6GSTA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 79
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gstA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gstA01
3ZRDA 2N5AA 2YNXA 5D73A 3HZ4A 1FG4A 3F8UA 3K8NA 1FVJA 5D9XA 11GSA 2M46A 2VCTA 2CV4A 2CX3A 4OO5A 5AGYA 1GUKA 5IOXA 1T3BA 1K0MA 3FR3A 1YDKA 4E8HA 3WGDA 4HU7A 3BOAA 4P3YB 1K0OA 4ZXGA 1OVNA 2YZHA 1K3YA 5DJMA 2L5LA 3DD3A 4XS4B 5JWOB 4HQZA 1V40A 3IC4A 4FQUA 5J9BA 3CSIA 1FO5A 4GF0A 5EY6A 2CZ2A 5E59A 22GSA 3C1SA 3ZYWA 3TOTA 4KAEA 3KTBA 4G10A 3VI7A 3F4SA 3UEMA 5JCUA 1T4ZA 2KP1A 2DIYA 3LGCA 3FR6A 1AQWA 2GQMA 1W4VA 1XW5A 2GSRA 4BL7A 2JZSA 1PRXA 4JE1A 4DSSB 4HZ4A 2O85A 5D8IA 1JHBA 1LJRA 5J41A 3C73A 3WD6A 4MDCA 3HVXA 3WT2A 1UN2A 4JR4A 5DVBA 1S3DA 2JSZA 1AIUA 4EKZA 3D22A 1GSQA 3GYKA 1YEPA 4GSTA 1HNCA 3ERFA 3WT1A 3MDKA 3M3MA 2L4CA 1SD9A 2M72A 1N8JA 2R6KA 4KCAA 2L57A 2QSIA 2RM6A 4GQFA 1B4QA 1ST9A 1Z7RA 3KP8A 4HJMA 5KN0A 1WMJA 2HRNA 2CVKA 1T1VA 1Z5YE 1OE8A 2R3XA 1RW1A 2LRTA 4USSA 1XWGA 4HEA2 3HJMA 3I6AA 2AYTA 2E0QA 2FWGA 3OR5A 3SBCA 3GX8A 1JLWA 3CMIA 2WDUA 2H30A 1YZXA 2AB6A 3I9V2 3KH7A 4OCEA 1K3OA 3G7IA 3LG6A 4HZ2A 5FT3A 2FY6A 3FEUA 3N9JA 3DKSA 2LRNA 3KD0A 1Q4JA 4TN8A 2GVPA 3ISOA 5HQPA 1AAZA 3IAS2 4IBPA 1TRWA 2YWIA 5IMVA 4IP6A 3GKNA 2LKUA 2HZEB 3PGTA 3O76A 5AN1A 3U5RE 2E7PA 3E9JB 2H71A 4IJ3A 4J2FA 4WKWA 4XTSA 4WXTA 3P8WA 3PH9A 5ECIB 2HI7A 1EWXA 3W8SA 4J57E 4L0UA 3TJGA 2FA8A 2QKEA 3VPTA 3J7Yk 2H8LA 3ZIJA 1X0RA 4I97A 2G0FA 2HSYA 2IJYA 1CQGA 1OC3A 4OFTA 3KCMA 3R3EA 2RUEA 3HZ8A 2AAWA 1I9DA 1VF3A 3VLNA 3G9BA 1YF0A 4K6XA 1PX6A 1U6TA 4JRRA 4CHSA 1YF1A 1UA5A 1J9BA 1KEBA 3F4TA 4F82A 4XS4A 3L0HA 5B7CA 4FYBA 5GSSA 2H75A 3DXBA 4WETA 2C0EA 2OADA 4DSRA 3CSHA 4TR4A 2K9FA 1HNAA 1K0CA 4L5OA 2HNLA 4KA0A 2DIZA 1Z6NA 3DRNA 2VD1A 1BQ7A 4ACSA 2H76A 2HRKB 2JL4A 5B8AA 2IIYA 1ERTA 5G5EA 5GSTA 2WZ9A 2DLXA 3FZ9A 3PINA 1GLQA 2B5XA 3N5OA 3UAPA 1FB6A 3C8EA 4DSSA 4ZBDA 2VLTA 4HU9A 1YKCA 1GSDA 4WR4A 3M9JA 4V1Ag 1Z7PA 2GQLA 3KZQA 4RQRA 4KDUA 2I9HA 5DALB 3UVHA 4E8EA 4FO5A 1DE2A 3APSA 5IOWA 5F8BA 1Y6EA 2H74A 2K18A 4YQVA 4ZB9A 1M2BA 3QAWA 1X5EA 3GMFA 2P5RA 2V41A 2VM1A 3EE2A 2WFCA 2V6OA 5H5SA 2TRXA 4ECJA 1TU7A 3CTFA 1NHOA 2TRCP 3RHCA 4F0BA 4YAVA 4KNDA 2IL3A 2LRCA 2H0HA 2PUKC 4WF5A 5IO2A 5KN3A 2ES7A 3UMAA 4CDOA 2O8VB 1X5CA 2AHEA 4IHUA 3EURA 2B1LA 2IPAA 4PNFA 1DBYA 3GL5A 1OC9A 4L8EA 1QFNA 4GSNA 2ZUPA 4XHMA 2H72A 5IPHA 2DJKA 1MDIA 1AQVA 12GSA 2I81A 3KXOA 1Z6MA 5G2ZA 5HR0A 2F51A 4TR1B 5LD0A 2PMTA 2PVOC 1SENA 1TKDB 5DJLA 4FH8A 4EL1A 4PUAA 2HZEA 4PURA 2KHPA 2I4AA 2ON7A 2MMZA 5ECNB 2N5FA 1E2YA 1OYJA 2KP2A 5HFGA 3HJOA 5GAND 3E3EA 4NV5A 2JZRA 1WIKA 4POMA 3I43A 8GSSA 5JCGA 1O8WA 5LNKe 2IMFA 3APOA 4MZWA 2LV3A 3HJPA 3M1GA 16GSA 5A4UA 1S3AA 1OKTA 4MZBA 5ECOB 4AJ8A 4MA9A 2L6DA 3F6DA 3ZL5A 2X8HA 3FHKA 4KDYA 1O81A 9GSSA 1Q98A 1XFLA 2ZNMA 4G0KA 4RUVA 3TJBA 2RM5A 3IV4A 3TJKA 3HY2A 5E4WA 3LXZA 2HRKA 4TW5A 5ENUA 3H93A 1U87A 1G6YA 2EIOA 2JACA 3R2QA 4F0CA 1FW1A 5C04A 4V1Ap 2VCXA 1KNGA 1X5DA 3F6FA 4I8BA 5ID2B 1FB0A 1M7TA 3C1RA 3QFAC 1Z9HA 2GQKA 1A24A 4KSOA 3P7XA 1B9XC 4I6XA 5CRWA 3CSJA 2MBSA 4KB3A 7GSSA 5A5KA 1XOAA 4K7IA 3UOMA 1G7EA 2L59A 5IMFA 5DALA 2VCQA 10GSA 4ECBA 3D4TA 4FIWA 4TKYA 2C0DA 5HR2A 1GTBA 4ID0A 5G1LA 1GTIA 1B48A 5EVOA 4F03A 2YP6A 2H19A 2V32A 4L5LA 1ERVA 2XPDA 5HR1A 4CW9A 2FD3A 3EMPA 2OJLA 1R5AA 3HD5A 3KJYA 2DMMA 4GSSA 4ZL9A 18GSA 3UVTA 4WBRD 5D9WA 4HOJA 6GSSA 1XVWA 2YN1A 1XOBA 3FR9A 1ABAA 2CX4A 1O73A 4I2UA 5G5FA 4PGTA 3ME8A 1SU9A 2PERA 2NVLA 4WEYA 4XCSA 2J23A 1LU4A 1XCCA 3ZMKA 2OE1A 1MEKA 4NWYA 3DYRA 1QK8A 1JLVA 1WRYA 5B6NA 4ML6A 1NSWA 3GTUA 3E0UA 19GSA 1T7PB 2VIMA 4LMWA 4TR1A 2I3YA 4O5RA 1MDKA 1K0BA 4G9HA 3IRAA 3GA4A 1XXUA 4OFNA 2HRFA 1XPVA 1ERWA 4BVYB 2VL3A 3FYGA 1EZKA 3IE3A 2HLSA 3NZNA 2ON5A 4GRFA 4ML1A 2X64A 5B6MA 3QCPA 3LXTA 3TKSC 5FWGA 2R4VA 2YWMA 1X9SB 2CQ9A 2JSYA 3ZFLA 1XIYA 3ED3A 1LBKA 2FNOA 3G7YA 2R5GA 1ZCPA 1PGTA 1XWKA 2LJRA 5ECSA 2CAIA 4KX4A 3QAGA 2YJ7A 4KUNA 1PN9A 3VI5A 2I1UA 1PL1A 1XWCA 2HE3A 3TCOA 1SK1A 5ECMB 1GTUA 1F37A 1X9WB 3TGZA 2A2RA 1F3BA 4NHZA 1FOVA 3GH9A 4ECIA 3Q19A 2DBCA 3RBTA 3UL3A 1G6WA 5J5NA 4DVCA 3ERGA 2VM2A 3US3A 1GWCA 2DJ1A 2FWHA 3TRXA 5KN1A 3RPNA 2VUPA 3H79A 1YEXA 2NPBA 4KH7A 1G7OA 2P31A 3IBHA 2FUG2 2YZUA 3IK7A 4XIHA 5G30A 4MJBA 2YANA 5ID2A 2C8UA 1V58A 2IMKA 1YQ1A 2MZCA 2C3NA 3KM6A 4V2MA 3ZREA 4V2LA 2D2ZA 2DJ0A 4IP1A 1KBNA 1R7HA 5JCWA 2FLSA 3D0ZA 2F9SA 5HFKA 1EGOA 1EV4A 2VLUA 3TRQA 3GKXA 4JBBA 1EOGA 3DVXA 4PQ1A 3GN3A 5ECRB 3IOSA 3Q74A 4XRAA 1TI3A 1F6MC 1T00A 4GWRA 2KOKA 1YY7A 3KTLA 1XWAA 5IMAA 2IFQB 1B4PA 4BWQA 3GRXA 3GX0A 1EV9A 3HVSA 2PN8A 2VCZA 5ECKB 2DC5A 3FZAA 4ZL8A 1ZL9A 2LQQA 1IYIA 3AY8A 1U3IA 2RLIA 4NV2A 2H1AA 1HD2A 1SKSB 3QMXA 2LNTA 2GZYA 2J9HA 4QQ7A 4X0XA 4BVXB 1VRSD 1N2AA 1V98A 4TR3A 1K0NA 3W6GA 1TRSA 4JU5A 4IQ1A 2E2GA 1PA3A 3Q6OA 3KGKA 2FWEA 3ZVJA 1BJXA 2C3TA 4N11A 4NAXA 4MZCA 5ABRA 4ISDA 4Q5FA 3BCIA 2HXKA 4N30A 4GXZA 4LL4B 3DIEA 1URMA 2FWFA 1TRUA 3S9FA 4K2DA 1A2JA 3QPMA 2MMOA 4K0NA 3FZ4A 4HDEA 2AUVA 2KUCA 4PNGA 4HI7A 4POLA 5INYA 2N5BA 2VCWA 2DJ3A 4LA1A 4MJEA 2XHFA 3IK9A 3UBLA 4MCUA 5CRDA 3UARA 2AJQB 4BVYA 1T8EB 4PQIA 2DJ2A 5KEJA 2WJUA 2O89A 1XW9A 3LYPA 2K8VA 2XPEA 4OWYA 3A2VA 5J9CA 4JZQA 1WWJA 1GH2A 3DWVA 1BYEA 1SK2A 2YCDA 4Q5QA 2H1DA 5ECPB 2B7KA 2DJJA 3QOUA 5DQSA 2OA7A 1XBSA 5G31A 4MABA 3KMOA 2A2SA 2X99A 4IN0A 3VURA 4YH2A 3BBYA 5CNWA 3UJ1A 2FGXA 2MMAA 2B5EA 4RQXA 1QGVA 3GURA 2RUFA 2K8SA 2GGTA 2Z9SA 4IJIA 3UBKA 2GLRA 1A2MA 3GV1A 1MD3A 3P90A 3P2AA 2B6MA 1EGRA 4POKA 1YJ6A 4MH3A 4I5QA 1IYHA 4MJCA 5D96A 3L9UA 1OAZA 5D93A 1GUHA 2BJXA 5CO3A 2FA4A 4X1UA 1GTAA 4KGIA 1SYXA 4KE3A 5J3RA 1TJDA 1G0TA 2NTOA 3LJRA 1M2AA 4F2IA 1A0RP 1CQHA 4IQAA 2CAQA 2GT6A 3F4RA 5IO0A 3ME7A 4H86A 4K1FA 4NXIA 4HJ2A 5G1KA 2PBJA 2H0GA 3EYTA 3HA9A 4KCEA 1SYRA 3DGQA 1XZOA 1O6JA 1BAYA 1ZGNA 3MWHA 5A4VA 4X43A 1UVZA 4MPFA 2YOIA 2IWTA 1TP9A 5EPFA 2VLVA 1TK5B 1PMTA 2XBIA 2IFQA 4WR5A 2PWJA 2HYXA 3D4MA 4IELA 1HQOA 2TIRA 4MJAA 1R26A 2L6CA 3TJJA 3VFIA 6GSWA 5D9TA 3TKRA 3ZIVA 3H1NA 3LEFA 3L4NA 1F2EA 4BVXA 1AW9A 3J7Yb 2B7JA 1MD4A 4IW9A 4ILFA 3KMNA 4I2TA 3IXRA 4K8MA 1DE1A 3HCZA 2LTKA 1PL2A 3IHQA 3CTGA 2LNSA 1Y25A 2HSMB 5ELAA 1QMVA 4D73B 3CBUA 4EUYA 1GNEA 4EXJA 3CYNA 2YV9A 2IMIA 2KLXA 1R5PA 2C1YA 3F3RA 1PX7A 3U6VA 4OD7A 1YKAA 2LEGA 1V2AA 2XBQA 3KEBA 1X9MB 4Q5NA 1TI1A 4TXOB 2GS3A 1A23A 4GTUA 2GSTA 3DMLA 4DSQA 6GSVA 4OFMA 1TOFA 1H4OA 4EF0A 3PPUA 2YWNA 1M0UA 4MF5A 3VWUA 4HUAA 2MYGA 3EC3A 3H8QA 4QL9A 3VPQA 1FVKA 5J4UA 2GDRA 1QXHA 2V2GA 1DUGA 4EVMA 3KIJA 1U3AA 6GSYA 3WGEA 2BTOT 5ECLB 2GT5A 3F63A 17GSA 3KP9A 4TRXA 1GSYA 2YJHA 4FYCA 4FYUA 4KDXA 4K7OA 4QL7A 1EEMA 1OKDA 3FK8A 1FHEA 3IDVA 3GHAA 3EVIA 4O32A 1OE7A 1UC7A 3F9UA 1TK8B 4J56E 2C0FA 4PUFC 4K9ZA 4AJ6A 2GZZA 1W89A 2EIQA 2H1BA 1TDIA 2WRTA 3ZFBA 1V57A 1GSEA 2JADA 5DDLA 1BX9A 1PQNA 2GZPA 2VAFA 1NM3A 4AJ7A 4N10A 1THXA 3M9KA 5ECQB 4AGSA 1TU8A 4ECCA 1SL0B 1DSBA 1SJZA 4XRDA 5IMCA 5LCZA 3RPPA 3FKFA 2R2JA 2YWOA 4MMMA 3PR8A 2MBTA 2V6KA 3RHBA 1FAAA 5CRHA 1TRVA 4LL1B 5EL8A 3TRPA 2VCVA 3APQA 6GSXA 4IS0A 4RI7A 1THOA 3L78A 4KF9A 3VWVA 3V1WA 2G2QA 1JZOA 2C80A 2LJKA 5GAPD 3DVWA 6GSUA 1WPIA 1JZWA 2EC4A 2PPTA 2VOCA 4ZBBA 1A0FA 4G19A 3TOUA 1F3AA 3QR6A 1RK4A 4BPYA 5IQYA 4O92A 2A4VA 2B1KA 13GSA 1GNWA 3GFKA 2BMXA 2WB9A 4BWSA 2HRAA 4ZB8A 1XW6A 3CRTA 5CP1A 1ZYQB 2OE3A 5ECHB 2MMNA 1WOUA 2LUSA 2HSMA 1M9AA 2CT6A 