5LCZA

Chimeric gst
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
195
Chain Sequence
AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYSEGILDLTEMITALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKPAMDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase A1,Glutathione S-transferase alpha
publication title Directed evolution of glutathione transferases towards a selective glutathione-binding site and improved oxidative stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 195
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5lczA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5lczA01
4KDUA 3GURA 4JRRA 4DSQA 7GSSA 6GSVA 3RPNA 1EEMA 4BWQA 4ISDA 2CVKA 5G2ZA 5B8BA 3TJBA 4J2FA 4GSNA 3LQ7A 1M99A 3LXTA 4GLTA 13GSA 1TDIA 4YAVA 3GKMA 3UVHA 3QR6A 3F3QA 3HY2A 2PVOC 3P8WA 1URMA 3EWLA 5ECMB 1LBKA 2VCZA 1FOVA 1GTUA 1KBNA 4X0XA 2WDUA 3IDVA 2IMIA 4KGIA 2PGTA 1TK8B 2KP1A 3EMPA 4OWYA 5AISA 2R4VA 2H19A 1Z3EA 3DKSA 2YCDA 3GN3A 4FIWA 1AUCA 5B6NA 2PWJA 5F8BA 2OKAA 1GTAA 1XOAA 9GSSA 1SK1A 1VF2A 19GSA 2N5BA 2GSSA 1TOFA 4NPBA 2YPMA 2YWNA 1K0DA 4KUNA 4MABA 1Z9HA 4PGTA 5A4UA 3IAS2 1ERTA 2V32A 3CSIA 4IS0A 3WGXA 4Q5NA 4HJMA 1PL1A 3GMFA 1PKWA 2UZ8A 3ZYWA 2DJ2A 5A4WA 2CV4A 2JSZA 1QGVA 2ZCTA 5COHA 1RQMA 2H8LA 3HVXA 4RI6A 2WB9A 3GTUA 2CVDA 4MZCA 4HZ2A 3UIWA 3EYTA 5EPFA 3H1NA 4TR1A 2L4QA 1NM3A 4PQ1A 2JADA 4N0ZA 3VK9A 3F4SA 2I9HA 2LNTA 4TKYA 4G9HA 4IW9A 3TOUA 1THOA 5DALB 5IMFA 4Z7XA 2PVQA 4PX1A 3EVIA 3IC4A 4AJ7A 1O81A 5H5QA 4BL7A 4OO5A 2OE1A 3SWLA 1ZOFA 1TK5B 2GQMA 2H01A 3LEFA 2PMTA 2F9SA 3IR4A 5ABRA 5JCGA 1O8WA 1TP9A 4DVCA 1B8XA 4PUAA 3LYPA 2DMLA 3C71A 5DBQA 3DYRA 4D73B 1TK0B 3UVTA 4JZQA 2H0GA 4NHZA 1U3IA 2P5RA 2DJJA 3DVWA 1Z7RA 2EIQA 2GT6A 5ECSA 3APSA 1PA3A 4YAPA 3GKXA 3J7Yb 2QSIA 4XS1A 1DBYA 2KLXA 3P2AA 5D9WA 4YH2A 3GX8A 1F37A 4ZL9A 5JCWA 1YY7A 1ZYEA 2GGTA 2YOIA 3EE2A 2DC5A 2GQLA 4EC0A 3ERWA 3GA4A 2HI7A 2JSYA 3HJPA 1XW5A 1PX6A 2X8CA 4HDEA 3HHVA 1EWXA 3WGDA 2VIMA 3KZQA 3TRQA 4ECBA 3TKQA 2L5OA 4USSA 1E6BA 2C0EA 3KMOA 1GUKA 2PN8A 3I9V2 3A2VA 3ISOA 4XRAA 2IJYA 3D21A 3FZ4A 2H6XA 1A2LA 2FNOA 4PURA 1GSEA 4JBBA 4CDOA 3IOSA 1QUWA 1B4QA 2R5GA 5GSSA 10GSA 3F6DA 1M9BA 1JZWA 3HD5A 4TR4A 1BQ7A 1NSWA 4F9ZA 2VM2A 1VGLA 4KX4A 3GNJA 2YANA 5H5SA 1KTEA 3F8UA 1WJKA 4KSMA 4HU7A 1B4PA 1VF1A 4FYBA 1HD2A 2IMDA 4RQRA 2IWTA 4I2UA 4OFMA 2E0QA 3MWHA 1G6WA 2CAQA 3ZMKA 2O87A 2V2GA 2AHEA 4G10A 5FHIA 2YJHA 1TI3A 5KN2A 1S3AA 4PQIA 4ZBDA 5CRHA 3ME8A 2H1AA 2LQOA 1PN9A 3Q19A 2FWEA 2GVPA 1SD8A 2B7KA 2LS5A 4N10A 4TXOB 1GWCA 4IN0A 5B8AA 5IQYA 2OACA 1BX9A 3LYKA 4LL1B 12GSA 1T7PB 2LKUA 5D9TA 1USBA 1V98A 4KSOA 1R4WA 1W89A 3E9JB 3LSZA 5DALA 2HLSA 5LCZA 2YZUA 1X5DA 3TCOA 4KE3A 1O85A 3S9FA 2H76A 5CRDA 3KCMA 3KH9A 5IOXA 1K0MA 2H74A 1R5PA 1EP8A 3FHKA 4OD7A 2CX3A 3ZTLA 2DJ1A 1HQOA 3RPPA 1BG5A 1DSBA 3L9VA 1W4VA 4D73A 2G0FA 2RLIA 1XWCA 2QC7A 3M3MA 1GSYA 5IO2A 4WBRD 5F06A 4O7HA 2VCTA 4HZ4A 2MYGA 3QOUA 5H5RA 1GTIA 1UVZA 2YWMA 2VLUA 1TJDA 3CTGA 2GSQA 2O89A 4Q5FA 2VO4A 2G2QA 2B6MA 5CP1A 1TI1A 3VPTA 5C00A 2WRTA 5ID2B 5EVOA 1MD4A 3BOAA 1GUHA 3F0IA 1ILOA 4TN8A 2K9FA 2H73A 1EOGA 3F4RA 4I97A 2V1MA 2F8AA 4MF7A 1ON4A 2HE3A 2GZYA 3Q74A 3W8JA 3J7Yk 3ZREA 5ECPB 2FUG2 2PERA 4PNGA 1SD9A 4L0WA 4ID0A 1GL8A 3IA1A 1K0NA 3UEMA 4JR6A 2YP6A 1YF0A 5G30A 2R2JA 1UN2A 3IE3A 4TR3A 3ZLPA 1ZCPA 2LTKA 2HSMB 5A5KA 2EC4A 1PMTA 4H86A 3P7XA 4N30A 3O76A 2PPTA 4PTSA 2L59A 4N11A 4WF4A 3GHAA 3Q18A 1GLQA 4IVFA 4PQHA 4MJEA 3TJFA 3A3TA 4WEYA 2IPAA 2RM6A 3MSZA 1M0UA 3WYWA 1T4ZA 2DJ0A 3H79A 3TKPA 2ON7A 1O8XA 2LQQA 2B7JA 4TXOA 2LRTA 4IP6A 4XRDA 2GQKA 1WWJA 2K8SA 3E0UA 3APQA 1K3OA 2GZPA 2I1UA 3R2QA 3ZVJA 1OE7A 2LV3A 2VCQA 2HRAA 4K7IA 2FA8A 3G9BA 3G7IA 3HZ4A 1HNCA 5IM9A 1VF3A 4BVYB 3CMIA 3QCPA 4WF5A 5IMDA 2HXKA 2NDOA 5CRWA 3C1SA 1WIKA 4GQFA 4MP4A 1GTBA 3QAGA 1XWKA 1JHBA 1AIUA 3TRPA 1HNAA 3GSTA 2N5AA 2YNXA 1J08A 3C7MA 4XIHA 3PINA 3BD2A 4LL4B 1S3DA 3VWUA 3HVSA 3FY7A 3L9SA 5HR3A 1SYXA 5FT3A 1IYIA 2VD0A 3KP8A 2GSTA 1PRXA 3ERGA 3D5JA 4ZB8A 2H75A 1G7OA 4MJCA 4OCFA 1MDIA 4XS6A 3FZAA 5ID2A 2M72A 2VLVA 2CA8A 4Q5QA 3R3EA 2VCWA 4MH3A 1ZL9A 2MMNA 2C1YA 17GSA 1XXUA 2DLXA 3EC3A 1GULA 1T1VA 1BYEA 2AB6A 1LJRA 2VD1A 1YJ6A 2HZFA 1M2AA 3D6IA 3GV1A 4MZBA 5HQPA 2HRFA 4HU9A 4EL1A 2R6KA 2WFCA 3ZVJD 5AIVA 4X1UA 1QQ2A 3CYNA 5ECKB 1A0RP 1IYHA 1FO5A 4DSRA 3G7YA 1GSDA 2IMEA 4DSSB 1A24A 2M80A 2B5YA 4IP1A 2IMFA 4MJBA 3N5OA 1AXDA 3Q6OA 2C80A 1K3LA 2PBJA 4HS1A 2KHPA 4K8MA 3GRXA 2P31A 1XCCA 4O92A 2HSMA 1K0AA 2YJ7A 1OC8A 2FY6A 1MTCA 4EKZA 4ZBBA 4MMMA 4CHSA 4PUFC 4MPFA 4NAXA 3F6FA 2VCVA 4NHWA 3QFBC 2I4AA 4KF9A 3M0FA 3U6VA 1AW9A 3TDGA 3QMXA 1VF4A 1BJXA 2FWGA 2VL9A 3IRAA 3DD3A 2ALBA 4NV2A 2L6CA 2H6ZA 2I81A 1QXHA 5J41A 3A2XA 1JFUA 3RHBA 4ZB6A 3TUEA 3IBHA 3UBLA 1AQVA 4HJ2A 5G5EA 2HFDA 1MDKA 2B5XA 4KB3A 3GH9A 4RUVA 4BVYA 1I9DA 1R7HA 4XS4B 2DJKA 3H8QA 3WGEA 2MZCA 3CSJA 1XW9A 5L71A 4ZL7A 1YZXA 1OYJA 4E8HA 2QGVA 1PGTA 1UA5A 3ZZXA 1WRYA 4V2MA 5A4VA 5ECNB 4ZBAA 3NZNA 3KH7A 4L8EA 2JACA 2XC2A 2YN1A 4TW5A 4ZL8A 3WT2A 1JZDA 3RBTA 3H93A 2VUPA 3FZ9A 3E3EA 3FK8A 4O32A 4JU5A 1WE0A 1ML6A 2WZ9A 3I6AA 1B9YC 2DMMA 2YWIA 1I5GA 2DSAA 2FD3A 2D2ZA 1WP0A 2IMKA 1GSUA 3ZIJA 2AAWA 1XFLA 3VLNA 2AJQB 2X99A 4OFNA 1G0TA 1V9WA 4ULXA 22GSA 2LEGA 2VM1A 2XPDA 2JZSA 2EIRA 3QAVA 4KH7A 3EINA 6GSTA 1OC9B 2ZUPA 4IGJA 1ABAA 1SL2B 4CW9A 1SKRB 3QD9A 5DCHA 5ECRB 3ED3A 1X5CA 2IFQB 1ZZYA 1GUMA 2KUCA 4J56E 4DSSA 3DIEA 4BWSA 5J4UA 5JWRB 1PD21 1H75A 3F63A 2C3TA 1M9AA 5B6MA 2C0DA 3W8SA 3KM6A 4JEDA 1X9MB 3WT1A 2LJKA 4K1FA 1SYRA 3QAWA 4RQXA 4L0UA 1YKCA 1GNWA 4GCIA 4NWYA 1FW1A 2M46A 4TOPA 2CZ3A 4G0IA 2Z9SA 4NXIA 2HT9A 1ERWA 2OBIA 3LXZA 1XW6A 6GSXA 2IN3A 3L78A 4QL9A 4MDCA 2YV9A 5KN3A 1FHEA 4K0GA 2H1GA 2F51A 2LJAA 3ZRDA 1JLVA 5F07A 3DMLA 5AN1A 2MMZA 2OBKA 1AAZA 2RUFA 1V58A 2B1LA 1SK0A 3KTLA 1B9XC 1VRSD 2OJLA 3DWVA 2TRCP 3QFAC 3IXRA 5KN1A 4LA1A 4OCEA 5C04A 1B48A 2P0GA 20GSA 1SK2A 1CQHA 1E2YA 2WCIA 2JZRA 1EEJA 1AC1A 2QKEA 1XWBA 2X8HA 4F2IA 1GSQA 2A4VA 1K0CA 4WXTA 4MZWA 3VWXA 2I3YA 1XVQA 2P5QA 4YQMA 1TRUA 5G31A 3DRNA 5DAKB 5EY6A 2C3NA 2GDRA 5IMCA 2IL3A 1DE2A 3DGQA 4L5LA 2A2SA 1OAZA 2AUVA 3FZ5A 3MDKA 4WR5A 1JZOA 4F0CA 4K2DA 4WETA 2H1DA 4ZXGA 1GH2A 4ACSA 1ZMAA 3QPMA 3TJKA 1YKAA 3TOTA 2MMOA 1GLPA 2R37A 1R26A 3KMNA 1M2DA 4LMVA 1MDJA 4TR0A 2O8VB 3VWVA 2X8GA 4GF0A 4ECJA 1GSFA 1RW1A 4XTSA 2HYXA 2MBTA 3C73A 3GKNA 3H4KA 3EU3A 2HSNB 2YV7A 3VWWA 1SL1B 2MMAA 1AQXA 4IKHA 5IMAA 2CVBA 1U6TA 5IIZA 3KP9A 1OC9A 3LG6A 3GFKA 3BJ5A 1Y25A 2L57A 8GSSA 1T3BA 2IFQA 1O73A 2IIYA 2RIIA 1X9WB 1CQGA 2LJRA 5JWOB 1SU9A 5GSTA 1FVKA 3HXSA 4HQSA 3IPZA 3QDNA 4AJ6A 1WMJA 2H1BA 1GNEA 2NBSA 2GZZA 4KDYA 2FCHA 3VPQA 3NIVA 2PU9C 1ZYQB 4IELA 2FGXA 1EV4A 1TRWA 1TW9A 1TU8A 1ST9A 1N2AA 4OMVA 3L9UA 2FHEA 2JZTA 2LRCA 4V2LA 5ELGA 4HOJA 1PKZA 2GTUA 1F6MC 2JL4A 5JCUA 4ZB9A 5IPGA 1XIYA 1RK4A 3A5WA 2PUKC 3NOFA 4BPYA 4I2TA 4BA7A 6GSUA 2ON5A 1K0BA 2CX4A 3KTBA 3HDCA 1QFNA 3IK7A 3LWAA 5HFKA 3PR8A 2VOCA 3LORA 5GZZB 1UC7A 3TKRA 4ML6A 1A2MA 5GAND 4ECIA 3C8EA 1XVWA 5D96A 1O6JA 5LNKe 3D22A 4K7OA 2NVLA 4K6XA 5HR0A 3AY8A 4F0BA 2VCXA 2VAFA 2HZEB 1Y6EA 3VFIA 1N8JA 1A0FA 2OE0A 1Z6NA 2HSYA 4GSTA 1ERVA 4FYUA 2HQTA 2J23A 2L6DA 3ZFLA 5AGYA 2X64A 3IK9A 1GRXA 2GLRA 3UAPA 3CTFA 4KAEA 2H0HA 5CREA 3BCIA 5J9CA 2YZHA 4EDZA 3VI5A 3ZIVA 5G5FA 3CSHA 5DAKA 5FWGA 3KD0A 4JE1A 4EXJA 2ZNMA 2A2RA 3FRCA 1MEKA 4NV5A 4WKWA 4G0LA 2CZ2A 4RI7A 1PQNA 1T4YA 1M7TA 2E2MA 4P3YB 4QQ7A 2CT6A 3FR6A 1PSQA 11GSA 3A2WA 4HI7A 5KEJA 5ECHB 2XPEA 1HYUA 2DJ3A 3EU4A 4FYCA 1F2EA 5ECQB 2C0FA 1YF1A 2AYTA 2H30A 4MLYA 1QMVA 3PGTA 5HFGA 1K0OA 1WPIA 3FR3A 1O7UA 3FYGA 3L0HA 3KGKA 1J0FA 3GL3A 2NPBA 4MH2A 2H6YA 4KNDA 2LNSA 3US3A 4MCUA 5IMVA 1EGOA 3M9JA 5LD0A 2N5FA 2K8VA 2HRKB 3RAZA 1A23A 2BJXA 4YQUA 4MF5A 5J9BA 3HA9A 1U87A 5ELAA 4ILFA 4EDYA 4K9ZA 4XCSA 3EMXA 4TRXA 3TRXA 3V1WA 3UJ1A 1S3CA 5D9VA 3OR5A 5ECLB 3UMAA 4GXZA 1FAAA 2DBCA 3ZITA 3ZL5A 2H0IA 2E2GA 2NTOA 5DQSA 3KEBA 3U5RE 4V1Ap 6GSYA 3JCML 4WR4A 2BMXA 2YWOA 3APOA 3IAM2 3TKSC 2R3XA 4GTUA 5DDLA 5IMZA 3KIJA 1DE1A 2WJUA 2FLSA 4MJAA 2RUEA 5ENUA 3MNGA 4FO5A 2H70A 2C4JA 3CBUA 3CRUA 4XHMA 1EOHA 2C8UA 2XHFA 4LLRA 3UARA 1T8EB 3GIXA 5D9XA 2CQ9A 1KNGA 4EUYA 1SKWB 4AGSA 4EF0A 5EL8A 3GUSA 18GSA 4K7NA 5CRGA 3TKSA 5IOWA 3LJRA 1BAYA 1MD3A 4BVXB 1AQWA 4HUAA 1NW2A 2DIZA 1U88A 1U3AA 1THXA 5CO3A 3F3RA 3DVXA 2H72A 1M2BA 2HZEA 3ERFA 1YEXA 4PNFA 3ME7A 2B5EA 4V1Ag 4POLA 1YQ1A 5IO0A 3ZFBA 3GH6A 1OKDA 4POKA 1Q4JA 4DEJA 2FWHA 4OFTA 1FB6A 4KW6A 4MPGA 6GSWA 1X0RA 1HNBA 2WS2A 3M1GA 5E4WA 3BCKA 3D0ZA 4NMUA 2WULA 3GX0A 4IJIA 4K0NA 5J5NA 4ZIJA 4QL7A 3O6TA 5D73A 3LGCA 1PL2A 3FR9A 3WD6A 2HNLA 4MK3A 4I8BA 2VLTA 1XZOA 3F4TA 3PH9A 4GWRA 3LFLA 1ERUA 1JLWA 1XWGA 4GSSA 6GSSA 4HQZA 3FW2A 1KEBA 3EURA 4KCEA 4MA9A 4N0VA 2F8FA 1TTZA 4AF2A 4FQUA 2KOKA 2VL2C 1JZRA 1SJ6A 5ECIB 2K18A 1XWAA 5F0GA 2XBQA 3FEUA 2GSRA 1YDKA 4GQCA 1NHYA 5DQYA 1F3AA 1XBSA 5JWQB 1G7EA 1WOUA 1TU7A 3W6GA 4EO3A 3RDWA 3KXOA 2J9HA 3BBYA 4EVMA 2GT5A 1GP1A 5GAPD 1SENA 1EP7A 5DJLA 5G1KA 2O85A 1LU4A 2V41A 4KA0A 2FWFA 2K6VA 3HYPA 1OKTA 2HRKA 4F03A 2AV4A 3TGZA 2H66A 2VL2A 3HKRA 3DEXA 3UOMA 3KJYA 2TIRA 3RHCA 4E8EA 1EGRA 3FKFA 1A8YA 4TXVA 2LUSA 1F9MA 3IV4A 3VURA 3PPUA 4PXOA 5IPHA 2CAIA 4L5OA 1V57A 4EE0A 1X9SB 1X5EA 1FB0A 2B3SA 1OC3A 1T00A 1OE8A 2LSTA 3I69A 5BMUA 4OO4A 2HRNA 1FVJA 3TB2A 1V2AA 2L5LA 5DVBA 1J9BA 1TRSA 2C3QA 2E7PA 14GSA 3HCZA 5HFIA 4I6XA 1TKDB 2OE3A 4YQVA 4XS4A 4G19A 2ES7A 3GYKA 3ZMLA 3O3TA 3DXBA 5CYYA 5AIXA 3GL5A 1EV9A 3C1RA 16GSA 2KP2A 4ML1A 5B7CA 4MF6A 4V2NA 4KCAA 5HR2A 4I5QA 1V40A 3I43A 2F3MA 4GRFA 1OVNA 4FH8A 1SL0B 4POMA 5J3RA 1K3YA 4LMWA 4X43A 3D4TA 3HJOA 3UL3A 4F82A 1GSSA 2BTOT 1A2JA 1BEDA 2JU5A 5D93A 4BVXA 1Z5YE 5F05A 2B1KA 1F3BA 3SBCA 1YEPA 2XBIA 1Z6MA 1FG4A 1Q98A 1XOBA 4IQAA 4G2EA 3G7JA 3GKKA 3P90A 4O5RA 2H71A 2REMA 3HVVA 3D4MA 3TJGA 4IHUA 4HEA2 2LRNA 3TKSE 1G6YA 2RM5A 4KDXA 5ECOB 2V6OA 4TVEA 3IHQA 5KN0A 4IBPA 1A8LA 1QK8A 4WBJA 4POBA 1R5AA 3TJJA 3K8NA 1SJIA 1SKSB 5G1LA 5DJMA 2C0GA 3GTUB 2V6KA 2TRXA 2HSHA 4G0KA 4TR1B 1DUGA 3VI7A 2GS3A 5D8IA 1XPVA 2MBSA 4IJ3A 1Z7PA 1TRVA 1C72A 3UBKA 3F9UA 5INYA 2EIOA 5HR1A 3M9KA 3L4NA 3CXGA 4BL7B 3M8NA 4ZILA 1SJZA 1TXXA 2FA4A 1H4OA 5E59A 4IQ1A 3N9JA 3CRTA 1EZKA 1ACVA 4JR4A 5DCGA 1ZGNA 4AJ8A 2VL3A 4ECCA 2L4CA 5CNWA 4Q5RA 3HZ8A 3HJMA 4J57E 2DIYA 2OADA 3MAKA 2WGRA 5CAXA 1NHOA 2O7KA 2OA7A 1PX7A 3GSSA 3IC8A
