  1A2M A;  5ECN B;  1TK5 B;  3UBK A;  4FQU A;  2H1B A;  1U88 A;  2PVQ A;  1A23 A;  2I3Y A;  3FZA A;  3O6T A;  1F37 A;  4MAB A;  1K0D A;  3LSZ A;  2DBC A;  4BL7 A;  2CZ2 A;  4PQH A;  2KP1 A;  2VCT A;  4HU9 A;  1K0N A;  3QFA C;  2IMI A;  2LEG A;  4ID0 A;  1XIY A;  2C4J A;  2CAQ A;  3HJO A;  3DVX A;  2FHE A;  1Z6M A;  2AYT A;  4FYC A;  2PGT A;  3HXS A;  2HSM B;  2PUK C;  3FRC A;  1YDK A;  1THX A;  1EP8 A;  2A2R A;  3LWA A;  1R26 A;  3J7Y b;  5ECM B;  3M0F A;  1AUC A;  1O81 A;  1HNA A;  2H19 A;  3BJ5 A;  3F3Q A;  1ILO A;  4Q5F A;  4GSN A;  2VCW A;  4ECC A;  3CMI A;  2L4Q A;  4N0Z A;  4PUR A;  4LL1 B;  3VPT A;  4DSS A;  4LMW A;  1ZZY A;  2M46 A;  4OCF A;  5E59 A;  4IKH A;  1GTU A;  2NVL A;  2GZY A;  1GUM A;  3TJG A;  2UZ8 A;  1TRW A;  3BCK A;  3I69 A;  1AIU A;  1SJZ A;  3O76 A;  1EV9 A;  2J9H A;  3HKR A;  3HY2 A;  2FGX A;  1PX6 A;  3QFB C;  3IA1 A;  3EMP A;  4G19 A;  1FVK A;  4J56 E;  1K3L A;  4O92 A;  1BG5 A;  3HDC A;  5C04 A;  1WP0 A;  2N5A A;  4KH7 A;  3TGZ A;  1SD9 A;  4ZL9 A;  3RAZ A;  3TRQ A;  1HD2 A;  2R2J A;  1HNB A;  2L57 A;  3QAW A;  4KSO A;  4NAX A;  1EGO A;  3LFL A;  3E0U A;  3GTU A;  3GV1 A;  2YZU A;  8GSS A;  2ON5 A;  1AQX A;  4MZC A;  1GNW A;  4MP4 A;  4L5L A;  2NTO A;  4HS1 A;  3L4N A;  2IMF A;  3BOA A;  2JSY A;  2IJY A;  3TJF A;  3C71 A;  3L9V A;  1V98 A;  4EF0 A;  3WGX A;  5F0G A;  2F9S A;  4L0W A;  1GP1 A;  4I2U A;  3APO A;  1QK8 A;  1A2L A;  4D73 B;  1GH2 A;  3LEF A;  3US3 A;  1G7E A;  4G0I A;  1YF0 A;  2H6X A;  3KGK A;  2AHE A;  3EMX A;  2OAD A;  2C3Q A;  5EVO A;  16GS A;  5E4W A;  2CVD A;  4BVY A;  2LRT A;  2GSS A;  1A0F A;  2YZH A;  1XPV A;  4MLY A;  3GKN A;  2NDO A;  2HRK A;  5C00 A;  4DSR A;  3EU3 A;  3WYW A;  3KCM A;  4GSS A;  2GST A;  3A5W A;  5HR3 A;  1THO A;  4JR4 A;  1E6B A;  3ZRD A;  4I2T A;  2DJ2 A;  3TRX A;  3ERF A;  2GZZ A;  3FY7 A;  4ML6 A;  1USB A;  1WOU A;  3SWL A;  3ZVJ D;  1QXH A;  5JWR B;  1ZGN A;  2AAW A;  2B7K A;  5IMA A;  5ECQ B;  3KM6 A;  5DAK B;  1T8E B;  1URM A;  2KHP A;  1MTC A;  2JSZ A;  4RUV A;  3G9B A;  3LYK A;  2RII A;  4CDO A;  3RPP A;  6GSW A;  2H74 A;  4G9H A;  4O5R A;  1GTI A;  1OKT A;  11GS A;  2XC2 A;  3CXG A;  1M9B A;  4G10 A;  2E0Q A;  2PBJ A;  5ECP B;  5ID2 A;  18GS A;  4ZB8 A;  2HLS A;  3QDN A;  4FYU A;  2C3T A;  3KZQ A;  1GTA A;  1BAY A;  3PR8 A;  3CTG A;  1TU7 A;  1FG4 A;  2GQL A;  3FZ9 A;  1ZYQ B;  1JLV A;  3QD9 A;  3DML A;  1GSQ A;  4TR1 B;  1QMV A;  1K0M A;  1NHY A;  1GSU A;  2N5B A;  2VD1 A;  4RI6 A;  5F06 A;  3NIV A;  1OC3 A;  1YY7 A;  4HQZ A;  3H4K A;  3UJ1 A;  4L8E A;  2WS2 A;  2VCV A;  2V6K A;  1MD4 A;  4EL1 A;  3DGQ A;  3ED3 A;  2YOI A;  2LNT A;  1XW9 A;  2B5Y A;  3VUR A;  1G6Y A;  1YF1 A;  2B3S A;  4JU5 A;  2E2M A;  1SKS B;  4K7N A;  2GT5 A;  3F8U A;  4IN0 A;  3IHQ A;  3AY8 A;  4NPB A;  1J0F A;  4ECB A;  2PMT A;  2RUE A;  4TXO A;  3TKR A;  5ECH B;  4G0L A;  4WR4 A;  3VPQ A;  1F9M A;  4H86 A;  3U5R E;  5BMU A;  1DBY A;  2B5E A;  3PGT A;  4J2F A;  3D4M A;  4EXJ A;  1MDK A;  2HZF A;  1K0C A;  3C73 A;  2F51 A;  6GSU A;  1M7T A;  2IPA A;  4EC0 A;  3FZ5 A;  4TRX A;  2CV4 A;  3H93 A;  1W4V A;  4OFN A;  4PX1 A;  4IJI A;  1XVQ A;  5JWO B;  1TDI A;  5KN0 A;  3WT1 A;  1PA3 A;  1V2A A;  2F8A A;  4XS6 A;  3RHB A;  3ZRE A;  2DJ3 A;  2BJX A;  3ZZX A;  5DQY A;  1SKR B;  4ZL8 A;  1FO5 A;  5DVB A;  3SBC A;  1O8W A;  20GS A;  3A2V A;  1EZK A;  1SL0 B;  4YQU A;  2QSI A;  5F05 A;  2RM5 A;  1OC9 A;  1NW2 A;  1JLW A;  1PN9 A;  1U6T A;  2TRC P;  1EWX A;  1SL2 B;  4WR5 A;  4Q5Q A;  2DJ0 A;  2TRX A;  4I97 A;  5DCG A;  6GSX A;  3TOT A;  1DE2 A;  2V32 A;  2R37 A;  2A2S A;  5ENU A;  19GS A;  1TRV A;  2VCX A;  3D22 A;  3L78 A;  2WGR A;  3CRT A;  3CSH A;  4MZW A;  3TKS C;  10GS A;  4MZB A;  6GSV A;  1S3D A;  3LG6 A;  4IGJ A;  2H75 A;  4WF5 A;  5F8B A;  5B7C A;  4HEA 2;  3ME7 A;  1B48 A;  1QFN A;  2GVP A;  3P2A A;  3VI7 A;  2WZ9 A;  5CP1 A;  3APS A;  4IHU A;  3FW2 A;  3UIW A;  2EIO A;  3W8J A;  1A8L A;  1U3I A;  2I1U A;  1IYH A;  5GAP D;  3FR9 A;  5D9X A;  1ZMA A;  4I8B A;  1B4P A;  1N2A A;  3ZTL A;  3CTF A;  1XZO A;  3HVX A;  1CQH A;  5HQP A;  2A4V A;  5D73 A;  1GNE A;  4MJE A;  1RW1 A;  4CW9 A;  5B8B A;  2LST A;  4ZIL A;  5IMV A;  1TW9 A;  5ECS A;  3CBU A;  3LXT A;  2HSH A;  5ECL B;  1FVJ A;  2VLU A;  2HRF A;  4OO4 A;  4F0C A;  1O85 A;  2X8G A;  1EV4 A;  2HSM A;  2PVO C;  3GFK A;  2OJL A;  2CVK A;  3UAR A;  2C1Y A;  2HZE A;  5LNK e;  5G1K A;  1K0O A;  3KTL A;  4GQC A;  1QGV A;  3GUS A;  1GUL A;  1LBK A;  1PKZ A;  1GUH A;  4F82 A;  2F3M A;  2HRN A;  2OE0 A;  2FY6 A;  4ZBA A;  1SD8 A;  3BD2 A;  1Z7R A;  2H6Y A;  2RUF A;  2YWO A;  5HFG A;  4KDU A;  3KMN A;  4FIW A;  3H1N A;  3Q6O A;  3N9J A;  1S3C A;  5CO3 A;  1DE1 A;  5GZZ B;  3L9S A;  4X43 A;  4IQA A;  1X0R A;  3GSS A;  2GQM A;  5ECR B;  2LKU A;  2C0D A;  4EVM A;  1R5P A;  1OKD A;  2YCD A;  1SK0 A;  3KMO A;  5DBQ A;  3GMF A;  2P5R A;  2IIY A;  3KJY A;  2C0E A;  3IDV A;  2HNL A;  3GKX A;  4WEY A;  4X1U A;  4L5O A;  1WPI A;  3A3T A;  3TKQ A;  3H79 A;  3WGE A;  3GUR A;  1TI3 A;  1O73 A;  3TCO A;  2WCI A;  4TVE A;  5IM9 A;  1FOV A;  5JCG A;  4MF6 A;  1VF4 A;  5B6M A;  1KEB A;  5IO2 A;  3F4T A;  2VOC A;  5HR2 A;  2I4A A;  2MMO A;  2O85 A;  2WRT A;  4J57 E;  4JED A;  2Z9S A;  3QR6 A;  3MWH A;  4D73 A;  1GWC A;  4ML1 A;  1ERT A;  3GX0 A;  5CAX A;  3R3E A;  1SU9 A;  3Q19 A;  2KLX A;  4NV5 A;  2H30 A;  3CRU A;  4LLR A;  1O7U A;  5D9V A;  3F63 A;  4KUN A;  1NSW A;  4HI7 A;  