3CRUA 4D73A 1AQXA 3QFBC 5HFIA 2B5YA 5IPGA 3M8NA 5AISA 4K0GA 3TKSA 4EO3A 3ZVJD 3A3TA 1V9WA 3ZLPA 5DBQA 5DCHA 3G7JA 3TB2A 1O85A 5F05A 2VL2C 2VD0A 4ZIJA 1VGLA 3NIVA 4NHWA 2LSTA 3MNGA 3WGXA 1GP1A 4TXOA 3Q18A 3EWLA 1E6BA 4G0LA 4WBJA 3GUSA 4MK3A 1SJ6A 1AUCA 3ZITA 3FZ5A 1OC9B 1U88A 4PQHA 3BD2A 5ELGA 1GL8A 4EE0A 4O7HA 2YPMA 5DQYA 1GSSA 3LORA 4JEDA 1SD8A 5KN2A 2GSSA 2V1MA 5IIZA 6GSTA 2RIIA 2ZCTA 3GKMA 2F8FA 1M2DA 3QDNA 1K0AA 2B3SA 2VL2A 1SJIA 4OO4A 1HNBA 4OMVA 2L4QA 3VWXA 2PGTA 2WS2A 1B9YC 5C00A 3EU4A 3TDGA 3IR4A 2WULA 4XS1A 1O8XA 4Z7XA 1SKWB 5DAKB 1K0DA 4ZL7A 4PTSA 1A8YA 1GLPA 1C72A 2AV4A 4ZBAA 1F9MA 4NMUA 4TOPA 1TW9A 4F9ZA 4YAPA 3L9VA 1RQMA 2H0IA 3CXGA 1QQ2A 3HKRA 1GRXA 3NOFA 5AIVA 4GCIA 1Z3EA 3ZMLA 1ON4A 1SKRB 1JFUA 2H6ZA 3QD9A 4BA7A 4IVFA 2GTUA 2H70A 3SWLA 2QC7A 5F07A 1ZOFA 3EU3A 2F3MA 1EEJA 20GSA 3D6IA 1B8XA 4AF2A 5IMZA 4ULXA 3GIXA 2FCHA 4LMVA 4Q5RA 1ZMAA 4N0ZA 2LS5A 2FHEA 5BMUA 1ZYEA 1VF4A 5HR3A 2HQTA 3VK9A 4L0WA 2HZFA 4GLTA 2REMA 4K7NA 3GKKA 1ERUA 2OBKA 1M9BA 3QAVA 3HXSA 3LYKA 2CZ3A 2WGRA 2O7KA 1O7UA 3C71A 2H66A 4KSMA 2HT9A 1EOHA 1WJKA 1JZDA 4JR6A 3TKSE 3RAZA 3A5WA 3DEXA 4MF7A 3A2XA 2C3QA 2CVBA 2H6YA 2QGVA 2ALBA 3BCKA 1ZZYA 4MPGA 1WP0A 2NDOA 1VF2A 4TXVA 1TK0B 4IKHA 1XWBA 4DEJA 1PSQA 2UZ8A 2K6VA 3ERWA 1TTZA 3TJFA 4GQCA 3TKPA 2YV7A 2PU9C 4EDZA 1A8LA 1VF1A 1GUMA 1BEDA 5AIXA 4LLRA 3MSZA 3GSTA 4YQMA 2E2MA 3A2WA 3VWWA 1M99A 2C4JA 2R37A 3HHVA 2JU5A 4ZB6A 5L71A 3W8JA 1USBA 4G2EA 1GSFA 4POBA 5CAXA 3WYWA 2X8GA 5COHA 1NW2A 5CREA 2P0GA 2GSQA 1I5GA 3KH9A 2OKAA 2P5QA 2VO4A 3IPZA 4RI6A 1S3CA 1TXXA 1R4WA 1ILOA 2L5OA 4NPBA 2CA8A 3GTUB 3FRCA 2H73A 2F8AA 3FY7A 1H75A 14GSA 5JWQB 3HVVA 3GH6A 4WF4A 3LSZA 1J08A 4BL7B 3L9SA 1ML6A 1MDJA 1J0FA 1GULA 1AC1A 2HSNB 1A2LA 4TVEA 3UIWA 2WCIA 3IA1A 1SL2B 1BG5A 3TUEA 5D9VA 3HDCA 2DMLA 3H4KA 5H5QA 1AXDA 2LQOA 4TR0A 2OACA 4ZILA 5JWRB 4HS1A 1K3LA 4HQSA 5DAKA 1WE0A 3ZZXA 1GSUA 1ACVA 2IN3A 5CRGA 3IAM2 4N0VA 3EINA 3MAKA 3FW2A 2DSAA 1MTCA 2M80A 2OBIA 5GZZB 1EP7A 2IMEA 3IC8A 2CVDA 1EP8A 2H6XA 4YQUA 1OC8A 2X8CA 2VL9A 2HSHA 1HYUA 5FHIA 2H01A 4MH2A 2JZTA 5F06A 2C0GA 2EIRA 2LJAA 2NBSA 3RDWA 1JZRA 3F0IA 4KW6A 1PD21 3M0FA 3I69A 4OCFA 2PVQA 2IMDA 3O3TA 2HFDA 1PKZA 5B8BA 3GNJA 4MLYA 1QUWA 3HYPA 4EC0A 1NHYA 1SL1B 1PKWA 3LQ7A 3EMXA 5A4WA 3ZTLA 3D5JA 1SK0A 3BJ5A 4IGJA 5H5RA 2OE0A 3D21A 1T4YA 1KTEA 4G0IA 4V2NA 3C7MA 2O87A 4MP4A 3LWAA 4XS6A 5IM9A 3GSSA 3JCML 4EDYA 1XVQA 3TKQA 3GL3A 3F3QA 4PX1A 2H1GA 5CYYA 3LFLA 5DCGA 5IMDA 4MF6A 3O6TA 4PXOA 5F0GA 2XC2A
chains in the Genus database with same CATH superfamily
3ZRDA 2N5AA 2YNXA 5D73A 3HZ4A 1FG4A 3F8UA 3K8NA 1FVJA 5D9XA 11GSA 2M46A 2VCTA 2CV4A 2CX3A 4OO5A 5AGYA 1GUKA 5IOXA 1T3BA 1K0MA 3FR3A 1YDKA 4E8HA 3WGDA 4HU7A 3BOAA 4P3YB 1K0OA 4ZXGA 1OVNA 2YZHA 1K3YA 5DJMA 2L5LA 3DD3A 4XS4B 5JWOB 4HQZA 1V40A 3IC4A 4FQUA 5J9BA 3CSIA 1FO5A 4GF0A 5EY6A 2CZ2A 5E59A 22GSA 3C1SA 3ZYWA 3TOTA 4KAEA 3KTBA 4G10A 3VI7A 3F4SA 3UEMA 5JCUA 1T4ZA 2KP1A 2DIYA 3LGCA 3FR6A 1AQWA 2GQMA 1W4VA 1XW5A 2GSRA 4BL7A 2JZSA 3TU3B 1PRXA 4JE1A 4DSSB 4HZ4A 2O85A 2HSNA 3RFRC 2EFHA 1I1IP 5D8IA 1JHBA 1LJRA 4PHZC 5J41A 3C73A 3WD6A 2A2PA 4MDCA 3HVXA 3WT2A 1UN2A 4JR4A 5DVBA 1S3DA 2JSZA 2EFDA 1AIUA 1PFOA 4EKZA 3D22A 1GSQA 3GYKA 1YEPA 4GSTA 1HNCA 3ERFA 3WT1A 3MDKA 3M3MA 2L4CA 1SD9A 2M72A 1N8JA 2WW0A 2R6KA 4KCAA 2L57A 3FMWA 2QSIA 2RM6A 4GQFA 1B4QA 1ST9A 1Z7RA 3KP8A 4HJMA 5KN0A 1WMJA 2HRNA 2CVKA 1T1VA 1Z5YE 1OE8A 2LRTA 2R3XA 1RW1A 4USSA 1XWGA 4HEA2 3HJMA 3I6AA 2AYTA 2E0QA 2FWGA 3OR5A 3SBCA 3GX8A 1JLWA 3CMIA 2WDUA 2H30A 4G01A 1YZXA 2AB6A 3I9V2 3KH7A 4OCEA 1K3OA 3G7IA 3LG6A 4HZ2A 5FT3A 2FY6A 3FEUA 3N9JA 3DKSA 2LRNA 3KD0A 1Q4JA 4TN8A 2GVPA 3ISOA 5HQPA 1AAZA 3IAS2 4IBPA 1TRWA 2YWIA 5IMVA 4IP6A 3GKNA 2LKUA 1S4BP 2HZEB 3PGTA 3O76A 5AN1A 3U5RE 2E7PA 3E9JB 2H71A 4IJ3A 4J2FA 4WKWA 4XTSA 4WXTA 3P8WA 3PH9A 5ECIB 2HI7A 1EWXA 3W8SA 4J57E 4L0UA 3TJGA 2FA8A 2QKEA 3VPTA 3J7Yk 2H8LA 3ZIJA 1X0RA 4I97A 2G0FA 2HSYA 2IJYA 1CQGA 1OC3A 4OFTA 2X49A 3KCMA 3R3EA 2RUEA 3HZ8A 2AAWA 1I9DA 1VF3A 3VLNA 3G9BA 1YF0A 4K6XA 1PX6A 4AKXB 1U6TA 4JRRA 4CHSA 1YF1A 1UA5A 1J9BA 1KEBA 5A5HB 3F4TA 4F82A 4XS4A 3L0HA 5B7CA 4FYBA 5GSSA 2H75A 3DXBA 4WETA 2C0EA 2OADA 4DSRA 3CSHA 4TR4A 2K9FA 1HNAA 1K0CA 4L5OA 2HNLA 4KA0A 2DIZA 1Z6NA 3LW9A 3DRNA 2VD1A 1BQ7A 4ACSA 2H76A 2HRKB 2JL4A 5B8AA 2IIYA 1ERTA 5G5EA 5GSTA 2WZ9A 2DLXA 3FZ9A 3PINA 1GLQA 5A1NA 2B5XA 3N5OA 3UAPA 1FB6A 3C8EA 4DSSA 4ZBDA 2VLTA 4HU9A 4A5PA 1YKCA 1GSDA 4WR4A 3M9JA 4V1Ag 1Z7PA 2GQLA 3KZQA 4RQRA 4KDUA 2I9HA 5DALB 3UVHA 4E8EA 4FO5A 1DE2A 3APSA 4K2XA 5IOWA 5F8BA 1Y6EA 2H74A 2K18A 2DKIA 4YQVA 4ZB9A 1M2BA 4QMKA 3QAWA 1X5EA 3GMFA 2O5VA 2P5RA 2V41A 2VM1A 3EE2A 2WFCA 2V6OA 5H5SA 2TRXA 4ECJA 5J4YA 1TU7A 3CTFA 1NHOA 2TRCP 4GDFA 3RHCA 4F0BA 2O3EA 4YAVA 4KNDA 2IL3A 2LRCA 2H0HA 2OT3A 2PUKC 4WF5A 5IO2A 5KN3A 2ES7A 3UMAA 4CDOA 2O8VB 1X5CA 2AHEA 4IHUA 3EURA 2B1LA 2IPAA 4PNFA 1DBYA 3GL5A 1OC9A 4L8EA 1QFNA 4GSNA 2ZUPA 4XHMA 2H72A 5IPHA 2DJKA 1MDIA 1AQVA 12GSA 2I81A 3KXOA 1Z6MA 5G2ZA 5HR0A 2F51A 4TR1B 5LD0A 2PMTA 1TXUA 2PVOC 1SENA 1TKDB 5DJLA 4FH8A 4EL1A 4PUAA 2HZEA 4PURA 2KHPA 2I4AA 2ON7A 2MMZA 5ECNB 2N5FA 1E2YA 1OYJA 2KP2A 5HFGA 3HJOA 5GAND 4YKFA 3E3EA 4NV5A 2JZRA 1WIKA 4POMA 3I43A 8GSSA 5JCGA 1O8WA 1FOHA 5LNKe 2IMFA 3APOA 4MZWA 2LV3A 3HJPA 3M1GA 16GSA 5A4UA 1S3AA 1OKTA 4MZBA 5ECOB 4AJ8A 4MA9A 2L6DA 5A5HA 3F6DA 3ZL5A 2X8HA 3FHKA 4KDYA 1O81A 9GSSA 1Q98A 1XFLA 2ZNMA 4G0KA 4RUVA 3TJBA 2RM5A 3IV4A 3TJKA 3HY2A 5E4WA 3LXZA 2HRKA 4TW5A 5ENUA 3H93A 1U87A 1G6YA 2EIOA 2JACA 3R2QA 4F0CA 1FW1A 5C04A 4V1Ap 2VCXA 1KNGA 1X5DA 3F6FA 4I8BA 3A5IA 5ID2B 1FB0A 1M7TA 3C1RA 3QFAC 1Z9HA 2GQKA 1A24A 4KSOA 3P7XA 1B9XC 4I6XA 5CRWA 3CSJA 2MBSA 4KB3A 7GSSA 5A5KA 1XOAA 4K7IA 3UOMA 1G7EA 2L59A 5IMFA 5DALA 2VCQA 10GSA 4ECBA 3D4TA 4FIWA 4TKYA 2C0DA 5HR2A 1GTBA 4ID0A 1ZYPA 5G1LA 1GTIA 1B48A 5EVOA 4F03A 2YP6A 2H19A 2V32A 4L5LA 1ERVA 2XPDA 5HR1A 4CW9A 4PI2C 2FD3A 3EMPA 2OJLA 1R5AA 3HD5A 3KJYA 2DMMA 4GSSA 1SVOA 4YKGA 4ZL9A 18GSA 3UVTA 4WBRD 5D9WA 5A34B 4HOJA 6GSSA 1XVWA 2YN1A 1XOBA 3FR9A 1ABAA 2CX4A 1O73A 4I2UA 5G5FA 4PGTA 3ME8A 1SU9A 2PERA 2NVLA 4WEYA 4XCSA 2J23A 5KOWA 1LU4A 1XCCA 3ZMKA 2O36A 2OE1A 1MEKA 4NWYA 3DYRA 1QK8A 1JLVA 1WRYA 5B6NA 4ML6A 1NSWA 3GTUA 3E0UA 19GSA 1T7PB 2VIMA 4LMWA 4TR1A 2I3YA 4O5RA 1MDKA 1K0BA 4G9HA 3IRAA 3GA4A 1XXUA 4OFNA 2HRFA 1XPVA 1ERWA 4BVYB 2VL3A 3FYGA 1EZKA 3IE3A 2HLSA 3NZNA 2ON5A 4GRFA 4ML1A 2R0GA 2X64A 5B6MA 3QCPA 3LXTA 3TKSC 5FWGA 2R4VA 2YWMA 1X9SB 2CQ9A 2JSYA 3ZFLA 1XIYA 3ED3A 1LBKA 2FNOA 3G7YA 2WVYA 2R5GA 1ZCPA 1PGTA 1XWKA 2LJRA 5ECSA 2CAIA 4KX4A 3QAGA 2YJ7A 4KUNA 1PN9A 3VI5A 2I1UA 1PL1A 1XWCA 3CWGA 2HE3A 3TCOA 1SK1A 5ECMB 1GTUA 1F37A 1X9WB 3TGZA 2A2RA 1F3BA 4NHZA 1FOVA 3GH9A 4ECIA 3Q19A 2DBCA 3RBTA 3UL3A 1G6WA 5J5NA 4DVCA 2WVZA 3ERGA 2VM2A 3US3A 5J47A 1GWCA 2DJ1A 2FWHA 3TRXA 5KN1A 3RPNA 2VUPA 3H79A 1YEXA 2NPBA 4KH7A 4ZB7A 1G7OA 2P31A 3IBHA 2FUG2 2YZUA 3IK7A 4XIHA 5G30A 4MJBA 2YANA 5ID2A 2C8UA 1V58A 2IMKA 1YQ1A 2MZCA 2C3NA 2WW3A 3KM6A 4V2MA 3ZREA 4V2LA 2D2ZA 4AKIA 2DJ0A 4IP1A 1KBNA 1R7HA 5JCWA 2FLSA 3D0ZA 2F9SA 5HFKA 3RGBC 1EGOA 1EV4A 2VLUA 3TRQA 3GKXA 2H1LA 4JBBA 1EOGA 3DVXA 4PQ1A 3GN3A 5ECRB 3IOSA 3Q74A 4XRAA 1TI3A 1F6MC 1T00A 4GWRA 2KOKA 1YY7A 3KTLA 1XWAA 5IMAA 2IFQB 1B4PA 4BWQA 3GRXA 3GX0A 1EV9A 3HVSA 2PN8A 2VCZA 5ECKB 4CY6A 2DC5A 3FZAA 4ZL8A 1ZL9A 