chains in the Genus database with same CATH superfamily
4KDUA 3GURA 4JRRA 4DSQA 7GSSA 6GSVA 3RPNA 1EEMA 4BWQA 4Z2TA 4ISDA 2CVKA 5G2ZA 5B8BA 3TJBA 4J2FA 4GSNA 4Z2UA 3LQ7A 1M99A 3LXTA 4GLTA 2R0GA 13GSA 1TDIA 4YAVA 3GKMA 3UVHA 3QR6A 3F3QA 3HY2A 2PVOC 3P8WA 1URMA 3EWLA 5ECMB 1LBKA 2VCZA 1FOVA 1GTUA 1KBNA 4X0XA 2WDUA 3IDVA 2IMIA 4KGIA 2PGTA 1TK8B 2KP1A 3EMPA 4OWYA 5AISA 2R4VA 2H19A 1Z3EA 3DKSA 2YCDA 3GN3A 2WW0A 4FIWA 1AUCA 5B6NA 2PWJA 5F8BA 2OKAA 1GTAA 1XOAA 9GSSA 1SK1A 1VF2A 19GSA 4PI0C 2N5BA 2GSSA 1TOFA 4NPBA 2YPMA 2YWNA 1K0DA 4KUNA 4MABA 1Z9HA 4PGTA 5A4UA 3IAS2 1ERTA 2V32A 3CSIA 4IS0A 3WGXA 4Q5NA 4HJMA 1PL1A 3GMFA 4QMKA 1PKWA 2UZ8A 3ZYWA 3HMJG 2DJ2A 5A4WA 2CV4A 2JSZA 1QGVA 3RGBC 2ZCTA 5COHA 2O3EA 1RQMA 2H8LA 3HVXA 4RI6A 2WB9A 3GTUA 2CVDA 4MZCA 4HZ2A 3UIWA 3EYTA 5EPFA 3H1NA 4TR1A 2L4QA 1NM3A 4PQ1A 2JADA 4N0ZA 3VK9A 3F4SA 2I9HA 2LNTA 4TKYA 4G9HA 4IW9A 3TOUA 1THOA 5DALB 5IMFA 4Z7XA 2PVQA 4PX1A 3EVIA 3IC4A 4AJ7A 1O81A 5H5QA 4BL7A 4OO5A 2OE1A 3SWLA 1ZOFA 1TK5B 2GQMA 2H01A 3LEFA 2PMTA 2F9SA 3IR4A 5ABRA 5JCGA 1O8WA 1TP9A 4DVCA 1B8XA 4PUAA 3LYPA 2DMLA 3C71A 5DBQA 2R0PA 3DYRA 4D73B 1TK0B 3UVTA 4JZQA 2H0GA 4NHZA 1U3IA 2P5RA 2DJJA 3DVWA 1Z7RA 2EIQA 2GT6A 5ECSA 4AKHA 3APSA 1PA3A 4YAPA 3GKXA 3J7Yb 2QSIA 4XS1A 1DBYA 2KLXA 3EPTA 3P2AA 5D9WA 4YH2A 5A34B 3GX8A 5J40A 1F37A 3TU3B 3A5IA 4ZL9A 5JCWA 1YY7A 1ZYEA 2GGTA 2YOIA 3EE2A 2DC5A 2GQLA 4EC0A 3ERWA 3GA4A 2HI7A 2JSYA 3HJPA 1XW5A 1PX6A 2X8CA 4HDEA 3HHVA 1EWXA 3WGDA 2VIMA 3KZQA 3TRQA 4ECBA 2WVZA 2L5OA 3TKQA 4USSA 1E6BA 2C0EA 3KMOA 1GUKA 2PN8A 3I9V2 3A2VA 3ISOA 4XRAA 2IJYA 3D21A 3FZ4A 2H6XA 4W66A 1A2LA 2FNOA 4PURA 1GSEA 4JBBA 4CDOA 3IOSA 1QUWA 1B4QA 2R5GA 5GSSA 10GSA 1N25A 3F6DA 1M9BA 1JZWA 3HD5A 4TR4A 1BQ7A 1NSWA 4F9ZA 2VM2A 1VGLA 4KX4A 3GNJA 2YANA 5H5SA 1KTEA 3F8UA 5A1NB 1WJKA 4KSMA 4HU7A 1B4PA 1VF1A 4FYBA 1HD2A 2IMDA 4RQRA 2IWTA 4OFMA 4I2UA 2E0QA 3MWHA 1G6WA 2CAQA 3ZMKA 2O87A 2V2GA 2AHEA 4G10A 5FHIA 2YJHA 1TI3A 5KN2A 1S3AA 4PQIA 4ZBDA 5CRHA 3ME8A 2H1AA 2LQOA 1PN9A 3Q19A 2FWEA 2GVPA 1SD8A 2B7KA 2LS5A 4N10A 4TXOB 1GWCA 4IN0A 5B8AA 5IQYA 2OACA 1BX9A 3LYKA 4LL1B 12GSA 1T7PB 2LKUA 5D9TA 1USBA 1V98A 4KSOA 2DKHA 1R4WA 1W89A 3E9JB 3LSZA 5DALA 2HLSA 5LCZA 2YZUA 1X5DA 3TCOA 4KE3A 1O85A 3CWGA 3S9FA 2H76A 5CRDA 3KCMA 3KH9A 1M3IA 5IOXA 1K0MA 2H74A 1R5PA 1EP8A 3FHKA 4OD7A 2CX3A 3ZTLA 2DJ1A 1HQOA 3RPPA 1BG5A 1DSBA 3L9VA 1W4VA 4D73A 2G0FA 2RLIA 1XWCA 2QC7A 3M3MA 1GSYA 5IO2A 4WBRD 5F06A 4O7HA 2VCTA 4HZ4A 2MYGA 3QOUA 5H5RA 1GTIA 2WZSA 1UVZA 2YWMA 2VLUA 1TJDA 3CTGA 2GSQA 2O89A 4Q5FA 2VO4A 2G2QA 2B6MA 5BRTA 5CP1A 1TI1A 3VPTA 5C00A 1FOHA 2WRTA 5ID2B 5EVOA 1MD4A 3BOAA 1GUHA 3F0IA 1ILOA 4TN8A 2K9FA 2H73A 1EOGA 3F4RA 4I97A 2V1MA 2F8AA 4MF7A 1ON4A 2HE3A 2GZYA 4O5UA 3Q74A 3W8JA 3J7Yk 3ZREA 5ECPB 2FUG2 2PERA 2EFHA 4PNGA 1SD9A 4L0WA 4ID0A 1GL8A 3IA1A 1K0NA 3UEMA 2H1LA 4JR6A 2YP6A 1YF0A 3IHGA 5G30A 2R2JA 5A1NA 1UN2A 3IE3A 4TR3A 3ZLPA 1ZCPA 2LTKA 4AI6A 2HSMB 5A5KA 2EC4A 1PMTA 4H86A 3P7XA 4N30A 3O76A 2PPTA 4PTSA 2L59A 4N11A 4WF4A 3GHAA 3Q18A 1GLQA 4IVFA 4PQHA 4MJEA 3TJFA 3A3TA 4WEYA 2A4HA 2IPAA 2RM6A 2A2PA 3MYDA 3MSZA 1M0UA 2DKIA 3WYWA 1T4ZA 2DJ0A 3H79A 3TKPA 2ON7A 1O8XA 2LQQA 2B7JA 3CHXC 4TXOA 2LRTA 4IP6A 4YKGA 4XRDA 2GQKA 1WWJA 2K8SA 3E0UA 3APQA 1K3OA 2GZPA 2I1UA 3R2QA 3ZVJA 1OE7A 2LV3A 2VCQA 2HRAA 4K7IA 2FA8A 3G9BA 3G7IA 3HZ4A 1HNCA 5IM9A 1VF3A 4BVYB 3CMIA 3QCPA 4WF5A 5IMDA 2HXKA 2NDOA 5CRWA 3C1SA 1WIKA 4GQFA 4MP4A 1GTBA 3QAGA 1XWKA 1JHBA 1AIUA 3TRPA 1HNAA 3GSTA 2N5AA 2YNXA 1J08A 3C7MA 4XIHA 3PINA 3BD2A 4LL4B 1S3DA 3VWUA 3HVSA 3FY7A 4AKGA 3L9SA 5HR3A 1BG1A 1SYXA 5FT3A 1IYIA 2VD0A 3KP8A 2GSTA 1SVMA 2O5VA 1PRXA 3ERGA 3D5JA 4ZB8A 2H75A 1G7OA 4MJCA 4OCFA 4GDFA 1MDIA 4XS6A 3FZAA 5ID2A 2M72A 2VLVA 2CA8A 4Q5QA 3R3EA 2VCWA 4MH3A 1ZL9A 2MMNA 2C1YA 17GSA 1XXUA 2DLXA 3EC3A 1GULA 1T1VA 5A5HB 1BYEA 2AB6A 1LJRA 2VD1A 1YJ6A 2HZFA 1M2AA 3D6IA 3GV1A 4MZBA 2EFDA 4E68A 2WW3A 5HQPA 2HRFA 4HU9A 4EL1A 2R6KA 2WFCA 3ZVJD 5AIVA 4X1UA 1QQ2A 3CYNA 5ECKB 1A0RP 1IYHA 1FO5A 4DSRA 3G7YA 4YKFA 1GSDA 2IMEA 4DSSB 1A24A 2M80A 2B5YA 4IP1A 2IMFA 4MJBA 3N5OA 1AXDA 3Q6OA 2C80A 1K3LA 2PBJA 4HS1A 2KHPA 4K8MA 3GRXA 2OT3A 2P31A 1XCCA 4O92A 2HSMA 1K0AA 2YJ7A 3HVNA 1OC8A 2FY6A 1MTCA 4EKZA 4ZBBA 4MMMA 4CHSA 4PUFC 1BF5A 4MPFA 4NAXA 3F6FA 2VCVA 4NHWA 3QFBC 1PN0A 2I4AA 4KF9A 3M0FA 3U6VA 1AW9A 3TDGA 1TXUA 3QMXA 4G01A 4AKIA 1VF4A 1BJXA 2FWGA 2VL9A 3IRAA 3DD3A 2ALBA 4NV2A 2L6CA 4MNNA 2H6ZA 2I81A 1QXHA 5J41A 3A2XA 1JFUA 3RHBA 4ZB6A 3TUEA 3IBHA 3UBLA 1AQVA 4HJ2A 5G5EA 2HFDA 1MDKA 2B5XA 4KB3A 3GH9A 4RUVA 4BVYA 1I9DA 1R7HA 4XS4B 2DJKA 3H8QA 3WGEA 2MZCA 4K5SA 5J4VA 3CSJA 1XW9A 5L71A 4ZL7A 1YZXA 1OYJA 4E8HA 2QGVA 4EIPA 1PGTA 1UA5A 2WW2A 3ZZXA 1WRYA 4V2MA 5A4VA 5ECNB 4ZBAA 3NZNA 3KH7A 4L8EA 2JACA 2XC2A 2YN1A 4TW5A 4ZL8A 4PI2C 3WT2A 1JZDA 3RBTA 3H93A 2VUPA 3FZ9A 3E3EA 1SVLA 3FK8A 4O32A 4JU5A 1WE0A 1ML6A 2WZ9A 3I6AA 1B9YC 2DMMA 2YWIA 1I5GA 2DSAA 2FD3A 4EIQA 2D2ZA 1WP0A 2IMKA 1GSUA 3ZIJA 2AAWA 1XFLA 3VLNA 2AJQB 2X99A 4OFNA 1G0TA 1V9WA 4ULXA 22GSA 2O36A 4AKXB 5A5HA 2LEGA 2VM1A 2XPDA 2JZSA 2EIRA 4PHZC 3QAVA 4KH7A 3EINA 6GSTA 1OC9B 2ZUPA 4IGJA 1ABAA 1SL2B 1ZYNA 4CW9A 1SKRB 3QD9A 4O5QA 5DCHA 5ECRB 3ED3A 1X5CA 2IFQB 1ZZYA 1GUMA 2KUCA 4J56E 4DSSA 3DIEA 4BWSA 5J4UA 5JWRB 1PD21 1H75A 3F63A 2C3TA 1M9AA 5B6MA 2C0DA 3W8SA 3KM6A 4JEDA 1X9MB 3WT1A 2LJKA 4K1FA 1SYRA 3QAWA 4RQXA 4L0UA 1YKCA 1GNWA 4GCIA 4NWYA 1FW1A 2M46A 4TOPA 2CZ3A 4G0IA 2Z9SA 4NXIA 2HT9A 1ERWA 2OBIA 3LXZA 1XW6A 6GSXA 2IN3A 3LW9A 3L78A 4QL9A 4MDCA 2YV9A 5KN3A 1FHEA 4K0GA 2H1GA 2X4AA 2F51A 2LJAA 3ZRDA 1JLVA 5F07A 3DMLA 5AN1A 2MMZA 2OBKA 1AAZA 2RUFA 1V58A 2B1LA 1SK0A 3KTLA 1B9XC 3MIXA 1VRSD 2OJLA 3DWVA 2TRCP 5A34A 3QFAC 3IXRA 5KN1A 4LA1A 4OCEA 5C04A 1B48A 2P0GA 20GSA 1SK2A 1CQHA 1E2YA 2WCIA 2JZRA 1EEJA 1AC1A 2QKEA 1XWBA 2X8HA 4F2IA 1GSQA 2A4VA 1K0CA 4WXTA 4MZWA 3VWXA 2I3YA 1XVQA 2P5QA 4YQMA 3RFRC 1I1IP 2X49A 1TRUA 5G31A 3DRNA 5DAKB 5EY6A 2C3NA 2GDRA 5IMCA 4BIKA 2IL3A 1DE2A 3DGQA 4L5LA 2A2SA 1OAZA 2AUVA 3FZ5A 3MDKA 4WR5A 1JZOA 4F0CA 4K2DA 4WETA 2H1DA 4ZXGA 1GH2A 4ACSA 1ZMAA 3QPMA 3TJKA 1YKAA 3TOTA 2MMOA 1GLPA 2R37A 1R26A 3KMNA 1M2DA 4LMVA 1MDJA 4TR0A 2O8VB 3VWVA 4ICYA 2X8GA 4GF0A 4ECJA 1GSFA 1S4BP 1RW1A 2EFEA 4XTSA 2HYXA 2MBTA 3C73A 3GKNA 3H4KA 3EU3A 2HSNB 2YV7A 3VWWA 1SL1B 2MMAA 1AQXA 4IKHA 5IMAA 2CVBA 1U6TA 5IIZA 3KP9A 1OC9A 3LG6A 3GFKA 3BJ5A 1Y25A 2L57A 8GSSA 1T3BA 2IFQA 1O73A 2IIYA 2RIIA 1X9WB 1CQGA 2LJRA 1ZYPA 5JWOB 1SU9A 5GSTA 1FVKA 3HXSA 4HQSA 3IPZA 3QDNA 4AJ6A 1WMJA 2H1BA 1SVOA 1GNEA 2NBSA 2GZZA 4KDYA 2FCHA 3VPQA 3NIVA 2PU9C 1ZYQB 4IELA 2FGXA 1EV4A 1TRWA 1TW9A 1TU8A 1ST9A 1N2AA 4OMVA 3L9UA 2FHEA 2JZTA 2LRCA 4V2LA 5ELGA 4HOJA 1PKZA 2GTUA 4K2XA 1F6MC 2JL4A 5JCUA 4ZB9A 5IPGA 1XG8A 1XIYA 1RK4A 4ZB7A 3A5WA 2PUKC 3NOFA 4BPYA 4I2TA 4BA7A 6GSUA 2ON5A 2QA2A 1K0BA 2CX4A 3KTBA 3HDCA 1QFNA 3IK7A 3LWAA 5HFKA 3PR8A 2VOCA 3LORA 5GZZB 1UC7A 3TKRA 2UV8G 4ML6A 1A2MA 5GAND 4ECIA 3C8EA 1XVWA 5D96A 3CQFA 1O6JA 5LNKe 3D22A 4K7OA 2NVLA 4K6XA 5HR0A 3AY8A 4F0BA 2VCXA 2VAFA 2HZEB 1Y6EA 3VFIA 1N8JA 1A0FA 2OE0A 1Z6NA 4FXYP 2HSYA 4GSTA 1ERVA 4FYUA 2HQTA 2J23A 2L6DA 2EFCA 3ZFLA 5AGYA 2X64A 3IK9A 4K5RA 1GRXA 2GLRA 3UAPA 3CTFA 4KAEA 2H0HA 2WVXB 5CREA 3BCIA 5J9CA 4Z2RA 2YZHA 4EDZA 3VI5A 3ZIVA 5G5FA 3CSHA 5DAKA 4N3ZA 5FWGA 3KD0A 4JE1A 4EXJA 2ZNMA 2A2RA 3FRCA 1MEKA 4NV5A 4WKWA 4G0LA 2CZ2A 4RI7A 1PQNA 1T4YA 1M7TA 2E2MA 4P3YB 4QQ7A 2CT6A 3FR6A 1PSQA 11GSA 3A2WA 4HI7A 5KEJA 5ECHB 2XPEA 1HYUA 2DJ3A 3EU4A 1F2EA 5ECQB 2C0FA 4FYCA 1YF1A 2AYTA 2H30A 4MLYA 1QMVA 3PGTA 5HFGA 1K0OA 1WPIA 3FR3A 1O7UA 3FYGA 3L0HA 3KGKA 1J0FA 3GL3A 2NPBA 4MH2A 2H6YA 4KNDA 2LNSA 3US3A 4MCUA 5IMVA 1EGOA 2HSNA 3M9JA 5LD0A 2N5FA 2K8VA 2HRKB 3RAZA 1A23A 2BJXA 4YQUA 4MF5A 5J9BA 3HA9A 4CY6A 1U87A 5ELAA 4ILFA 4EDYA 4K9ZA 4XCSA 3EMXA 4TRXA 3TRXA 3V1WA 3UJ1A 1S3CA 5D9VA 3OR5A 5ECLB 3FMWA 3UMAA 4GXZA 1FAAA 2DBCA 5BMUB 3ZITA 3ZL5A 2H0IA 2E2GA 2NTOA 5DQSA 3KEBA 3U5RE 4V1Ap 6GSYA 3JCML 4WR4A 2BMXA 2YWOA 3APOA 3IAM2 3TKSC 2R3XA 4GTUA 5DDLA 5IMZA 3KIJA 1DE1A 2WJUA 2FLSA 4MJAA 2RUEA 5ENUA 3MNGA 4FO5A 2H70A 2C4JA 3CBUA 3CRUA 4XHMA 1EOHA 2C8UA 2XHFA 4LLRA 3UARA 1T8EB 3GIXA 5D9XA 2CQ9A 1KNGA 4EUYA 1SKWB 4AGSA 4EF0A 5EL8A 3GUSA 18GSA 4K7NA 5CRGA 3TKSA 5IOWA 3LJRA 1BAYA 1MD3A 4BVXB 1AQWA 4HUAA 1Y1UA 1NW2A 2DIZA 1U88A 1U3AA 1THXA 5CO3A 3F3RA 3DVXA 2H72A 1M2BA 2HZEA 3ERFA 1YEXA 4PNFA 3ME7A 2B5EA 2VKZG 4V1Ag 2WW1A 4POLA 1YQ1A 5IO0A 3ZFBA 1PFOA 3GH6A 1OKDA 4POKA 1Q4JA 4DEJA 2FWHA 4OFTA 1FB6A 4KW6A 4MPGA 6GSWA 1X0RA 1HNBA 2WS2A 3M1GA 5E4WA 3BCKA 2WVXA 3D0ZA 4NMUA 2WULA 3GX0A 4IJIA 4K0NA 5J5NA 4ZIJA 4QL7A 3O6TA 5D73A 3LGCA 1PL2A 3FR9A 3WD6A 2HNLA 4MK3A 2VLTA 4I8BA 1XZOA 3F4TA 3PH9A 4GWRA 3LFLA 1ERUA 5KOWA 5J4YA 1JLWA 1XWGA 4GSSA 6GSSA 4HQZA 3FW2A 1KEBA 3EURA 4KCEA 4MA9A 4N0VA 2F8FA 1TTZA 4AF2A 4FQUA 2KOKA 2VL2C 1JZRA 1SJ6A 5ECIB 2K18A 1XWAA 5F0GA 