2OE1 A;  5G2Z A;  4XCS A;  3KIJ A;  2H76 A;  3IXR A;  4N10 A;  2OE3 A;  1XOB A;  2D2Z A;  2TIR A;  2EIQ A;  4MPF A;  3F4S A;  3GN3 A;  4N11 A;  4OFM A;  3GL5 A;  1T7P B;  2DSA A;  1I9D A;  2FWH A;  2K8V A;  1B9X C;  3KD0 A;  1YKC A;  1H75 A;  1M0U A;  2FLS A;  4ZB9 A;  3DYR A;  2XHF A;  3ZML A;  5JCW A;  13GS A;  2IFQ B;  1PSQ A;  5DAK A;  3ME8 A;  5INY A;  1HYU A;  1Y25 A;  5A4V A;  3ZFB A;  4IW9 A;  1OVN A;  3UVH A;  1XWC A;  3IAS 2;  4V1A g;  3IK7 A;  4GQF A;  3IE3 A;  2CAI A;  2BTO T;  1HNC A;  1TJD A;  2DJK A;  1AXD A;  1GSS A;  3I9V 2;  3GST A;  3VWV A;  3FEU A;  1S3A A;  2JZR A;  4OCE A;  4Z7X A;  1GL8 A;  1PGT A;  3CSI A;  3KEB A;  3PIN A;  3FK8 A;  1SYX A;  2K9F A;  4NMU A;  3QPM A;  1BX9 A;  3P90 A;  4QL7 A;  2CZ3 A;  2VIM A;  1A24 A;  4L0U A;  4XS4 B;  1R7H A;  2OAC A;  1XVW A;  1F2E A;  1DUG A;  1HQO A;  1O6J A;  2LJA A;  2VUP A;  1F3B A;  3DXB A;  3F6D A;  4O32 A;  4NHW A;  3QAV A;  3F6F A;  4ZBB A;  2M72 A;  3LJR A;  4KAE A;  2WDU A;  1XOA A;  2VL2 C;  5G5F A;  2HT9 A;  2O87 A;  3D21 A;  2DJ1 A;  1Y6E A;  2OBK A;  1B4Q A;  2V41 A;  4MH2 A;  1X9M B;  4BPY A;  1EGR A;  4KCA A;  3ZVJ A;  2NBS A;  3TKS A;  1PQN A;  2ZUP A;  3F4R A;  2DIZ A;  2K18 A;  1SK1 A;  2QKE A;  1WRY A;  3IC4 A;  3ZLP A;  3GNJ A;  1OAZ A;  4AJ8 A;  4ACS A;  5EY6 A;  2F8F A;  3W6G A;  3EVI A;  4HDE A;  4GTU A;  4MCU A;  2L6D A;  3GIX A;  5DJL A;  1W89 A;  1T3B A;  3TKP A;  1EP7 A;  1G7O A;  2KUC A;  2YWN A;  3C8E A;  4HZ4 A;  3WD6 A;  2WUL A;  2C3N A;  5DAL B;  1XBS A;  3DIE A;  5IO0 A;  2IL3 A;  2L59 A;  2CQ9 A;  2IME A;  1U3A A;  4ZB6 A;  4IEL A;  5H5R A;  5CRW A;  4GF0 A;  2YN1 A;  2J23 A;  4GLT A;  1TU8 A;  4N30 A;  4QQ7 A;  5AN1 A;  2ZCT A;  2HRK B;  2X8H A;  1V40 A;  2RLI A;  4MF5 A;  1OE8 A;  4PNG A;  4HJ2 A;  2C0G A;  3G7Y A;  2K8S A;  1XWB A;  3EUR A;  5L71 A;  2R5G A;  3GKK A;  2JU5 A;  4IP6 A;  2I9H A;  1PKW A;  1GSD A;  1I5G A;  3CSJ A;  1AW9 A;  4N0V A;  4ILF A;  1WE0 A;  1ZYE A;  1PMT A;  4BWQ A;  3GA4 A;  1SYR A;  1FB6 A;  2O89 A;  3QAG A;  2XPE A;  2K6V A;  4NHZ A;  2ES7 A;  3EYT A;  1IYI A;  3G7I A;  3M3M A;  5A4W A;  4POL A;  1PL1 A;  1YZX A;  2DJJ A;  1QUW A;  2HSN B;  4TOP A;  3FR3 A;  4BA7 A;  3VWX A;  1TK8 B;  1J08 A;  3TJK A;  3UAP A;  2YV7 A;  4EUY A;  3IBH A;  4KDX A;  4EKZ A;  5D9W A;  4PQ1 A;  4LMV A;  1PRX A;  1TXX A;  5JWQ B;  4ZL7 A;  3U6V A;  3ERG A;  1ABA A;  4DVC A;  3GRX A;  4OMV A;  1F6M C;  4ECJ A;  1XWK A;  1MDI A;  2HQT A;  3HVS A;  1XCC A;  3F3R A;  5CRD A;  3Q74 A;  1PD2 1;  3HJM A;  4K7I A;  4RI7 A;  1ON4 A;  1DSB A;  3LQ7 A;  4AGS A;  1T00 A;  2HXK A;  2QGV A;  1MEK A;  2L5O A;  1RQM A;  3E3E A;  2H70 A;  2ON7 A;  3NZN A;  2LRC A;  2RM6 A;  2VL9 A;  2AB6 A;  4BVX B;  1XXU A;  1GLP A;  2GDR A;  4MA9 A;  2GSQ A;  4TXV A;  4YAP A;  1Z3E A;  2FD3 A;  1NHO A;  3V1W A;  3LXZ A;  4KND A;  1XWA A;  5FHI A;  2B6M A;  2C80 A;  1EEJ A;  1A8Y A;  4IQ1 A;  2FNO A;  3APQ A;  1TTZ A;  4WBR D;  1NM3 A;  1PX7 A;  3M9K A;  4KX4 A;  5EPF A;  5G31 A;  1Q98 A;  4AF2 A;  4IJ3 A;  3GH9 A;  1UA5 A;  1XW6 A;  1SEN A;  3FYG A;  4ZIJ A;  4PTS A;  4F2I A;  4NV2 A;  2JAC A;  5J4U A;  4K2D A;  1VGL A;  17GS A;  2DLX A;  2YPM A;  1ZL9 A;  1B8X A;  1OC8 A;  3L0H A;  2FWG A;  1FHE A;  2OBI A;  3TUE A;  3HA9 A;  1X5D A;  1K3Y A;  1OC9 B;  3HCZ A;  3HZ4 A;  5ECK B;  2H1G A;  3HJP A;  1TP9 A;  4K8M A;  3BBY A;  3TRP A;  2VLT A;  2FWE A;  4G2E A;  2PER A;  3HZ8 A;  1ZCP A;  2LRN A;  2JL4 A;  5AIX A;  2VAF A;  3QMX A;  4OD7 A;  3MAK A;  1AC1 A;  5EL8 A;  4KF9 A;  1TOF A;  2G2Q A;  3UEM A;  3DEX A;  2FCH A;  3CYN A;  5ABR A;  2FA4 A;  2P31 A;  2ZNM A;  2LJK A;  2FA8 A;  1FW1 A;  5AIV A;  1VF2 A;  1VRS D;  1Z9H A;  5IQY A;  4WBJ A;  4USS A;  3ZL5 A;  4FH8 A;  4EO3 A;  2YV9 A;  4LL4 B;  2XBI A;  1GSY A;  6GSY A;  2HFD A;  4K6X A;  1T4Z A;  2P5Q A;  4MMM A;  2PWJ A;  4ECI A;  4HUA A;  3TJB A;  5CNW A;  4OWY A;  2MZC A;  4ULX A;  3JCM L;  4AJ7 A;  3FKF A;  3UL3 A;  1SJ6 A;  5DDL A;  4GCI A;  4YAV A;  2OA7 A;  4MF7 A;  2VL2 A;  2MBS A;  2H0G A;  4XIH A;  1TI1 A;  1V57 A;  2R4V A;  2M80 A;  3N5O A;  4JE1 A;  1AQW A;  5KN3 A;  1MD3 A;  3BCI A;  3A2X A;  5H5S A;  4G0K A;  3EE2 A;  3C7M A;  2IFQ A;  1SKW B;  1UVZ A;  5D9T A;  3VWU A;  3F0I A;  4AJ6 A;  4MJB A;  4PGT A;  2MMN A;  1Q4J A;  1V58 A;  2LJR A;  3QOU A;  4DEJ A;  2P0G A;  1AAZ A;  2KP2 A;  1WMJ A;  2VL3 A;  4NWY A;  3ERW A;  1YEX A;  2HZE B;  2X64 A;  6GST A;  3M8N A;  2LQO A;  3EC3 A;  5J41 A;  4KB3 A;  5IMF A;  2LNS A;  5DJM A;  3DRN A;  1WIK A;  1YJ6 A;  1JZD A;  3HD5 A;  1OYJ A;  2X99 A;  2FWF A;  4JZQ A;  2VO4 A;  3D0Z A;  3TJJ A;  4XS4 A;  4EE0 A;  2HYX A;  1TK0 B;  1ERW A;  3ZMK A;  1Z5Y E;  4KA0 A;  1EOG A;  3ZYW A;  5IOW A;  3QCP A;  1LU4 A;  1PL2 A;  3IK9 A;  5J9B A;  2LTK A;  4IS0 A;  4K0N A;  3HHV A;  4EDY A;  2L5L A;  2O7K A;  4E8H A;  1WJK A;  2YNX A;  1BQ7 A;  4YQM A;  4BL7 B;  4EDZ A;  3LYP A;  3IC8 A;  2G0F A;  2JZT A;  2V1M A;  4HZ2 A;  3TKS E;  1VF1 A;  5AGY A;  3M9J A;  5J3R A;  3DWV A;  2H0I A;  5IIZ A;  2HSY A;  4F9Z A;  1JHB A;  4WKW A;  1GRX A;  3M1G A;  2VCQ A;  3ZIJ A;  4V2M A;  1O8X A;  5ECI B;  2GSR A;  1BED A;  1GLQ A;  3P8W A;  5ELG A;  1FAA A;  7GSS A;  3IAM 2;  2DC5 A;  3O3T A;  1EEM A;  5DAL A;  3GH6 A;  4DSS B;  3OR5 A;  2GT6 A;  1E2Y A;  1AQV A;  3UOM A;  4BWS A;  1ACV A;  2GGT A;  2H72 A;  2MMZ A;  1Z6N A;  1F3A A;  4TR1 A;  4HOJ A;  1GSF A;  4P3Y B;  1JFU A;  1N8J A;  2N5F A;  