2LQQA 1IYIA 3AY8A 1U3IA 2RLIA 4NV2A 2H1AA 1HD2A 1SKSB 3QMXA 2LNTA 2GZYA 2J9HA 4QQ7A 4X0XA 4BVXB 1VRSD 1N2AA 1V98A 4TR3A 1K0NA 3W6GA 1TRSA 4JU5A 4IQ1A 2E2GA 1PA3A 3Q6OA 3KGKA 2FWEA 3ZVJA 1BJXA 2C3TA 4N11A 4NAXA 4MZCA 5ABRA 4ISDA 4Q5FA 3BCIA 2HXKA 4N30A 4GXZA 4LL4B 3DIEA 1URMA 2FWFA 1TRUA 3EPTA 3S9FA 4K2DA 1Y1UA 1A2JA 4FXYP 3QPMA 2MMOA 4K0NA 4AI6A 3FZ4A 4HDEA 2AUVA 2KUCA 4PNGA 4HI7A 4POLA 5INYA 2N5BA 2VCWA 2DJ3A 4LA1A 4MJEA 2XHFA 3IK9A 3UBLA 4MCUA 5CRDA 3UARA 2AJQB 4BVYA 1T8EB 1YEWC 4PQIA 2DJ2A 5KEJA 4O5UA 2WJUA 2O89A 1XW9A 3LYPA 2K8VA 4MNNA 2XPEA 4OWYA 3A2VA 5J9CA 4JZQA 1WWJA 1ZYNA 1GH2A 3DWVA 1BYEA 1SK2A 2YCDA 4Q5QA 2H1DA 5ECPB 2B7KA 2DJJA 4K5SA 3QOUA 5DQSA 2OA7A 1XBSA 5G31A 4MABA 4O5QA 3KMOA 2A2SA 2X99A 4IN0A 3VURA 4YH2A 3BBYA 5CNWA 3UJ1A 2FGXA 2MMAA 2B5EA 4RQXA 1QGVA 3GURA 2RUFA 2K8SA 2GGTA 2Z9SA 4IJIA 3UBKA 2GLRA 1A2MA 3GV1A 1MD3A 3P90A 3P2AA 2B6MA 1EGRA 4POKA 1YJ6A 4MH3A 4I5QA 4Z2UA 1IYHA 4MJCA 5D96A 3L9UA 1OAZA 5D93A 1GUHA 2BJXA 5CO3A 2FA4A 4X1UA 2DKHA 1GTAA 4KGIA 1SYXA 4W66A 4KE3A 5J3RA 1TJDA 1G0TA 2NTOA 3LJRA 1M2AA 4F2IA 1A0RP 1CQHA 4IQAA 2CAQA 2GT6A 3F4RA 5IO0A 3ME7A 4H86A 4K1FA 4NXIA 4HJ2A 5G1KA 2PBJA 2H0GA 3EYTA 3HA9A 4KCEA 1SYRA 3DGQA 1XZOA 1O6JA 1BAYA 1ZGNA 3MWHA 5A4VA 4X43A 1UVZA 4MPFA 2YOIA 2IWTA 1TP9A 5EPFA 2VLVA 3HMJG 1TK5B 1PMTA 2XBIA 2WVXB 2IFQA 4WR5A 2PWJA 2HYXA 3D4MA 4IELA 1HQOA 2R0PA 1M3IA 2TIRA 4MJAA 1R26A 2L6CA 3TJJA 3VFIA 6GSWA 5D9TA 3TKRA 3ZIVA 2VKZG 3H1NA 3LEFA 3L4NA 1F2EA 4BVXA 1AW9A 3J7Yb 2B7JA 1MD4A 4IW9A 4ILFA 3KMNA 4I2TA 3IXRA 4K8MA 1DE1A 3HCZA 2LTKA 1PL2A 3IHQA 3CTGA 2LNSA 1Y25A 4K5RA 2HSMB 5ELAA 1QMVA 4D73B 5J4VA 5J40A 3CBUA 4EUYA 1GNEA 4EXJA 3CYNA 2YV9A 2IMIA 2KLXA 1R5PA 2C1YA 3F3RA 1PX7A 3U6VA 4OD7A 1YKAA 2LEGA 1V2AA 2XBQA 3KEBA 1X9MB 4Q5NA 1TI1A 4TXOB 2GS3A 1A23A 4GTUA 2GSTA 3DMLA 4DSQA 6GSVA 4OFMA 1TOFA 1H4OA 4EF0A 3PPUA 2YWNA 1M0UA 4MF5A 3VWUA 4HUAA 2MYGA 3EC3A 3H8QA 4QL9A 3VPQA 1FVKA 5J4UA 2GDRA 1QXHA 2V2GA 1DUGA 4EVMA 3KIJA 1U3AA 6GSYA 3WGEA 2BTOT 5ECLB 2GT5A 3F63A 17GSA 3KP9A 4TRXA 1GSYA 2YJHA 4FYCA 4FYUA 4KDXA 4K7OA 2EFEA 4QL7A 1EEMA 1OKDA 3FK8A 1FHEA 3IDVA 1SVLA 3GHAA 3EVIA 4O32A 1OE7A 1UC7A 3F9UA 1TK8B 4PI0C 4ICYA 4J56E 2C0FA 4PUFC 4K9ZA 4AJ6A 2GZZA 1W89A 2EIQA 1SVMA 2H1BA 1TDIA 2WRTA 3ZFBA 1V57A 1GSEA 2JADA 5DDLA 1BX9A 1XG8A 1PQNA 2GZPA 2VAFA 1NM3A 4AJ7A 4N10A 1THXA 3M9KA 5ECQB 4AGSA 1TU8A 3IHGA 4ECCA 1SL0B 2X4AA 1DSBA 1SJZA 4XRDA 5IMCA 5LCZA 3RPPA 3FKFA 2R2JA 2YWOA 4MMMA 3PR8A 2MBTA 2V6KA 3RHBA 1FAAA 5CRHA 1TRVA 4LL1B 5EL8A 3TRPA 2VCVA 3APQA 6GSXA 4IS0A 4RI7A 1THOA 3L78A 4KF9A 3CHXC 3VWVA 3V1WA 2G2QA 5A1NB 5BMUB 1JZOA 2C80A 2LJKA 5GAPD 3MYDA 1PN0A 3DVWA 6GSUA 2WVXA 1WPIA 1JZWA 2EC4A 2PPTA 2VOCA 1M3JA 4ZBBA 1A0FA 4G19A 3TOUA 1F3AA 3QR6A 1RK4A 5KOXA 4BPYA 5IQYA 4O92A 2A4VA 2B1KA 13GSA 1GNWA 3GFKA 2BMXA 2WB9A 1S3RA 4BWSA 2HRAA 4ZB8A 1XW6A 3CRTA 5CP1A 1ZYQB 2OE3A 5ECHB 2MMNA 1WOUA 2LUSA 2HSMA 1M9AA 2CT6A 3CRUA 4D73A 1AQXA 3QFBC 5HFIA 2B5YA 5IPGA 3M8NA 5AISA 4K0GA 3TKSA 4EO3A 3ZVJD 3A3TA 1V9WA 3ZLPA 5DBQA 4AKGA 1BG1A 5DCHA 3G7JA 3TB2A 2QA1A 1O85A 5F05A 2VL2C 2VD0A 4ZIJA 1VGLA 3NIVA 4NHWA 2LSTA 3MNGA 3WGXA 1GP1A 4TXOA 3Q18A 3MIXA 3EWLA 1E6BA 4G0LA 4WBJA 3GUSA 4Z2RA 4MK3A 1SJ6A 1AUCA 3ZITA 3FZ5A 1OC9B 1U88A 4PQHA 3BD2A 5ELGA 1GL8A 4EE0A 4O7HA 2YPMA 5DQYA 1GSSA 3LORA 4JEDA 1SD8A 5KN2A 2GSSA 2V1MA 5IIZA 6GSTA 2RIIA 2ZCTA 3GKMA 2F8FA 1M2DA 3QDNA 1K0AA 2B3SA 2VL2A 1SJIA 4OO4A 1HNBA 4OMVA 2L4QA 3VWXA 2PGTA 2WS2A 1B9YC 5C00A 3EU4A 3TDGA 3IR4A 5A34A 2WULA 4XS1A 1O8XA 4Z7XA 1SKWB 4AKHA 5DAKB 1K0DA 4ZL7A 4PTSA 1A8YA 1GLPA 3CQFA 1C72A 2AV4A 4ZBAA 1F9MA 4NMUA 4TOPA 1TW9A 4F9ZA 4YAPA 3L9VA 1RQMA 2H0IA 3CXGA 1QQ2A 3HKRA 1GRXA 4CY8A 3NOFA 5AIVA 4GCIA 1Z3EA 3ZMLA 1ON4A 1SKRB 1JFUA 2H6ZA 3QD9A 4Z2TA 4BA7A 4IVFA 2GTUA 2H70A 3SWLA 2QC7A 5F07A 4BIKA 1ZOFA 3EU3A 2F3MA 1EEJA 20GSA 3D6IA 2EFCA 1B8XA 4AF2A 5IMZA 4ULXA 3GIXA 2FCHA 4LMVA 4Q5RA 1ZMAA 4N0ZA 2LS5A 2FHEA 5BMUA 1ZYEA 1VF4A 5HR3A 2HQTA 3VK9A 4L0WA 2HZFA 4GLTA 2REMA 4K7NA 2R0CA 3GKKA 1ERUA 2OBKA 1M9BA 3QAVA 3HXSA 3LYKA 2CZ3A 2WGRA 2O7KA 1O7UA 3C71A 2WW2A 2H66A 4KSMA 2HT9A 1EOHA 1WJKA 1JZDA 4JR6A 3TKSE 3RAZA 2A4HA 2WW1A 3A5WA 3DEXA 3HVNA 4MF7A 3A2XA 2C3QA 2CVBA 2H6YA 2QGVA 2ALBA 3BCKA 1ZZYA 4MPGA 1WP0A 2NDOA 1VF2A 4TXVA 2QA2A 1TK0B 4IKHA 1BF5A 1XWBA 4DEJA 1PSQA 2UZ8A 2K6VA 3ERWA 1TTZA 3TJFA 4GQCA 3TKPA 2YV7A 2PU9C 4EDZA 1A8LA 1YVLA 1VF1A 1GUMA 1BEDA 5AIXA 4LLRA 3MSZA 3GSTA 4YQMA 2E2MA 3A2WA 3VWWA 1M99A 2C4JA 2R37A 3HHVA 2JU5A 4ZB6A 5L71A 3W8JA 1USBA 4G2EA 1GSFA 4POBA 5CAXA 3WYWA 2X8GA 5COHA 1NW2A 5CREA 2P0GA 2GSQA 1I5GA 3KH9A 2OKAA 2P5QA 2VO4A 3IPZA 4RI6A 1S3CA 1TXXA 1R4WA 1ILOA 2L5OA 4NPBA 2CA8A 3GTUB 3FRCA 2H73A 2F8AA 3FY7A 1H75A 14GSA 5JWQB 3HVVA 3GH6A 4WF4A 3LSZA 1J08A 4BL7B 3L9SA 1ML6A 1MDJA 1J0FA 1GULA 1AC1A 2HSNB 4E68A 1A2LA 4TVEA 3UIWA 2WCIA 3IA1A 1SL2B 1BG5A 3TUEA 5D9VA 3HDCA 2DMLA 3H4KA 5H5QA 1AXDA 2LQOA 4TR0A 2OACA 4ZILA 5JWRB 4HS1A 1K3LA 4HQSA 5DAKA 1WE0A 3ZZXA 1GSUA 1ACVA 2IN3A 5CRGA 3IAM2 4N0VA 3EINA 3MAKA 3FW2A 2DSAA 1MTCA 2M80A 2OBIA 5GZZB 1EP7A 2IMEA 2WZSA 3IC8A 2CVDA 1EP8A 2H6XA 4YQUA 1OC8A 2X8CA 2VL9A 2HSHA 1HYUA 5FHIA 2H01A 4MH2A 4X4JA 2JZTA 5F06A 2C0GA 2EIRA 2LJAA 2NBSA 3RDWA 1JZRA 3F0IA 4N3ZA 4KW6A 1PD21 3M0FA 3I69A 4OCFA 2PVQA 2IMDA 3O3TA 1N25A 2HFDA 1PKZA 5B8BA 3GNJA 4MLYA 1QUWA 3HYPA 4EC0A 1NHYA 1SL1B 5BRTA 4EIPA 1PKWA 3LQ7A 3EMXA 5A4WA 3ZTLA 3D5JA 1SK0A 3BJ5A 4IGJA 5H5RA 2OE0A 2UV8G 3D21A 1T4YA 1KTEA 4G0IA 4V2NA 3C7MA 2O87A 4MP4A 3LWAA 4XS6A 5IM9A 3GSSA 3JCML 4EDYA 1XVQA 3TKQA 3GL3A 3F3QA 4PX1A 4EIQA 2H1GA 5CYYA 4HSCX 3LFLA 5DCGA 5IMDA 4MF6A 3O6TA 4PXOA 5F0GA 2XC2A
chains in the Genus database with same CATH topology
3ZRDA 2N5AA 2YNXA 5D73A 3HZ4A 1FG4A 3F8UA 3K8NA 1FVJA 5D9XA 11GSA 2M46A 2VCTA 2CV4A 2CX3A 4OO5A 5AGYA 1GUKA 5IOXA 1T3BA 1K0MA 3FR3A 1YDKA 4E8HA 3WGDA 4HU7A 3BOAA 4P3YB 1K0OA 4ZXGA 1OVNA 2YZHA 1K3YA 5DJMA 2L5LA 3DD3A 4XS4B 5JWOB 4HQZA 1V40A 3IC4A 4FQUA 5J9BA 3CSIA 1FO5A 4GF0A 5EY6A 2CZ2A 5E59A 22GSA 3C1SA 3ZYWA 3TOTA 4KAEA 3KTBA 4G10A 3VI7A 3F4SA 3UEMA 5JCUA 1T4ZA 2KP1A 2DIYA 3LGCA 3FR6A 1AQWA 2GQMA 1W4VA 1XW5A 2GSRA 4BL7A 2JZSA 3TU3B 1PRXA 4JE1A 4DSSB 4HZ4A 2O85A 2HSNA 2EFHA 5D8IA 1JHBA 1LJRA 5J41A 3C73A 3WD6A 2A2PA 4MDCA 3HVXA 3WT2A 1UN2A 4JR4A 5DVBA 1S3DA 2JSZA 2EFDA 1AIUA 4EKZA 3D22A 1GSQA 3GYKA 1YEPA 4GSTA 1HNCA 3ERFA 3WT1A 3MDKA 3M3MA 2L4CA 1SD9A 2M72A 1N8JA 2R6KA 4KCAA 2L57A 3FMWA 2QSIA 2RM6A 4GQFA 1B4QA 1ST9A 1Z7RA 3KP8A 4HJMA 5KN0A 1WMJA 2HRNA 2CVKA 1T1VA 1Z5YE 1OE8A 2LRTA 2R3XA 1RW1A 4USSA 1XWGA 4HEA2 3HJMA 3I6AA 2AYTA 2E0QA 2FWGA 3OR5A 3SBCA 3GX8A 1JLWA 3CMIA 2WDUA 2H30A 4G01A 1YZXA 2AB6A 3I9V2 3KH7A 4OCEA 1K3OA 3G7IA 3LG6A 4HZ2A 5FT3A 2FY6A 3FEUA 3N9JA 3DKSA 2LRNA 3KD0A 1Q4JA 4TN8A 2GVPA 3ISOA 5HQPA 1AAZA 3IAS2 4IBPA 1TRWA 2YWIA 5IMVA 4IP6A 3GKNA 2LKUA 2HZEB 3PGTA 3O76A 5AN1A 3U5RE 2E7PA 3E9JB 2H71A 4IJ3A 4J2FA 4WKWA 4XTSA 4WXTA 3P8WA 3PH9A 5ECIB 2HI7A 1EWXA 3W8SA 4J57E 4L0UA 3TJGA 2FA8A 2QKEA 3VPTA 3J7Yk 2H8LA 3ZIJA 1X0RA 4I97A 2G0FA 2HSYA 2IJYA 1CQGA 1OC3A 4OFTA 2X49A 3KCMA 3R3EA 2RUEA 3HZ8A 2AAWA 1I9DA 1VF3A 3VLNA 3G9BA 1YF0A 4K6XA 1PX6A 4AKXB 1U6TA 4JRRA 4CHSA 1YF1A 1UA5A 1J9BA 1KEBA 5A5HB 3F4TA 4F82A 4XS4A 3L0HA 5B7CA 4FYBA 5GSSA 2H75A 3DXBA 4WETA 2C0EA 2OADA 4DSRA 3CSHA 4TR4A 2K9FA 1HNAA 1K0CA 4L5OA 2HNLA 