2XBQA 3FEUA 2GSRA 1YDKA 4GQCA 1NHYA 5DQYA 1F3AA 1XBSA 5JWQB 1G7EA 1WOUA 1TU7A 3W6GA 4EO3A 3RDWA 3KXOA 2J9HA 3BBYA 4EVMA 2GT5A 1GP1A 5GAPD 1SENA 1EP7A 5DJLA 5G1KA 2O85A 1LU4A 2V41A 4KA0A 2FWFA 2K6VA 3HYPA 1OKTA 2HRKA 4F03A 2AV4A 3TGZA 2H66A 2VL2A 3HKRA 3DEXA 3UOMA 3KJYA 2TIRA 3RHCA 4E8EA 1EGRA 3FKFA 1A8YA 4TXVA 2LUSA 1F9MA 3IV4A 3VURA 3PPUA 4PXOA 5IPHA 2CAIA 4L5OA 1V57A 4EE0A 1X9SB 1X5EA 1FB0A 2B3SA 1OC3A 1T00A 1OE8A 2LSTA 3I69A 5BMUA 1S3RA 4OO4A 2HRNA 1FVJA 3TB2A 1V2AA 2L5LA 5DVBA 2R0CA 1J9BA 1TRSA 2C3QA 2E7PA 4A5PA 14GSA 3HCZA 5HFIA 1YVLA 4I6XA 1TKDB 2OE3A 4YQVA 4XS4A 4G19A 2ES7A 3GYKA 3ZMLA 3O3TA 3DXBA 5CYYA 5AIXA 3GL5A 1EV9A 3C1RA 16GSA 2KP2A 4ML1A 5B7CA 4MF6A 4V2NA 4HSCX 4KCAA 5HR2A 4I5QA 1V40A 3I43A 2F3MA 4GRFA 1OVNA 4FH8A 1SL0B 4POMA 5J3RA 1K3YA 4LMWA 4X43A 3D4TA 3HJOA 3UL3A 4F82A 1GSSA 2BTOT 1A2JA 1BEDA 2JU5A 5D93A 4BVXA 1Z5YE 5F05A 2B1KA 1F3BA 3SBCA 1YEPA 2XBIA 1Z6MA 1FG4A 1Q98A 1XOBA 5KOXA 4IQAA 4G2EA 3G7JA 3GKKA 3P90A 4O5RA 2H71A 2REMA 3HVVA 3D4MA 3TJGA 4IHUA 4CY8A 4HEA2 2LRNA 3TKSE 1G6YA 2RM5A 4KDXA 5ECOB 2V6OA 4TVEA 3IHQA 5KN0A 4IBPA 1A8LA 1QK8A 1M3JA 4WBJA 4POBA 1R5AA 3TJJA 3K8NA 1SJIA 1SKSB 5G1LA 5DJMA 2C0GA 3GTUB 2V6KA 2TRXA 2HSHA 4G0KA 2QA1A 4TR1B 1DUGA 3VI7A 2GS3A 5D8IA 1XPVA 2MBSA 4IJ3A 1Z7PA 1TRVA 1C72A 3UBKA 3F9UA 5INYA 2EIOA 5HR1A 3M9KA 3L4NA 3CXGA 4BL7B 3M8NA 4ZILA 1SJZA 1TXXA 2FA4A 1H4OA 5E59A 4IQ1A 3N9JA 3CRTA 1EZKA 1ACVA 4JR4A 5DCGA 1ZGNA 4AJ8A 2VL3A 4ECCA 2L4CA 5CNWA 4Q5RA 5J47A 1YEWC 4X4JA 3HZ8A 3HJMA 4J57E 2DIYA 2OADA 3MAKA 2WGRA 5CAXA 1NHOA 2O7KA 2OA7A 1PX7A 2WVYA 3GSSA 3IC8A
chains in the Genus database with same CATH topology
4KDUA 3GURA 4JRRA 4DSQA 7GSSA 6GSVA 3RPNA 1EEMA 4BWQA 4Z2TA 4ISDA 2CVKA 5G2ZA 5B8BA 3TJBA 4J2FA 4GSNA 4Z2UA 3LQ7A 1M99A 3LXTA 4GLTA 2R0GA 13GSA 1TDIA 4YAVA 3GKMA 3UVHA 3QR6A 3F3QA 3HY2A 2PVOC 3P8WA 1URMA 3EWLA 5ECMB 1LBKA 2VCZA 1FOVA 1GTUA 1KBNA 4X0XA 2WDUA 3IDVA 2IMIA 4KGIA 2PGTA 1TK8B 2KP1A 3EMPA 4OWYA 5AISA 2R4VA 2H19A 1Z3EA 3DKSA 2YCDA 3GN3A 4FIWA 1AUCA 5B6NA 2PWJA 5F8BA 2OKAA 1GTAA 1XOAA 9GSSA 1SK1A 1VF2A 19GSA 2N5BA 2GSSA 1TOFA 4NPBA 2YPMA 2YWNA 1K0DA 4KUNA 4MABA 1Z9HA 4PGTA 5A4UA 3IAS2 1ERTA 2V32A 3CSIA 4IS0A 3WGXA 4Q5NA 4HJMA 1PL1A 3GMFA 4QMKA 1PKWA 2UZ8A 3ZYWA 3HMJG 2DJ2A 5A4WA 2CV4A 2JSZA 1QGVA 2ZCTA 5COHA 1RQMA 2H8LA 3HVXA 4RI6A 2WB9A 3GTUA 2CVDA 4MZCA 4HZ2A 3UIWA 3EYTA 5EPFA 3H1NA 4TR1A 2L4QA 1NM3A 4PQ1A 2JADA 4N0ZA 3VK9A 3F4SA 2I9HA 2LNTA 4TKYA 4G9HA 4IW9A 3TOUA 1THOA 5DALB 5IMFA 4Z7XA 2PVQA 4PX1A 3EVIA 3IC4A 4AJ7A 1O81A 5H5QA 4BL7A 4OO5A 2OE1A 3SWLA 1ZOFA 1TK5B 2GQMA 2H01A 3LEFA 2PMTA 2F9SA 3IR4A 5ABRA 5JCGA 1O8WA 1TP9A 4DVCA 1B8XA 4PUAA 3LYPA 2DMLA 3C71A 5DBQA 2R0PA 3DYRA 4D73B 1TK0B 3UVTA 4JZQA 2H0GA 4NHZA 1U3IA 2P5RA 2DJJA 3DVWA 1Z7RA 2EIQA 2GT6A 5ECSA 4AKHA 3APSA 1PA3A 4YAPA 3GKXA 3J7Yb 2QSIA 4XS1A 1DBYA 2KLXA 3EPTA 3P2AA 5D9WA 4YH2A 5A34B 3GX8A 5J40A 1F37A 3TU3B 3A5IA 4ZL9A 5JCWA 1YY7A 1ZYEA 2GGTA 2YOIA 3EE2A 2DC5A 2GQLA 4EC0A 3ERWA 3GA4A 2HI7A 2JSYA 3HJPA 1XW5A 1PX6A 2X8CA 4HDEA 3HHVA 1EWXA 3WGDA 2VIMA 3KZQA 3TRQA 4ECBA 3TKQA 2L5OA 4USSA 1E6BA 2C0EA 3KMOA 1GUKA 2PN8A 3I9V2 3A2VA 3ISOA 4XRAA 2IJYA 3D21A 3FZ4A 2H6XA 4W66A 1A2LA 2FNOA 4PURA 1GSEA 4JBBA 4CDOA 3IOSA 1QUWA 1B4QA 2R5GA 5GSSA 10GSA 1N25A 3F6DA 1M9BA 1JZWA 3HD5A 4TR4A 1BQ7A 1NSWA 4F9ZA 2VM2A 1VGLA 4KX4A 3GNJA 2YANA 5H5SA 1KTEA 3F8UA 5A1NB 1WJKA 4KSMA 4HU7A 1B4PA 1VF1A 4FYBA 1HD2A 2IMDA 4RQRA 2IWTA 4OFMA 4I2UA 2E0QA 3MWHA 1G6WA 2CAQA 3ZMKA 2O87A 2V2GA 2AHEA 4G10A 5FHIA 2YJHA 1TI3A 5KN2A 1S3AA 4PQIA 4ZBDA 5CRHA 3ME8A 2H1AA 2LQOA 1PN9A 3Q19A 2FWEA 2GVPA 1SD8A 2B7KA 2LS5A 4N10A 4TXOB 1GWCA 4IN0A 5B8AA 5IQYA 2OACA 1BX9A 3LYKA 4LL1B 12GSA 1T7PB 2LKUA 5D9TA 1USBA 1V98A 4KSOA 2DKHA 1R4WA 1W89A 3E9JB 3LSZA 5DALA 2HLSA 5LCZA 2YZUA 1X5DA 3TCOA 4KE3A 1O85A 3CWGA 3S9FA 2H76A 5CRDA 3KCMA 3KH9A 5IOXA 1K0MA 2H74A 1R5PA 1EP8A 3FHKA 4OD7A 2CX3A 3ZTLA 2DJ1A 1HQOA 3RPPA 1BG5A 1DSBA 3L9VA 1W4VA 4D73A 2G0FA 2RLIA 1XWCA 2QC7A 3M3MA 1GSYA 5IO2A 4WBRD 5F06A 4O7HA 2VCTA 4HZ4A 2MYGA 3QOUA 5H5RA 1GTIA 1UVZA 2YWMA 2VLUA 1TJDA 3CTGA 2GSQA 2O89A 4Q5FA 2VO4A 2G2QA 2B6MA 5BRTA 5CP1A 1TI1A 3VPTA 5C00A 1FOHA 2WRTA 5ID2B 5EVOA 1MD4A 3BOAA 1GUHA 3F0IA 1ILOA 4TN8A 2K9FA 2H73A 1EOGA 3F4RA 4I97A 2V1MA 2F8AA 4MF7A 1ON4A 2HE3A 2GZYA 4O5UA 3Q74A 3W8JA 3J7Yk 3ZREA 5ECPB 2FUG2 2PERA 2EFHA 4PNGA 1SD9A 4L0WA 4ID0A 1GL8A 3IA1A 1K0NA 3UEMA 2H1LA 4JR6A 2YP6A 1YF0A 3IHGA 5G30A 2R2JA 5A1NA 1UN2A 3IE3A 4TR3A 3ZLPA 1ZCPA 2LTKA 4AI6A 2HSMB 5A5KA 2EC4A 1PMTA 4H86A 3P7XA 4N30A 3O76A 2PPTA 4PTSA 2L59A 4N11A 4WF4A 3GHAA 3Q18A 1GLQA 4IVFA 4PQHA 4MJEA 3TJFA 3A3TA 4WEYA 2A4HA 2IPAA 2RM6A 2A2PA 3MYDA 3MSZA 1M0UA 2DKIA 3WYWA 1T4ZA 2DJ0A 3H79A 3TKPA 2ON7A 1O8XA 2LQQA 2B7JA 4TXOA 2LRTA 4IP6A 4YKGA 4XRDA 2GQKA 1WWJA 2K8SA 3E0UA 3APQA 1K3OA 2GZPA 2I1UA 3R2QA 3ZVJA 1OE7A 2LV3A 2VCQA 2HRAA 4K7IA 2FA8A 3G9BA 3G7IA 3HZ4A 1HNCA 5IM9A 1VF3A 4BVYB 3CMIA 3QCPA 4WF5A 5IMDA 2HXKA 2NDOA 5CRWA 3C1SA 1WIKA 4GQFA 4MP4A 1GTBA 3QAGA 1XWKA 1JHBA 1AIUA 3TRPA 1HNAA 3GSTA 2N5AA 2YNXA 1J08A 3C7MA 4XIHA 3PINA 3BD2A 4LL4B 1S3DA 3VWUA 3HVSA 3FY7A 4AKGA 3L9SA 5HR3A 1BG1A 1SYXA 5FT3A 1IYIA 2VD0A 3KP8A 2GSTA 1SVMA 2O5VA 1PRXA 3ERGA 3D5JA 4ZB8A 2H75A 1G7OA 4MJCA 4OCFA 4GDFA 1MDIA 4XS6A 3FZAA 5ID2A 2M72A 2VLVA 2CA8A 4Q5QA 3R3EA 2VCWA 4MH3A 1ZL9A 2MMNA 2C1YA 17GSA 1XXUA 2DLXA 3EC3A 1GULA 1T1VA 5A5HB 1BYEA 2AB6A 1LJRA 2VD1A 1YJ6A 2HZFA 1M2AA 3D6IA 3GV1A 4MZBA 2EFDA 4E68A 5HQPA 2HRFA 4HU9A 4EL1A 2R6KA 2WFCA 3ZVJD 5AIVA 4X1UA 1QQ2A 3CYNA 5ECKB 1A0RP 1IYHA 1FO5A 4DSRA 3G7YA 4YKFA 1GSDA 2IMEA 4DSSB 1A24A 2M80A 2B5YA 4IP1A 2IMFA 4MJBA 3N5OA 1AXDA 3Q6OA 2C80A 1K3LA 2PBJA 4HS1A 2KHPA 4K8MA 3GRXA 2OT3A 2P31A 1XCCA 4O92A 2HSMA 1K0AA 2YJ7A 1OC8A 2FY6A 1MTCA 4EKZA 4ZBBA 4MMMA 4CHSA 4PUFC 1BF5A 4MPFA 4NAXA 3F6FA 2VCVA 4NHWA 3QFBC 1PN0A 2I4AA 4KF9A 3M0FA 3U6VA 1AW9A 3TDGA 1TXUA 3QMXA 4G01A 4AKIA 1VF4A 1BJXA 2FWGA 2VL9A 3IRAA 3DD3A 2ALBA 4NV2A 2L6CA 4MNNA 2H6ZA 2I81A 1QXHA 5J41A 3A2XA 1JFUA 3RHBA 4ZB6A 3TUEA 3IBHA 3UBLA 1AQVA 4HJ2A 5G5EA 2HFDA 1MDKA 2B5XA 4KB3A 3GH9A 4RUVA 4BVYA 1I9DA 1R7HA 4XS4B 2DJKA 3H8QA 3WGEA 2MZCA 4K5SA 5J4VA 3CSJA 1XW9A 5L71A 4ZL7A 1YZXA 1OYJA 4E8HA 2QGVA 4EIPA 1PGTA 1UA5A 3ZZXA 1WRYA 4V2MA 5A4VA 5ECNB 4ZBAA 3NZNA 3KH7A 4L8EA 2JACA 2XC2A 2YN1A 4TW5A 4ZL8A 3WT2A 1JZDA 3RBTA 3H93A 2VUPA 3FZ9A 3E3EA 1SVLA 3FK8A 4O32A 4JU5A 1WE0A 1ML6A 2WZ9A 3I6AA 1B9YC 2DMMA 2YWIA 1I5GA 2DSAA 2FD3A 4EIQA 2D2ZA 1WP0A 2IMKA 1GSUA 3ZIJA 2AAWA 1XFLA 3VLNA 2AJQB 2X99A 4OFNA 1G0TA 1V9WA 4ULXA 22GSA 4AKXB 5A5HA 2LEGA 2VM1A 2XPDA 2JZSA 2EIRA 3QAVA 4KH7A 3EINA 6GSTA 1OC9B 2ZUPA 4IGJA 1ABAA 1SL2B 1ZYNA 4CW9A 1SKRB 3QD9A 4O5QA 5DCHA 5ECRB 3ED3A 1X5CA 2IFQB 1ZZYA 1GUMA 2KUCA 4J56E 4DSSA 3DIEA 4BWSA 5J4UA 5JWRB 1PD21 1H75A 3F63A 2C3TA 1M9AA 5B6MA 2C0DA 3W8SA 3KM6A 4JEDA 1X9MB 3WT1A 2LJKA 4K1FA 1SYRA 3QAWA 4RQXA 4L0UA 1YKCA 1GNWA 4GCIA 4NWYA 1FW1A 2M46A 4TOPA 2CZ3A 4G0IA 2Z9SA 4NXIA 2HT9A 1ERWA 2OBIA 3LXZA 1XW6A 6GSXA 2IN3A 3LW9A 3L78A 4QL9A 4MDCA 2YV9A 5KN3A 1FHEA 4K0GA 2H1GA 2X4AA 2F51A 2LJAA 3ZRDA 1JLVA 5F07A 3DMLA 5AN1A 2MMZA 2OBKA 1AAZA 2RUFA 1V58A 2B1LA 1SK0A 3KTLA 1B9XC 3MIXA 1VRSD 2OJLA 3DWVA 2TRCP 5A34A 3QFAC 3IXRA 5KN1A 4LA1A 4OCEA 5C04A 1B48A 2P0GA 20GSA 1SK2A 1CQHA 1E2YA 2WCIA 2JZRA 1EEJA 1AC1A 2QKEA 1XWBA 2X8HA 4F2IA 1GSQA 2A4VA 1K0CA 4WXTA 4MZWA 3VWXA 2I3YA 1XVQA 2P5QA 4YQMA 2X49A 1TRUA 5G31A 3DRNA 5DAKB 5EY6A 2C3NA 2GDRA 5IMCA 2IL3A 1DE2A 3DGQA 4L5LA 2A2SA 1OAZA 2AUVA 3FZ5A 3MDKA 4WR5A 1JZOA 4F0CA 4K2DA 4WETA 2H1DA 4ZXGA 1GH2A 4ACSA 1ZMAA 3QPMA 3TJKA 1YKAA 3TOTA 2MMOA 1GLPA 2R37A 1R26A 3KMNA 1M2DA 4LMVA 1MDJA 4TR0A 2O8VB 3VWVA 4ICYA 2X8GA 4GF0A 4ECJA 1GSFA 1RW1A 2EFEA 4XTSA 2HYXA 2MBTA 3C73A 3GKNA 3H4KA 3EU3A 2HSNB 2YV7A 3VWWA 1SL1B 2MMAA 1AQXA 4IKHA 5IMAA 2CVBA 1U6TA 5IIZA 3KP9A 1OC9A 3LG6A 3GFKA 3BJ5A 1Y25A 2L57A 8GSSA 1T3BA 2IFQA 1O73A 2IIYA 2RIIA 1X9WB 1CQGA 2LJRA 1ZYPA 5JWOB 1SU9A 5GSTA 1FVKA 3HXSA 4HQSA 3IPZA 3QDNA 4AJ6A 1WMJA 2H1BA 1SVOA 1GNEA 2NBSA 2GZZA 4KDYA 2FCHA 3VPQA 3NIVA 2PU9C 1ZYQB 4IELA 2FGXA 1EV4A 1TRWA 1TW9A 1TU8A 1ST9A 1N2AA 4OMVA 3L9UA 2FHEA 2JZTA 2LRCA 4V2LA 5ELGA 4HOJA 1PKZA 2GTUA 4K2XA 1F6MC 2JL4A 5JCUA 4ZB9A 5IPGA 1XIYA 1RK4A 4ZB7A 3A5WA 2PUKC 3NOFA 4BPYA 4I2TA 4BA7A 6GSUA 2ON5A 2QA2A 1K0BA 2CX4A 3KTBA 3HDCA 1QFNA 3IK7A 3LWAA 5HFKA 3PR8A 2VOCA 3LORA 5GZZB 1UC7A 3TKRA 2UV8G 4ML6A 1A2MA 5GAND 4ECIA 3C8EA 1XVWA 5D96A 1O6JA 5LNKe 3D22A 4K7OA 2NVLA 4K6XA 5HR0A 3AY8A 4F0BA 2VCXA 2VAFA 2HZEB 1Y6EA 3VFIA 1N8JA 1A0FA 2OE0A 1Z6NA 2HSYA 4GSTA 1ERVA 4FYUA 2HQTA 2J23A 2L6DA 2EFCA 3ZFLA 5AGYA 2X64A 3IK9A 4K5RA 1GRXA 2GLRA 3UAPA 3CTFA 4KAEA 2H0HA 5CREA 3BCIA 5J9CA 4Z2RA 2YZHA 4EDZA 3VI5A 3ZIVA 5G5FA 3CSHA 5DAKA 4N3ZA 5FWGA 3KD0A 4JE1A 4EXJA 2ZNMA 2A2RA 3FRCA 1MEKA 4NV5A 4WKWA 4G0LA 2CZ2A 4RI7A 1PQNA 1T4YA 1M7TA 2E2MA 4P3YB 4QQ7A 2CT6A 3FR6A 1PSQA 11GSA 3A2WA 4HI7A 5KEJA 5ECHB 2XPEA 1HYUA 2DJ3A 3EU4A 1F2EA 5ECQB 2C0FA 4FYCA 1YF1A 2AYTA 2H30A 4MLYA 1QMVA 3PGTA 5HFGA 1K0OA 1WPIA 3FR3A 1O7UA 3FYGA 3L0HA 3KGKA 1J0FA 3GL3A 2NPBA 4MH2A 2H6YA 4KNDA 2LNSA 3US3A 4MCUA 5IMVA 1EGOA 2HSNA 3M9JA 5LD0A 2N5FA 2K8VA 2HRKB 3RAZA 1A23A 2BJXA 4YQUA 4MF5A 5J9BA 3HA9A 4CY6A 1U87A 5ELAA 4ILFA 4EDYA 4K9ZA 4XCSA 3EMXA 4TRXA 3TRXA 3V1WA 3UJ1A 1S3CA 5D9VA 3OR5A 5ECLB 3FMWA 3UMAA 4GXZA 1FAAA 2DBCA 5BMUB 3ZITA 3ZL5A 2H0IA 2E2GA 2NTOA 5DQSA 3KEBA 3U5RE 4V1Ap 6GSYA 3JCML 4WR4A 2BMXA 2YWOA 3APOA 3IAM2 3TKSC 2R3XA 4GTUA 5DDLA 5IMZA 3KIJA 1DE1A 2WJUA 2FLSA 4MJAA 2RUEA 5ENUA 3MNGA 4FO5A 2H70A 2C4JA 3CBUA 3CRUA 4XHMA 1EOHA 2C8UA 2XHFA 4LLRA 