3ZIV A;  1JZR A;  1ERU A;  3FHK A;  5B8A A;  2B1L A;  1ZOF A;  4YQV A;  5ELA A;  2H8L A;  2B1K A;  4V2N A;  2X8C A;  2XPD A;  5AIS A;  2CA8 A;  2LUS A;  2PU9 C;  3WGD A;  4XHM A;  2H1A A;  4TN8 A;  2V2G A;  2MMA A;  4NXI A;  2YWM A;  5KEJ A;  14GS A;  5GST A;  4TR0 A;  4POM A;  2AV4 A;  2L6C A;  3DKS A;  22GS A;  5A4U A;  3IOS A;  1VF3 A;  1ST9 A;  5HFK A;  1A2J A;  2VLV A;  3UMA A;  3KP9 A;  1G0T A;  1RK4 A;  3GTU B;  1KTE A;  2H66 A;  3ZIT A;  2R3X A;  1K0A A;  2ALB A;  9GSS A;  4K0G A;  4FO5 A;  2DML A;  1QQ2 A;  5LCZ A;  2AJQ B;  1T1V A;  1B9Y C;  4V2L A;  4TR3 A;  4F0B A;  4MJA A;  4MDC A;  2REM A;  3E9J B;  3L9U A;  4JBB A;  1M9A A;  2DMM A;  3D5J A;  3DVW A;  5CRG A;  5H5Q A;  3A2W A;  1YQ1 A;  4Q5N A;  4ISD A;  1OE7 A;  2LV3 A;  4PXO A;  4MJC A;  3G7J A;  3VK9 A;  1C72 A;  3IV4 A;  4MPG A;  4BVY B;  4IP1 A;  4POB A;  1SK2 A;  4IBP A;  3DD3 A;  3EWL A;  1J9B A;  2VD0 A;  1UC7 A;  5CRE A;  1KBN A;  3RBT A;  4QL9 A;  5D93 A;  3RHC A;  5ECO B;  1YKA A;  4K1F A;  1XWG A;  1BYE A;  5IMC A;  2R6K A;  5F07 A;  1TRU A;  2CX3 A;  3K8N A;  4KCE A;  2MBT A;  2GTU A;  2JAD A;  4PNF A;  2QC7 A;  4K9Z A;  4POK A;  2YJ7 A;  4BVX A;  4X0X A;  2VM2 A;  4TR4 A;  5DQS A;  4IVF A;  1YEP A;  4HU7 A;  1GTB A;  3GKM A;  2HRA A;  2L4C A;  3Q18 A;  1T4Y A;  4PQI A;  2YWI A;  1WWJ A;  3LOR A;  2AUV A;  3HVV A;  3H8Q A;  1KNG A;  2IN3 A;  1ERV A;  3IRA A;  4XTS A;  1JZO A;  3KXO A;  5ID2 B;  5GAN D;  1R4W A;  3S9F A;  3MSZ A;  3RDW A;  3I43 A;  2H01 A;  1X5C A;  3TB2 A;  4I5Q A;  2XBQ A;  3TOU A;  1ML6 A;  3ZFL A;  5HR0 A;  3WT2 A;  4JR6 A;  4HQS A;  5FWG A;  3P7X A;  3D6I A;  5FT3 A;  2BMX A;  2H1D A;  4RQR A;  4PUF C;  2MYG A;  4LA1 A;  3VFI A;  3FZ4 A;  4OFT A;  2DIY A;  1M2D A;  5HFI A;  2IMK A;  5A5K A;  1EOH A;  5COH A;  4YH2 A;  4XS1 A;  4OO5 A;  1LJR A;  3NOF A;  3IPZ A;  1BJX A;  3MDK A;  5IMD A;  2VCZ A;  5CYY A;  1JZW A;  2CVB A;  3UBL A;  2V6O A;  1MDJ A;  2GS3 A;  2WB9 A;  4GWR A;  4WF4 A;  1SJI A;  2WFC A; 
#chains in the Genus database with same CATH topology
 5DCH A;  1M2A A;  4RQX A;  4TXO B;  2CT6 A;  3VI5 A;  4FYB A;  3EIN A;  4K2X A;  1A0R P;  1GUK A;  5BMU B;  2WJU A;  2GZP A;  2E7P A;  3F9U A;  2VM1 A;  3J7Y k;  2YAN A;  4MK3 A;  4I6X A;  3VWW A;  1TKD B;  5G1L A;  1GSE A;  4WET A;  4CHS A;  3LGC A;  4TW5 A;  4DSQ A;  2H73 A;  5GSS A;  2E2G A;  2PPT A;  2KOK A;  1N25 A;  3IR4 A;  2B7J A;  4XRD A;  5D8I A;  5JCU A;  3KP8 A;  4GRF A;  3GL3 A;  3R2Q A;  3GYK A;  1UN2 A;  4KDY A;  3KH7 A;  5IPG A;  4WXT A;  1TRS A;  2IWT A;  3EU4 A;  2IMD A;  3PH9 A;  2PN8 A;  4K7O A;  4HJM A;  3D4T A;  3GX8 A;  3MNG A;  2H71 A;  4O7H A;  5A1N B;  5J9C A;  2YP6 A;  4Q5R A;  6GSS A;  2EC4 A;  12GS A;  5G5E A;  1XFL A;  5D96 A;  5LD0 A;  2EIR A;  1K0B A;  2YJH A;  1X5E A;  4KE3 A;  4JRR A;  5J5N A;  4ZXG A;  1XW5 A;  2DKH A;  3PPU A;  1M99 A;  3C1R A;  1Z7P A;  1X9W B;  2JZS A;  3KTB A;  2I81 A;  1G6W A;  2O8V B;  5IMZ A;  1ZYN A;  2C8U A;  5J40 A;  2C0F A;  3GHA A;  5G30 A;  1TXU A;  1X9S B;  1R5A A;  3C1S A;  5HR1 A;  4PUA A;  2HI7 A;  3W8S A;  4KGI A;  4ZBD A;  2HE3 A;  5B6N A;  1FB0 A;  2H0H A;  5CRH A;  3I6A A;  3TDG A;  2CX4 A;  2NPB A;  1V9W A;  2LS5 A;  5IOX A;  4KSM A;  3ISO A;  1SL1 B;  5A34 B;  2LQQ A;  1M2B A;  4V1A p;  2B5X A;  5IPH A;  3KH9 A;  4F03 A;  5KN2 A;  4XRA A;  1CQG A;  3HYP A;  4GXZ A;  4GST A;  2GLR A;  1H4O A;  2OKA A;  2GQK A;  3VLN A;  2FUG 2;  1U87 A;  4AKX B;  3UVT A;  4TKY A;  5KN1 A;  3RPN A;  1K3O A;  3FR6 A;  4E8E A;  2H6Z A;  4KW6 A;  4MH3 A;  1A2M A;  5ECN B;  1TK5 B;  2A4H A;  3UBK A;  4FQU A;  2H1B A;  1U88 A;  2PVQ A;  1A23 A;  2I3Y A;  3FZA A;  3O6T A;  1F37 A;  4MAB A;  1K0D A;  3LSZ A;  4QMK A;  2DBC A;  4BL7 A;  2CZ2 A;  4PQH A;  2KP1 A;  2VCT A;  4HU9 A;  1K0N A;  2O5V A;  3QFA C;  2IMI A;  2LEG A;  4ID0 A;  1XIY A;  2C4J A;  2CAQ A;  3HJO A;  3DVX A;  2FHE A;  1SVM A;  1Z6M A;  2AYT A;  4FYC A;  2PGT A;  3HXS A;  2HSM B;  2PUK C;  3FRC A;  1YDK A;  1THX A;  1EP8 A;  1M3J A;  2A2R A;  3LWA A;  1R26 A;  4Z2U A;  3J7Y b;  5ECM B;  3M0F A;  1AUC A;  1O81 A;  1HNA A;  2H19 A;  3BJ5 A;  3F3Q A;  1ILO A;  4Q5F A;  4GSN A;  2VCW A;  4ECC A;  2EFE A;  3CMI A;  2L4Q A;  2QA1 A;  4N0Z A;  4PUR A;  4LL1 B;  3VPT A;  4DSS A;  4LMW A;  1ZZY A;  2M46 A;  4OCF A;  5E59 A;  3CQF A;  4IKH A;  1GTU A;  2NVL A;  2GZY A;  1GUM A;  3TJG A;  2UZ8 A;  1TRW A;  3BCK A;  3I69 A;  1AIU A;  1SJZ A;  3O76 A;  1EV9 A;  2J9H A;  3HKR A;  3HY2 A;  2FGX A;  1PX6 A;  3QFB C;  3IA1 A;  3EMP A;  4G19 A;  1FVK A;  4J56 E;  1K3L A;  4O92 A;  1BG5 A;  2R0P A;  3HDC A;  5C04 A;  1WP0 A;  2N5A A;  4KH7 A;  3TGZ A;  1SD9 A;  4ZL9 A;  3RAZ A;  3TRQ A;  1HD2 A;  2R2J A;  1HNB A;  2L57 A;  3QAW A;  4KSO A;  4NAX A;  1EGO A;  5A5H B;  2WVZ A;  3LFL A;  3E0U A;  3GTU A;  3GV1 A;  2YZU A;  8GSS A;  2ON5 A;  1AQX A;  4MZC A;  1GNW A;  4MP4 A;  1FOH A;  4L5L A;  2NTO A;  4HS1 A;  3L4N A;  2IMF A;  3BOA A;  2JSY A;  2IJY A;  3TJF A;  4O5Q A;  3C71 A;  3L9V A;  4K5S A;  1V98 A;  4EF0 A;  3WGX A;  5F0G A;  2F9S A;  4L0W A;  1GP1 A;  4I2U A;  3APO A;  1QK8 A;  1A2L A;  4D73 B;  1GH2 A;  3LEF A;  3US3 A;  1G7E A;  4G0I A;  1YF0 A;  2H6X A;  3KGK A;  2AHE A;  3EMX A;  2OAD A;  2C3Q A;  5EVO A;  16GS A;  5E4W A;  2CVD A;  2WZS A;  4BVY A;  2LRT A;  2GSS A;  1A0F A;  2YZH A;  1XPV A;  4MLY A;  3GKN A;  2NDO A;  2HRK A;  5C00 A;  4DSR A;  3EU3 A;  3WYW A;  3KCM A;  4GSS A;  2GST A;  