4KA0A 2DIZA 1Z6NA 3LW9A 3DRNA 2VD1A 1BQ7A 4ACSA 2H76A 2HRKB 2JL4A 5B8AA 2IIYA 1ERTA 5G5EA 5GSTA 2WZ9A 2DLXA 3FZ9A 3PINA 1GLQA 5A1NA 2B5XA 3N5OA 3UAPA 1FB6A 3C8EA 4DSSA 4ZBDA 2VLTA 4HU9A 4A5PA 1YKCA 1GSDA 4WR4A 3M9JA 4V1Ag 1Z7PA 2GQLA 3KZQA 4RQRA 4KDUA 2I9HA 5DALB 3UVHA 4E8EA 4FO5A 1DE2A 3APSA 4K2XA 5IOWA 5F8BA 1Y6EA 2H74A 2K18A 2DKIA 4YQVA 4ZB9A 1M2BA 4QMKA 3QAWA 1X5EA 3GMFA 2O5VA 2P5RA 2V41A 2VM1A 3EE2A 2WFCA 2V6OA 5H5SA 2TRXA 4ECJA 5J4YA 1TU7A 3CTFA 1NHOA 2TRCP 4GDFA 3RHCA 4F0BA 4YAVA 4KNDA 2IL3A 2LRCA 2H0HA 2OT3A 2PUKC 4WF5A 5IO2A 5KN3A 2ES7A 3UMAA 4CDOA 2O8VB 1X5CA 2AHEA 4IHUA 3EURA 2B1LA 2IPAA 4PNFA 1DBYA 3GL5A 1OC9A 4L8EA 1QFNA 4GSNA 2ZUPA 4XHMA 2H72A 5IPHA 2DJKA 1MDIA 1AQVA 12GSA 2I81A 3KXOA 1Z6MA 5G2ZA 5HR0A 2F51A 4TR1B 5LD0A 2PMTA 1TXUA 2PVOC 1SENA 1TKDB 5DJLA 4FH8A 4EL1A 4PUAA 2HZEA 4PURA 2KHPA 2I4AA 2ON7A 2MMZA 5ECNB 2N5FA 1E2YA 1OYJA 2KP2A 5HFGA 3HJOA 5GAND 4YKFA 3E3EA 4NV5A 2JZRA 1WIKA 4POMA 3I43A 8GSSA 5JCGA 1O8WA 1FOHA 5LNKe 2IMFA 3APOA 4MZWA 2LV3A 3HJPA 3M1GA 16GSA 5A4UA 1S3AA 1OKTA 4MZBA 5ECOB 4AJ8A 4MA9A 2L6DA 5A5HA 3F6DA 3ZL5A 2X8HA 3FHKA 4KDYA 1O81A 9GSSA 1Q98A 1XFLA 2ZNMA 4G0KA 4RUVA 3TJBA 2RM5A 3IV4A 3TJKA 3HY2A 5E4WA 3LXZA 2HRKA 4TW5A 5ENUA 3H93A 1U87A 1G6YA 2EIOA 2JACA 3R2QA 4F0CA 1FW1A 5C04A 4V1Ap 2VCXA 1KNGA 1X5DA 3F6FA 4I8BA 3A5IA 5ID2B 1FB0A 1M7TA 3C1RA 3QFAC 1Z9HA 2GQKA 1A24A 4KSOA 3P7XA 1B9XC 4I6XA 5CRWA 3CSJA 2MBSA 4KB3A 7GSSA 5A5KA 1XOAA 4K7IA 3UOMA 1G7EA 2L59A 5IMFA 5DALA 2VCQA 10GSA 4ECBA 3D4TA 4FIWA 4TKYA 2C0DA 5HR2A 1GTBA 4ID0A 1ZYPA 5G1LA 1GTIA 1B48A 5EVOA 4F03A 2YP6A 2H19A 2V32A 4L5LA 1ERVA 2XPDA 5HR1A 4CW9A 2FD3A 3EMPA 2OJLA 1R5AA 3HD5A 3KJYA 2DMMA 4GSSA 1SVOA 4YKGA 4ZL9A 18GSA 3UVTA 4WBRD 5D9WA 5A34B 4HOJA 6GSSA 1XVWA 2YN1A 1XOBA 3FR9A 1ABAA 2CX4A 1O73A 4I2UA 5G5FA 4PGTA 3ME8A 1SU9A 2PERA 2NVLA 4WEYA 4XCSA 2J23A 5KOWA 1LU4A 1XCCA 3ZMKA 2OE1A 1MEKA 4NWYA 3DYRA 1QK8A 1JLVA 1WRYA 5B6NA 4ML6A 1NSWA 3GTUA 3E0UA 19GSA 1T7PB 2VIMA 4LMWA 4TR1A 2I3YA 4O5RA 1MDKA 1K0BA 4G9HA 3IRAA 3GA4A 1XXUA 4OFNA 2HRFA 1XPVA 1ERWA 4BVYB 2VL3A 3FYGA 1EZKA 3IE3A 2HLSA 3NZNA 2ON5A 4GRFA 4ML1A 2R0GA 2X64A 5B6MA 3QCPA 3LXTA 3TKSC 5FWGA 2R4VA 2YWMA 1X9SB 2CQ9A 2JSYA 3ZFLA 1XIYA 3ED3A 1LBKA 2FNOA 3G7YA 2R5GA 1ZCPA 1PGTA 1XWKA 2LJRA 5ECSA 2CAIA 4KX4A 3QAGA 2YJ7A 4KUNA 1PN9A 3VI5A 2I1UA 1PL1A 1XWCA 3CWGA 2HE3A 3TCOA 1SK1A 5ECMB 1GTUA 1F37A 1X9WB 3TGZA 2A2RA 1F3BA 4NHZA 1FOVA 3GH9A 4ECIA 3Q19A 2DBCA 3RBTA 3UL3A 1G6WA 5J5NA 4DVCA 3ERGA 2VM2A 3US3A 5J47A 1GWCA 2DJ1A 2FWHA 3TRXA 5KN1A 3RPNA 2VUPA 3H79A 1YEXA 2NPBA 4KH7A 4ZB7A 1G7OA 2P31A 3IBHA 2FUG2 2YZUA 3IK7A 4XIHA 5G30A 4MJBA 2YANA 5ID2A 2C8UA 1V58A 2IMKA 1YQ1A 2MZCA 2C3NA 3KM6A 4V2MA 3ZREA 4V2LA 2D2ZA 4AKIA 2DJ0A 4IP1A 1KBNA 1R7HA 5JCWA 2FLSA 3D0ZA 2F9SA 5HFKA 1EGOA 1EV4A 2VLUA 3TRQA 3GKXA 2H1LA 4JBBA 1EOGA 3DVXA 4PQ1A 3GN3A 5ECRB 3IOSA 3Q74A 4XRAA 1TI3A 1F6MC 1T00A 4GWRA 2KOKA 1YY7A 3KTLA 1XWAA 5IMAA 2IFQB 1B4PA 4BWQA 3GRXA 3GX0A 1EV9A 3HVSA 2PN8A 2VCZA 5ECKB 4CY6A 2DC5A 3FZAA 4ZL8A 1ZL9A 2LQQA 1IYIA 3AY8A 1U3IA 2RLIA 4NV2A 2H1AA 1HD2A 1SKSB 3QMXA 2LNTA 2GZYA 2J9HA 4QQ7A 4X0XA 4BVXB 1VRSD 1N2AA 1V98A 4TR3A 1K0NA 3W6GA 1TRSA 4JU5A 4IQ1A 2E2GA 1PA3A 3Q6OA 3KGKA 2FWEA 3ZVJA 1BJXA 2C3TA 4N11A 4NAXA 4MZCA 5ABRA 4ISDA 4Q5FA 3BCIA 2HXKA 4N30A 4GXZA 4LL4B 3DIEA 1URMA 2FWFA 1TRUA 3EPTA 3S9FA 4K2DA 1Y1UA 1A2JA 3QPMA 2MMOA 4K0NA 4AI6A 3FZ4A 4HDEA 2AUVA 2KUCA 4PNGA 4HI7A 4POLA 5INYA 2N5BA 2VCWA 2DJ3A 4LA1A 4MJEA 2XHFA 3IK9A 3UBLA 4MCUA 5CRDA 3UARA 2AJQB 4BVYA 1T8EB 4PQIA 2DJ2A 5KEJA 4O5UA 2WJUA 2O89A 1XW9A 3LYPA 2K8VA 4MNNA 2XPEA 4OWYA 3A2VA 5J9CA 4JZQA 1WWJA 1ZYNA 1GH2A 3DWVA 1BYEA 1SK2A 2YCDA 4Q5QA 2H1DA 5ECPB 2B7KA 2DJJA 4K5SA 3QOUA 5DQSA 2OA7A 1XBSA 5G31A 4MABA 4O5QA 3KMOA 2A2SA 2X99A 4IN0A 3VURA 4YH2A 3BBYA 5CNWA 3UJ1A 2FGXA 2MMAA 2B5EA 4RQXA 1QGVA 3GURA 2RUFA 2K8SA 2GGTA 2Z9SA 4IJIA 3UBKA 2GLRA 1A2MA 3GV1A 1MD3A 3P90A 3P2AA 2B6MA 1EGRA 4POKA 1YJ6A 4MH3A 4I5QA 4Z2UA 1IYHA 4MJCA 5D96A 3L9UA 1OAZA 5D93A 1GUHA 2BJXA 5CO3A 2FA4A 4X1UA 2DKHA 1GTAA 4KGIA 1SYXA 4W66A 4KE3A 5J3RA 1TJDA 1G0TA 2NTOA 3LJRA 1M2AA 4F2IA 1A0RP 1CQHA 4IQAA 2CAQA 2GT6A 3F4RA 5IO0A 3ME7A 4H86A 4K1FA 4NXIA 4HJ2A 5G1KA 2PBJA 2H0GA 3EYTA 3HA9A 4KCEA 1SYRA 3DGQA 1XZOA 1O6JA 1BAYA 1ZGNA 3MWHA 5A4VA 4X43A 1UVZA 4MPFA 2YOIA 2IWTA 1TP9A 5EPFA 2VLVA 3HMJG 1TK5B 1PMTA 2XBIA 2IFQA 4WR5A 2PWJA 2HYXA 3D4MA 4IELA 1HQOA 2R0PA 2TIRA 4MJAA 1R26A 2L6CA 3TJJA 3VFIA 6GSWA 5D9TA 3TKRA 3ZIVA 2VKZG 3H1NA 3LEFA 3L4NA 1F2EA 4BVXA 1AW9A 3J7Yb 2B7JA 1MD4A 4IW9A 4ILFA 3KMNA 4I2TA 3IXRA 4K8MA 1DE1A 3HCZA 2LTKA 1PL2A 3IHQA 3CTGA 2LNSA 1Y25A 4K5RA 2HSMB 5ELAA 1QMVA 4D73B 5J4VA 5J40A 3CBUA 4EUYA 1GNEA 4EXJA 3CYNA 2YV9A 2IMIA 2KLXA 1R5PA 2C1YA 3F3RA 1PX7A 3U6VA 4OD7A 1YKAA 2LEGA 1V2AA 2XBQA 3KEBA 1X9MB 4Q5NA 1TI1A 4TXOB 2GS3A 1A23A 4GTUA 2GSTA 3DMLA 4DSQA 6GSVA 4OFMA 1TOFA 1H4OA 4EF0A 3PPUA 2YWNA 1M0UA 4MF5A 3VWUA 4HUAA 2MYGA 3EC3A 3H8QA 4QL9A 3VPQA 1FVKA 5J4UA 2GDRA 1QXHA 2V2GA 1DUGA 4EVMA 3KIJA 1U3AA 6GSYA 3WGEA 2BTOT 5ECLB 2GT5A 3F63A 17GSA 3KP9A 4TRXA 1GSYA 2YJHA 4FYCA 4FYUA 4KDXA 4K7OA 2EFEA 4QL7A 1EEMA 1OKDA 3FK8A 1FHEA 3IDVA 1SVLA 3GHAA 3EVIA 4O32A 1OE7A 1UC7A 3F9UA 1TK8B 4ICYA 4J56E 2C0FA 4PUFC 4K9ZA 4AJ6A 2GZZA 1W89A 2EIQA 1SVMA 2H1BA 1TDIA 2WRTA 3ZFBA 1V57A 1GSEA 2JADA 5DDLA 1BX9A 1PQNA 2GZPA 2VAFA 1NM3A 4AJ7A 4N10A 1THXA 3M9KA 5ECQB 4AGSA 1TU8A 3IHGA 4ECCA 1SL0B 2X4AA 1DSBA 1SJZA 4XRDA 5IMCA 5LCZA 3RPPA 3FKFA 2R2JA 2YWOA 4MMMA 3PR8A 2MBTA 2V6KA 3RHBA 1FAAA 5CRHA 1TRVA 4LL1B 5EL8A 3TRPA 2VCVA 3APQA 6GSXA 4IS0A 4RI7A 1THOA 3L78A 4KF9A 3VWVA 3V1WA 2G2QA 5A1NB 5BMUB 1JZOA 2C80A 2LJKA 5GAPD 3MYDA 1PN0A 3DVWA 6GSUA 1WPIA 1JZWA 2EC4A 2PPTA 2VOCA 4ZBBA 1A0FA 4G19A 3TOUA 1F3AA 3QR6A 1RK4A 5KOXA 4BPYA 5IQYA 4O92A 2A4VA 2B1KA 13GSA 1GNWA 3GFKA 2BMXA 2WB9A 4BWSA 2HRAA 4ZB8A 1XW6A 3CRTA 5CP1A 1ZYQB 2OE3A 5ECHB 2MMNA 1WOUA 2LUSA 2HSMA 1M9AA 2CT6A 3CRUA 4D73A 1AQXA 3QFBC 5HFIA 2B5YA 5IPGA 3M8NA 5AISA 4K0GA 3TKSA 4EO3A 3ZVJD 3A3TA 1V9WA 3ZLPA 5DBQA 4AKGA 1BG1A 5DCHA 3G7JA 3TB2A 2QA1A 1O85A 5F05A 2VL2C 2VD0A 4ZIJA 1VGLA 3NIVA 4NHWA 2LSTA 3MNGA 3WGXA 1GP1A 4TXOA 3Q18A 3MIXA 3EWLA 1E6BA 4G0LA 4WBJA 3GUSA 4Z2RA 4MK3A 1SJ6A 1AUCA 3ZITA 3FZ5A 1OC9B 1U88A 4PQHA 3BD2A 5ELGA 1GL8A 4EE0A 4O7HA 2YPMA 5DQYA 1GSSA 3LORA 4JEDA 1SD8A 5KN2A 2GSSA 2V1MA 5IIZA 6GSTA 2RIIA 2ZCTA 3GKMA 2F8FA 1M2DA 3QDNA 1K0AA 2B3SA 2VL2A 1SJIA 4OO4A 1HNBA 4OMVA 2L4QA 3VWXA 2PGTA 2WS2A 1B9YC 5C00A 3EU4A 3TDGA 3IR4A 5A34A 2WULA 4XS1A 1O8XA 4Z7XA 1SKWB 4AKHA 5DAKB 1K0DA 4ZL7A 4PTSA 1A8YA 1GLPA 1C72A 2AV4A 4ZBAA 1F9MA 4NMUA 4TOPA 1TW9A 4F9ZA 4YAPA 3L9VA 1RQMA 2H0IA 3CXGA 1QQ2A 3HKRA 1GRXA 4CY8A 3NOFA 5AIVA 4GCIA 1Z3EA 3ZMLA 1ON4A 1SKRB 1JFUA 2H6ZA 3QD9A 4Z2TA 4BA7A 4IVFA 2GTUA 2H70A 3SWLA 2QC7A 5F07A 1ZOFA 3EU3A 2F3MA 1EEJA 20GSA 3D6IA 2EFCA 1B8XA 4AF2A 5IMZA 4ULXA 3GIXA 2FCHA 4LMVA 4Q5RA 1ZMAA 4N0ZA 2LS5A 2FHEA 5BMUA 1ZYEA 1VF4A 5HR3A 2HQTA 3VK9A 4L0WA 2HZFA 4GLTA 2REMA 4K7NA 2R0CA 3GKKA 1ERUA 2OBKA 1M9BA 3QAVA 3HXSA 3LYKA 2CZ3A 2WGRA 2O7KA 1O7UA 3C71A 2H66A 4KSMA 2HT9A 1EOHA 1WJKA 1JZDA 4JR6A 3TKSE 3RAZA 2A4HA 3A5WA 3DEXA 4MF7A 3A2XA 2C3QA 2CVBA 2H6YA 2QGVA 2ALBA 3BCKA 1ZZYA 4MPGA 1WP0A 2NDOA 1VF2A 4TXVA 2QA2A 1TK0B 4IKHA 1BF5A 1XWBA 4DEJA 1PSQA 2UZ8A 2K6VA 3ERWA 1TTZA 3TJFA 4GQCA 3TKPA 2YV7A 