3UARA 1T8EB 3GIXA 5D9XA 2CQ9A 1KNGA 4EUYA 1SKWB 4AGSA 4EF0A 5EL8A 3GUSA 18GSA 4K7NA 5CRGA 3TKSA 5IOWA 3LJRA 1BAYA 1MD3A 4BVXB 1AQWA 4HUAA 1Y1UA 1NW2A 2DIZA 1U88A 1U3AA 1THXA 5CO3A 3F3RA 3DVXA 2H72A 1M2BA 2HZEA 3ERFA 1YEXA 4PNFA 3ME7A 2B5EA 2VKZG 4V1Ag 4POLA 1YQ1A 5IO0A 3ZFBA 3GH6A 1OKDA 4POKA 1Q4JA 4DEJA 2FWHA 4OFTA 1FB6A 4KW6A 4MPGA 6GSWA 1X0RA 1HNBA 2WS2A 3M1GA 5E4WA 3BCKA 3D0ZA 4NMUA 2WULA 3GX0A 4IJIA 4K0NA 5J5NA 4ZIJA 4QL7A 3O6TA 5D73A 3LGCA 1PL2A 3FR9A 3WD6A 2HNLA 4MK3A 2VLTA 4I8BA 1XZOA 3F4TA 3PH9A 4GWRA 3LFLA 1ERUA 5KOWA 5J4YA 1JLWA 1XWGA 4GSSA 6GSSA 4HQZA 3FW2A 1KEBA 3EURA 4KCEA 4MA9A 4N0VA 2F8FA 1TTZA 4AF2A 4FQUA 2KOKA 2VL2C 1JZRA 1SJ6A 5ECIB 2K18A 1XWAA 5F0GA 2XBQA 3FEUA 2GSRA 1YDKA 4GQCA 1NHYA 5DQYA 1F3AA 1XBSA 5JWQB 1G7EA 1WOUA 1TU7A 3W6GA 4EO3A 3RDWA 3KXOA 2J9HA 3BBYA 4EVMA 2GT5A 1GP1A 5GAPD 1SENA 1EP7A 5DJLA 5G1KA 2O85A 1LU4A 2V41A 4KA0A 2FWFA 2K6VA 3HYPA 1OKTA 2HRKA 4F03A 2AV4A 3TGZA 2H66A 2VL2A 3HKRA 3DEXA 3UOMA 3KJYA 2TIRA 3RHCA 4E8EA 1EGRA 3FKFA 1A8YA 4TXVA 2LUSA 1F9MA 3IV4A 3VURA 3PPUA 4PXOA 5IPHA 2CAIA 4L5OA 1V57A 4EE0A 1X9SB 1X5EA 1FB0A 2B3SA 1OC3A 1T00A 1OE8A 2LSTA 3I69A 5BMUA 4OO4A 2HRNA 1FVJA 3TB2A 1V2AA 2L5LA 5DVBA 2R0CA 1J9BA 1TRSA 2C3QA 2E7PA 4A5PA 14GSA 3HCZA 5HFIA 1YVLA 4I6XA 1TKDB 2OE3A 4YQVA 4XS4A 4G19A 2ES7A 3GYKA 3ZMLA 3O3TA 3DXBA 5CYYA 5AIXA 3GL5A 1EV9A 3C1RA 16GSA 2KP2A 4ML1A 5B7CA 4MF6A 4V2NA 4KCAA 5HR2A 4I5QA 1V40A 3I43A 2F3MA 4GRFA 1OVNA 4FH8A 1SL0B 4POMA 5J3RA 1K3YA 4LMWA 4X43A 3D4TA 3HJOA 3UL3A 4F82A 1GSSA 2BTOT 1A2JA 1BEDA 2JU5A 5D93A 4BVXA 1Z5YE 5F05A 2B1KA 1F3BA 3SBCA 1YEPA 2XBIA 1Z6MA 1FG4A 1Q98A 1XOBA 5KOXA 4IQAA 4G2EA 3G7JA 3GKKA 3P90A 4O5RA 2H71A 2REMA 3HVVA 3D4MA 3TJGA 4IHUA 4CY8A 4HEA2 2LRNA 3TKSE 1G6YA 2RM5A 4KDXA 5ECOB 2V6OA 4TVEA 3IHQA 5KN0A 4IBPA 1A8LA 1QK8A 4WBJA 4POBA 1R5AA 3TJJA 3K8NA 1SJIA 1SKSB 5G1LA 5DJMA 2C0GA 3GTUB 2V6KA 2TRXA 2HSHA 4G0KA 2QA1A 4TR1B 1DUGA 3VI7A 2GS3A 5D8IA 1XPVA 2MBSA 4IJ3A 1Z7PA 1TRVA 1C72A 3UBKA 3F9UA 5INYA 2EIOA 5HR1A 3M9KA 3L4NA 3CXGA 4BL7B 3M8NA 4ZILA 1SJZA 1TXXA 2FA4A 1H4OA 5E59A 4IQ1A 3N9JA 3CRTA 1EZKA 1ACVA 4JR4A 5DCGA 1ZGNA 4AJ8A 2VL3A 4ECCA 2L4CA 5CNWA 4Q5RA 5J47A 4X4JA 3HZ8A 3HJMA 4J57E 2DIYA 2OADA 3MAKA 2WGRA 5CAXA 1NHOA 2O7KA 2OA7A 1PX7A 3GSSA 3IC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDU A;  3GUR A;  4JRR A;  4DSQ A;  7GSS A;  6GSV A;  3RPN A;  1EEM A;  4BWQ A;  4ISD A;  2CVK A;  5G2Z A;  5B8B A;  3TJB A;  4J2F A;  4GSN A;  3LQ7 A;  1M99 A;  3LXT A;  4GLT A;  13GS A;  1TDI A;  4YAV A;  3GKM A;  3UVH A;  3QR6 A;  3F3Q A;  3HY2 A;  2PVO C;  3P8W A;  1URM A;  3EWL A;  5ECM B;  1LBK A;  2VCZ A;  1FOV A;  1GTU A;  1KBN A;  4X0X A;  2WDU A;  3IDV A;  2IMI A;  4KGI A;  2PGT A;  1TK8 B;  2KP1 A;  3EMP A;  4OWY A;  5AIS A;  2R4V A;  2H19 A;  1Z3E A;  3DKS A;  2YCD A;  3GN3 A;  4FIW A;  1AUC A;  5B6N A;  2PWJ A;  5F8B A;  2OKA A;  1GTA A;  1XOA A;  9GSS A;  1SK1 A;  1VF2 A;  19GS A;  2N5B A;  2GSS A;  1TOF A;  4NPB A;  2YPM A;  2YWN A;  1K0D A;  4KUN A;  4MAB A;  1Z9H A;  4PGT A;  5A4U A;  3IAS 2;  1ERT A;  2V32 A;  3CSI A;  4IS0 A;  3WGX A;  4Q5N A;  4HJM A;  1PL1 A;  3GMF A;  1PKW A;  2UZ8 A;  3ZYW A;  2DJ2 A;  5A4W A;  2CV4 A;  2JSZ A;  1QGV A;  2ZCT A;  5COH A;  1RQM A;  2H8L A;  3HVX A;  4RI6 A;  2WB9 A;  3GTU A;  2CVD A;  4MZC A;  4HZ2 A;  3UIW A;  3EYT A;  5EPF A;  3H1N A;  4TR1 A;  2L4Q A;  1NM3 A;  4PQ1 A;  2JAD A;  4N0Z A;  3VK9 A;  3F4S A;  2I9H A;  2LNT A;  4TKY A;  4G9H A;  4IW9 A;  3TOU A;  1THO A;  5DAL B;  5IMF A;  4Z7X A;  2PVQ A;  4PX1 A;  3EVI A;  3IC4 A;  4AJ7 A;  1O81 A;  5H5Q A;  4BL7 A;  4OO5 A;  2OE1 A;  3SWL A;  1ZOF A;  1TK5 B;  2GQM A;  2H01 A;  3LEF A;  2PMT A;  2F9S A;  3IR4 A;  5ABR A;  5JCG A;  1O8W A;  1TP9 A;  4DVC A;  1B8X A;  4PUA A;  3LYP A;  2DML A;  3C71 A;  5DBQ A;  3DYR A;  4D73 B;  1TK0 B;  3UVT A;  4JZQ A;  2H0G A;  4NHZ A;  1U3I A;  2P5R A;  2DJJ A;  3DVW A;  1Z7R A;  2EIQ A;  2GT6 A;  5ECS A;  3APS A;  1PA3 A;  4YAP A;  3GKX A;  3J7Y b;  2QSI A;  4XS1 A;  1DBY A;  2KLX A;  3P2A A;  5D9W A;  4YH2 A;  3GX8 A;  1F37 A;  4ZL9 A;  5JCW A;  1YY7 A;  1ZYE A;  2GGT A;  2YOI A;  3EE2 A;  2DC5 A;  2GQL A;  4EC0 A;  3ERW A;  3GA4 A;  2HI7 A;  2JSY A;  3HJP A;  1XW5 A;  1PX6 A;  2X8C A;  4HDE A;  3HHV A;  1EWX A;  3WGD A;  2VIM A;  3KZQ A;  3TRQ A;  4ECB A;  3TKQ A;  2L5O A;  4USS A;  1E6B A;  2C0E A;  3KMO A;  1GUK A;  2PN8 A;  3I9V 2;  3A2V A;  3ISO A;  4XRA A;  2IJY A;  3D21 A;  3FZ4 A;  2H6X A;  1A2L A;  2FNO A;  4PUR A;  1GSE A;  4JBB A;  4CDO A;  3IOS A;  1QUW A;  1B4Q A;  2R5G A;  5GSS A;  10GS A;  3F6D A;  1M9B A;  1JZW A;  3HD5 A;  4TR4 A;  1BQ7 A;  1NSW A;  4F9Z A;  2VM2 A;  1VGL A;  4KX4 A;  3GNJ A;  2YAN A;  5H5S A;  1KTE A;  3F8U A;  1WJK A;  4KSM A;  4HU7 A;  1B4P A;  1VF1 A;  4FYB A;  1HD2 A;  2IMD A;  4RQR A;  2IWT A;  4I2U A;  4OFM A;  2E0Q A;  3MWH A;  1G6W A;  2CAQ A;  3ZMK A;  2O87 A;  2V2G A;  2AHE A;  4G10 A;  5FHI A;  2YJH A;  1TI3 A;  5KN2 A;  1S3A A;  4PQI A;  4ZBD A;  5CRH A;  3ME8 A;  2H1A A;  2LQO A;  1PN9 A;  3Q19 A;  2FWE A;  2GVP A;  1SD8 A;  2B7K A;  2LS5 A;  4N10 A;  4TXO B;  1GWC A;  4IN0 A;  5B8A A;  5IQY A;  2OAC A;  1BX9 A;  3LYK A;  4LL1 B;  12GS A;  1T7P B;  2LKU A;  5D9T A;  1USB A;  1V98 A;  4KSO A;  1R4W A;  1W89 A;  3E9J B;  3LSZ A;  5DAL A;  2HLS A;  5LCZ A;  2YZU A;  1X5D A;  3TCO A;  4KE3 A;  1O85 A;  3S9F A;  2H76 A;  5CRD A;  3KCM A;  3KH9 A;  5IOX A;  1K0M A;  2H74 A;  1R5P A;  1EP8 A;  3FHK A;  4OD7 A;  2CX3 A;  3ZTL A;  2DJ1 A;  1HQO A;  3RPP A;  1BG5 A;  1DSB A;  3L9V A;  1W4V A;  4D73 A;  2G0F A;  2RLI A;  1XWC A;  2QC7 A;  3M3M A;  1GSY A;  5IO2 A;  4WBR D;  5F06 A;  4O7H A;  2VCT A;  4HZ4 A;  2MYG A;  3QOU A;  5H5R A;  1GTI A;  1UVZ A;  2YWM A;  2VLU A;  1TJD A;  3CTG A;  2GSQ A;  2O89 A;  4Q5F A;  2VO4 A;  2G2Q A;  2B6M A;  5CP1 A;  1TI1 A;  3VPT A;  5C00 A;  2WRT A;  5ID2 B;  5EVO A;  1MD4 A;  3BOA A;  1GUH A;  3F0I A;  1ILO A;  4TN8 A;  2K9F A;  2H73 A;  1EOG A;  3F4R A;  4I97 A;  2V1M A;  2F8A A;  4MF7 A;  1ON4 A;  2HE3 A;  2GZY A;  3Q74 A;  3W8J A;  3J7Y k;  3ZRE A;  5ECP B;  2FUG 2;  2PER A;  4PNG A;  1SD9 A;  4L0W A;  4ID0 A;  1GL8 A;  3IA1 A;  1K0N A;  3UEM A;  4JR6 A;  2YP6 A;  1YF0 A;  5G30 A;  2R2J A;  1UN2 A;  3IE3 A;  4TR3 A;  3ZLP A;  1ZCP A;  2LTK A;  2HSM B;  5A5K A;  2EC4 A;  1PMT A;  4H86 A;  3P7X A;  4N30 A;  3O76 A;  2PPT A;  4PTS A;  2L59 A;  4N11 A;  4WF4 A;  3GHA A;  3Q18 A;  1GLQ A;  4IVF A;  4PQH A;  4MJE A;  3TJF A;  3A3T A;  4WEY A;  2IPA A;  2RM6 A;  3MSZ A;  1M0U A;  3WYW A;  1T4Z A;  2DJ0 A;  3H79 A;  3TKP A;  2ON7 A;  1O8X A;  2LQQ A;  2B7J A;  4TXO A;  2LRT A;  4IP6 A;  4XRD A;  2GQK A;  1WWJ A;  2K8S A;  3E0U A;  3APQ A;  1K3O A;  2GZP A;  2I1U A;  3R2Q A;  3ZVJ A;  1OE7 A;  2LV3 A;  2VCQ A;  2HRA A;  4K7I A;  2FA8 A;  3G9B A;  3G7I A;  3HZ4 A;  1HNC A;  5IM9 A;  1VF3 A;  4BVY B;  3CMI A;  3QCP A;  4WF5 A;  5IMD A;  2HXK A;  2NDO A;  5CRW A;  3C1S A;  1WIK A;  4GQF A;  4MP4 A;  1GTB A;  3QAG A;  1XWK A;  1JHB A;  1AIU A;  3TRP A;  1HNA A;  3GST A;  2N5A A;  2YNX A;  1J08 A;  3C7M A;  4XIH A;  3PIN A;  3BD2 A;  4LL4 B;  1S3D A;  3VWU A;  3HVS A;  3FY7 A;  3L9S A;  5HR3 A;  1SYX A;  5FT3 A;  1IYI A;  2VD0 A;  3KP8 A;  2GST A;  1PRX A;  3ERG A;  3D5J A;  4ZB8 A;  2H75 A;  1G7O A;  4MJC A;  4OCF A;  1MDI A;  4XS6 A;  3FZA A;  5ID2 A;  2M72 A;  2VLV A;  2CA8 A;  4Q5Q A;  3R3E A;  2VCW A;  4MH3 A;  1ZL9 A;  2MMN A;  2C1Y A;  17GS A;  1XXU A;  2DLX A;  3EC3 A;  1GUL A;  1T1V A;  1BYE A;  2AB6 A;  1LJR A;  2VD1 A;  1YJ6 A;  2HZF A;  1M2A A;  3D6I A;  3GV1 A;  4MZB A;  5HQP A;  2HRF A;  4HU9 A;  4EL1 A;  2R6K A;  2WFC A;  3ZVJ D;  5AIV A;  4X1U A;  1QQ2 A;  3CYN A;  5ECK B;  1A0R P;  1IYH A;  1FO5 A;  4DSR A;  3G7Y A;  1GSD A;  2IME A;  4DSS B;  1A24 A;  2M80 A;  2B5Y A;  4IP1 A;  2IMF A;  4MJB A;  3N5O A;  1AXD A;  3Q6O A;  2C80 A;  1K3L A;  2PBJ A;  4HS1 A;  2KHP A;  4K8M A;  3GRX A;  2P31 A;  1XCC A;  4O92 A;  2HSM A;  1K0A A;  2YJ7 A;  1OC8 A;  2FY6 A;  1MTC A;  4EKZ A;  4ZBB A;  4MMM A;  4CHS A;  4PUF C;  4MPF A;  4NAX A;  3F6F A;  2VCV A;  4NHW A;  3QFB C;  2I4A A;  4KF9 A;  3M0F A;  3U6V A;  1AW9 A;  3TDG A;  3QMX A;  1VF4 A;  1BJX A;  2FWG A;  2VL9 A;  3IRA A;  3DD3 A;  2ALB A;  4NV2 A;  2L6C A;  2H6Z A;  2I81 A;  1QXH A;  5J41 A;  3A2X A;  1JFU A;  3RHB A;  4ZB6 A;  3TUE A;  3IBH A;  3UBL A;  1AQV A;  4HJ2 A;  5G5E A;  2HFD A;  1MDK A;  2B5X A;  4KB3 A;  3GH9 A;  4RUV A;  4BVY A;  1I9D A;  1R7H A;  4XS4 B;  2DJK A;  3H8Q A;  3WGE A;  2MZC A;  3CSJ A;  1XW9 A;  5L71 A;  4ZL7 A;  1YZX A;  1OYJ A;  4E8H A;  2QGV A;  1PGT A;  1UA5 A;  3ZZX A;  1WRY A;  4V2M A;  5A4V A;  5ECN B;  4ZBA A;  3NZN A;  3KH7 A;  4L8E A;  2JAC A;  2XC2 A;  2YN1 A;  4TW5 A;  4ZL8 A;  3WT2 A;  1JZD A;  3RBT A;  3H93 A;  2VUP A;  3FZ9 A;  3E3E A;  3FK8 A;  4O32 A;  4JU5 A;  1WE0 A;  1ML6 A;  2WZ9 A;  3I6A A;  1B9Y C;  2DMM A;  2YWI A;  1I5G A;  2DSA A;  2FD3 A;  2D2Z A;  1WP0 A;  2IMK A;  1GSU A;  3ZIJ A;  2AAW A;  1XFL A;  3VLN A;  2AJQ B;  2X99 A;  4OFN A;  1G0T A;  1V9W A;  4ULX A;  22GS A;  2LEG A;  2VM1 A;  2XPD A;  2JZS A;  2EIR A;  3QAV A;  4KH7 A;  3EIN A;  6GST A;  1OC9 B;  2ZUP A;  4IGJ A;  1ABA A;  1SL2 B;  4CW9 A;  1SKR B;  3QD9 A;  5DCH A;  5ECR B;  3ED3 A;  1X5C A;  2IFQ B;  1ZZY A;  1GUM A;  2KUC A;  4J56 E;  4DSS A;  3DIE A;  4BWS A;  5J4U A;  5JWR B;  1PD2 1;  1H75 A;  3F63 A;  2C3T A;  1M9A A;  5B6M A;  2C0D A;  3W8S A;  3KM6 A;  4JED A;  