3A5W A;  5HR3 A;  1THO A;  4JR4 A;  4AKH A;  1E6B A;  3ZRD A;  4I2T A;  2DJ2 A;  3TRX A;  3ERF A;  2GZZ A;  3FY7 A;  4ML6 A;  1USB A;  1WOU A;  3SWL A;  3ZVJ D;  1QXH A;  5JWR B;  1ZGN A;  2AAW A;  4N3Z A;  2B7K A;  5IMA A;  4E68 A;  5ECQ B;  3KM6 A;  3LW9 A;  5DAK B;  1T8E B;  1URM A;  2KHP A;  1MTC A;  2JSZ A;  4RUV A;  3G9B A;  3LYK A;  2RII A;  1I1I P;  4CDO A;  3RPP A;  6GSW A;  2H74 A;  4G9H A;  4O5R A;  1GTI A;  1OKT A;  11GS A;  2XC2 A;  3CXG A;  1M9B A;  4G10 A;  2E0Q A;  2PBJ A;  5ECP B;  5ID2 A;  18GS A;  4CY8 A;  4ZB8 A;  2HLS A;  3QDN A;  4FYU A;  2C3T A;  3KZQ A;  2OT3 A;  1GTA A;  1BAY A;  3PR8 A;  3CTG A;  1TU7 A;  1FG4 A;  2GQL A;  3FZ9 A;  1ZYQ B;  1JLV A;  3QD9 A;  3DML A;  1GSQ A;  4TR1 B;  1QMV A;  1K0M A;  1NHY A;  1GSU A;  2N5B A;  2VD1 A;  4RI6 A;  5F06 A;  3NIV A;  1M3I A;  1OC3 A;  1YY7 A;  4HQZ A;  3H4K A;  3UJ1 A;  4L8E A;  5KOX A;  2WS2 A;  2VCV A;  2V6K A;  1MD4 A;  2WW0 A;  4EL1 A;  4Z2R A;  3DGQ A;  5KOW A;  3ED3 A;  2YOI A;  2LNT A;  1XW9 A;  2B5Y A;  3VUR A;  1G6Y A;  1YF1 A;  2B3S A;  4JU5 A;  2E2M A;  1SKS B;  4K7N A;  2GT5 A;  3F8U A;  4IN0 A;  3IHQ A;  3AY8 A;  4NPB A;  1J0F A;  1ZYP A;  4ECB A;  2PMT A;  2RUE A;  4TXO A;  3TKR A;  5ECH B;  4G0L A;  4WR4 A;  3VPQ A;  1F9M A;  4H86 A;  3U5R E;  5BMU A;  1DBY A;  2B5E A;  3PGT A;  4J2F A;  3D4M A;  4EXJ A;  1MDK A;  2HZF A;  1K0C A;  3C73 A;  2F51 A;  6GSU A;  1M7T A;  2IPA A;  4EC0 A;  3FZ5 A;  4TRX A;  4K5R A;  1S4B P;  2CV4 A;  3H93 A;  1W4V A;  4OFN A;  4PX1 A;  4IJI A;  1XVQ A;  5JWO B;  1TDI A;  5KN0 A;  3WT1 A;  1PA3 A;  1V2A A;  2F8A A;  3HVN A;  4XS6 A;  3RHB A;  3ZRE A;  2DJ3 A;  2BJX A;  3ZZX A;  5A1N A;  5DQY A;  1SKR B;  4ZL8 A;  1FO5 A;  5DVB A;  3SBC A;  1O8W A;  20GS A;  3A2V A;  1EZK A;  1SL0 B;  4YQU A;  2QSI A;  5F05 A;  2RM5 A;  1OC9 A;  1NW2 A;  1JLW A;  1PN9 A;  1U6T A;  2TRC P;  1EWX A;  1SL2 B;  4WR5 A;  4Q5Q A;  2DJ0 A;  2TRX A;  4I97 A;  5DCG A;  6GSX A;  3TOT A;  4BIK A;  1DE2 A;  2V32 A;  2R37 A;  2A2S A;  5ENU A;  19GS A;  1TRV A;  1PN0 A;  2VCX A;  3D22 A;  3L78 A;  2WGR A;  3CRT A;  3CSH A;  4MZW A;  3TKS C;  10GS A;  4MZB A;  6GSV A;  1S3D A;  3LG6 A;  4IGJ A;  2H75 A;  4WF5 A;  5A34 A;  5F8B A;  5B7C A;  4HEA 2;  3ME7 A;  1B48 A;  1QFN A;  2GVP A;  3P2A A;  3VI7 A;  2WZ9 A;  3IHG A;  5CP1 A;  2X4A A;  3APS A;  4IHU A;  3FW2 A;  3UIW A;  2EIO A;  1YEW C;  3W8J A;  1A8L A;  1U3I A;  2I1U A;  1IYH A;  4ICY A;  5GAP D;  3FR9 A;  5D9X A;  1ZMA A;  4I8B A;  1B4P A;  1N2A A;  3ZTL A;  3CTF A;  1XZO A;  3HVX A;  3A5I A;  1CQH A;  5HQP A;  2A4V A;  5D73 A;  1GNE A;  4MJE A;  1RW1 A;  4CW9 A;  5B8B A;  2LST A;  4ZIL A;  5IMV A;  1TW9 A;  4EIQ A;  5ECS A;  3CBU A;  3LXT A;  2HSH A;  5ECL B;  1FVJ A;  2VLU A;  2HRF A;  4OO4 A;  4F0C A;  1O85 A;  2X8G A;  1EV4 A;  2HSM A;  2PVO C;  2O36 A;  3GFK A;  2OJL A;  2CVK A;  3UAR A;  2C1Y A;  2HZE A;  5LNK e;  5G1K A;  1K0O A;  3KTL A;  4GQC A;  1QGV A;  3GUS A;  1GUL A;  1LBK A;  1PKZ A;  1GUH A;  4F82 A;  2F3M A;  2HRN A;  2R0G A;  2OE0 A;  2FY6 A;  4ZBA A;  1SD8 A;  4HSC X;  3BD2 A;  1Z7R A;  2H6Y A;  2RUF A;  2YWO A;  5HFG A;  4KDU A;  3KMN A;  4FIW A;  3H1N A;  3Q6O A;  3N9J A;  1S3C A;  5CO3 A;  1DE1 A;  4AKI A;  5GZZ B;  3L9S A;  4X43 A;  4IQA A;  1X0R A;  3GSS A;  2GQM A;  5ECR B;  2LKU A;  2C0D A;  4EVM A;  1R5P A;  1OKD A;  2YCD A;  1SK0 A;  3KMO A;  5DBQ A;  3GMF A;  2WVX B;  2P5R A;  2IIY A;  3KJY A;  2C0E A;  3IDV A;  2HNL A;  3GKX A;  4WEY A;  4X1U A;  4L5O A;  1WPI A;  3A3T A;  3TKQ A;  3H79 A;  3WGE A;  2WVY A;  5A5H A;  3GUR A;  1TI3 A;  1O73 A;  3TCO A;  2WCI A;  4TVE A;  4O5U A;  5IM9 A;  1FOV A;  5JCG A;  4MF6 A;  1VF4 A;  5B6M A;  1KEB A;  5IO2 A;  3F4T A;  2VOC A;  5HR2 A;  2I4A A;  2MMO A;  2O85 A;  2EFH A;  2WRT A;  4J57 E;  4JED A;  3HMJ G;  4X4J A;  2Z9S A;  3QR6 A;  3MWH A;  4D73 A;  1GWC A;  4ML1 A;  1ERT A;  3GX0 A;  5CAX A;  3R3E A;  1SU9 A;  3Q19 A;  2KLX A;  4NV5 A;  2H30 A;  3CRU A;  4LLR A;  1O7U A;  5D9V A;  3F63 A;  4KUN A;  5J4V A;  1NSW A;  4HI7 A;  2OE1 A;  5G2Z A;  4XCS A;  3KIJ A;  2H76 A;  3IXR A;  4N10 A;  2OE3 A;  1XOB A;  2D2Z A;  2WW1 A;  2TIR A;  2EIQ A;  4MPF A;  3F4S A;  3GN3 A;  4N11 A;  4OFM A;  3GL5 A;  1T7P B;  2DSA A;  1I9D A;  2FWH A;  2K8V A;  1B9X C;  3KD0 A;  1YKC A;  1H75 A;  1M0U A;  2FLS A;  2DKI A;  4ZB9 A;  3DYR A;  2XHF A;  3ZML A;  5JCW A;  13GS A;  2IFQ B;  2R0C A;  1PSQ A;  5DAK A;  3ME8 A;  5INY A;  1HYU A;  1Y25 A;  5A4V A;  3ZFB A;  4IW9 A;  1OVN A;  3UVH A;  1XWC A;  3IAS 2;  4V1A g;  3IK7 A;  4GQF A;  3IE3 A;  2CAI A;  2BTO T;  1HNC A;  1TJD A;  4PI0 C;  2DJK A;  1AXD A;  1GSS A;  3I9V 2;  3GST A;  3VWV A;  3FEU A;  1BG1 A;  1S3A A;  2JZR A;  4OCE A;  4Z7X A;  1GL8 A;  1PGT A;  3CSI A;  3KEB A;  3PIN A;  3FK8 A;  1SYX A;  2K9F A;  4NMU A;  3QPM A;  3CWG A;  1BX9 A;  3P90 A;  4QL7 A;  2CZ3 A;  2VIM A;  1A24 A;  4L0U A;  4XS4 B;  1R7H A;  2OAC A;  1XVW A;  1F2E A;  1DUG A;  1HQO A;  4PI2 C;  1O6J A;  2LJA A;  2VUP A;  1F3B A;  3DXB A;  3F6D A;  4O32 A;  4NHW A;  3QAV A;  3F6F A;  4ZBB A;  2M72 A;  3LJR A;  4KAE A;  2WDU A;  1XOA A;  2EFD A;  2VL2 C;  5G5F A;  2HT9 A;  2O87 A;  3D21 A;  2DJ1 A;  1Y6E A;  2OBK A;  1B4Q A;  2V41 A;  4MH2 A;  1X9M B;  4BPY A;  3MYD A;  1EGR A;  4KCA A;  3ZVJ A;  2NBS A;  3TKS A;  1PQN A;  2ZUP A;  3F4R A;  2DIZ A;  2K18 A;  1SK1 A;  2QKE A;  1WRY A;  3IC4 A;  3ZLP A;  3GNJ A;  1OAZ A;  4AJ8 A;  4ACS A;  