2PU9C 4EDZA 1A8LA 1YVLA 1VF1A 1GUMA 1BEDA 5AIXA 4LLRA 3MSZA 3GSTA 4YQMA 2E2MA 3A2WA 3VWWA 1M99A 2C4JA 2R37A 3HHVA 2JU5A 4ZB6A 5L71A 3W8JA 1USBA 4G2EA 1GSFA 4POBA 5CAXA 3WYWA 2X8GA 5COHA 1NW2A 5CREA 2P0GA 2GSQA 1I5GA 3KH9A 2OKAA 2P5QA 2VO4A 3IPZA 4RI6A 1S3CA 1TXXA 1R4WA 1ILOA 2L5OA 4NPBA 2CA8A 3GTUB 3FRCA 2H73A 2F8AA 3FY7A 1H75A 14GSA 5JWQB 3HVVA 3GH6A 4WF4A 3LSZA 1J08A 4BL7B 3L9SA 1ML6A 1MDJA 1J0FA 1GULA 1AC1A 2HSNB 4E68A 1A2LA 4TVEA 3UIWA 2WCIA 3IA1A 1SL2B 1BG5A 3TUEA 5D9VA 3HDCA 2DMLA 3H4KA 5H5QA 1AXDA 2LQOA 4TR0A 2OACA 4ZILA 5JWRB 4HS1A 1K3LA 4HQSA 5DAKA 1WE0A 3ZZXA 1GSUA 1ACVA 2IN3A 5CRGA 3IAM2 4N0VA 3EINA 3MAKA 3FW2A 2DSAA 1MTCA 2M80A 2OBIA 5GZZB 1EP7A 2IMEA 3IC8A 2CVDA 1EP8A 2H6XA 4YQUA 1OC8A 2X8CA 2VL9A 2HSHA 1HYUA 5FHIA 2H01A 4MH2A 4X4JA 2JZTA 5F06A 2C0GA 2EIRA 2LJAA 2NBSA 3RDWA 1JZRA 3F0IA 4N3ZA 4KW6A 1PD21 3M0FA 3I69A 4OCFA 2PVQA 2IMDA 3O3TA 1N25A 2HFDA 1PKZA 5B8BA 3GNJA 4MLYA 1QUWA 3HYPA 4EC0A 1NHYA 1SL1B 5BRTA 4EIPA 1PKWA 3LQ7A 3EMXA 5A4WA 3ZTLA 3D5JA 1SK0A 3BJ5A 4IGJA 5H5RA 2OE0A 2UV8G 3D21A 1T4YA 1KTEA 4G0IA 4V2NA 3C7MA 2O87A 4MP4A 3LWAA 4XS6A 5IM9A 3GSSA 3JCML 4EDYA 1XVQA 3TKQA 3GL3A 3F3QA 4PX1A 4EIQA 2H1GA 5CYYA 3LFLA 5DCGA 5IMDA 4MF6A 3O6TA 4PXOA 5F0GA 2XC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRD A;  2N5A A;  2YNX A;  5D73 A;  3HZ4 A;  1FG4 A;  3F8U A;  3K8N A;  1FVJ A;  5D9X A;  11GS A;  2M46 A;  2VCT A;  2CV4 A;  2CX3 A;  4OO5 A;  5AGY A;  1GUK A;  5IOX A;  1T3B A;  1K0M A;  3FR3 A;  1YDK A;  4E8H A;  3WGD A;  4HU7 A;  3BOA A;  4P3Y B;  1K0O A;  4ZXG A;  1OVN A;  2YZH A;  1K3Y A;  5DJM A;  2L5L A;  3DD3 A;  4XS4 B;  5JWO B;  4HQZ A;  1V40 A;  3IC4 A;  4FQU A;  5J9B A;  3CSI A;  1FO5 A;  4GF0 A;  5EY6 A;  2CZ2 A;  5E59 A;  22GS A;  3C1S A;  3ZYW A;  3TOT A;  4KAE A;  3KTB A;  4G10 A;  3VI7 A;  3F4S A;  3UEM A;  5JCU A;  1T4Z A;  2KP1 A;  2DIY A;  3LGC A;  3FR6 A;  1AQW A;  2GQM A;  1W4V A;  1XW5 A;  2GSR A;  4BL7 A;  2JZS A;  1PRX A;  4JE1 A;  4DSS B;  4HZ4 A;  2O85 A;  5D8I A;  1JHB A;  1LJR A;  5J41 A;  3C73 A;  3WD6 A;  4MDC A;  3HVX A;  3WT2 A;  1UN2 A;  4JR4 A;  5DVB A;  1S3D A;  2JSZ A;  1AIU A;  4EKZ A;  3D22 A;  1GSQ A;  3GYK A;  1YEP A;  4GST A;  1HNC A;  3ERF A;  3WT1 A;  3MDK A;  3M3M A;  2L4C A;  1SD9 A;  2M72 A;  1N8J A;  2R6K A;  4KCA A;  2L57 A;  2QSI A;  2RM6 A;  4GQF A;  1B4Q A;  1ST9 A;  1Z7R A;  3KP8 A;  4HJM A;  5KN0 A;  1WMJ A;  2HRN A;  2CVK A;  1T1V A;  1Z5Y E;  1OE8 A;  2R3X A;  1RW1 A;  2LRT A;  4USS A;  1XWG A;  4HEA 2;  3HJM A;  3I6A A;  2AYT A;  2E0Q A;  2FWG A;  3OR5 A;  3SBC A;  3GX8 A;  1JLW A;  3CMI A;  2WDU A;  2H30 A;  1YZX A;  2AB6 A;  3I9V 2;  3KH7 A;  4OCE A;  1K3O A;  3G7I A;  3LG6 A;  4HZ2 A;  5FT3 A;  2FY6 A;  3FEU A;  3N9J A;  3DKS A;  2LRN A;  3KD0 A;  1Q4J A;  4TN8 A;  2GVP A;  3ISO A;  5HQP A;  1AAZ A;  3IAS 2;  4IBP A;  1TRW A;  2YWI A;  5IMV A;  4IP6 A;  3GKN A;  2LKU A;  2HZE B;  3PGT A;  3O76 A;  5AN1 A;  3U5R E;  2E7P A;  3E9J B;  2H71 A;  4IJ3 A;  4J2F A;  4WKW A;  4XTS A;  4WXT A;  3P8W A;  3PH9 A;  5ECI B;  2HI7 A;  1EWX A;  3W8S A;  4J57 E;  4L0U A;  3TJG A;  2FA8 A;  2QKE A;  3VPT A;  3J7Y k;  2H8L A;  3ZIJ A;  1X0R A;  4I97 A;  2G0F A;  2HSY A;  2IJY A;  1CQG A;  1OC3 A;  4OFT A;  3KCM A;  3R3E A;  2RUE A;  3HZ8 A;  2AAW A;  1I9D A;  1VF3 A;  3VLN A;  3G9B A;  1YF0 A;  4K6X A;  1PX6 A;  1U6T A;  4JRR A;  4CHS A;  1YF1 A;  1UA5 A;  1J9B A;  1KEB A;  3F4T A;  4F82 A;  4XS4 A;  3L0H A;  5B7C A;  4FYB A;  5GSS A;  2H75 A;  3DXB A;  4WET A;  2C0E A;  2OAD A;  4DSR A;  3CSH A;  4TR4 A;  2K9F A;  1HNA A;  1K0C A;  4L5O A;  2HNL A;  4KA0 A;  2DIZ A;  1Z6N A;  3DRN A;  2VD1 A;  1BQ7 A;  4ACS A;  2H76 A;  2HRK B;  2JL4 A;  5B8A A;  2IIY A;  1ERT A;  5G5E A;  5GST A;  2WZ9 A;  2DLX A;  3FZ9 A;  3PIN A;  1GLQ A;  2B5X A;  3N5O A;  3UAP A;  1FB6 A;  3C8E A;  4DSS A;  4ZBD A;  2VLT A;  4HU9 A;  1YKC A;  1GSD A;  4WR4 A;  3M9J A;  4V1A g;  1Z7P A;  2GQL A;  3KZQ A;  4RQR A;  4KDU A;  2I9H A;  5DAL B;  3UVH A;  4E8E A;  4FO5 A;  1DE2 A;  3APS A;  5IOW A;  5F8B A;  1Y6E A;  2H74 A;  2K18 A;  4YQV A;  4ZB9 A;  1M2B A;  3QAW A;  1X5E A;  3GMF A;  2P5R A;  2V41 A;  2VM1 A;  3EE2 A;  2WFC A;  2V6O A;  5H5S A;  2TRX A;  4ECJ A;  1TU7 A;  3CTF A;  1NHO A;  2TRC P;  3RHC A;  4F0B A;  4YAV A;  4KND A;  2IL3 A;  2LRC A;  2H0H A;  2PUK C;  4WF5 A;  5IO2 A;  5KN3 A;  2ES7 A;  3UMA A;  4CDO A;  2O8V B;  1X5C A;  2AHE A;  4IHU A;  3EUR A;  2B1L A;  2IPA A;  4PNF A;  1DBY A;  3GL5 A;  1OC9 A;  4L8E A;  1QFN A;  4GSN A;  2ZUP A;  4XHM A;  2H72 A;  5IPH A;  2DJK A;  1MDI A;  1AQV A;  12GS A;  2I81 A;  3KXO A;  1Z6M A;  5G2Z A;  5HR0 A;  2F51 A;  4TR1 B;  5LD0 A;  2PMT A;  2PVO C;  1SEN A;  1TKD B;  5DJL A;  4FH8 A;  4EL1 A;  4PUA A;  2HZE A;  4PUR A;  2KHP A;  2I4A A;  2ON7 A;  2MMZ A;  5ECN B;  2N5F A;  1E2Y A;  1OYJ A;  2KP2 A;  5HFG A;  3HJO A;  5GAN D;  3E3E A;  4NV5 A;  2JZR A;  1WIK A;  4POM A;  3I43 A;  8GSS A;  5JCG A;  1O8W A;  5LNK e;  2IMF A;  3APO A;  4MZW A;  2LV3 A;  3HJP A;  3M1G A;  16GS A;  5A4U A;  1S3A A;  1OKT A;  4MZB A;  5ECO B;  4AJ8 A;  4MA9 A;  2L6D A;  3F6D A;  3ZL5 A;  2X8H A;  3FHK A;  4KDY A;  1O81 A;  9GSS A;  1Q98 A;  1XFL A;  2ZNM A;  4G0K A;  4RUV A;  3TJB A;  2RM5 A;  3IV4 A;  3TJK A;  3HY2 A;  5E4W A;  3LXZ A;  2HRK A;  4TW5 A;  5ENU A;  3H93 A;  1U87 A;  1G6Y A;  2EIO A;  2JAC A;  3R2Q A;  4F0C A;  1FW1 A;  5C04 A;  4V1A p;  2VCX A;  1KNG A;  1X5D A;  3F6F A;  4I8B A;  5ID2 B;  1FB0 A;  1M7T A;  3C1R A;  3QFA C;  1Z9H A;  2GQK A;  1A24 A;  4KSO A;  3P7X A;  1B9X C;  4I6X A;  5CRW A;  3CSJ A;  2MBS A;  4KB3 A;  7GSS A;  5A5K A;  1XOA A;  4K7I A;  3UOM A;  1G7E A;  2L59 A;  5IMF A;  5DAL A;  2VCQ A;  10GS A;  4ECB A;  3D4T A;  4FIW A;  4TKY A;  2C0D A;  5HR2 A;  1GTB A;  4ID0 A;  5G1L A;  1GTI A;  1B48 A;  5EVO A;  4F03 A;  2YP6 A;  2H19 A;  2V32 A;  4L5L A;  1ERV A;  2XPD A;  5HR1 A;  4CW9 A;  2FD3 A;  3EMP A;  2OJL A;  1R5A A;  3HD5 A;  3KJY A;  2DMM A;  4GSS A;  4ZL9 A;  18GS A;  3UVT A;  4WBR D;  5D9W A;  4HOJ A;  6GSS A;  1XVW A;  2YN1 A;  1XOB A;  3FR9 A;  1ABA A;  2CX4 A;  1O73 A;  4I2U A;  5G5F A;  4PGT A;  3ME8 A;  1SU9 A;  2PER A;  2NVL A;  4WEY A;  4XCS A;  2J23 A;  1LU4 A;  1XCC A;  3ZMK A;  2OE1 A;  1MEK A;  4NWY A;  3DYR A;  1QK8 A;  1JLV A;  1WRY A;  5B6N A;  4ML6 A;  1NSW A;  3GTU A;  3E0U A;  19GS A;  1T7P B;  2VIM A;  4LMW A;  4TR1 A;  2I3Y A;  4O5R A;  1MDK A;  1K0B A;  4G9H A;  3IRA A;  3GA4 A;  1XXU A;  4OFN A;  2HRF A;  1XPV A;  1ERW A;  4BVY B;  2VL3 A;  3FYG A;  1EZK A;  3IE3 A;  2HLS A;  3NZN A;  2ON5 A;  4GRF A;  4ML1 A;  2X64 A;  5B6M A;  3QCP A;  3LXT A;  3TKS C;  5FWG A;  2R4V A;  2YWM A;  1X9S B;  2CQ9 A;  2JSY A;  3ZFL A;  1XIY A;  3ED3 A;  1LBK A;  2FNO A;  3G7Y A;  2R5G A;  1ZCP A;  1PGT A;  1XWK A;  2LJR A;  5ECS A;  2CAI A;  4KX4 A;  3QAG A;  2YJ7 A;  4KUN A;  1PN9 A;  3VI5 A;  2I1U A;  1PL1 A;  1XWC A;  2HE3 A;  3TCO A;  1SK1 A;  5ECM B;  1GTU A;  1F37 A;  1X9W B;  3TGZ A;  2A2R A;  1F3B A;  4NHZ A;  1FOV A;  3GH9 A;  4ECI A;  3Q19 A;  2DBC A;  3RBT A;  3UL3 A;  1G6W A;  5J5N A;  4DVC A;  3ERG A;  2VM2 A;  3US3 A;  1GWC A;  2DJ1 A;  2FWH A;  3TRX A;  5KN1 A;  3RPN A;  2VUP A;  3H79 A;  1YEX A;  2NPB A;  4KH7 A;  1G7O