1X9M B;  3WT1 A;  2LJK A;  4K1F A;  1SYR A;  3QAW A;  4RQX A;  4L0U A;  1YKC A;  1GNW A;  4GCI A;  4NWY A;  1FW1 A;  2M46 A;  4TOP A;  2CZ3 A;  4G0I A;  2Z9S A;  4NXI A;  2HT9 A;  1ERW A;  2OBI A;  3LXZ A;  1XW6 A;  6GSX A;  2IN3 A;  3L78 A;  4QL9 A;  4MDC A;  2YV9 A;  5KN3 A;  1FHE A;  4K0G A;  2H1G A;  2F51 A;  2LJA A;  3ZRD A;  1JLV A;  5F07 A;  3DML A;  5AN1 A;  2MMZ A;  2OBK A;  1AAZ A;  2RUF A;  1V58 A;  2B1L A;  1SK0 A;  3KTL A;  1B9X C;  1VRS D;  2OJL A;  3DWV A;  2TRC P;  3QFA C;  3IXR A;  5KN1 A;  4LA1 A;  4OCE A;  5C04 A;  1B48 A;  2P0G A;  20GS A;  1SK2 A;  1CQH A;  1E2Y A;  2WCI A;  2JZR A;  1EEJ A;  1AC1 A;  2QKE A;  1XWB A;  2X8H A;  4F2I A;  1GSQ A;  2A4V A;  1K0C A;  4WXT A;  4MZW A;  3VWX A;  2I3Y A;  1XVQ A;  2P5Q A;  4YQM A;  1TRU A;  5G31 A;  3DRN A;  5DAK B;  5EY6 A;  2C3N A;  2GDR A;  5IMC A;  2IL3 A;  1DE2 A;  3DGQ A;  4L5L A;  2A2S A;  1OAZ A;  2AUV A;  3FZ5 A;  3MDK A;  4WR5 A;  1JZO A;  4F0C A;  4K2D A;  4WET A;  2H1D A;  4ZXG A;  1GH2 A;  4ACS A;  1ZMA A;  3QPM A;  3TJK A;  1YKA A;  3TOT A;  2MMO A;  1GLP A;  2R37 A;  1R26 A;  3KMN A;  1M2D A;  4LMV A;  1MDJ A;  4TR0 A;  2O8V B;  3VWV A;  2X8G A;  4GF0 A;  4ECJ A;  1GSF A;  1RW1 A;  4XTS A;  2HYX A;  2MBT A;  3C73 A;  3GKN A;  3H4K A;  3EU3 A;  2HSN B;  2YV7 A;  3VWW A;  1SL1 B;  2MMA A;  1AQX A;  4IKH A;  5IMA A;  2CVB A;  1U6T A;  5IIZ A;  3KP9 A;  1OC9 A;  3LG6 A;  3GFK A;  3BJ5 A;  1Y25 A;  2L57 A;  8GSS A;  1T3B A;  2IFQ A;  1O73 A;  2IIY A;  2RII A;  1X9W B;  1CQG A;  2LJR A;  5JWO B;  1SU9 A;  5GST A;  1FVK A;  3HXS A;  4HQS A;  3IPZ A;  3QDN A;  4AJ6 A;  1WMJ A;  2H1B A;  1GNE A;  2NBS A;  2GZZ A;  4KDY A;  2FCH A;  3VPQ A;  3NIV A;  2PU9 C;  1ZYQ B;  4IEL A;  2FGX A;  1EV4 A;  1TRW A;  1TW9 A;  1TU8 A;  1ST9 A;  1N2A A;  4OMV A;  3L9U A;  2FHE A;  2JZT A;  2LRC A;  4V2L A;  5ELG A;  4HOJ A;  1PKZ A;  2GTU A;  1F6M C;  2JL4 A;  5JCU A;  4ZB9 A;  5IPG A;  1XIY A;  1RK4 A;  3A5W A;  2PUK C;  3NOF A;  4BPY A;  4I2T A;  4BA7 A;  6GSU A;  2ON5 A;  1K0B A;  2CX4 A;  3KTB A;  3HDC A;  1QFN A;  3IK7 A;  3LWA A;  5HFK A;  3PR8 A;  2VOC A;  3LOR A;  5GZZ B;  1UC7 A;  3TKR A;  4ML6 A;  1A2M A;  5GAN D;  4ECI A;  3C8E A;  1XVW A;  5D96 A;  1O6J A;  5LNK e;  3D22 A;  4K7O A;  2NVL A;  4K6X A;  5HR0 A;  3AY8 A;  4F0B A;  2VCX A;  2VAF A;  2HZE B;  1Y6E A;  3VFI A;  1N8J A;  1A0F A;  2OE0 A;  1Z6N A;  2HSY A;  4GST A;  1ERV A;  4FYU A;  2HQT A;  2J23 A;  2L6D A;  3ZFL A;  5AGY A;  2X64 A;  3IK9 A;  1GRX A;  2GLR A;  3UAP A;  3CTF A;  4KAE A;  2H0H A;  5CRE A;  3BCI A;  5J9C A;  2YZH A;  4EDZ A;  3VI5 A;  3ZIV A;  5G5F A;  3CSH A;  5DAK A;  5FWG A;  3KD0 A;  4JE1 A;  4EXJ A;  2ZNM A;  2A2R A;  3FRC A;  1MEK A;  4NV5 A;  4WKW A;  4G0L A;  2CZ2 A;  4RI7 A;  1PQN A;  1T4Y A;  1M7T A;  2E2M A;  4P3Y B;  4QQ7 A;  2CT6 A;  3FR6 A;  1PSQ A;  11GS A;  3A2W A;  4HI7 A;  5KEJ A;  5ECH B;  2XPE A;  1HYU A;  2DJ3 A;  3EU4 A;  4FYC A;  1F2E A;  5ECQ B;  2C0F A;  1YF1 A;  2AYT A;  2H30 A;  4MLY A;  1QMV A;  3PGT A;  5HFG A;  1K0O A;  1WPI A;  3FR3 A;  1O7U A;  3FYG A;  3L0H A;  3KGK A;  1J0F A;  3GL3 A;  2NPB A;  4MH2 A;  2H6Y A;  4KND A;  2LNS A;  3US3 A;  4MCU A;  5IMV A;  1EGO A;  3M9J A;  5LD0 A;  2N5F A;  2K8V A;  2HRK B;  3RAZ A;  1A23 A;  2BJX A;  4YQU A;  4MF5 A;  5J9B A;  3HA9 A;  1U87 A;  5ELA A;  4ILF A;  4EDY A;  4K9Z A;  4XCS A;  3EMX A;  4TRX A;  3TRX A;  3V1W A;  3UJ1 A;  1S3C A;  5D9V A;  3OR5 A;  5ECL B;  3UMA A;  4GXZ A;  1FAA A;  2DBC A;  3ZIT A;  3ZL5 A;  2H0I A;  2E2G A;  2NTO A;  5DQS A;  3KEB A;  3U5R E;  4V1A p;  6GSY A;  3JCM L;  4WR4 A;  2BMX A;  2YWO A;  3APO A;  3IAM 2;  3TKS C;  2R3X A;  4GTU A;  5DDL A;  5IMZ A;  3KIJ A;  1DE1 A;  2WJU A;  2FLS A;  4MJA A;  2RUE A;  5ENU A;  3MNG A;  4FO5 A;  2H70 A;  2C4J A;  3CBU A;  3CRU A;  4XHM A;  1EOH A;  2C8U A;  2XHF A;  4LLR A;  3UAR A;  1T8E B;  3GIX A;  5D9X A;  2CQ9 A;  1KNG A;  4EUY A;  1SKW B;  4AGS A;  4EF0 A;  5EL8 A;  3GUS A;  18GS A;  4K7N A;  5CRG A;  3TKS A;  5IOW A;  3LJR A;  1BAY A;  1MD3 A;  4BVX B;  1AQW A;  4HUA A;  1NW2 A;  2DIZ A;  1U88 A;  1U3A A;  1THX A;  5CO3 A;  3F3R A;  3DVX A;  2H72 A;  1M2B A;  2HZE A;  3ERF A;  1YEX A;  4PNF A;  3ME7 A;  2B5E A;  4V1A g;  4POL A;  1YQ1 A;  5IO0 A;  3ZFB A;  3GH6 A;  1OKD A;  4POK A;  1Q4J A;  4DEJ A;  2FWH A;  4OFT A;  1FB6 A;  4KW6 A;  4MPG A;  6GSW A;  1X0R A;  1HNB A;  2WS2 A;  3M1G A;  5E4W A;  3BCK A;  3D0Z A;  4NMU A;  2WUL A;  3GX0 A;  4IJI A;  4K0N A;  5J5N A;  4ZIJ A;  4QL7 A;  3O6T A;  5D73 A;  3LGC A;  1PL2 A;  3FR9 A;  3WD6 A;  2HNL A;  4MK3 A;  4I8B A;  2VLT A;  1XZO A;  3F4T A;  3PH9 A;  4GWR A;  3LFL A;  1ERU A;  1JLW A;  1XWG A;  4GSS A;  6GSS A;  4HQZ A;  3FW2 A;  1KEB A;  3EUR A;  4KCE A;  4MA9 A;  4N0V A;  2F8F A;  1TTZ A;  4AF2 A;  4FQU A;  2KOK A;  2VL2 C;  1JZR A;  1SJ6 A;  5ECI B;  2K18 A;  1XWA A;  5F0G A;  2XBQ A;  3FEU A;  2GSR A;  1YDK A;  4GQC A;  1NHY A;  5DQY A;  1F3A A;  1XBS A;  5JWQ B;  1G7E A;  1WOU A;  1TU7 A;  3W6G A;  4EO3 A;  3RDW A;  3KXO A;  2J9H A;  3BBY A;  4EVM A;  2GT5 A;  1GP1 A;  5GAP D;  1SEN A;  1EP7 A;  5DJL A;  5G1K A;  2O85 A;  1LU4 A;  2V41 A;  4KA0 A;  2FWF A;  2K6V A;  3HYP A;  1OKT A;  2HRK A;  4F03 A;  2AV4 A;  3TGZ A;  2H66 A;  2VL2 A;  3HKR A;  3DEX A;  3UOM A;  3KJY A;  2TIR A;  3RHC A;  4E8E A;  1EGR A;  3FKF A;  1A8Y A;  4TXV A;  2LUS A;  1F9M A;  3IV4 A;  3VUR A;  3PPU A;  4PXO A;  5IPH A;  2CAI A;  4L5O A;  1V57 A;  4EE0 A;  1X9S B;  1X5E A;  1FB0 A;  2B3S A;  1OC3 A;  1T00 A;  1OE8 A;  2LST A;  3I69 A;  5BMU A;  4OO4 A;  2HRN A;  1FVJ A;  3TB2 A;  1V2A A;  2L5L A;  5DVB A;  1J9B A;  1TRS A;  2C3Q A;  2E7P A;  14GS A;  3HCZ A;  5HFI A;  4I6X A;  1TKD B;  2OE3 A;  4YQV A;  4XS4 A;  4G19 A;  2ES7 A;  3GYK A;  3ZML A;  3O3T A;  3DXB A;  5CYY A;  5AIX A;  3GL5 A;  1EV9 A;  3C1R A;  16GS A;  2KP2 A;  4ML1 A;  5B7C A;  4MF6 A;  4V2N A;  4KCA A;  5HR2 A;  4I5Q A;  1V40 A;  3I43 A;  2F3M A;  4GRF A;  1OVN A;  4FH8 A;  1SL0 B;  4POM A;  5J3R A;  1K3Y A;  4LMW A;  4X43 A;  3D4T A;  3HJO A;  3UL3 A;  4F82 A;  1GSS A;  2BTO T;  1A2J A;  1BED A;  2JU5 A;  5D93 A;  4BVX A;  1Z5Y E;  5F05 A;  2B1K A;  1F3B A;  3SBC A;  1YEP A;  2XBI A;  1Z6M A;  1FG4 A;  1Q98 A;  1XOB A;  4IQA A;  4G2E A;  3G7J A;  3GKK A;  3P90 A;  4O5R A;  2H71 A;  2REM A;  3HVV A;  3D4M A;  3TJG A;  4IHU A;  4HEA 2;  2LRN A;  3TKS E;  1G6Y A;  2RM5 A;  4KDX A;  5ECO B;  2V6O A;  4TVE A;  3IHQ A;  5KN0 A;  4IBP A;  1A8L A;  1QK8 A;  4WBJ A;  4POB A;  1R5A A;  3TJJ A;  3K8N A;  1SJI A;  1SKS B;  5G1L A;  5DJM A;  2C0G A;  3GTU B;  2V6K A;  2TRX A;  2HSH A;  4G0K A;  4TR1 B;  1DUG A;  3VI7 A;  2GS3 A;  5D8I A;  1XPV A;  2MBS A;  4IJ3 A;  1Z7P A;  1TRV A;  1C72 A;  3UBK A;  3F9U A;  5INY A;  2EIO A;  5HR1 A;  3M9K A;  3L4N A;  3CXG A;  4BL7 B;  3M8N A;  4ZIL A;  1SJZ A;  1TXX A;  2FA4 A;  1H4O A;  5E59 A;  4IQ1 A;  3N9J A;  3CRT A;  1EZK A;  1ACV A;  4JR4 A;  5DCG A;  1ZGN A;  4AJ8 A;  2VL3 A;  4ECC A;  2L4C A;  5CNW A;  4Q5R A;  3HZ8 A;  3HJM A;  4J57 E;  2DIY A;  2OAD A;  3MAK A;  2WGR A;  5CAX A;  1NHO A;  2O7K A;  2OA7 A;  1PX7 A;  3GSS A;  3IC8 A; 
#chains in the Genus database with same CATH topology
 4KDU A;  3GUR A;  4JRR A;  4DSQ A;  7GSS A;  6GSV A;  3RPN A;  1EEM A;  4BWQ A;  4Z2T A;  4ISD A;  2CVK A;  5G2Z A;  5B8B A;  3TJB A;  4J2F A;  4GSN A;  4Z2U A;  3LQ7 A;  1M99 A;  3LXT A;  4GLT A;  2R0G A;  13GS A;  1TDI A;  4YAV A;  3GKM A;  3UVH A;  3QR6 A;  3F3Q A;  3HY2 A;  2PVO C;  3P8W A;  1URM A;  3EWL A;  5ECM B;  1LBK A;  2VCZ A;  1FOV A;  1GTU A;  1KBN A;  4X0X A;  2WDU A;  3IDV A;  2IMI A;  4KGI A;  2PGT A;  1TK8 B;  2KP1 A;  3EMP A;  4OWY A;  5AIS A;  2R4V A;  2H19 A;  1Z3E A;  3DKS A;  2YCD A;  3GN3 A;  2WW0 A;  4FIW A;  1AUC A;  5B6N A;  2PWJ A;  5F8B A;  2OKA A;  1GTA A;  1XOA A;  9GSS A;  1SK1 A;  1VF2 A;  19GS A;  4PI0 C;  2N5B A;  2GSS A;  1TOF A;  4NPB A;  2YPM A;  2YWN A;  1K0D A;  4KUN A;  4MAB A;  1Z9H A;  4PGT A;  5A4U A;  3IAS 2;  1ERT A;  2V32 A;  3CSI A;  4IS0 A;  3WGX A;  4Q5N A;  4HJM A;  1PL1 A;  3GMF A;  4QMK A;  1PKW A;  2UZ8 A;  3ZYW A;  3HMJ G;  2DJ2 A;  5A4W A;  2CV4 A;  2JSZ A;  1QGV A;  3RGB C;  2ZCT A;  5COH A;  2O3E A;  1RQM A;  2H8L A;  3HVX A;  4RI6 A;  2WB9 A;  3GTU A;  2CVD A;  4MZC A;  4HZ2 A;  3UIW A;  3EYT A;  5EPF A;  3H1N A;  4TR1 A;  2L4Q A;  1NM3 A;  4PQ1 A;  2JAD A;  4N0Z A;  3VK9 A;  3F4S A;  2I9H A;  2LNT A;  4TKY A;  4G9H A;  4IW9 A;  3TOU A;  1THO A;  5DAL B;  5IMF A;  4Z7X A;  2PVQ A;  4PX1 A;  3EVI A;  3IC4 A;  4AJ7 A;  1O81 A;  5H5Q A;  4BL7 A;  4OO5 A;  2OE1 A;  3SWL A;  1ZOF A;  1TK5 B;  2GQM A;  2H01 A;  3LEF A;  2PMT A;  2F9S A;  3IR4 A;  5ABR A;  5JCG A;  1O8W A;  1TP9 A;  4DVC A;  1B8X A;  4PUA A;  3LYP A;  2DML A;  3C71 A;  5DBQ A;  2R0P A;  3DYR A;  4D73 B;  1TK0 B;  3UVT A;  4JZQ A;  2H0G A;  4NHZ A;  1U3I A;  2P5R A;  2DJJ A;  3DVW A;  1Z7R A;  2EIQ A;  2GT6 A;  5ECS A;  4AKH A;  3APS A;  1PA3 A;  4YAP A;  3GKX A;  3J7Y b;  2QSI A;  4XS1 A;  1DBY A;  2KLX A;  3EPT A;  3P2A A;  5D9W A;  4YH2 A;  5A34 B;  3GX8 A;  5J40 A;  1F37 A;  3TU3 B;  3A5I A;  4ZL9 A;  5JCW A;  1YY7 A;  1ZYE A;  2GGT A;  2YOI A;  3EE2 A;  2DC5 A;  2GQL A;  4EC0 A;  3ERW A;  3GA4 A;  2HI7 A;  2JSY A;  3HJP A;  1XW5 A;  1PX6 A;  2X8C A;  4HDE A;  3HHV A;  1EWX A;  3WGD A;  2VIM A;  3KZQ A;  3TRQ A;  4ECB A;  2WVZ A;  2L5O A;  3TKQ A;  4USS A;  1E6B A;  2C0E A;  3KMO A;  1GUK A;  2PN8 A;  3I9V 2;  