4G01 A;  5EY6 A;  2F8F A;  3W6G A;  3EVI A;  4HDE A;  4GTU A;  4MCU A;  2L6D A;  3GIX A;  5DJL A;  1W89 A;  2H1L A;  1T3B A;  3TKP A;  1EP7 A;  1G7O A;  2KUC A;  2YWN A;  3C8E A;  4HZ4 A;  3WD6 A;  2WUL A;  2C3N A;  5DAL B;  1XBS A;  3DIE A;  5IO0 A;  2IL3 A;  2L59 A;  2CQ9 A;  2IME A;  1U3A A;  4ZB6 A;  1XG8 A;  4IEL A;  5H5R A;  5CRW A;  4GF0 A;  2YN1 A;  2J23 A;  4GLT A;  1TU8 A;  4N30 A;  4QQ7 A;  5AN1 A;  2ZCT A;  2HRK B;  2X8H A;  1V40 A;  2RLI A;  4MF5 A;  1OE8 A;  4PNG A;  4HJ2 A;  2C0G A;  3G7Y A;  2K8S A;  1XWB A;  3EUR A;  5L71 A;  2R5G A;  3GKK A;  2JU5 A;  3RGB C;  4IP6 A;  2I9H A;  1PKW A;  1GSD A;  1I5G A;  3CSJ A;  1AW9 A;  4N0V A;  4ILF A;  1WE0 A;  1ZYE A;  1PMT A;  4BWQ A;  3GA4 A;  1SYR A;  1FB6 A;  2O89 A;  3QAG A;  2XPE A;  2K6V A;  4NHZ A;  2ES7 A;  3EYT A;  1IYI A;  3G7I A;  3M3M A;  5A4W A;  4POL A;  1PL1 A;  1YZX A;  2DJJ A;  1QUW A;  2HSN B;  4TOP A;  3FR3 A;  4BA7 A;  3VWX A;  2VKZ G;  1TK8 B;  1J08 A;  3TJK A;  3UAP A;  2YV7 A;  4EUY A;  3IBH A;  4KDX A;  2X49 A;  4EKZ A;  5D9W A;  4PQ1 A;  4LMV A;  1PRX A;  1TXX A;  5JWQ B;  4ZL7 A;  3U6V A;  3ERG A;  1ABA A;  4DVC A;  3GRX A;  4OMV A;  1F6M C;  4ECJ A;  1XWK A;  4EIP A;  4ZB7 A;  1MDI A;  2HQT A;  3HVS A;  1XCC A;  3F3R A;  5CRD A;  3Q74 A;  1PD2 1;  3HJM A;  5J4Y A;  4K7I A;  4RI7 A;  1ON4 A;  1DSB A;  3LQ7 A;  4AGS A;  1T00 A;  2HXK A;  2QGV A;  1MEK A;  2L5O A;  1SVO A;  1RQM A;  3E3E A;  3RFR C;  2H70 A;  2ON7 A;  3NZN A;  2LRC A;  2RM6 A;  2VL9 A;  2AB6 A;  4BVX B;  1XXU A;  1GLP A;  2GDR A;  4MA9 A;  2GSQ A;  3EPT A;  4TXV A;  4YAP A;  1Z3E A;  2FD3 A;  1NHO A;  3V1W A;  3LXZ A;  4KND A;  1XWA A;  5FHI A;  2B6M A;  2C80 A;  1EEJ A;  1A8Y A;  2EFC A;  4IQ1 A;  2FNO A;  3APQ A;  1TTZ A;  4WBR D;  1NM3 A;  1PX7 A;  3M9K A;  4KX4 A;  5EPF A;  5G31 A;  2WVX A;  1Q98 A;  4AF2 A;  4IJ3 A;  4AKG A;  3GH9 A;  1UA5 A;  1XW6 A;  1SEN A;  3FYG A;  4ZIJ A;  4PTS A;  4F2I A;  4NV2 A;  2JAC A;  5J4U A;  4K2D A;  1VGL A;  17GS A;  2DLX A;  2YPM A;  1ZL9 A;  1B8X A;  1OC8 A;  3L0H A;  2FWG A;  1FHE A;  2OBI A;  5BRT A;  3TUE A;  3HA9 A;  1X5D A;  1K3Y A;  1OC9 B;  3HCZ A;  3HZ4 A;  5ECK B;  2H1G A;  3HJP A;  1TP9 A;  4K8M A;  4AI6 A;  3BBY A;  3TRP A;  2VLT A;  2FWE A;  4G2E A;  2PER A;  3HZ8 A;  1ZCP A;  3FMW A;  2LRN A;  2JL4 A;  5AIX A;  2VAF A;  3QMX A;  4OD7 A;  3MAK A;  1AC1 A;  5EL8 A;  4KF9 A;  1TOF A;  2G2Q A;  3UEM A;  3DEX A;  2FCH A;  3CYN A;  5ABR A;  4W66 A;  2FA4 A;  2P31 A;  2ZNM A;  2LJK A;  2FA8 A;  1FW1 A;  5AIV A;  1VF2 A;  1VRS D;  1Z9H A;  5IQY A;  4WBJ A;  4USS A;  3ZL5 A;  4FH8 A;  4EO3 A;  2YV9 A;  4LL4 B;  4MNN A;  2XBI A;  3MIX A;  1GSY A;  4GDF A;  6GSY A;  2HFD A;  4K6X A;  1T4Z A;  2P5Q A;  4MMM A;  2PWJ A;  4ECI A;  2QA2 A;  4HUA A;  3TJB A;  5CNW A;  4OWY A;  2MZC A;  4ULX A;  3JCM L;  4AJ7 A;  3FKF A;  3UL3 A;  1SJ6 A;  5DDL A;  4GCI A;  4YAV A;  2OA7 A;  4MF7 A;  2VL2 A;  2MBS A;  2H0G A;  4XIH A;  1TI1 A;  1V57 A;  2R4V A;  2M80 A;  3N5O A;  4JE1 A;  1AQW A;  5KN3 A;  1MD3 A;  3BCI A;  3A2X A;  5H5S A;  4G0K A;  3EE2 A;  3C7M A;  2IFQ A;  1SKW B;  1UVZ A;  5D9T A;  3VWU A;  3F0I A;  4AJ6 A;  4MJB A;  4PGT A;  2MMN A;  4PHZ C;  1Q4J A;  1V58 A;  2LJR A;  3QOU A;  4DEJ A;  2P0G A;  2WW2 A;  1AAZ A;  2KP2 A;  1WMJ A;  2VL3 A;  4NWY A;  3ERW A;  1YEX A;  2HZE B;  2X64 A;  6GST A;  3M8N A;  2LQO A;  3EC3 A;  5J41 A;  4KB3 A;  5IMF A;  2LNS A;  5DJM A;  3DRN A;  1WIK A;  1YJ6 A;  1JZD A;  3HD5 A;  1OYJ A;  2X99 A;  2FWF A;  4JZQ A;  2VO4 A;  3D0Z A;  3TJJ A;  4XS4 A;  4EE0 A;  2HYX A;  1TK0 B;  1ERW A;  3ZMK A;  1Z5Y E;  4KA0 A;  1EOG A;  3ZYW A;  4Z2T A;  5IOW A;  3QCP A;  1LU4 A;  1PL2 A;  3IK9 A;  4CY6 A;  5J9B A;  2LTK A;  4IS0 A;  4K0N A;  3HHV A;  4EDY A;  2L5L A;  2O7K A;  4E8H A;  1WJK A;  2YNX A;  1BQ7 A;  4YQM A;  4BL7 B;  4EDZ A;  3LYP A;  1BF5 A;  3IC8 A;  2G0F A;  2JZT A;  2V1M A;  5J47 A;  4HZ2 A;  3TKS E;  1VF1 A;  5AGY A;  3M9J A;  5J3R A;  3DWV A;  2H0I A;  5IIZ A;  2HSY A;  4F9Z A;  1JHB A;  4WKW A;  1GRX A;  3M1G A;  2VCQ A;  3ZIJ A;  4V2M A;  1O8X A;  5ECI B;  2GSR A;  1BED A;  1GLQ A;  3P8W A;  5ELG A;  1FAA A;  4FXY P;  7GSS A;  3IAM 2;  2DC5 A;  3O3T A;  4YKG A;  1EEM A;  5DAL A;  2O3E A;  3GH6 A;  4DSS B;  3OR5 A;  2GT6 A;  1E2Y A;  1AQV A;  3UOM A;  4BWS A;  1ACV A;  2GGT A;  2H72 A;  2MMZ A;  1Z6N A;  1F3A A;  4TR1 A;  1S3R A;  4HOJ A;  1GSF A;  4P3Y B;  2WW3 A;  1JFU A;  1N8J A;  2N5F A;  3ZIV A;  1JZR A;  3CHX C;  1ERU A;  3FHK A;  5B8A A;  2B1L A;  1ZOF A;  4YQV A;  5ELA A;  2H8L A;  2B1K A;  4V2N A;  2X8C A;  2XPD A;  5AIS A;  2CA8 A;  1PFO A;  2LUS A;  2PU9 C;  3WGD A;  4XHM A;  2H1A A;  4TN8 A;  2V2G A;  2MMA A;  4NXI A;  2YWM A;  5KEJ A;  14GS A;  5GST A;  4TR0 A;  4POM A;  2AV4 A;  2L6C A;  3DKS A;  22GS A;  5A4U A;  3IOS A;  1VF3 A;  1ST9 A;  5HFK A;  1A2J A;  2VLV A;  3UMA A;  3KP9 A;  1G0T A;  1RK4 A;  3GTU B;  1KTE A;  2H66 A;  3ZIT A;  2R3X A;  1K0A A;  2ALB A;  9GSS A;  4K0G A;  4FO5 A;  2DML A;  3TU3 B;  1QQ2 A;  5LCZ A;  2AJQ B;  1T1V A;  2HSN A;  1B9Y C;  4V2L A;  4TR3 A;  4F0B A;  4MJA A;  1Y1U A;  4MDC A;  2REM A;  3E9J B;  3L9U A;  4JBB A;  1M9A A;  2DMM A;  3D5J A;  3DVW A;  5CRG A;  5H5Q A;  3A2W A;  1YQ1 A;  4Q5N A;  2A2P A;  4ISD A;  1OE7 A;  2LV3 A;  4PXO A;  4MJC A;  4A5P A;  3G7J A;  2UV8 G;  3VK9 A;  1C72 A;  3IV4 A;  4MPG A;  4BVY B;  4IP1 A;  4POB A;  1SK2 A;  4IBP A;  3DD3 A;  3EWL A;  1J9B A;  2VD0 