A;  2P31 A;  3IBH A;  2FUG 2;  2YZU A;  3IK7 A;  4XIH A;  5G30 A;  4MJB A;  2YAN A;  5ID2 A;  2C8U A;  1V58 A;  2IMK A;  1YQ1 A;  2MZC A;  2C3N A;  3KM6 A;  4V2M A;  3ZRE A;  4V2L A;  2D2Z A;  2DJ0 A;  4IP1 A;  1KBN A;  1R7H A;  5JCW A;  2FLS A;  3D0Z A;  2F9S A;  5HFK A;  1EGO A;  1EV4 A;  2VLU A;  3TRQ A;  3GKX A;  4JBB A;  1EOG A;  3DVX A;  4PQ1 A;  3GN3 A;  5ECR B;  3IOS A;  3Q74 A;  4XRA A;  1TI3 A;  1F6M C;  1T00 A;  4GWR A;  2KOK A;  1YY7 A;  3KTL A;  1XWA A;  5IMA A;  2IFQ B;  1B4P A;  4BWQ A;  3GRX A;  3GX0 A;  1EV9 A;  3HVS A;  2PN8 A;  2VCZ A;  5ECK B;  2DC5 A;  3FZA A;  4ZL8 A;  1ZL9 A;  2LQQ A;  1IYI A;  3AY8 A;  1U3I A;  2RLI A;  4NV2 A;  2H1A A;  1HD2 A;  1SKS B;  3QMX A;  2LNT A;  2GZY A;  2J9H A;  4QQ7 A;  4X0X A;  4BVX B;  1VRS D;  1N2A A;  1V98 A;  4TR3 A;  1K0N A;  3W6G A;  1TRS A;  4JU5 A;  4IQ1 A;  2E2G A;  1PA3 A;  3Q6O A;  3KGK A;  2FWE A;  3ZVJ A;  1BJX A;  2C3T A;  4N11 A;  4NAX A;  4MZC A;  5ABR A;  4ISD A;  4Q5F A;  3BCI A;  2HXK A;  4N30 A;  4GXZ A;  4LL4 B;  3DIE A;  1URM A;  2FWF A;  1TRU A;  3S9F A;  4K2D A;  1A2J A;  3QPM A;  2MMO A;  4K0N A;  3FZ4 A;  4HDE A;  2AUV A;  2KUC A;  4PNG A;  4HI7 A;  4POL A;  5INY A;  2N5B A;  2VCW A;  2DJ3 A;  4LA1 A;  4MJE A;  2XHF A;  3IK9 A;  3UBL A;  4MCU A;  5CRD A;  3UAR A;  2AJQ B;  4BVY A;  1T8E B;  4PQI A;  2DJ2 A;  5KEJ A;  2WJU A;  2O89 A;  1XW9 A;  3LYP A;  2K8V A;  2XPE A;  4OWY A;  3A2V A;  5J9C A;  4JZQ A;  1WWJ A;  1GH2 A;  3DWV A;  1BYE A;  1SK2 A;  2YCD A;  4Q5Q A;  2H1D A;  5ECP B;  2B7K A;  2DJJ A;  3QOU A;  5DQS A;  2OA7 A;  1XBS A;  5G31 A;  4MAB A;  3KMO A;  2A2S A;  2X99 A;  4IN0 A;  3VUR A;  4YH2 A;  3BBY A;  5CNW A;  3UJ1 A;  2FGX A;  2MMA A;  2B5E A;  4RQX A;  1QGV A;  3GUR A;  2RUF A;  2K8S A;  2GGT A;  2Z9S A;  4IJI A;  3UBK A;  2GLR A;  1A2M A;  3GV1 A;  1MD3 A;  3P90 A;  3P2A A;  2B6M A;  1EGR A;  4POK A;  1YJ6 A;  4MH3 A;  4I5Q A;  1IYH A;  4MJC A;  5D96 A;  3L9U A;  1OAZ A;  5D93 A;  1GUH A;  2BJX A;  5CO3 A;  2FA4 A;  4X1U A;  1GTA A;  4KGI A;  1SYX A;  4KE3 A;  5J3R A;  1TJD A;  1G0T A;  2NTO A;  3LJR A;  1M2A A;  4F2I A;  1A0R P;  1CQH A;  4IQA A;  2CAQ A;  2GT6 A;  3F4R A;  5IO0 A;  3ME7 A;  4H86 A;  4K1F A;  4NXI A;  4HJ2 A;  5G1K A;  2PBJ A;  2H0G A;  3EYT A;  3HA9 A;  4KCE A;  1SYR A;  3DGQ A;  1XZO A;  1O6J A;  1BAY A;  1ZGN A;  3MWH A;  5A4V A;  4X43 A;  1UVZ A;  4MPF A;  2YOI A;  2IWT A;  1TP9 A;  5EPF A;  2VLV A;  1TK5 B;  1PMT A;  2XBI A;  2IFQ A;  4WR5 A;  2PWJ A;  2HYX A;  3D4M A;  4IEL A;  1HQO A;  2TIR A;  4MJA A;  1R26 A;  2L6C A;  3TJJ A;  3VFI A;  6GSW A;  5D9T A;  3TKR A;  3ZIV A;  3H1N A;  3LEF A;  3L4N A;  1F2E A;  4BVX A;  1AW9 A;  3J7Y b;  2B7J A;  1MD4 A;  4IW9 A;  4ILF A;  3KMN A;  4I2T A;  3IXR A;  4K8M A;  1DE1 A;  3HCZ A;  2LTK A;  1PL2 A;  3IHQ A;  3CTG A;  2LNS A;  1Y25 A;  2HSM B;  5ELA A;  1QMV A;  4D73 B;  3CBU A;  4EUY A;  1GNE A;  4EXJ A;  3CYN A;  2YV9 A;  2IMI A;  2KLX A;  1R5P A;  2C1Y A;  3F3R A;  1PX7 A;  3U6V A;  4OD7 A;  1YKA A;  2LEG A;  1V2A A;  2XBQ A;  3KEB A;  1X9M B;  4Q5N A;  1TI1 A;  4TXO B;  2GS3 A;  1A23 A;  4GTU A;  2GST A;  3DML A;  4DSQ A;  6GSV A;  4OFM A;  1TOF A;  1H4O A;  4EF0 A;  3PPU A;  2YWN A;  1M0U A;  4MF5 A;  3VWU A;  4HUA A;  2MYG A;  3EC3 A;  3H8Q A;  4QL9 A;  3VPQ A;  1FVK A;  5J4U A;  2GDR A;  1QXH A;  2V2G A;  1DUG A;  4EVM A;  3KIJ A;  1U3A A;  6GSY A;  3WGE A;  2BTO T;  5ECL B;  2GT5 A;  3F63 A;  17GS A;  3KP9 A;  4TRX A;  1GSY A;  2YJH A;  4FYC A;  4FYU A;  4KDX A;  4K7O A;  4QL7 A;  1EEM A;  1OKD A;  3FK8 A;  1FHE A;  3IDV A;  3GHA A;  3EVI A;  4O32 A;  1OE7 A;  1UC7 A;  3F9U A;  1TK8 B;  4J56 E;  2C0F A;  4PUF C;  4K9Z A;  4AJ6 A;  2GZZ A;  1W89 A;  2EIQ A;  2H1B A;  1TDI A;  2WRT A;  3ZFB A;  1V57 A;  1GSE A;  2JAD A;  5DDL A;  1BX9 A;  1PQN A;  2GZP A;  2VAF A;  1NM3 A;  4AJ7 A;  4N10 A;  1THX A;  3M9K A;  5ECQ B;  4AGS A;  1TU8 A;  4ECC A;  1SL0 B;  1DSB A;  1SJZ A;  4XRD A;  5IMC A;  5LCZ A;  3RPP A;  3FKF A;  2R2J A;  2YWO A;  4MMM A;  3PR8 A;  2MBT A;  2V6K A;  3RHB A;  1FAA A;  5CRH A;  1TRV A;  4LL1 B;  5EL8 A;  3TRP A;  2VCV A;  3APQ A;  6GSX A;  4IS0 A;  4RI7 A;  1THO A;  3L78 A;  4KF9 A;  3VWV A;  3V1W A;  2G2Q A;  1JZO A;  2C80 A;  2LJK A;  5GAP D;  3DVW A;  6GSU A;  1WPI A;  1JZW A;  2EC4 A;  2PPT A;  2VOC A;  4ZBB A;  1A0F A;  4G19 A;  3TOU A;  1F3A A;  3QR6 A;  1RK4 A;  4BPY A;  5IQY A;  4O92 A;  2A4V A;  2B1K A;  13GS A;  1GNW A;  3GFK A;  2BMX A;  2WB9 A;  4BWS A;  2HRA A;  4ZB8 A;  1XW6 A;  3CRT A;  5CP1 A;  1ZYQ B;  2OE3 A;  5ECH B;  2MMN A;  1WOU A;  2LUS A;  2HSM A;  1M9A A;  2CT6 A;  3CRU A;  4D73 A;  1AQX A;  3QFB C;  5HFI A;  2B5Y A;  5IPG A;  3M8N A;  5AIS A;  4K0G A;  3TKS A;  4EO3 A;  3ZVJ D;  3A3T A;  1V9W A;  3ZLP A;  5DBQ A;  5DCH A;  3G7J A;  3TB2 A;  1O85 A;  5F05 A;  2VL2 C;  2VD0 A;  4ZIJ A;  1VGL A;  3NIV A;  4NHW A;  2LST A;  3MNG A;  3WGX A;  1GP1 A;  4TXO A;  3Q18 A;  3EWL A;  1E6B A;  4G0L A;  4WBJ A;  3GUS A;  4MK3 A;  1SJ6 A;  1AUC A;  3ZIT A;  3FZ5 A;  1OC9 B;  1U88 A;  4PQH A;  3BD2 A;  5ELG A;  1GL8 A;  4EE0 A;  4O7H A;  2YPM A;  5DQY A;  1GSS A;  3LOR A;  4JED A;  1SD8 A;  5KN2 A;  2GSS A;  2V1M A;  5IIZ A;  6GST A;  2RII A;  2ZCT A;  3GKM A;  2F8F A;  1M2D A;  3QDN A;  1K0A A;  2B3S A;  2VL2 A;  1SJI A;  4OO4 A;  1HNB A;  4OMV A;  2L4Q A;  3VWX A;  2PGT A;  2WS2 A;  1B9Y C;  5C00 A;  3EU4 A;  3TDG A;  3IR4 A;  2WUL A;  4XS1 A;  1O8X A;  4Z7X A;  1SKW B;  5DAK B;  1K0D A;  4ZL7 A;  4PTS A;  1A8Y A;  1GLP A;  1C72 A;  2AV4 A;  4ZBA A;  1F9M A;  4NMU A;  4TOP A;  1TW9 A;  4F9Z A;  4YAP A;  3L9V A;  1RQM A;  2H0I A;  3CXG A;  1QQ2 A;  3HKR A;  1GRX A;  3NOF A;  5AIV A;  4GCI A;  1Z3E A;  3ZML A;  1ON4 A;  1SKR B;  1JFU A;  2H6Z A;  3QD9 A;  4BA7 A;  4IVF A;  2GTU A;  2H70 A;  3SWL A;  2QC7 A;  5F07 A;  1ZOF A;  3EU3 A;  2F3M A;  1EEJ A;  20GS A;  3D6I A;  1B8X A;  4AF2 A;  5IMZ A;  4ULX A;  3GIX A;  2FCH A;  4LMV A;  4Q5R A;  1ZMA A;  4N0Z A;  2LS5 A;  2FHE A;  5BMU A;  1ZYE A;  1VF4 A;  5HR3 A;  2HQT A;  3VK9 A;  4L0W A;  2HZF A;  4GLT A;  2REM A;  4K7N A;  3GKK A;  1ERU A;  2OBK A;  1M9B A;  3QAV A;  3HXS A;  3LYK A;  2CZ3 A;  2WGR A;  2O7K A;  1O7U A;  3C71 A;  2H66 A;  4KSM A;  2HT9 A;  1EOH A;  1WJK A;  1JZD A;  4JR6 A;  3TKS E;  3RAZ A;  3A5W A;  3DEX A;  4MF7 A;  3A2X A;  2C3Q A;  2CVB A;  2H6Y A;  2QGV A;  2ALB A;  3BCK A;  1ZZY A;  4MPG A;  1WP0 A;  2NDO A;  1VF2 A;  4TXV A;  1TK0 B;  4IKH A;  1XWB A;  4DEJ A;  1PSQ A;  2UZ8 A;  2K6V A;  3ERW A;  1TTZ A;  3TJF A;  4GQC A;  3TKP A;  2YV7 A;  2PU9 C;  4EDZ A;  1A8L A;  1VF1 A;  1GUM A;  1BED A;  5AIX A;  4LLR A;  3MSZ A;  3GST A;  4YQM A;  2E2M A;  3A2W A;  3VWW A;  1M99 A;  2C4J A;  2R37 A;  3HHV A;  2JU5 A;  4ZB6 A;  5L71 A;  3W8J A;  1USB A;  4G2E A;  1GSF A;  4POB A;  5CAX A;  3WYW A;  2X8G A;  5COH A;  1NW2 A;  5CRE A;  2P0G A;  2GSQ A;  1I5G A;  3KH9 A;  2OKA A;  2P5Q A;  2VO4 A;  3IPZ A;  4RI6 A;  1S3C A;  1TXX A;  1R4W A;  1ILO A;  2L5O A;  4NPB A;  2CA8 A;  3GTU B;  3FRC A;  2H73 A;  2F8A A;  3FY7 A;  1H75 A;  14GS A;  5JWQ B;  3HVV A;  3GH6 A;  4WF4 A;  3LSZ A;  1J08 A;  4BL7 B;  3L9S A;  1ML6 A;  1MDJ A;  1J0F A;  1GUL A;  1AC1 A;  2HSN B;  1A2L A;  4TVE A;  