3A2V A;  3ISO A;  4XRA A;  2IJY A;  3D21 A;  3FZ4 A;  2H6X A;  4W66 A;  1A2L A;  2FNO A;  4PUR A;  1GSE A;  4JBB A;  4CDO A;  3IOS A;  1QUW A;  1B4Q A;  2R5G A;  5GSS A;  10GS A;  1N25 A;  3F6D A;  1M9B A;  1JZW A;  3HD5 A;  4TR4 A;  1BQ7 A;  1NSW A;  4F9Z A;  2VM2 A;  1VGL A;  4KX4 A;  3GNJ A;  2YAN A;  5H5S A;  1KTE A;  3F8U A;  5A1N B;  1WJK A;  4KSM A;  4HU7 A;  1B4P A;  1VF1 A;  4FYB A;  1HD2 A;  2IMD A;  4RQR A;  2IWT A;  4OFM A;  4I2U A;  2E0Q A;  3MWH A;  1G6W A;  2CAQ A;  3ZMK A;  2O87 A;  2V2G A;  2AHE A;  4G10 A;  5FHI A;  2YJH A;  1TI3 A;  5KN2 A;  1S3A A;  4PQI A;  4ZBD A;  5CRH A;  3ME8 A;  2H1A A;  2LQO A;  1PN9 A;  3Q19 A;  2FWE A;  2GVP A;  1SD8 A;  2B7K A;  2LS5 A;  4N10 A;  4TXO B;  1GWC A;  4IN0 A;  5B8A A;  5IQY A;  2OAC A;  1BX9 A;  3LYK A;  4LL1 B;  12GS A;  1T7P B;  2LKU A;  5D9T A;  1USB A;  1V98 A;  4KSO A;  2DKH A;  1R4W A;  1W89 A;  3E9J B;  3LSZ A;  5DAL A;  2HLS A;  5LCZ A;  2YZU A;  1X5D A;  3TCO A;  4KE3 A;  1O85 A;  3CWG A;  3S9F A;  2H76 A;  5CRD A;  3KCM A;  3KH9 A;  1M3I A;  5IOX A;  1K0M A;  2H74 A;  1R5P A;  1EP8 A;  3FHK A;  4OD7 A;  2CX3 A;  3ZTL A;  2DJ1 A;  1HQO A;  3RPP A;  1BG5 A;  1DSB A;  3L9V A;  1W4V A;  4D73 A;  2G0F A;  2RLI A;  1XWC A;  2QC7 A;  3M3M A;  1GSY A;  5IO2 A;  4WBR D;  5F06 A;  4O7H A;  2VCT A;  4HZ4 A;  2MYG A;  3QOU A;  5H5R A;  1GTI A;  2WZS A;  1UVZ A;  2YWM A;  2VLU A;  1TJD A;  3CTG A;  2GSQ A;  2O89 A;  4Q5F A;  2VO4 A;  2G2Q A;  2B6M A;  5BRT A;  5CP1 A;  1TI1 A;  3VPT A;  5C00 A;  1FOH A;  2WRT A;  5ID2 B;  5EVO A;  1MD4 A;  3BOA A;  1GUH A;  3F0I A;  1ILO A;  4TN8 A;  2K9F A;  2H73 A;  1EOG A;  3F4R A;  4I97 A;  2V1M A;  2F8A A;  4MF7 A;  1ON4 A;  2HE3 A;  2GZY A;  4O5U A;  3Q74 A;  3W8J A;  3J7Y k;  3ZRE A;  5ECP B;  2FUG 2;  2PER A;  2EFH A;  4PNG A;  1SD9 A;  4L0W A;  4ID0 A;  1GL8 A;  3IA1 A;  1K0N A;  3UEM A;  2H1L A;  4JR6 A;  2YP6 A;  1YF0 A;  3IHG A;  5G30 A;  2R2J A;  5A1N A;  1UN2 A;  3IE3 A;  4TR3 A;  3ZLP A;  1ZCP A;  2LTK A;  4AI6 A;  2HSM B;  5A5K A;  2EC4 A;  1PMT A;  4H86 A;  3P7X A;  4N30 A;  3O76 A;  2PPT A;  4PTS A;  2L59 A;  4N11 A;  4WF4 A;  3GHA A;  3Q18 A;  1GLQ A;  4IVF A;  4PQH A;  4MJE A;  3TJF A;  3A3T A;  4WEY A;  2A4H A;  2IPA A;  2RM6 A;  2A2P A;  3MYD A;  3MSZ A;  1M0U A;  2DKI A;  3WYW A;  1T4Z A;  2DJ0 A;  3H79 A;  3TKP A;  2ON7 A;  1O8X A;  2LQQ A;  2B7J A;  3CHX C;  4TXO A;  2LRT A;  4IP6 A;  4YKG A;  4XRD A;  2GQK A;  1WWJ A;  2K8S A;  3E0U A;  3APQ A;  1K3O A;  2GZP A;  2I1U A;  3R2Q A;  3ZVJ A;  1OE7 A;  2LV3 A;  2VCQ A;  2HRA A;  4K7I A;  2FA8 A;  3G9B A;  3G7I A;  3HZ4 A;  1HNC A;  5IM9 A;  1VF3 A;  4BVY B;  3CMI A;  3QCP A;  4WF5 A;  5IMD A;  2HXK A;  2NDO A;  5CRW A;  3C1S A;  1WIK A;  4GQF A;  4MP4 A;  1GTB A;  3QAG A;  1XWK A;  1JHB A;  1AIU A;  3TRP A;  1HNA A;  3GST A;  2N5A A;  2YNX A;  1J08 A;  3C7M A;  4XIH A;  3PIN A;  3BD2 A;  4LL4 B;  1S3D A;  3VWU A;  3HVS A;  3FY7 A;  4AKG A;  3L9S A;  5HR3 A;  1BG1 A;  1SYX A;  5FT3 A;  1IYI A;  2VD0 A;  3KP8 A;  2GST A;  1SVM A;  2O5V A;  1PRX A;  3ERG A;  3D5J A;  4ZB8 A;  2H75 A;  1G7O A;  4MJC A;  4OCF A;  4GDF A;  1MDI A;  4XS6 A;  3FZA A;  5ID2 A;  2M72 A;  2VLV A;  2CA8 A;  4Q5Q A;  3R3E A;  2VCW A;  4MH3 A;  1ZL9 A;  2MMN A;  2C1Y A;  17GS A;  1XXU A;  2DLX A;  3EC3 A;  1GUL A;  1T1V A;  5A5H B;  1BYE A;  2AB6 A;  1LJR A;  2VD1 A;  1YJ6 A;  2HZF A;  1M2A A;  3D6I A;  3GV1 A;  4MZB A;  2EFD A;  4E68 A;  2WW3 A;  5HQP A;  2HRF A;  4HU9 A;  4EL1 A;  2R6K A;  2WFC A;  3ZVJ D;  5AIV A;  4X1U A;  1QQ2 A;  3CYN A;  5ECK B;  1A0R P;  1IYH A;  1FO5 A;  4DSR A;  3G7Y A;  4YKF A;  1GSD A;  2IME A;  4DSS B;  1A24 A;  2M80 A;  2B5Y A;  4IP1 A;  2IMF A;  4MJB A;  3N5O A;  1AXD A;  3Q6O A;  2C80 A;  1K3L A;  2PBJ A;  4HS1 A;  2KHP A;  4K8M A;  3GRX A;  2OT3 A;  2P31 A;  1XCC A;  4O92 A;  2HSM A;  1K0A A;  2YJ7 A;  3HVN A;  1OC8 A;  2FY6 A;  1MTC A;  4EKZ A;  4ZBB A;  4MMM A;  4CHS A;  4PUF C;  1BF5 A;  4MPF A;  4NAX A;  3F6F A;  2VCV A;  4NHW A;  3QFB C;  1PN0 A;  2I4A A;  4KF9 A;  3M0F A;  3U6V A;  1AW9 A;  3TDG A;  1TXU A;  3QMX A;  4G01 A;  4AKI A;  1VF4 A;  1BJX A;  2FWG A;  2VL9 A;  3IRA A;  3DD3 A;  2ALB A;  4NV2 A;  2L6C A;  4MNN A;  2H6Z A;  2I81 A;  1QXH A;  5J41 A;  3A2X A;  1JFU A;  3RHB A;  4ZB6 A;  3TUE A;  3IBH A;  3UBL A;  1AQV A;  4HJ2 A;  5G5E A;  2HFD A;  1MDK A;  2B5X A;  4KB3 A;  3GH9 A;  4RUV A;  4BVY A;  1I9D A;  1R7H A;  4XS4 B;  2DJK A;  3H8Q A;  3WGE A;  2MZC A;  4K5S A;  5J4V A;  3CSJ A;  1XW9 A;  5L71 A;  4ZL7 A;  1YZX A;  1OYJ A;  4E8H A;  2QGV A;  4EIP A;  1PGT A;  1UA5 A;  2WW2 A;  3ZZX A;  1WRY A;  4V2M A;  5A4V A;  5ECN B;  4ZBA A;  3NZN A;  3KH7 A;  4L8E A;  2JAC A;  2XC2 A;  2YN1 A;  4TW5 A;  4ZL8 A;  4PI2 C;  3WT2 A;  1JZD A;  3RBT A;  3H93 A;  2VUP A;  3FZ9 A;  3E3E A;  1SVL A;  3FK8 A;  4O32 A;  4JU5 A;  1WE0 A;  1ML6 A;  2WZ9 A;  3I6A A;  1B9Y C;  2DMM A;  2YWI A;  1I5G A;  2DSA A;  2FD3 A;  4EIQ A;  2D2Z A;  1WP0 A;  2IMK A;  1GSU A;  3ZIJ A;  2AAW A;  1XFL A;  3VLN A;  2AJQ B;  2X99 A;  4OFN A;  1G0T A;  1V9W A;  4ULX A;  22GS A;  2O36 A;  4AKX B;  5A5H A;  2LEG A;  2VM1 A;  2XPD A;  2JZS A;  2EIR A;  4PHZ C;  3QAV A;  4KH7 A;  3EIN A;  6GST A;  1OC9 B;  2ZUP A;  4IGJ A;  1ABA A;  1SL2 B;  1ZYN A;  4CW9 A;  1SKR B;  3QD9 A;  4O5Q A;  5DCH A;  5ECR B;  3ED3 A;  1X5C A;  2IFQ B;  1ZZY A;  1GUM A;  2KUC A;  4J56 E;  4DSS A;  3DIE A;  4BWS A;  5J4U A;  5JWR B;  1PD2 1;  1H75 A;  3F63 A;  2C3T A;  1M9A A;  5B6M A;  2C0D A;  3W8S A;  3KM6 A;  4JED A;  1X9M B;  3WT1 A;  2LJK A;  4K1F A;  1SYR A;  3QAW A;  4RQX A;  4L0U A;  1YKC A;  1GNW A;  4GCI A;  4NWY A;  1FW1 A;  2M46 A;  4TOP A;  2CZ3 A;  4G0I A;  2Z9S A;  4NXI A;  2HT9 A;  1ERW A;  2OBI A;  3LXZ A;  1XW6 A;  6GSX A;  2IN3 A;  3LW9 A;  3L78 A;  4QL9 A;  4MDC A;  2YV9 A;  5KN3 A;  1FHE A;  4K0G A;  2H1G A;  2X4A A;  2F51 A;  2LJA A;  3ZRD A;  1JLV A;  5F07 A;  3DML A;  5AN1 A;  2MMZ A;  2OBK A;  1AAZ A;  2RUF A;  1V58 A;  2B1L A;  1SK0 A;  3KTL A;  1B9X C;  3MIX A;  1VRS D;  2OJL A;  3DWV A;  2TRC P;  5A34 A;  3QFA C;  3IXR A;  5KN1 A;  4LA1 A;  4OCE A;  5C04 A;  1B48 A;  2P0G A;  20GS A;  1SK2 A;  1CQH A;  1E2Y A;  2WCI A;  2JZR A;  1EEJ A;  1AC1 A;  2QKE A;  1XWB A;  2X8H A;  4F2I A;  1GSQ A;  2A4V A;  1K0C A;  4WXT A;  4MZW A;  3VWX A;  2I3Y A;  1XVQ A;  2P5Q A;  4YQM A;  3RFR C;  1I1I P;  2X49 A;  1TRU A;  5G31 A;  3DRN A;  5DAK B;  5EY6 A;  2C3N A;  2GDR A;  5IMC A;  4BIK A;  2IL3 A;  1DE2 A;  3DGQ A;  4L5L A;  2A2S A;  1OAZ A;  2AUV A;  3FZ5 A;  3MDK A;  4WR5 A;  1JZO A;  4F0C A;  4K2D A;  4WET A;  2H1D A;  4ZXG A;  1GH2 A;  4ACS A;  1ZMA A;  3QPM A;  3TJK A;  1YKA A;  3TOT A;  2MMO A;  1GLP A;  2R37 A;  1R26 A;  3KMN A;  1M2D A;  4LMV A;  1MDJ A;  4TR0 A;  2O8V B;  3VWV A;  4ICY A;  2X8G A;  4GF0 A;  4ECJ A;  1GSF A;  1S4B P;  1RW1 A;  2EFE A;  4XTS A;  2HYX A;  2MBT A;  3C73 A;  3GKN A;  3H4K A;  3EU3 A;  2HSN B;  2YV7 A;  3VWW A;  1SL1 B;  2MMA A;  1AQX A;  4IKH A;  5IMA A;  2CVB A;  1U6T A;  5IIZ A;  3KP9 A;  1OC9 A;  3LG6 A;  3GFK A;  3BJ5 A;  1Y25 A;  2L57 A;  8GSS A;  1T3B A;  2IFQ A;  1O73 A;  2IIY A;  2RII A;  1X9W B;  1CQG A;  2LJR A;  1ZYP A;  5JWO B;  1SU9 A;  5GST A;  1FVK A;  3HXS A;  4HQS A;  3IPZ A;  3QDN A;  4AJ6 A;  1WMJ A;  2H1B A;  1SVO A;  1GNE A;  2NBS A;  2GZZ A;  4KDY A;  2FCH A;  3VPQ A;  3NIV A;  2PU9 C;  1ZYQ B;  4IEL A;  2FGX A;  1EV4 A;  1TRW A;  1TW9 A;  1TU8 A;  1ST9 A;  1N2A A;  4OMV A;  3L9U A;  2FHE A;  2JZT A;  2LRC A;  4V2L A;  5ELG A;  4HOJ A;  1PKZ A;  2GTU A;  4K2X A;  1F6M C;  2JL4 A;  5JCU A;  4ZB9 A;  5IPG A;  1XG8 A;  1XIY A;  1RK4 A;  4ZB7 A;  3A5W A;  2PUK C;  3NOF A;  4BPY A;  4I2T A;  4BA7 A;  6GSU A;  2ON5 A;  2QA2 A;  1K0B A;  2CX4 A;  3KTB A;  3HDC A;  1QFN A;  3IK7 A;  3LWA A;  5HFK A;  3PR8 A;  2VOC A;  3LOR A;  5GZZ B;  1UC7 A;  3TKR A;  2UV8 G;  4ML6 A;  1A2M A;  5GAN D;  4ECI A;  3C8E A;  1XVW A;  5D96 A;  3CQF A;  1O6J A;  5LNK e;  3D22 A;  4K7O A;  2NVL A;  4K6X A;  5HR0 A;  3AY8 A;  4F0B A;  2VCX A;  2VAF A;  2HZE B;  1Y6E A;  3VFI A;  1N8J A;  1A0F A;  2OE0 A;  1Z6N A;  4FXY P;  2HSY A;  4GST A;  1ERV A;  4FYU A;  2HQT A;  2J23 A;  2L6D A;  2EFC A;  3ZFL A;  5AGY A;  2X64 A;  3IK9 A;  4K5R A;  1GRX A;  2GLR A;  3UAP A;  3CTF A;  4KAE A;  2H0H A;  2WVX B;  5CRE A;  3BCI A;  5J9C A;  4Z2R A;  2YZH A;  4EDZ A;  3VI5 A;  3ZIV A;  5G5F A;  3CSH A;  5DAK A;  4N3Z A;  5FWG A;  3KD0 A;  4JE1 A;  4EXJ A;  2ZNM A;  2A2R A;  3FRC A;  1MEK A;  4NV5 A;  4WKW A;  4G0L A;  2CZ2 A;  4RI7 A;  1PQN A;  1T4Y A;  1M7T A;  2E2M A;  4P3Y B;  4QQ7 A;  2CT6 A;  3FR6 A;  1PSQ A;  11GS A;  3A2W A;  4HI7 A;  5KEJ A;  5ECH B;  2XPE A;  1HYU A;  2DJ3 A;  3EU4 A;  1F2E A;  5ECQ B;  2C0F A;  4FYC A;  1YF1 A;  2AYT A;  2H30 A;  4MLY A;  1QMV A;  3PGT A;  5HFG A;  1K0O A;  1WPI A;  3FR3 A;  1O7U A;  3FYG A;  3L0H A;  3KGK A;  1J0F A;  3GL3 A;  2NPB A;  4MH2 A;  2H6Y A;  4KND A;  2LNS A;  3US3 A;  4MCU A;  5IMV A;  1EGO A;  2HSN A;  3M9J A;  5LD0 A;  2N5F A;  2K8V A;  2HRK B;  3RAZ A;  1A23 A;  2BJX A;  4YQU A;  4MF5 A;  5J9B A;  3HA9 A;  4CY6 A;  1U87 A;  5ELA A;  4ILF A;  4EDY A;  4K9Z A;  4XCS A;  3EMX A;  4TRX A;  3TRX A;  3V1W A;  3UJ1 A;  1S3C A;  5D9V A;  3OR5 A;  5ECL B;  3FMW A;  3UMA A;  4GXZ A;  1FAA A;  2DBC A;  5BMU B;  3ZIT A;  3ZL5 A;  2H0I A;  2E2G A;  2NTO A;  5DQS A;  3KEB A;  3U5R E;  4V1A p;  6GSY A;  3JCM L;  4WR4 A;  2BMX A;  2YWO A;  3APO A;  