A;  1UC7 A;  5CRE A;  1KBN A;  3RBT A;  4QL9 A;  5D93 A;  3RHC A;  5ECO B;  1YKA A;  4K1F A;  1YVL A;  1XWG A;  1BYE A;  5IMC A;  2R6K A;  5F07 A;  1TRU A;  2CX3 A;  3K8N A;  4KCE A;  2MBT A;  2GTU A;  2JAD A;  4PNF A;  2QC7 A;  4K9Z A;  4POK A;  2YJ7 A;  4BVX A;  4X0X A;  2VM2 A;  4TR4 A;  5DQS A;  4IVF A;  1YEP A;  4HU7 A;  1GTB A;  3GKM A;  2HRA A;  2L4C A;  3Q18 A;  1T4Y A;  4PQI A;  2YWI A;  1WWJ A;  3LOR A;  2AUV A;  3HVV A;  3H8Q A;  1KNG A;  2IN3 A;  1ERV A;  3IRA A;  4XTS A;  1JZO A;  3KXO A;  5ID2 B;  5GAN D;  1R4W A;  3S9F A;  3MSZ A;  3RDW A;  3I43 A;  2H01 A;  1X5C A;  3TB2 A;  4I5Q A;  2XBQ A;  3TOU A;  1ML6 A;  3ZFL A;  5HR0 A;  3WT2 A;  4JR6 A;  4HQS A;  5FWG A;  3P7X A;  3D6I A;  5FT3 A;  2BMX A;  2H1D A;  4RQR A;  4PUF C;  2MYG A;  4LA1 A;  3VFI A;  3FZ4 A;  4OFT A;  2DIY A;  1M2D A;  5HFI A;  2IMK A;  5A5K A;  1EOH A;  1SVL A;  5COH A;  4YH2 A;  4XS1 A;  4OO5 A;  1LJR A;  3NOF A;  3IPZ A;  1BJX A;  3MDK A;  5IMD A;  2VCZ A;  5CYY A;  1JZW A;  2CVB A;  3UBL A;  2V6O A;  1MDJ A;  2GS3 A;  2WB9 A;  4GWR A;  4YKF A;  4WF4 A;  1SJI A;  2WFC A; 
#chains in the Genus database with same CATH homology
 5DCH A;  1M2A A;  4RQX A;  4TXO B;  2CT6 A;  3VI5 A;  4FYB A;  3EIN A;  4K2X A;  1A0R P;  1GUK A;  5BMU B;  2WJU A;  2GZP A;  2E7P A;  3F9U A;  2VM1 A;  3J7Y k;  2YAN A;  4MK3 A;  4I6X A;  3VWW A;  1TKD B;  5G1L A;  1GSE A;  4WET A;  4CHS A;  3LGC A;  4TW5 A;  4DSQ A;  2H73 A;  5GSS A;  2E2G A;  2PPT A;  2KOK A;  1N25 A;  3IR4 A;  2B7J A;  4XRD A;  5D8I A;  5JCU A;  3KP8 A;  4GRF A;  3GL3 A;  3R2Q A;  3GYK A;  1UN2 A;  4KDY A;  3KH7 A;  5IPG A;  4WXT A;  1TRS A;  2IWT A;  3EU4 A;  2IMD A;  3PH9 A;  2PN8 A;  4K7O A;  4HJM A;  3D4T A;  3GX8 A;  3MNG A;  2H71 A;  4O7H A;  5A1N B;  5J9C A;  2YP6 A;  4Q5R A;  6GSS A;  2EC4 A;  12GS A;  5G5E A;  1XFL A;  5D96 A;  5LD0 A;  2EIR A;  1K0B A;  2YJH A;  1X5E A;  4KE3 A;  4JRR A;  5J5N A;  4ZXG A;  1XW5 A;  2DKH A;  3PPU A;  1M99 A;  3C1R A;  1Z7P A;  1X9W B;  2JZS A;  3KTB A;  2I81 A;  1G6W A;  2O8V B;  5IMZ A;  1ZYN A;  2C8U A;  5J40 A;  2C0F A;  3GHA A;  5G30 A;  1TXU A;  1X9S B;  1R5A A;  3C1S A;  5HR1 A;  4PUA A;  2HI7 A;  3W8S A;  4KGI A;  4ZBD A;  2HE3 A;  5B6N A;  1FB0 A;  2H0H A;  5CRH A;  3I6A A;  3TDG A;  2CX4 A;  2NPB A;  1V9W A;  2LS5 A;  5IOX A;  4KSM A;  3ISO A;  1SL1 B;  5A34 B;  2LQQ A;  1M2B A;  4V1A p;  2B5X A;  5IPH A;  3KH9 A;  4F03 A;  5KN2 A;  4XRA A;  1CQG A;  3HYP A;  4GXZ A;  4GST A;  2GLR A;  1H4O A;  2OKA A;  2GQK A;  3VLN A;  2FUG 2;  1U87 A;  4AKX B;  3UVT A;  4TKY A;  5KN1 A;  3RPN A;  1K3O A;  3FR6 A;  4E8E A;  2H6Z A;  4KW6 A;  4MH3 A;  1A2M A;  5ECN B;  1TK5 B;  2A4H A;  3UBK A;  4FQU A;  2H1B A;  1U88 A;  2PVQ A;  1A23 A;  2I3Y A;  3FZA A;  3O6T A;  1F37 A;  4MAB A;  1K0D A;  3LSZ A;  4QMK A;  2DBC A;  4BL7 A;  2CZ2 A;  4PQH A;  2KP1 A;  2VCT A;  4HU9 A;  1K0N A;  2O5V A;  3QFA C;  2IMI A;  2LEG A;  4ID0 A;  1XIY A;  2C4J A;  2CAQ A;  3HJO A;  3DVX A;  2FHE A;  1SVM A;  1Z6M A;  2AYT A;  4FYC A;  2PGT A;  3HXS A;  2HSM B;  2PUK C;  3FRC A;  1YDK A;  1THX A;  1EP8 A;  2A2R A;  3LWA A;  1R26 A;  4Z2U A;  3J7Y b;  5ECM B;  3M0F A;  1AUC A;  1O81 A;  1HNA A;  2H19 A;  3BJ5 A;  3F3Q A;  1ILO A;  4Q5F A;  4GSN A;  2VCW A;  4ECC A;  2EFE A;  3CMI A;  2L4Q A;  2QA1 A;  4N0Z A;  4PUR A;  4LL1 B;  3VPT A;  4DSS A;  4LMW A;  1ZZY A;  2M46 A;  4OCF A;  5E59 A;  4IKH A;  1GTU A;  2NVL A;  2GZY A;  1GUM A;  3TJG A;  2UZ8 A;  1TRW A;  3BCK A;  3I69 A;  1AIU A;  1SJZ A;  3O76 A;  1EV9 A;  2J9H A;  3HKR A;  3HY2 A;  2FGX A;  1PX6 A;  3QFB C;  3IA1 A;  3EMP A;  4G19 A;  1FVK A;  4J56 E;  1K3L A;  4O92 A;  1BG5 A;  2R0P A;  3HDC A;  5C04 A;  1WP0 A;  2N5A A;  4KH7 A;  3TGZ A;  1SD9 A;  4ZL9 A;  3RAZ A;  3TRQ A;  1HD2 A;  2R2J A;  1HNB A;  2L57 A;  3QAW A;  4KSO A;  4NAX A;  1EGO A;  5A5H B;  3LFL A;  3E0U A;  3GTU A;  3GV1 A;  2YZU A;  8GSS A;  2ON5 A;  1AQX A;  4MZC A;  1GNW A;  4MP4 A;  1FOH A;  4L5L A;  2NTO A;  4HS1 A;  3L4N A;  2IMF A;  3BOA A;  2JSY A;  2IJY A;  3TJF A;  4O5Q A;  3C71 A;  3L9V A;  4K5S A;  1V98 A;  4EF0 A;  3WGX A;  5F0G A;  2F9S A;  4L0W A;  1GP1 A;  4I2U A;  3APO A;  1QK8 A;  1A2L A;  4D73 B;  1GH2 A;  3LEF A;  3US3 A;  1G7E A;  4G0I A;  1YF0 A;  2H6X A;  3KGK A;  2AHE A;  3EMX A;  2OAD A;  2C3Q A;  5EVO A;  16GS A;  5E4W A;  2CVD A;  4BVY A;  2LRT A;  2GSS A;  1A0F A;  2YZH A;  1XPV A;  4MLY A;  3GKN A;  2NDO A;  2HRK A;  5C00 A;  4DSR A;  3EU3 A;  3WYW A;  3KCM A;  4GSS A;  2GST A;  3A5W A;  5HR3 A;  1THO A;  4JR4 A;  4AKH A;  1E6B A;  3ZRD A;  4I2T A;  2DJ2 A;  3TRX A;  3ERF A;  2GZZ A;  3FY7 A;  4ML6 A;  1USB A;  1WOU A;  3SWL A;  3ZVJ D;  1QXH A;  5JWR B;  1ZGN A;  2AAW A;  4N3Z A;  2B7K A;  5IMA A;  4E68 A;  5ECQ B;  3KM6 A;  3LW9 A;  5DAK B;  1T8E B;  1URM A;  2KHP A;  1MTC A;  2JSZ A;  4RUV A;  3G9B A;  3LYK A;  2RII A;  4CDO A;  3RPP A;  6GSW A;  2H74 A;  4G9H A;  4O5R A;  1GTI A;  1OKT A;  11GS A;  2XC2 A;  3CXG A;  1M9B A;  4G10 A;  2E0Q A;  2PBJ A;  5ECP B;  5ID2 A;  18GS A;  4CY8 A;  4ZB8 A;  2HLS A;  3QDN A;  4FYU A;  2C3T A;  3KZQ A;  2OT3 A;  1GTA A;  1BAY A;  3PR8 A;  3CTG A;  1TU7 A;  1FG4 A;  2GQL A;  3FZ9 A;  1ZYQ B;  1JLV A;  3QD9 A;  3DML A;  1GSQ A;  4TR1 B;  1QMV A;  1K0M A;  1NHY A;  1GSU A;  2N5B A;  2VD1 A;  4RI6 A;  5F06 A;  3NIV A;  1OC3 A;  1YY7 A;  4HQZ A;  3H4K A;  3UJ1 A;  4L8E A;  5KOX A;  2WS2 A;  2VCV A;  2V6K A;  1MD4 A;  4EL1 