3UIW A;  2WCI A;  3IA1 A;  1SL2 B;  1BG5 A;  3TUE A;  5D9V A;  3HDC A;  2DML A;  3H4K A;  5H5Q A;  1AXD A;  2LQO A;  4TR0 A;  2OAC A;  4ZIL A;  5JWR B;  4HS1 A;  1K3L A;  4HQS A;  5DAK A;  1WE0 A;  3ZZX A;  1GSU A;  1ACV A;  2IN3 A;  5CRG A;  3IAM 2;  4N0V A;  3EIN A;  3MAK A;  3FW2 A;  2DSA A;  1MTC A;  2M80 A;  2OBI A;  5GZZ B;  1EP7 A;  2IME A;  3IC8 A;  2CVD A;  1EP8 A;  2H6X A;  4YQU A;  1OC8 A;  2X8C A;  2VL9 A;  2HSH A;  1HYU A;  5FHI A;  2H01 A;  4MH2 A;  2JZT A;  5F06 A;  2C0G A;  2EIR A;  2LJA A;  2NBS A;  3RDW A;  1JZR A;  3F0I A;  4KW6 A;  1PD2 1;  3M0F A;  3I69 A;  4OCF A;  2PVQ A;  2IMD A;  3O3T A;  2HFD A;  1PKZ A;  5B8B A;  3GNJ A;  4MLY A;  1QUW A;  3HYP A;  4EC0 A;  1NHY A;  1SL1 B;  1PKW A;  3LQ7 A;  3EMX A;  5A4W A;  3ZTL A;  3D5J A;  1SK0 A;  3BJ5 A;  4IGJ A;  5H5R A;  2OE0 A;  3D21 A;  1T4Y A;  1KTE A;  4G0I A;  4V2N A;  3C7M A;  2O87 A;  4MP4 A;  3LWA A;  4XS6 A;  5IM9 A;  3GSS A;  3JCM L;  4EDY A;  1XVQ A;  3TKQ A;  3GL3 A;  3F3Q A;  4PX1 A;  2H1G A;  5CYY A;  3LFL A;  5DCG A;  5IMD A;  4MF6 A;  3O6T A;  4PXO A;  5F0G A;  2XC2 A; 
#chains in the Genus database with same CATH topology
 3ZRD A;  2N5A A;  2YNX A;  5D73 A;  3HZ4 A;  1FG4 A;  3F8U A;  3K8N A;  1FVJ A;  5D9X A;  11GS A;  2M46 A;  2VCT A;  2CV4 A;  2CX3 A;  4OO5 A;  5AGY A;  1GUK A;  5IOX A;  1T3B A;  1K0M A;  3FR3 A;  1YDK A;  4E8H A;  3WGD A;  4HU7 A;  3BOA A;  4P3Y B;  1K0O A;  4ZXG A;  1OVN A;  2YZH A;  1K3Y A;  5DJM A;  2L5L A;  3DD3 A;  4XS4 B;  5JWO B;  4HQZ A;  1V40 A;  3IC4 A;  4FQU A;  5J9B A;  3CSI A;  1FO5 A;  4GF0 A;  5EY6 A;  2CZ2 A;  5E59 A;  22GS A;  3C1S A;  3ZYW A;  3TOT A;  4KAE A;  3KTB A;  4G10 A;  3VI7 A;  3F4S A;  3UEM A;  5JCU A;  1T4Z A;  2KP1 A;  2DIY A;  3LGC A;  3FR6 A;  1AQW A;  2GQM A;  1W4V A;  1XW5 A;  2GSR A;  4BL7 A;  2JZS A;  3TU3 B;  1PRX A;  4JE1 A;  4DSS B;  4HZ4 A;  2O85 A;  2HSN A;  3RFR C;  2EFH A;  1I1I P;  5D8I A;  1JHB A;  1LJR A;  4PHZ C;  5J41 A;  3C73 A;  3WD6 A;  2A2P A;  4MDC A;  3HVX A;  3WT2 A;  1UN2 A;  4JR4 A;  5DVB A;  1S3D A;  2JSZ A;  2EFD A;  1AIU A;  1PFO A;  4EKZ A;  3D22 A;  1GSQ A;  3GYK A;  1YEP A;  4GST A;  1HNC A;  3ERF A;  3WT1 A;  3MDK A;  3M3M A;  2L4C A;  1SD9 A;  2M72 A;  1N8J A;  2WW0 A;  2R6K A;  4KCA A;  2L57 A;  3FMW A;  2QSI A;  2RM6 A;  4GQF A;  1B4Q A;  1ST9 A;  1Z7R A;  3KP8 A;  4HJM A;  5KN0 A;  1WMJ A;  2HRN A;  2CVK A;  1T1V A;  1Z5Y E;  1OE8 A;  2LRT A;  2R3X A;  1RW1 A;  4USS A;  1XWG A;  4HEA 2;  3HJM A;  3I6A A;  2AYT A;  2E0Q A;  2FWG A;  3OR5 A;  3SBC A;  3GX8 A;  1JLW A;  3CMI A;  2WDU A;  2H30 A;  4G01 A;  1YZX A;  2AB6 A;  3I9V 2;  3KH7 A;  4OCE A;  1K3O A;  3G7I A;  3LG6 A;  4HZ2 A;  5FT3 A;  2FY6 A;  3FEU A;  3N9J A;  3DKS A;  2LRN A;  3KD0 A;  1Q4J A;  4TN8 A;  2GVP A;  3ISO A;  5HQP A;  1AAZ A;  3IAS 2;  4IBP A;  1TRW A;  2YWI A;  5IMV A;  4IP6 A;  3GKN A;  2LKU A;  1S4B P;  2HZE B;  3PGT A;  3O76 A;  5AN1 A;  3U5R E;  2E7P A;  3E9J B;  2H71 A;  4IJ3 A;  4J2F A;  4WKW A;  4XTS A;  4WXT A;  3P8W A;  3PH9 A;  5ECI B;  2HI7 A;  1EWX A;  3W8S A;  4J57 E;  4L0U A;  3TJG A;  2FA8 A;  2QKE A;  3VPT A;  3J7Y k;  2H8L A;  3ZIJ A;  1X0R A;  4I97 A;  2G0F A;  2HSY A;  2IJY A;  1CQG A;  1OC3 A;  4OFT A;  2X49 A;  3KCM A;  3R3E A;  2RUE A;  3HZ8 A;  2AAW A;  1I9D A;  1VF3 A;  3VLN A;  3G9B A;  1YF0 A;  4K6X A;  1PX6 A;  4AKX B;  1U6T A;  4JRR A;  4CHS A;  1YF1 A;  1UA5 A;  1J9B A;  1KEB A;  5A5H B;  3F4T A;  4F82 A;  4XS4 A;  3L0H A;  5B7C A;  4FYB A;  5GSS A;  2H75 A;  3DXB A;  4WET A;  2C0E A;  2OAD A;  4DSR A;  3CSH A;  4TR4 A;  2K9F A;  1HNA A;  1K0C A;  4L5O A;  2HNL A;  4KA0 A;  2DIZ A;  1Z6N A;  3LW9 A;  3DRN A;  2VD1 A;  1BQ7 A;  4ACS A;  2H76 A;  2HRK B;  2JL4 A;  5B8A A;  2IIY A;  1ERT A;  5G5E A;  5GST A;  2WZ9 A;  2DLX A;  3FZ9 A;  3PIN A;  1GLQ A;  5A1N A;  2B5X A;  3N5O A;  3UAP A;  1FB6 A;  3C8E A;  4DSS A;  4ZBD A;  2VLT A;  4HU9 A;  4A5P A;  1YKC A;  1GSD A;  4WR4 A;  3M9J A;  4V1A g;  1Z7P A;  2GQL A;  3KZQ A;  4RQR A;  4KDU A;  2I9H A;  5DAL B;  3UVH A;  4E8E A;  4FO5 A;  1DE2 A;  3APS A;  4K2X A;  5IOW A;  5F8B A;  1Y6E A;  2H74 A;  2K18 A;  2DKI A;  4YQV A;  4ZB9 A;  1M2B A;  4QMK A;  3QAW A;  1X5E A;  3GMF A;  2O5V A;  2P5R A;  2V41 A;  2VM1 A;  3EE2 A;  2WFC A;  2V6O A;  5H5S A;  2TRX A;  4ECJ A;  5J4Y A;  1TU7 A;  3CTF A;  1NHO A;  2TRC P;  4GDF A;  3RHC A;  4F0B A;  2O3E A;  4YAV A;  4KND A;  2IL3 A;  2LRC A;  2H0H A;  2OT3 A;  2PUK C;  4WF5 A;  5IO2 A;  5KN3 A;  2ES7 A;  3UMA A;  4CDO A;  2O8V B;  1X5C A;  2AHE A;  4IHU A;  3EUR A;  2B1L A;  2IPA A;  4PNF A;  1DBY A;  3GL5 A;  1OC9 A;  4L8E A;  1QFN A;  4GSN A;  2ZUP A;  4XHM A;  2H72 A;  5IPH A;  2DJK A;  1MDI A;  1AQV A;  12GS A;  2I81 A;  3KXO A;  1Z6M A;  5G2Z A;  5HR0 A;  2F51 A;  4TR1 B;  5LD0 A;  2PMT A;  1TXU A;  2PVO C;  1SEN A;  1TKD B;  5DJL A;  4FH8 A;  4EL1 A;  4PUA A;  2HZE A;  4PUR A;  2KHP A;  2I4A A;  2ON7 A;  2MMZ A;  5ECN B;  2N5F A;  1E2Y A;  1OYJ A;  2KP2 A;  5HFG A;  3HJO A;  5GAN D;  4YKF A;  3E3E A;  4NV5 A;  2JZR A;  1WIK A;  4POM A;  3I43 A;  8GSS A;  5JCG A;  1O8W A;  1FOH A;  5LNK e;  2IMF A;  3APO A;  4MZW A;  2LV3 A;  3HJP A;  3M1G A;  16GS A;  5A4U A;  1S3A A;  1OKT A;  4MZB A;  5ECO B;  4AJ8 A;  4MA9 A;  2L6D A;  5A5H A;  3F6D A;  3ZL5 A;  2X8H A;  3FHK A;  4KDY A;  1O81 A;  9GSS A;  1Q98 A;  1XFL A;  2ZNM A;  4G0K A;  4RUV A;  3TJB A;  2RM5 A;  3IV4 A;  3TJK A;  3HY2 A;  5E4W A;  3LXZ A;  2HRK A;  4TW5 A;  5ENU A;  3H93 A;  1U87 A;  1G6Y A;  2EIO A;  2JAC A;  3R2Q A;  4F0C A;  1FW1 A;  5C04 A;  4V1A p;  2VCX A;  1KNG A;  1X5D A;  3F6F A;  4I8B A;  3A5I A;  5ID2 B;  1FB0 A;  1M7T A;  3C1R A;  3QFA C;  1Z9H A;  2GQK A;  1A24 A;  4KSO A;  3P7X A;  1B9X C;  4I6X A;  5CRW A;  3CSJ A;  2MBS A;  4KB3 A;  7GSS A;  5A5K A;  1XOA A;  4K7I A;  3UOM A;  1G7E A;  2L59 A;  5IMF A;  5DAL A;  2VCQ A;  10GS A;  4ECB A;  3D4T A;  4FIW A;  4TKY A;  2C0D A;  5HR2 A;  1GTB A;  4ID0 A;  1ZYP A;  5G1L A;  1GTI A;  1B48 A;  5EVO A;  4F03 A;  2YP6 A;  2H19 A;  2V32 A;  4L5L A;  1ERV A;  2XPD A;  5HR1 A;  4CW9 A;  4PI2 C;  2FD3 A;  3EMP A;  2OJL A;  1R5A A;  3HD5 A;  3KJY A;  2DMM A;  4GSS A;  1SVO A;  4YKG A;  4ZL9 A;  18GS A;  3UVT A;  4WBR D;  5D9W A;  5A34 B;  4HOJ A;  6GSS A;  1XVW A;  2YN1 A;  1XOB A;  3FR9 A;  1ABA A;  2CX4 A;  1O73 A;  4I2U A;  5G5F A;  4PGT A;  3ME8 A;  1SU9 A;  2PER A;  2NVL A;  4WEY A;  4XCS A;  2J23 A;  5KOW A;  1LU4 A;  1XCC A;  3ZMK A;  2O36 A;  2OE1 A;  1MEK A;  4NWY A;  3DYR A;  1QK8 A;  1JLV A;  1WRY A;  5B6N A;  4ML6 A;  1NSW A;  3GTU A;  3E0U A;  19GS A;  1T7P B;  2VIM A;  4LMW A;  4TR1 A;  2I3Y A;  4O5R A;  1MDK A;  1K0B A;  4G9H A;  3IRA A;  3GA4 A;  1XXU A;  4OFN A;  2HRF A;  1XPV A;  1ERW A;  4BVY B;  2VL3 A;  3FYG A;  1EZK A;  3IE3 A;  2HLS A;  3NZN A;  2ON5 A;  4GRF A;  4ML1 A;  2R0G A;  2X64 A;  5B6M A;  3QCP A;  3LXT A;  3TKS C;  5FWG A;  2R4V A;  2YWM A;  1X9S B;  2CQ9 A;  2JSY A;  3ZFL A;  1XIY A;  3ED3 A;  1LBK A;  2FNO A;  3G7Y A;  2WVY A;  2R5G A;  1ZCP A;  1PGT A;  1XWK A;  2LJR A;  5ECS A;  2CAI A;  4KX4 A;  3QAG A;  2YJ7 A;  4KUN A;  1PN9 A;  3VI5 A;  2I1U A;  1PL1 A;  1XWC A;  3CWG A;  2HE3 A;  3TCO A;  1SK1 A;  5ECM B;  1GTU A;  1F37 A;  