3IAM 2;  3TKS C;  2R3X A;  4GTU A;  5DDL A;  5IMZ A;  3KIJ A;  1DE1 A;  2WJU A;  2FLS A;  4MJA A;  2RUE A;  5ENU A;  3MNG A;  4FO5 A;  2H70 A;  2C4J A;  3CBU A;  3CRU A;  4XHM A;  1EOH A;  2C8U A;  2XHF A;  4LLR A;  3UAR A;  1T8E B;  3GIX A;  5D9X A;  2CQ9 A;  1KNG A;  4EUY A;  1SKW B;  4AGS A;  4EF0 A;  5EL8 A;  3GUS A;  18GS A;  4K7N A;  5CRG A;  3TKS A;  5IOW A;  3LJR A;  1BAY A;  1MD3 A;  4BVX B;  1AQW A;  4HUA A;  1Y1U A;  1NW2 A;  2DIZ A;  1U88 A;  1U3A A;  1THX A;  5CO3 A;  3F3R A;  3DVX A;  2H72 A;  1M2B A;  2HZE A;  3ERF A;  1YEX A;  4PNF A;  3ME7 A;  2B5E A;  2VKZ G;  4V1A g;  2WW1 A;  4POL A;  1YQ1 A;  5IO0 A;  3ZFB A;  1PFO A;  3GH6 A;  1OKD A;  4POK A;  1Q4J A;  4DEJ A;  2FWH A;  4OFT A;  1FB6 A;  4KW6 A;  4MPG A;  6GSW A;  1X0R A;  1HNB A;  2WS2 A;  3M1G A;  5E4W A;  3BCK A;  2WVX A;  3D0Z A;  4NMU A;  2WUL A;  3GX0 A;  4IJI A;  4K0N A;  5J5N A;  4ZIJ A;  4QL7 A;  3O6T A;  5D73 A;  3LGC A;  1PL2 A;  3FR9 A;  3WD6 A;  2HNL A;  4MK3 A;  2VLT A;  4I8B A;  1XZO A;  3F4T A;  3PH9 A;  4GWR A;  3LFL A;  1ERU A;  5KOW A;  5J4Y A;  1JLW A;  1XWG A;  4GSS A;  6GSS A;  4HQZ A;  3FW2 A;  1KEB A;  3EUR A;  4KCE A;  4MA9 A;  4N0V A;  2F8F A;  1TTZ A;  4AF2 A;  4FQU A;  2KOK A;  2VL2 C;  1JZR A;  1SJ6 A;  5ECI B;  2K18 A;  1XWA A;  5F0G A;  2XBQ A;  3FEU A;  2GSR A;  1YDK A;  4GQC A;  1NHY A;  5DQY A;  1F3A A;  1XBS A;  5JWQ B;  1G7E A;  1WOU A;  1TU7 A;  3W6G A;  4EO3 A;  3RDW A;  3KXO A;  2J9H A;  3BBY A;  4EVM A;  2GT5 A;  1GP1 A;  5GAP D;  1SEN A;  1EP7 A;  5DJL A;  5G1K A;  2O85 A;  1LU4 A;  2V41 A;  4KA0 A;  2FWF A;  2K6V A;  3HYP A;  1OKT A;  2HRK A;  4F03 A;  2AV4 A;  3TGZ A;  2H66 A;  2VL2 A;  3HKR A;  3DEX A;  3UOM A;  3KJY A;  2TIR A;  3RHC A;  4E8E A;  1EGR A;  3FKF A;  1A8Y A;  4TXV A;  2LUS A;  1F9M A;  3IV4 A;  3VUR A;  3PPU A;  4PXO A;  5IPH A;  2CAI A;  4L5O A;  1V57 A;  4EE0 A;  1X9S B;  1X5E A;  1FB0 A;  2B3S A;  1OC3 A;  1T00 A;  1OE8 A;  2LST A;  3I69 A;  5BMU A;  1S3R A;  4OO4 A;  2HRN A;  1FVJ A;  3TB2 A;  1V2A A;  2L5L A;  5DVB A;  2R0C A;  1J9B A;  1TRS A;  2C3Q A;  2E7P A;  4A5P A;  14GS A;  3HCZ A;  5HFI A;  1YVL A;  4I6X A;  1TKD B;  2OE3 A;  4YQV A;  4XS4 A;  4G19 A;  2ES7 A;  3GYK A;  3ZML A;  3O3T A;  3DXB A;  5CYY A;  5AIX A;  3GL5 A;  1EV9 A;  3C1R A;  16GS A;  2KP2 A;  4ML1 A;  5B7C A;  4MF6 A;  4V2N A;  4HSC X;  4KCA A;  5HR2 A;  4I5Q A;  1V40 A;  3I43 A;  2F3M A;  4GRF A;  1OVN A;  4FH8 A;  1SL0 B;  4POM A;  5J3R A;  1K3Y A;  4LMW A;  4X43 A;  3D4T A;  3HJO A;  3UL3 A;  4F82 A;  1GSS A;  2BTO T;  1A2J A;  1BED A;  2JU5 A;  5D93 A;  4BVX A;  1Z5Y E;  5F05 A;  2B1K A;  1F3B A;  3SBC A;  1YEP A;  2XBI A;  1Z6M A;  1FG4 A;  1Q98 A;  1XOB A;  5KOX A;  4IQA A;  4G2E A;  3G7J A;  3GKK A;  3P90 A;  4O5R A;  2H71 A;  2REM A;  3HVV A;  3D4M A;  3TJG A;  4IHU A;  4CY8 A;  4HEA 2;  2LRN A;  3TKS E;  1G6Y A;  2RM5 A;  4KDX A;  5ECO B;  2V6O A;  4TVE A;  3IHQ A;  5KN0 A;  4IBP A;  1A8L A;  1QK8 A;  1M3J A;  4WBJ A;  4POB A;  1R5A A;  3TJJ A;  3K8N A;  1SJI A;  1SKS B;  5G1L A;  5DJM A;  2C0G A;  3GTU B;  2V6K A;  2TRX A;  2HSH A;  4G0K A;  2QA1 A;  4TR1 B;  1DUG A;  3VI7 A;  2GS3 A;  5D8I A;  1XPV A;  2MBS A;  4IJ3 A;  1Z7P A;  1TRV A;  1C72 A;  3UBK A;  3F9U A;  5INY A;  2EIO A;  5HR1 A;  3M9K A;  3L4N A;  3CXG A;  4BL7 B;  3M8N A;  4ZIL A;  1SJZ A;  1TXX A;  2FA4 A;  1H4O A;  5E59 A;  4IQ1 A;  3N9J A;  3CRT A;  1EZK A;  1ACV A;  4JR4 A;  5DCG A;  1ZGN A;  4AJ8 A;  2VL3 A;  4ECC A;  2L4C A;  5CNW A;  4Q5R A;  5J47 A;  1YEW C;  4X4J A;  3HZ8 A;  3HJM A;  4J57 E;  2DIY A;  2OAD A;  3MAK A;  2WGR A;  5CAX A;  1NHO A;  2O7K A;  2OA7 A;  1PX7 A;  2WVY A;  3GSS A;  3IC8 A; 
#chains in the Genus database with same CATH homology
 4KDU A;  3GUR A;  4JRR A;  4DSQ A;  7GSS A;  6GSV A;  3RPN A;  1EEM A;  4BWQ A;  4Z2T A;  4ISD A;  2CVK A;  5G2Z A;  5B8B A;  3TJB A;  4J2F A;  4GSN A;  4Z2U A;  3LQ7 A;  1M99 A;  3LXT A;  4GLT A;  2R0G A;  13GS A;  1TDI A;  4YAV A;  3GKM A;  3UVH A;  3QR6 A;  3F3Q A;  3HY2 A;  2PVO C;  3P8W A;  1URM A;  3EWL A;  5ECM B;  1LBK A;  2VCZ A;  1FOV A;  1GTU A;  1KBN A;  4X0X A;  2WDU A;  3IDV A;  2IMI A;  4KGI A;  2PGT A;  1TK8 B;  2KP1 A;  3EMP A;  4OWY A;  5AIS A;  2R4V A;  2H19 A;  1Z3E A;  3DKS A;  2YCD A;  3GN3 A;  4FIW A;  1AUC A;  5B6N A;  2PWJ A;  5F8B A;  2OKA A;  1GTA A;  1XOA A;  9GSS A;  1SK1 A;  1VF2 A;  19GS A;  2N5B A;  2GSS A;  1TOF A;  4NPB A;  2YPM A;  2YWN A;  1K0D A;  4KUN A;  4MAB A;  1Z9H A;  4PGT A;  5A4U A;  3IAS 2;  1ERT A;  2V32 A;  3CSI A;  4IS0 A;  3WGX A;  4Q5N A;  4HJM A;  1PL1 A;  3GMF A;  4QMK A;  1PKW A;  2UZ8 A;  3ZYW A;  3HMJ G;  2DJ2 A;  5A4W A;  2CV4 A;  2JSZ A;  1QGV A;  2ZCT A;  5COH A;  1RQM A;  2H8L A;  3HVX A;  4RI6 A;  2WB9 A;  3GTU A;  2CVD A;  4MZC A;  4HZ2 A;  3UIW A;  3EYT A;  5EPF A;  3H1N A;  4TR1 A;  2L4Q A;  1NM3 A;  4PQ1 A;  2JAD A;  4N0Z A;  3VK9 A;  3F4S A;  2I9H A;  2LNT A;  4TKY A;  4G9H A;  4IW9 A;  3TOU A;  1THO A;  5DAL B;  5IMF A;  4Z7X A;  2PVQ A;  4PX1 A;  3EVI A;  3IC4 A;  4AJ7 A;  1O81 A;  5H5Q A;  4BL7 A;  4OO5 A;  2OE1 A;  3SWL A;  1ZOF A;  1TK5 B;  2GQM A;  2H01 A;  3LEF A;  2PMT A;  2F9S A;  3IR4 A;  5ABR A;  5JCG A;  1O8W A;  1TP9 A;  4DVC A;  1B8X A;  4PUA A;  3LYP A;  2DML A;  3C71 A;  5DBQ A;  2R0P A;  3DYR A;  4D73 B;  1TK0 B;  3UVT A;  4JZQ A;  2H0G A;  4NHZ A;  1U3I A;  2P5R A;  2DJJ A;  3DVW A;  1Z7R A;  2EIQ A;  2GT6 A;  5ECS A;  4AKH A;  3APS A;  1PA3 A;  4YAP A;  3GKX A;  3J7Y b;  2QSI A;  4XS1 A;  1DBY A;  2KLX A;  3EPT A;  3P2A A;  5D9W A;  4YH2 A;  5A34 B;  3GX8 A;  5J40 A;  1F37 A;  3TU3 B;  3A5I A;  4ZL9 A;  5JCW A;  1YY7 A;  1ZYE A;  2GGT A;  2YOI A;  3EE2 A;  2DC5 A;  2GQL A;  4EC0 A;  3ERW A;  3GA4 A;  2HI7 A;  2JSY A;  3HJP A;  1XW5 A;  1PX6 A;  2X8C A;  4HDE A;  3HHV A;  1EWX A;  3WGD A;  2VIM A;  3KZQ A;  3TRQ A;  4ECB A;  3TKQ A;  2L5O A;  4USS A;  1E6B A;  2C0E A;  3KMO A;  1GUK A;  2PN8 A;  3I9V 2;  3A2V A;  3ISO A;  4XRA A;  2IJY A;  3D21 A;  3FZ4 A;  2H6X A;  4W66 A;  1A2L A;  2FNO A;  4PUR A;  1GSE A;  4JBB A;  4CDO A;  3IOS A;  1QUW A;  1B4Q A;  2R5G A;  5GSS A;  10GS A;  1N25 A;  3F6D A;  1M9B A;  1JZW A;  3HD5 A;  4TR4 A;  1BQ7 A;  1NSW A;  4F9Z A;  2VM2 A;  1VGL A;  4KX4 A;  3GNJ A;  2YAN A;  5H5S A;  1KTE A;  3F8U A;  5A1N B;  1WJK A;  4KSM A;  4HU7 A;  1B4P A;  1VF1 A;  4FYB A;  1HD2 A;  2IMD A;  4RQR A;  2IWT A;  4OFM A;  4I2U A;  2E0Q A;  3MWH A;  1G6W A;  2CAQ A;  3ZMK A;  2O87 A;  2V2G A;  2AHE A;  4G10 A;  5FHI A;  2YJH A;  1TI3 A;  5KN2 A;  1S3A A;  4PQI A;  4ZBD A;  5CRH A;  3ME8 A;  2H1A A;  2LQO A;  1PN9 A;  3Q19 A;  2FWE A;  2GVP A;  1SD8 A;  2B7K A;  2LS5 A;  4N10 A;  4TXO B;  1GWC A;  4IN0 A;  5B8A A;  5IQY A;  2OAC A;  1BX9 A;  3LYK A;  4LL1 B;  12GS A;  1T7P B;  2LKU A;  5D9T A;  1USB A;  1V98 A;  4KSO A;  2DKH A;  1R4W A;  1W89 A;  3E9J B;  3LSZ A;  5DAL A;  2HLS A;  5LCZ A;  2YZU A;  1X5D A;  3TCO A;  4KE3 A;  1O85 A;  3CWG A;  3S9F A;  2H76 A;  5CRD A;  3KCM A;  3KH9 A;  5IOX A;  1K0M A;  2H74 A;  1R5P A;  1EP8 A;  3FHK A;  4OD7 A;  2CX3 A;  3ZTL A;  2DJ1 A;  1HQO A;  3RPP A;  1BG5 A;  1DSB A;  3L9V A;  1W4V A;  4D73 A;  2G0F A;  2RLI A;  1XWC A;  2QC7 A;  3M3M A;  1GSY A;  5IO2 A;  4WBR D;  5F06 A;  4O7H A;  2VCT A;  4HZ4 A;  2MYG A;  3QOU A;  5H5R A;  1GTI A;  1UVZ A;  2YWM A;  2VLU A;  1TJD A;  3CTG A;  2GSQ A;  2O89 A;  4Q5F A;  2VO4 A;  2G2Q A;  2B6M A;  5BRT A;  5CP1 A;  1TI1 A;  3VPT A;  5C00 A;  1FOH A;  2WRT A;  5ID2 B;  5EVO A;  1MD4 A;  3BOA A;  1GUH A;  3F0I A;  1ILO A;  4TN8 A;  2K9F A;  2H73 A;  1EOG A;  3F4R A;  4I97 A;  2V1M A;  2F8A A;  4MF7 A;  1ON4 A;  2HE3 A;  2GZY A;  4O5U A;  3Q74 A;  3W8J A;  3J7Y k;  3ZRE A;  5ECP B;  2FUG 2;  2PER A;  2EFH A;  4PNG A;  1SD9 A;  4L0W A;  4ID0 A;  1GL8 A;  3IA1 A;  1K0N A;  3UEM A;  2H1L A;  4JR6 A;  2YP6 A;  1YF0 A;  3IHG A;  5G30 A;  2R2J A;  5A1N A;  1UN2 A;  3IE3 A;  4TR3 A;  3ZLP A;  1ZCP A;  2LTK A;  4AI6 A;  2HSM B;  5A5K A;  2EC4 A;  1PMT A;  4H86 A;  3P7X A;  4N30 A;  3O76 A;  2PPT A;  4PTS A;  2L59 A;  4N11 A;  4WF4 A;  3GHA A;  3Q18 A;  1GLQ A;  4IVF A;  4PQH A;  4MJE A;  3TJF A;  3A3T A;  4WEY A;  2A4H A;  2IPA A;  2RM6 A;  2A2P A;  3MYD A;  3MSZ A;  1M0U A;  2DKI A;  3WYW A;  1T4Z A;  2DJ0 A;  3H79 A;  3TKP A;  2ON7 A;  1O8X A;  2LQQ A;  2B7J A;  4TXO A;  2LRT A;  4IP6 A;  4YKG A;  4XRD A;  2GQK A;  1WWJ A;  2K8S A;  3E0U A;  3APQ A;  1K3O A;  2GZP A;  2I1U A;  3R2Q A;  3ZVJ A;  1OE7 A;  2LV3 A;  2VCQ A;  2HRA A;  4K7I A;  2FA8 A;  3G9B A;  3G7I A;  3HZ4 A;  1HNC A;  5IM9 A;  1VF3 A;  4BVY B;  3CMI A;  3QCP A;  4WF5 A;  5IMD A;  2HXK A;  2NDO A;  5CRW A;  3C1S A;  1WIK A;  4GQF A;  4MP4 A;  1GTB A;  3QAG A;  1XWK A;  1JHB A;  1AIU A;  3TRP A;  1HNA A;  3GST A;  2N5A A;  2YNX A;  1J08 A;  3C7M A;  4XIH A;  3PIN A;  3BD2 A;  4LL4 B;  1S3D A;  3VWU A;  3HVS A;  3FY7 A;  4AKG A;  3L9S A;  5HR3 A;  1BG1 A;  1SYX A;  5FT3 A;  1IYI A;  2VD0 A;  3KP8 A;  2GST A;  1SVM A;  2O5V A;  1PRX A;  3ERG A;  3D5J A;  4ZB8 A;  2H75 A;  1G7O A;  4MJC A;  4OCF A;  4GDF A;  1MDI A;  4XS6 A;  3FZA A;  5ID2 A;  2M72 A;  2VLV A;  2CA8 A;  4Q5Q A;  3R3E A;  2VCW A;  4MH3 A;  1ZL9 A;  2MMN A;  2C1Y A;  17GS A;  1XXU A;  2DLX A;  3EC3 A;  1GUL A;  1T1V A;  5A5H B;  1BYE A;  2AB6 A;  1LJR A;  2VD1 A;  1YJ6 A;  2HZF A;  1M2A A;  3D6I A;  3GV1 A;  4MZB A;  2EFD A;  4E68 A;  5HQP A;  2HRF A;  4HU9 A;  4EL1 A;  2R6K A;  2WFC A;  3ZVJ D;  5AIV A;  4X1U