A;  4Z2R A;  3DGQ A;  5KOW A;  3ED3 A;  2YOI A;  2LNT A;  1XW9 A;  2B5Y A;  3VUR A;  1G6Y A;  1YF1 A;  2B3S A;  4JU5 A;  2E2M A;  1SKS B;  4K7N A;  2GT5 A;  3F8U A;  4IN0 A;  3IHQ A;  3AY8 A;  4NPB A;  1J0F A;  1ZYP A;  4ECB A;  2PMT A;  2RUE A;  4TXO A;  3TKR A;  5ECH B;  4G0L A;  4WR4 A;  3VPQ A;  1F9M A;  4H86 A;  3U5R E;  5BMU A;  1DBY A;  2B5E A;  3PGT A;  4J2F A;  3D4M A;  4EXJ A;  1MDK A;  2HZF A;  1K0C A;  3C73 A;  2F51 A;  6GSU A;  1M7T A;  2IPA A;  4EC0 A;  3FZ5 A;  4TRX A;  4K5R A;  2CV4 A;  3H93 A;  1W4V A;  4OFN A;  4PX1 A;  4IJI A;  1XVQ A;  5JWO B;  1TDI A;  5KN0 A;  3WT1 A;  1PA3 A;  1V2A A;  2F8A A;  4XS6 A;  3RHB A;  3ZRE A;  2DJ3 A;  2BJX A;  3ZZX A;  5A1N A;  5DQY A;  1SKR B;  4ZL8 A;  1FO5 A;  5DVB A;  3SBC A;  1O8W A;  20GS A;  3A2V A;  1EZK A;  1SL0 B;  4YQU A;  2QSI A;  5F05 A;  2RM5 A;  1OC9 A;  1NW2 A;  1JLW A;  1PN9 A;  1U6T A;  2TRC P;  1EWX A;  1SL2 B;  4WR5 A;  4Q5Q A;  2DJ0 A;  2TRX A;  4I97 A;  5DCG A;  6GSX A;  3TOT A;  1DE2 A;  2V32 A;  2R37 A;  2A2S A;  5ENU A;  19GS A;  1TRV A;  1PN0 A;  2VCX A;  3D22 A;  3L78 A;  2WGR A;  3CRT A;  3CSH A;  4MZW A;  3TKS C;  10GS A;  4MZB A;  6GSV A;  1S3D A;  3LG6 A;  4IGJ A;  2H75 A;  4WF5 A;  5A34 A;  5F8B A;  5B7C A;  4HEA 2;  3ME7 A;  1B48 A;  1QFN A;  2GVP A;  3P2A A;  3VI7 A;  2WZ9 A;  3IHG A;  5CP1 A;  2X4A A;  3APS A;  4IHU A;  3FW2 A;  3UIW A;  2EIO A;  3W8J A;  1A8L A;  1U3I A;  2I1U A;  1IYH A;  4ICY A;  5GAP D;  3FR9 A;  5D9X A;  1ZMA A;  4I8B A;  1B4P A;  1N2A A;  3ZTL A;  3CTF A;  1XZO A;  3HVX A;  3A5I A;  1CQH A;  5HQP A;  2A4V A;  5D73 A;  1GNE A;  4MJE A;  1RW1 A;  4CW9 A;  5B8B A;  2LST A;  4ZIL A;  5IMV A;  1TW9 A;  4EIQ A;  5ECS A;  3CBU A;  3LXT A;  2HSH A;  5ECL B;  1FVJ A;  2VLU A;  2HRF A;  4OO4 A;  4F0C A;  1O85 A;  2X8G A;  1EV4 A;  2HSM A;  2PVO C;  3GFK A;  2OJL A;  2CVK A;  3UAR A;  2C1Y A;  2HZE A;  5LNK e;  5G1K A;  1K0O A;  3KTL A;  4GQC A;  1QGV A;  3GUS A;  1GUL A;  1LBK A;  1PKZ A;  1GUH A;  4F82 A;  2F3M A;  2HRN A;  2R0G A;  2OE0 A;  2FY6 A;  4ZBA A;  1SD8 A;  3BD2 A;  1Z7R A;  2H6Y A;  2RUF A;  2YWO A;  5HFG A;  4KDU A;  3KMN A;  4FIW A;  3H1N A;  3Q6O A;  3N9J A;  1S3C A;  5CO3 A;  1DE1 A;  4AKI A;  5GZZ B;  3L9S A;  4X43 A;  4IQA A;  1X0R A;  3GSS A;  2GQM A;  5ECR B;  2LKU A;  2C0D A;  4EVM A;  1R5P A;  1OKD A;  2YCD A;  1SK0 A;  3KMO A;  5DBQ A;  3GMF A;  2P5R A;  2IIY A;  3KJY A;  2C0E A;  3IDV A;  2HNL A;  3GKX A;  4WEY A;  4X1U A;  4L5O A;  1WPI A;  3A3T A;  3TKQ A;  3H79 A;  3WGE A;  5A5H A;  3GUR A;  1TI3 A;  1O73 A;  3TCO A;  2WCI A;  4TVE A;  4O5U A;  5IM9 A;  1FOV A;  5JCG A;  4MF6 A;  1VF4 A;  5B6M A;  1KEB A;  5IO2 A;  3F4T A;  2VOC A;  5HR2 A;  2I4A A;  2MMO A;  2O85 A;  2EFH A;  2WRT A;  4J57 E;  4JED A;  3HMJ G;  4X4J A;  2Z9S A;  3QR6 A;  3MWH A;  4D73 A;  1GWC A;  4ML1 A;  1ERT A;  3GX0 A;  5CAX A;  3R3E A;  1SU9 A;  3Q19 A;  2KLX A;  4NV5 A;  2H30 A;  3CRU A;  4LLR A;  1O7U A;  5D9V A;  3F63 A;  4KUN A;  5J4V A;  1NSW A;  4HI7 A;  2OE1 A;  5G2Z A;  4XCS A;  3KIJ A;  2H76 A;  3IXR A;  4N10 A;  2OE3 A;  1XOB A;  2D2Z A;  2TIR A;  2EIQ A;  4MPF A;  3F4S A;  3GN3 A;  4N11 A;  4OFM A;  3GL5 A;  1T7P B;  2DSA A;  1I9D A;  2FWH A;  2K8V A;  1B9X C;  3KD0 A;  1YKC A;  1H75 A;  1M0U A;  2FLS A;  2DKI A;  4ZB9 A;  3DYR A;  2XHF A;  3ZML A;  5JCW A;  13GS A;  2IFQ B;  2R0C A;  1PSQ A;  5DAK A;  3ME8 A;  5INY A;  1HYU A;  1Y25 A;  5A4V A;  3ZFB A;  4IW9 A;  1OVN A;  3UVH A;  1XWC A;  3IAS 2;  4V1A g;  3IK7 A;  4GQF A;  3IE3 A;  2CAI A;  2BTO T;  1HNC A;  1TJD A;  2DJK A;  1AXD A;  1GSS A;  3I9V 2;  3GST A;  3VWV A;  3FEU A;  1BG1 A;  1S3A A;  2JZR A;  4OCE A;  4Z7X A;  1GL8 A;  1PGT A;  3CSI A;  3KEB A;  3PIN A;  3FK8 A;  1SYX A;  2K9F A;  4NMU A;  3QPM A;  3CWG A;  1BX9 A;  3P90 A;  4QL7 A;  2CZ3 A;  2VIM A;  1A24 A;  4L0U A;  4XS4 B;  1R7H A;  2OAC A;  1XVW A;  1F2E A;  1DUG A;  1HQO A;  1O6J A;  2LJA A;  2VUP A;  1F3B A;  3DXB A;  3F6D A;  4O32 A;  4NHW A;  3QAV A;  3F6F A;  4ZBB A;  2M72 A;  3LJR A;  4KAE A;  2WDU A;  1XOA A;  2EFD A;  2VL2 C;  5G5F A;  2HT9 A;  2O87 A;  3D21 A;  2DJ1 A;  1Y6E A;  2OBK A;  1B4Q A;  2V41 A;  4MH2 A;  1X9M B;  4BPY A;  3MYD A;  1EGR A;  4KCA A;  3ZVJ A;  2NBS A;  3TKS A;  1PQN A;  2ZUP A;  3F4R A;  2DIZ A;  2K18 A;  1SK1 A;  2QKE A;  1WRY A;  3IC4 A;  3ZLP A;  3GNJ A;  1OAZ A;  4AJ8 A;  4ACS A;  4G01 A;  5EY6 A;  2F8F A;  3W6G A;  3EVI A;  4HDE A;  4GTU A;  4MCU A;  2L6D A;  3GIX A;  5DJL A;  1W89 A;  2H1L A;  1T3B A;  3TKP A;  1EP7 A;  1G7O A;  2KUC A;  2YWN A;  3C8E A;  4HZ4 A;  3WD6 A;  2WUL A;  2C3N A;  5DAL B;  1XBS A;  3DIE A;  5IO0 A;  2IL3 A;  2L59 A;  2CQ9 A;  2IME A;  1U3A A;  4ZB6 A;  4IEL A;  5H5R A;  5CRW A;  4GF0 A;  2YN1 A;  2J23 A;  4GLT A;  1TU8 A;  4N30 A;  4QQ7 A;  5AN1 A;  2ZCT A;  2HRK B;  2X8H A;  1V40 A;  2RLI A;  4MF5 A;  1OE8 A;  4PNG A;  4HJ2 A;  2C0G A;  3G7Y A;  2K8S A;  1XWB A;  3EUR A;  5L71 A;  2R5G A;  3GKK A;  2JU5 A;  4IP6 A;  2I9H A;  1PKW A;  1GSD A;  1I5G A;  3CSJ A;  1AW9 A;  4N0V A;  4ILF A;  1WE0 A;  1ZYE A;  1PMT A;  4BWQ A;  3GA4 A;  1SYR A;  1FB6 A;  2O89 A;  3QAG A;  2XPE A;  2K6V A;  4NHZ A;  2ES7 A;  3EYT A;  1IYI A;  3G7I A;  3M3M A;  5A4W A;  4POL A;  1PL1 A;  1YZX A;  2DJJ A;  1QUW A;  2HSN B;  4TOP A;  3FR3 A;  4BA7 A;  3VWX A;  2VKZ G;  1TK8 B;  1J08 A;  3TJK A;  3UAP A;  2YV7 A;  4EUY A;  3IBH A;  4KDX A;  2X49 A;  4EKZ A;  5D9W A;  4PQ1 A;  4LMV