A;  1QQ2 A;  3CYN A;  5ECK B;  1A0R P;  1IYH A;  1FO5 A;  4DSR A;  3G7Y A;  4YKF A;  1GSD A;  2IME A;  4DSS B;  1A24 A;  2M80 A;  2B5Y A;  4IP1 A;  2IMF A;  4MJB A;  3N5O A;  1AXD A;  3Q6O A;  2C80 A;  1K3L A;  2PBJ A;  4HS1 A;  2KHP A;  4K8M A;  3GRX A;  2OT3 A;  2P31 A;  1XCC A;  4O92 A;  2HSM A;  1K0A A;  2YJ7 A;  1OC8 A;  2FY6 A;  1MTC A;  4EKZ A;  4ZBB A;  4MMM A;  4CHS A;  4PUF C;  1BF5 A;  4MPF A;  4NAX A;  3F6F A;  2VCV A;  4NHW A;  3QFB C;  1PN0 A;  2I4A A;  4KF9 A;  3M0F A;  3U6V A;  1AW9 A;  3TDG A;  1TXU A;  3QMX A;  4G01 A;  4AKI A;  1VF4 A;  1BJX A;  2FWG A;  2VL9 A;  3IRA A;  3DD3 A;  2ALB A;  4NV2 A;  2L6C A;  4MNN A;  2H6Z A;  2I81 A;  1QXH A;  5J41 A;  3A2X A;  1JFU A;  3RHB A;  4ZB6 A;  3TUE A;  3IBH A;  3UBL A;  1AQV A;  4HJ2 A;  5G5E A;  2HFD A;  1MDK A;  2B5X A;  4KB3 A;  3GH9 A;  4RUV A;  4BVY A;  1I9D A;  1R7H A;  4XS4 B;  2DJK A;  3H8Q A;  3WGE A;  2MZC A;  4K5S A;  5J4V A;  3CSJ A;  1XW9 A;  5L71 A;  4ZL7 A;  1YZX A;  1OYJ A;  4E8H A;  2QGV A;  4EIP A;  1PGT A;  1UA5 A;  3ZZX A;  1WRY A;  4V2M A;  5A4V A;  5ECN B;  4ZBA A;  3NZN A;  3KH7 A;  4L8E A;  2JAC A;  2XC2 A;  2YN1 A;  4TW5 A;  4ZL8 A;  3WT2 A;  1JZD A;  3RBT A;  3H93 A;  2VUP A;  3FZ9 A;  3E3E A;  1SVL A;  3FK8 A;  4O32 A;  4JU5 A;  1WE0 A;  1ML6 A;  2WZ9 A;  3I6A A;  1B9Y C;  2DMM A;  2YWI A;  1I5G A;  2DSA A;  2FD3 A;  4EIQ A;  2D2Z A;  1WP0 A;  2IMK A;  1GSU A;  3ZIJ A;  2AAW A;  1XFL A;  3VLN A;  2AJQ B;  2X99 A;  4OFN A;  1G0T A;  1V9W A;  4ULX A;  22GS A;  4AKX B;  5A5H A;  2LEG A;  2VM1 A;  2XPD A;  2JZS A;  2EIR A;  3QAV A;  4KH7 A;  3EIN A;  6GST A;  1OC9 B;  2ZUP A;  4IGJ A;  1ABA A;  1SL2 B;  1ZYN A;  4CW9 A;  1SKR B;  3QD9 A;  4O5Q A;  5DCH A;  5ECR B;  3ED3 A;  1X5C A;  2IFQ B;  1ZZY A;  1GUM A;  2KUC A;  4J56 E;  4DSS A;  3DIE A;  4BWS A;  5J4U A;  5JWR B;  1PD2 1;  1H75 A;  3F63 A;  2C3T A;  1M9A A;  5B6M A;  2C0D A;  3W8S A;  3KM6 A;  4JED A;  1X9M B;  3WT1 A;  2LJK A;  4K1F A;  1SYR A;  3QAW A;  4RQX A;  4L0U A;  1YKC A;  1GNW A;  4GCI A;  4NWY A;  1FW1 A;  2M46 A;  4TOP A;  2CZ3 A;  4G0I A;  2Z9S A;  4NXI A;  2HT9 A;  1ERW A;  2OBI A;  3LXZ A;  1XW6 A;  6GSX A;  2IN3 A;  3LW9 A;  3L78 A;  4QL9 A;  4MDC A;  2YV9 A;  5KN3 A;  1FHE A;  4K0G A;  2H1G A;  2X4A A;  2F51 A;  2LJA A;  3ZRD A;  1JLV A;  5F07 A;  3DML A;  5AN1 A;  2MMZ A;  2OBK A;  1AAZ A;  2RUF A;  1V58 A;  2B1L A;  1SK0 A;  3KTL A;  1B9X C;  3MIX A;  1VRS D;  2OJL A;  3DWV A;  2TRC P;  5A34 A;  3QFA C;  3IXR A;  5KN1 A;  4LA1 A;  4OCE A;  5C04 A;  1B48 A;  2P0G A;  20GS A;  1SK2 A;  1CQH A;  1E2Y A;  2WCI A;  2JZR A;  1EEJ A;  1AC1 A;  2QKE A;  1XWB A;  2X8H A;  4F2I A;  1GSQ A;  2A4V A;  1K0C A;  4WXT A;  4MZW A;  3VWX A;  2I3Y A;  1XVQ A;  2P5Q A;  4YQM A;  2X49 A;  1TRU A;  5G31 A;  3DRN A;  5DAK B;  5EY6 A;  2C3N A;  2GDR A;  5IMC A;  2IL3 A;  1DE2 A;  3DGQ A;  4L5L A;  2A2S A;  1OAZ A;  2AUV A;  3FZ5 A;  3MDK A;  4WR5 A;  1JZO A;  4F0C A;  4K2D A;  4WET A;  2H1D A;  4ZXG A;  1GH2 A;  4ACS A;  1ZMA A;  3QPM A;  3TJK A;  1YKA A;  3TOT A;  2MMO A;  1GLP A;  2R37 A;  1R26 A;  3KMN A;  1M2D A;  4LMV A;  1MDJ A;  4TR0 A;  2O8V B;  3VWV A;  4ICY A;  2X8G A;  4GF0 A;  4ECJ A;  1GSF A;  1RW1 A;  2EFE A;  4XTS A;  2HYX A;  2MBT A;  3C73 A;  3GKN A;  3H4K A;  3EU3 A;  2HSN B;  2YV7 A;  3VWW A;  1SL1 B;  2MMA A;  1AQX A;  4IKH A;  5IMA A;  2CVB A;  1U6T A;  5IIZ A;  3KP9 A;  1OC9 A;  3LG6 A;  3GFK A;  3BJ5 A;  1Y25 A;  2L57 A;  8GSS A;  1T3B A;  2IFQ A;  1O73 A;  2IIY A;  2RII A;  1X9W B;  1CQG A;  2LJR A;  1ZYP A;  5JWO B;  1SU9 A;  5GST A;  1FVK A;  3HXS A;  4HQS A;  3IPZ A;  3QDN A;  4AJ6 A;  1WMJ A;  2H1B A;  1SVO A;  1GNE A;  2NBS A;  2GZZ A;  4KDY A;  2FCH A;  3VPQ A;  3NIV A;  2PU9 C;  1ZYQ B;  4IEL A;  2FGX A;  1EV4 A;  1TRW A;  1TW9 A;  1TU8 A;  1ST9 A;  1N2A A;  4OMV A;  3L9U A;  2FHE A;  2JZT A;  2LRC A;  4V2L A;  5ELG A;  4HOJ A;  1PKZ A;  2GTU A;  4K2X A;  1F6M C;  2JL4 A;  5JCU A;  4ZB9 A;  5IPG A;  1XIY A;  1RK4 A;  4ZB7 A;  3A5W A;  2PUK C;  3NOF A;  4BPY A;  4I2T A;  4BA7 A;  6GSU A;  2ON5 A;  2QA2 A;  1K0B A;  2CX4 A;  3KTB A;  3HDC A;  1QFN A;  3IK7 A;  3LWA A;  5HFK A;  3PR8 A;  2VOC A;  3LOR A;  5GZZ B;  1UC7 A;  3TKR A;  2UV8 G;  4ML6 A;  1A2M A;  5GAN D;  4ECI A;  3C8E A;  1XVW A;  5D96 A;  1O6J A;  5LNK e;  3D22 A;  4K7O A;  2NVL A;  4K6X A;  5HR0 A;  3AY8 A;  4F0B A;  2VCX A;  2VAF A;  2HZE B;  1Y6E A;  3VFI A;  1N8J A;  1A0F A;  2OE0 A;  1Z6N A;  2HSY A;  4GST A;  1ERV A;  4FYU A;  2HQT A;  2J23 A;  2L6D A;  2EFC A;  3ZFL A;  5AGY A;  2X64 A;  3IK9 A;  4K5R A;  1GRX A;  2GLR A;  3UAP A;  3CTF A;  4KAE A;  2H0H A;  5CRE A;  3BCI A;  5J9C A;  4Z2R A;  2YZH A;  4EDZ A;  3VI5 A;  3ZIV A;  5G5F A;  3CSH A;  5DAK A;  4N3Z A;  5FWG A;  3KD0 A;  4JE1 A;  4EXJ A;  2ZNM A;  2A2R A;  3FRC A;  1MEK A;  4NV5 A;  4WKW A;  4G0L A;  2CZ2 A;  4RI7 A;  1PQN A;  1T4Y A;  1M7T A;  2E2M A;  4P3Y B;  4QQ7 A;  2CT6 A;  3FR6 A;  1PSQ A;  11GS A;  3A2W A;  4HI7 A;  5KEJ A;  5ECH B;  2XPE A;  1HYU A;  2DJ3 A;  3EU4 A;  1F2E A;  5ECQ B;  2C0F A;  4FYC A;  1YF1 A;  2AYT A;  2H30 A;  4MLY A;  1QMV A;  3PGT A;  5HFG A;  1K0O A;  1WPI A;  3FR3 A;  1O7U A;  3FYG A;  3L0H A;  3KGK A;  1J0F A;  3GL3 A;  2NPB A;  4MH2 A;  2H6Y A;  4KND A;  2LNS A;  3US3 A;  4MCU A;  5IMV A;  1EGO A;  2HSN A;  3M9J A;  5LD0 A;  2N5F A;  2K8V A;  2HRK B;  3RAZ A;  1A23 A;  2BJX A;  4YQU A;  4MF5 A;  5J9B A;  3HA9 A;  4CY6 A;  1U87 A;  5ELA A;  4ILF A;  4EDY A;  4K9Z A;  4XCS A;  3EMX A;  4TRX A;  3TRX A;  3V1W A;  3UJ1 A;  1S3C A;  5D9V A;  3OR5 A;  5ECL B;  3FMW A;  3UMA A;  4GXZ A;  1FAA A;  2DBC A;  5BMU B;  3ZIT A;  3ZL5 A;  2H0I A;  2E2G A;  2NTO A;  5DQS A;  3KEB A;  3U5R E;  4V1A p;  6GSY A;  3JCM L;  4WR4 A;  2BMX A;  2YWO A;  3APO A;  3IAM 2;  3TKS C;  2R3X A;  4GTU A;  5DDL A;  5IMZ A;  3KIJ A;  1DE1 A;  2WJU A;  2FLS A;  4MJA A;  2RUE A;  5ENU A;  3MNG A;  4FO5 A;  2H70 A;  2C4J A;  3CBU A;  3CRU A;  4XHM A;  1EOH A;  2C8U A;  2XHF A;  4LLR A;  3UAR A;  1T8E B;  3GIX A;  5D9X A;  2CQ9 A;  1KNG A;  4EUY A;  1SKW B;  4AGS A;  4EF0 A;  5EL8 A;  3GUS A;  18GS A;  4K7N A;  5CRG A;  3TKS A;  5IOW A;  3LJR A;  1BAY A;  1MD3 A;  4BVX B;  1AQW A;  4HUA A;  1Y1U A;  1NW2 A;  2DIZ A;  1U88 A;  1U3A A;  1THX A;  5CO3 A;  3F3R A;  3DVX A;  2H72 A;  1M2B A;  2HZE A;  3ERF A;  1YEX A;  4PNF A;  3ME7 A;  2B5E A;  2VKZ G;  4V1A g;  4POL A;  1YQ1 A;  5IO0 A;  3ZFB A;  3GH6 A;  1OKD A;  4POK A;  1Q4J A;  4DEJ A;  2FWH A;  4OFT A;  1FB6 A;  4KW6 A;  4MPG A;  6GSW A;  1X0R A;  1HNB A;  2WS2 A;  3M1G A;  5E4W A;  3BCK A;  3D0Z A;  4NMU A;  2WUL A;  3GX0 A;  4IJI A;  4K0N A;  5J5N A;  4ZIJ A;  4QL7 A;  3O6T A;  5D73 A;  3LGC A;  1PL2 A;  3FR9 A;  3WD6 A;  2HNL A;  4MK3 A;  2VLT A;  4I8B A;  1XZO A;  3F4T A;  3PH9 A;  4GWR A;  3LFL A;  1ERU A;  5KOW A;  5J4Y A;  1JLW A;  1XWG A;  4GSS A;  6GSS A;  4HQZ A;  3FW2 A;  1KEB A;  3EUR A;  4KCE A;  4MA9 A;  4N0V A;  2F8F A;  1TTZ A;  4AF2 A;  4FQU A;  2KOK A;  2VL2 C;  1JZR A;  1SJ6 A;  5ECI B;  2K18 A;  1XWA A;  5F0G A;  2XBQ A;  3FEU A;  2GSR A;  1YDK A;  4GQC A;  1NHY A;  5DQY A;  1F3A A;  1XBS A;  5JWQ B;  1G7E A;  1WOU A;  1TU7 A;  3W6G A;  4EO3 A;  3RDW A;  3KXO A;  2J9H A;  3BBY A;  4EVM A;  2GT5 A;  1GP1 A;  5GAP D;  1SEN A;  1EP7 A;  5DJL A;  5G1K A;  2O85 A;  1LU4 A;  2V41 A;  4KA0 A;  2FWF A;  2K6V A;  3HYP A;  1OKT A;  2HRK A;  4F03 A;  2AV4 A;  3TGZ A;  2H66 A;  2VL2 A;  3HKR A;  3DEX A;  3UOM A;  3KJY A;  2TIR A;  3RHC A;  4E8E A;  1EGR A;  3FKF A;  1A8Y A;  4TXV A;  2LUS A;  1F9M A;  3IV4 A;  3VUR A;  3PPU A;  4PXO A;  5IPH A;  2CAI A;  4L5O A;  1V57 A;  4EE0 A;  1X9S B;  1X5E A;  1FB0 A;  2B3S A;  1OC3 A;  1T00 A;  1OE8 A;  2LST A;  3I69 A;  5BMU A;  4OO4 A;  2HRN A;  1FVJ A;  3TB2 A;  1V2A A;  2L5L A;  5DVB A;  2R0C A;  1J9B A;  1TRS A;  2C3Q A;  2E7P A;  4A5P A;  14GS A;  3HCZ A;  5HFI A;  1YVL A;  4I6X A;  1TKD B;  2OE3 A;  4YQV A;  4XS4 A;  4G19 A;  2ES7 A;  3GYK A;  3ZML A;  3O3T A;  3DXB A;  5CYY A;  5AIX A;  3GL5 A;  1EV9 A;  3C1R A;  16GS A;  2KP2 A;  4ML1 A;  5B7C A;  4MF6 A;  4V2N A;  4KCA A;  5HR2 A;  4I5Q A;  1V40 A;  3I43 A;  2F3M A;  4GRF A;  1OVN A;  4FH8 A;  1SL0 B;  4POM A;  5J3R A;  1K3Y A;  4LMW A;  4X43 A;  3D4T A;  3HJO A;  3UL3 A;  4F82 A;  1GSS A;  2BTO T;  1A2J A;  1BED A;  2JU5 A;  5D93 A;  4BVX A;  1Z5Y E;  5F05 A;  2B1K A;  1F3B A;  3SBC A;  1YEP A;  2XBI A;  1Z6M A;  1FG4 A;  1Q98 A;  1XOB A;  5KOX A;  4IQA A;  4G2E A;  3G7J A;  3GKK A;  3P90 A;  4O5R A;  2H71 A;  2REM A;  3HVV A;  3D4M A;  3TJG A;  4IHU A;  4CY8 A;  4HEA 2;  2LRN A;  3TKS E;  1G6Y A;  2RM5 A;  4KDX A;  5ECO B;  2V6O A;  4TVE A;  3IHQ A;  5KN0 A;  4IBP A;  1A8L A;  1QK8 A;  4WBJ A;  4POB A;  1R5A A;  3TJJ A;  3K8N A;  1SJI A;  1SKS B;  5G1L A;  5DJM A;  2C0G A;  3GTU B;  2V6K A;  2TRX A;  2HSH A;  4G0K A;  2QA1 A;  4TR1 B;  1DUG A;  3VI7 A;  2GS3 A;  5D8I A;  1XPV A;  2MBS A;  4IJ3 A;  1Z7P A;  1TRV A;  1C72 A;  3UBK A;  3F9U A;  5INY A;  2EIO A;  5HR1 A;  3M9K A;  3L4N A;  3CXG A;  4BL7 B;  3M8N A;  4ZIL A;  1SJZ A;  1TXX A;  2FA4 A;  1H4O A;  5E59 A;  4IQ1 A;  3N9J A;  3CRT A;  1EZK A;  1ACV A;  4JR4 A;  5DCG A;  1ZGN A;  4AJ8 A;  2VL3 A;  4ECC A;  2L4C A;  5CNW A;  4Q5R A;  5J47 A;  4X4J A;  3HZ8 A;  3HJM A;  4J57 E;  2DIY A;  2OAD A;  3MAK A;  2WGR A;  5CAX A;  1NHO A;  2O7K A;  2OA7 A;  1PX7 A;  3GSS A;  3IC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...