A;  1PRX A;  1TXX A;  5JWQ B;  4ZL7 A;  3U6V A;  3ERG A;  1ABA A;  4DVC A;  3GRX A;  4OMV A;  1F6M C;  4ECJ A;  1XWK A;  4EIP A;  4ZB7 A;  1MDI A;  2HQT A;  3HVS A;  1XCC A;  3F3R A;  5CRD A;  3Q74 A;  1PD2 1;  3HJM A;  5J4Y A;  4K7I A;  4RI7 A;  1ON4 A;  1DSB A;  3LQ7 A;  4AGS A;  1T00 A;  2HXK A;  2QGV A;  1MEK A;  2L5O A;  1SVO A;  1RQM A;  3E3E A;  2H70 A;  2ON7 A;  3NZN A;  2LRC A;  2RM6 A;  2VL9 A;  2AB6 A;  4BVX B;  1XXU A;  1GLP A;  2GDR A;  4MA9 A;  2GSQ A;  3EPT A;  4TXV A;  4YAP A;  1Z3E A;  2FD3 A;  1NHO A;  3V1W A;  3LXZ A;  4KND A;  1XWA A;  5FHI A;  2B6M A;  2C80 A;  1EEJ A;  1A8Y A;  2EFC A;  4IQ1 A;  2FNO A;  3APQ A;  1TTZ A;  4WBR D;  1NM3 A;  1PX7 A;  3M9K A;  4KX4 A;  5EPF A;  5G31 A;  1Q98 A;  4AF2 A;  4IJ3 A;  4AKG A;  3GH9 A;  1UA5 A;  1XW6 A;  1SEN A;  3FYG A;  4ZIJ A;  4PTS A;  4F2I A;  4NV2 A;  2JAC A;  5J4U A;  4K2D A;  1VGL A;  17GS A;  2DLX A;  2YPM A;  1ZL9 A;  1B8X A;  1OC8 A;  3L0H A;  2FWG A;  1FHE A;  2OBI A;  5BRT A;  3TUE A;  3HA9 A;  1X5D A;  1K3Y A;  1OC9 B;  3HCZ A;  3HZ4 A;  5ECK B;  2H1G A;  3HJP A;  1TP9 A;  4K8M A;  4AI6 A;  3BBY A;  3TRP A;  2VLT A;  2FWE A;  4G2E A;  2PER A;  3HZ8 A;  1ZCP A;  3FMW A;  2LRN A;  2JL4 A;  5AIX A;  2VAF A;  3QMX A;  4OD7 A;  3MAK A;  1AC1 A;  5EL8 A;  4KF9 A;  1TOF A;  2G2Q A;  3UEM A;  3DEX A;  2FCH A;  3CYN A;  5ABR A;  4W66 A;  2FA4 A;  2P31 A;  2ZNM A;  2LJK A;  2FA8 A;  1FW1 A;  5AIV A;  1VF2 A;  1VRS D;  1Z9H A;  5IQY A;  4WBJ A;  4USS A;  3ZL5 A;  4FH8 A;  4EO3 A;  2YV9 A;  4LL4 B;  4MNN A;  2XBI A;  3MIX A;  1GSY A;  4GDF A;  6GSY A;  2HFD A;  4K6X A;  1T4Z A;  2P5Q A;  4MMM A;  2PWJ A;  4ECI A;  2QA2 A;  4HUA A;  3TJB A;  5CNW A;  4OWY A;  2MZC A;  4ULX A;  3JCM L;  4AJ7 A;  3FKF A;  3UL3 A;  1SJ6 A;  5DDL A;  4GCI A;  4YAV A;  2OA7 A;  4MF7 A;  2VL2 A;  2MBS A;  2H0G A;  4XIH A;  1TI1 A;  1V57 A;  2R4V A;  2M80 A;  3N5O A;  4JE1 A;  1AQW A;  5KN3 A;  1MD3 A;  3BCI A;  3A2X A;  5H5S A;  4G0K A;  3EE2 A;  3C7M A;  2IFQ A;  1SKW B;  1UVZ A;  5D9T A;  3VWU A;  3F0I A;  4AJ6 A;  4MJB A;  4PGT A;  2MMN A;  1Q4J A;  1V58 A;  2LJR A;  3QOU A;  4DEJ A;  2P0G A;  1AAZ A;  2KP2 A;  1WMJ A;  2VL3 A;  4NWY A;  3ERW A;  1YEX A;  2HZE B;  2X64 A;  6GST A;  3M8N A;  2LQO A;  3EC3 A;  5J41 A;  4KB3 A;  5IMF A;  2LNS A;  5DJM A;  3DRN A;  1WIK A;  1YJ6 A;  1JZD A;  3HD5 A;  1OYJ A;  2X99 A;  2FWF A;  4JZQ A;  2VO4 A;  3D0Z A;  3TJJ A;  4XS4 A;  4EE0 A;  2HYX A;  1TK0 B;  1ERW A;  3ZMK A;  1Z5Y E;  4KA0 A;  1EOG A;  3ZYW A;  4Z2T A;  5IOW A;  3QCP A;  1LU4 A;  1PL2 A;  3IK9 A;  4CY6 A;  5J9B A;  2LTK A;  4IS0 A;  4K0N A;  3HHV A;  4EDY A;  2L5L A;  2O7K A;  4E8H A;  1WJK A;  2YNX A;  1BQ7 A;  4YQM A;  4BL7 B;  4EDZ A;  3LYP A;  1BF5 A;  3IC8 A;  2G0F A;  2JZT A;  2V1M A;  5J47 A;  4HZ2 A;  3TKS E;  1VF1 A;  5AGY A;  3M9J A;  5J3R A;  3DWV A;  2H0I A;  5IIZ A;  2HSY A;  4F9Z A;  1JHB A;  4WKW A;  1GRX A;  3M1G A;  2VCQ A;  3ZIJ A;  4V2M A;  1O8X A;  5ECI B;  2GSR A;  1BED A;  1GLQ A;  3P8W A;  5ELG A;  1FAA A;  7GSS A;  3IAM 2;  2DC5 A;  3O3T A;  4YKG A;  1EEM A;  5DAL A;  3GH6 A;  4DSS B;  3OR5 A;  2GT6 A;  1E2Y A;  1AQV A;  3UOM A;  4BWS A;  1ACV A;  2GGT A;  2H72 A;  2MMZ A;  1Z6N A;  1F3A A;  4TR1 A;  4HOJ A;  1GSF A;  4P3Y B;  1JFU A;  1N8J A;  2N5F A;  3ZIV A;  1JZR A;  1ERU A;  3FHK A;  5B8A A;  2B1L A;  1ZOF A;  4YQV A;  5ELA A;  2H8L A;  2B1K A;  4V2N A;  2X8C A;  2XPD A;  5AIS A;  2CA8 A;  2LUS A;  2PU9 C;  3WGD A;  4XHM A;  2H1A A;  4TN8 A;  2V2G A;  2MMA A;  4NXI A;  2YWM A;  5KEJ A;  14GS A;  5GST A;  4TR0 A;  4POM A;  2AV4 A;  2L6C A;  3DKS A;  22GS A;  5A4U A;  3IOS A;  1VF3 A;  1ST9 A;  5HFK A;  1A2J A;  2VLV A;  3UMA A;  3KP9 A;  1G0T A;  1RK4 A;  3GTU B;  1KTE A;  2H66 A;  3ZIT A;  2R3X A;  1K0A A;  2ALB A;  9GSS A;  4K0G A;  4FO5 A;  2DML A;  3TU3 B;  1QQ2 A;  5LCZ A;  2AJQ B;  1T1V A;  2HSN A;  1B9Y C;  4V2L A;  4TR3 A;  4F0B A;  4MJA A;  1Y1U A;  4MDC A;  2REM A;  3E9J B;  3L9U A;  4JBB A;  1M9A A;  2DMM A;  3D5J A;  3DVW A;  5CRG A;  5H5Q A;  3A2W A;  1YQ1 A;  4Q5N A;  2A2P A;  4ISD A;  1OE7 A;  2LV3 A;  4PXO A;  4MJC A;  4A5P A;  3G7J A;  2UV8 G;  3VK9 A;  1C72 A;  3IV4 A;  4MPG A;  4BVY B;  4IP1 A;  4POB A;  1SK2 A;  4IBP A;  3DD3 A;  3EWL A;  1J9B A;  2VD0 A;  1UC7 A;  5CRE A;  1KBN A;  3RBT A;  4QL9 A;  5D93 A;  3RHC A;  5ECO B;  1YKA A;  4K1F A;  1YVL A;  1XWG A;  1BYE A;  5IMC A;  2R6K A;  5F07 A;  1TRU A;  2CX3 A;  3K8N A;  4KCE A;  2MBT A;  2GTU A;  2JAD A;  4PNF A;  2QC7 A;  4K9Z A;  4POK A;  2YJ7 A;  4BVX A;  4X0X A;  2VM2 A;  4TR4 A;  5DQS A;  4IVF A;  1YEP A;  4HU7 A;  1GTB A;  3GKM A;  2HRA A;  2L4C A;  3Q18 A;  1T4Y A;  4PQI A;  2YWI A;  1WWJ A;  3LOR A;  2AUV A;  3HVV A;  3H8Q A;  1KNG A;  2IN3 A;  1ERV A;  3IRA A;  4XTS A;  1JZO A;  3KXO A;  5ID2 B;  5GAN D;  1R4W A;  3S9F A;  3MSZ A;  3RDW A;  3I43 A;  2H01 A;  1X5C A;  3TB2 A;  4I5Q A;  2XBQ A;  3TOU A;  1ML6 A;  3ZFL A;  5HR0 A;  3WT2 A;  4JR6 A;  4HQS A;  5FWG A;  3P7X A;  3D6I A;  5FT3 A;  2BMX A;  2H1D A;  4RQR A;  4PUF C;  2MYG A;  4LA1 A;  3VFI A;  3FZ4 A;  4OFT A;  2DIY A;  1M2D A;  5HFI A;  2IMK A;  5A5K A;  1EOH A;  1SVL A;  5COH A;  4YH2 A;  4XS1 A;  4OO5 A;  1LJR A;  3NOF A;  3IPZ A;  1BJX A;  3MDK A;  5IMD A;  2VCZ A;  5CYY A;  1JZW A;  2CVB A;  3UBL A;  2V6O A;  1MDJ A;  2GS3 A;  2WB9 A;  4GWR A;  4YKF A;  4WF4 A;  1SJI A;  2WFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...