1X9W B;  3TGZ A;  2A2R A;  1F3B A;  4NHZ A;  1FOV A;  3GH9 A;  4ECI A;  3Q19 A;  2DBC A;  3RBT A;  3UL3 A;  1G6W A;  5J5N A;  4DVC A;  2WVZ A;  3ERG A;  2VM2 A;  3US3 A;  5J47 A;  1GWC A;  2DJ1 A;  2FWH A;  3TRX A;  5KN1 A;  3RPN A;  2VUP A;  3H79 A;  1YEX A;  2NPB A;  4KH7 A;  4ZB7 A;  1G7O A;  2P31 A;  3IBH A;  2FUG 2;  2YZU A;  3IK7 A;  4XIH A;  5G30 A;  4MJB A;  2YAN A;  5ID2 A;  2C8U A;  1V58 A;  2IMK A;  1YQ1 A;  2MZC A;  2C3N A;  2WW3 A;  3KM6 A;  4V2M A;  3ZRE A;  4V2L A;  2D2Z A;  4AKI A;  2DJ0 A;  4IP1 A;  1KBN A;  1R7H A;  5JCW A;  2FLS A;  3D0Z A;  2F9S A;  5HFK A;  3RGB C;  1EGO A;  1EV4 A;  2VLU A;  3TRQ A;  3GKX A;  2H1L A;  4JBB A;  1EOG A;  3DVX A;  4PQ1 A;  3GN3 A;  5ECR B;  3IOS A;  3Q74 A;  4XRA A;  1TI3 A;  1F6M C;  1T00 A;  4GWR A;  2KOK A;  1YY7 A;  3KTL A;  1XWA A;  5IMA A;  2IFQ B;  1B4P A;  4BWQ A;  3GRX A;  3GX0 A;  1EV9 A;  3HVS A;  2PN8 A;  2VCZ A;  5ECK B;  4CY6 A;  2DC5 A;  3FZA A;  4ZL8 A;  1ZL9 A;  2LQQ A;  1IYI A;  3AY8 A;  1U3I A;  2RLI A;  4NV2 A;  2H1A A;  1HD2 A;  1SKS B;  3QMX A;  2LNT A;  2GZY A;  2J9H A;  4QQ7 A;  4X0X A;  4BVX B;  1VRS D;  1N2A A;  1V98 A;  4TR3 A;  1K0N A;  3W6G A;  1TRS A;  4JU5 A;  4IQ1 A;  2E2G A;  1PA3 A;  3Q6O A;  3KGK A;  2FWE A;  3ZVJ A;  1BJX A;  2C3T A;  4N11 A;  4NAX A;  4MZC A;  5ABR A;  4ISD A;  4Q5F A;  3BCI A;  2HXK A;  4N30 A;  4GXZ A;  4LL4 B;  3DIE A;  1URM A;  2FWF A;  1TRU A;  3EPT A;  3S9F A;  4K2D A;  1Y1U A;  1A2J A;  4FXY P;  3QPM A;  2MMO A;  4K0N A;  4AI6 A;  3FZ4 A;  4HDE A;  2AUV A;  2KUC A;  4PNG A;  4HI7 A;  4POL A;  5INY A;  2N5B A;  2VCW A;  2DJ3 A;  4LA1 A;  4MJE A;  2XHF A;  3IK9 A;  3UBL A;  4MCU A;  5CRD A;  3UAR A;  2AJQ B;  4BVY A;  1T8E B;  1YEW C;  4PQI A;  2DJ2 A;  5KEJ A;  4O5U A;  2WJU A;  2O89 A;  1XW9 A;  3LYP A;  2K8V A;  4MNN A;  2XPE A;  4OWY A;  3A2V A;  5J9C A;  4JZQ A;  1WWJ A;  1ZYN A;  1GH2 A;  3DWV A;  1BYE A;  1SK2 A;  2YCD A;  4Q5Q A;  2H1D A;  5ECP B;  2B7K A;  2DJJ A;  4K5S A;  3QOU A;  5DQS A;  2OA7 A;  1XBS A;  5G31 A;  4MAB A;  4O5Q A;  3KMO A;  2A2S A;  2X99 A;  4IN0 A;  3VUR A;  4YH2 A;  3BBY A;  5CNW A;  3UJ1 A;  2FGX A;  2MMA A;  2B5E A;  4RQX A;  1QGV A;  3GUR A;  2RUF A;  2K8S A;  2GGT A;  2Z9S A;  4IJI A;  3UBK A;  2GLR A;  1A2M A;  3GV1 A;  1MD3 A;  3P90 A;  3P2A A;  2B6M A;  1EGR A;  4POK A;  1YJ6 A;  4MH3 A;  4I5Q A;  4Z2U A;  1IYH A;  4MJC A;  5D96 A;  3L9U A;  1OAZ A;  5D93 A;  1GUH A;  2BJX A;  5CO3 A;  2FA4 A;  4X1U A;  2DKH A;  1GTA A;  4KGI A;  1SYX A;  4W66 A;  4KE3 A;  5J3R A;  1TJD A;  1G0T A;  2NTO A;  3LJR A;  1M2A A;  4F2I A;  1A0R P;  1CQH A;  4IQA A;  2CAQ A;  2GT6 A;  3F4R A;  5IO0 A;  3ME7 A;  4H86 A;  4K1F A;  4NXI A;  4HJ2 A;  5G1K A;  2PBJ A;  2H0G A;  3EYT A;  3HA9 A;  4KCE A;  1SYR A;  3DGQ A;  1XZO A;  1O6J A;  1BAY A;  1ZGN A;  3MWH A;  5A4V A;  4X43 A;  1UVZ A;  4MPF A;  2YOI A;  2IWT A;  1TP9 A;  5EPF A;  2VLV A;  3HMJ G;  1TK5 B;  1PMT A;  2XBI A;  2WVX B;  2IFQ A;  4WR5 A;  2PWJ A;  2HYX A;  3D4M A;  4IEL A;  1HQO A;  2R0P A;  1M3I A;  2TIR A;  4MJA A;  1R26 A;  2L6C A;  3TJJ A;  3VFI A;  6GSW A;  5D9T A;  3TKR A;  3ZIV A;  2VKZ G;  3H1N A;  3LEF A;  3L4N A;  1F2E A;  4BVX A;  1AW9 A;  3J7Y b;  2B7J A;  1MD4 A;  4IW9 A;  4ILF A;  3KMN A;  4I2T A;  3IXR A;  4K8M A;  1DE1 A;  3HCZ A;  2LTK A;  1PL2 A;  3IHQ A;  3CTG A;  2LNS A;  1Y25 A;  4K5R A;  2HSM B;  5ELA A;  1QMV A;  4D73 B;  5J4V A;  5J40 A;  3CBU A;  4EUY A;  1GNE A;  4EXJ A;  3CYN A;  2YV9 A;  2IMI A;  2KLX A;  1R5P A;  2C1Y A;  3F3R A;  1PX7 A;  3U6V A;  4OD7 A;  1YKA A;  2LEG A;  1V2A A;  2XBQ A;  3KEB A;  1X9M B;  4Q5N A;  1TI1 A;  4TXO B;  2GS3 A;  1A23 A;  4GTU A;  2GST A;  3DML A;  4DSQ A;  6GSV A;  4OFM A;  1TOF A;  1H4O A;  4EF0 A;  3PPU A;  2YWN A;  1M0U A;  4MF5 A;  3VWU A;  4HUA A;  2MYG A;  3EC3 A;  3H8Q A;  4QL9 A;  3VPQ A;  1FVK A;  5J4U A;  2GDR A;  1QXH A;  2V2G A;  1DUG A;  4EVM A;  3KIJ A;  1U3A A;  6GSY A;  3WGE A;  2BTO T;  5ECL B;  2GT5 A;  3F63 A;  17GS A;  3KP9 A;  4TRX A;  1GSY A;  2YJH A;  4FYC A;  4FYU A;  4KDX A;  4K7O A;  2EFE A;  4QL7 A;  1EEM A;  1OKD A;  3FK8 A;  1FHE A;  3IDV A;  1SVL A;  3GHA A;  3EVI A;  4O32 A;  1OE7 A;  1UC7 A;  3F9U A;  1TK8 B;  4PI0 C;  4ICY A;  4J56 E;  2C0F A;  4PUF C;  4K9Z A;  4AJ6 A;  2GZZ A;  1W89 A;  2EIQ A;  1SVM A;  2H1B A;  1TDI A;  2WRT A;  3ZFB A;  1V57 A;  1GSE A;  2JAD A;  5DDL A;  1BX9 A;  1XG8 A;  1PQN A;  2GZP A;  2VAF A;  1NM3 A;  4AJ7 A;  4N10 A;  1THX A;  3M9K A;  5ECQ B;  4AGS A;  1TU8 A;  3IHG A;  4ECC A;  1SL0 B;  2X4A A;  1DSB A;  1SJZ A;  4XRD A;  5IMC A;  5LCZ A;  3RPP A;  3FKF A;  2R2J A;  2YWO A;  4MMM A;  3PR8 A;  2MBT A;  2V6K A;  3RHB A;  1FAA A;  5CRH A;  1TRV A;  4LL1 B;  5EL8 A;  3TRP A;  2VCV A;  3APQ A;  6GSX A;  4IS0 A;  4RI7 A;  1THO A;  3L78 A;  4KF9 A;  3CHX C;  3VWV A;  3V1W A;  2G2Q A;  5A1N B;  5BMU B;  1JZO A;  2C80 A;  2LJK A;  5GAP D;  3MYD A;  1PN0 A;  3DVW A;  6GSU A;  2WVX A;  1WPI A;  1JZW A;  2EC4 A;  2PPT A;  2VOC A;  1M3J A;  4ZBB A;  1A0F A;  4G19 A;  3TOU A;  1F3A A;  3QR6 A;  1RK4 A;  5KOX A;  4BPY A;  5IQY A;  4O92 A;  2A4V A;  2B1K A;  13GS A;  1GNW A;  3GFK A;  2BMX A;  2WB9 A;  1S3R A;  4BWS A;  2HRA A;  4ZB8 A;  1XW6 A;  3CRT A;  5CP1 A;  1ZYQ B;  2OE3 A;  5ECH B;  2MMN A;  1WOU A;  2LUS A;  2HSM A;  1M9A A;  2CT6 A;  3CRU A;  4D73 A;  1AQX A;  3QFB C;  5HFI A;  2B5Y A;  5IPG A;  3M8N A;  5AIS A;  4K0G A;  3TKS A;  4EO3 A;  3ZVJ D;  3A3T A;  1V9W A;  3ZLP A;  5DBQ A;  4AKG A;  1BG1 A;  5DCH A;  3G7J A;  3TB2 A;  2QA1 A;  1O85 A;  5F05 A;  2VL2 C;  2VD0 A;  4ZIJ A;  1VGL A;  3NIV A;  4NHW A;  2LST A;  3MNG A;  3WGX A;  1GP1 A;  4TXO A;  3Q18 A;  3MIX A;  3EWL A;  1E6B A;  4G0L A;  4WBJ A;  3GUS A;  4Z2R A;  4MK3 A;  1SJ6 A;  1AUC A;  3ZIT A;  3FZ5 A;  1OC9 B;  1U88 A;  4PQH A;  3BD2 A;  5ELG A;  1GL8 A;  4EE0 A;  4O7H A;  2YPM A;  5DQY A;  1GSS A;  3LOR A;  4JED A;  1SD8 A;  5KN2 A;  2GSS A;  2V1M A;  5IIZ A;  6GST A;  2RII A;  2ZCT A;  3GKM A;  2F8F A;  1M2D A;  3QDN A;  1K0A A;  2B3S A;  2VL2 A;  1SJI A;  4OO4 A;  1HNB A;  4OMV A;  2L4Q A;  3VWX A;  2PGT A;  2WS2 A;  1B9Y C;  5C00 A;  3EU4 A;  3TDG A;  3IR4 A;  5A34 A;  2WUL A;  4XS1 A;  1O8X A;  4Z7X A;  1SKW B;  4AKH A;  5DAK B;  1K0D A;  4ZL7 A;  4PTS A;  1A8Y A;  1GLP A;  3CQF A;  1C72 A;  2AV4 A;  4ZBA A;  1F9M A;  4NMU A;  4TOP A;  1TW9 A;  4F9Z A;  4YAP A;  3L9V A;  1RQM A;  2H0I A;  3CXG A;  1QQ2 A;  3HKR A;  1GRX A;  4CY8 A;  3NOF A;  5AIV A;  4GCI A;  1Z3E A;  3ZML A;  1ON4 A;  1SKR B;  1JFU A;  2H6Z A;  3QD9 A;  4Z2T A;  4BA7 A;  4IVF A;  2GTU A;  2H70 A;  3SWL A;  2QC7 A;  5F07 A;  4BIK A;  1ZOF A;  3EU3 A;  2F3M A;  1EEJ A;  20GS A;  3D6I A;  2EFC A;  1B8X A;  4AF2 A;  5IMZ A;  4ULX A;  3GIX A;  2FCH A;  4LMV A;  4Q5R A;  1ZMA A;  4N0Z A;  2LS5 A;  2FHE A;  5BMU A;  1ZYE A;  1VF4 A;  5HR3 A;  2HQT A;  3VK9 A;  4L0W A;  2HZF A;  4GLT A;  2REM A;  4K7N A;  2R0C A;  3GKK A;  1ERU A;  2OBK A;  1M9B A;  3QAV A;  3HXS A;  3LYK A;  2CZ3 A;  2WGR A;  2O7K A;  1O7U A;  3C71 A;  2WW2 A;  2H66 A;  4KSM A;  2HT9 A;  1EOH A;  1WJK A;  1JZD A;  4JR6 A;  3TKS E;  3RAZ A;  2A4H A;  2WW1 A;  3A5W A;  3DEX A;  3HVN A;  4MF7 A;  3A2X A;  2C3Q A;  2CVB A;  2H6Y A;  2QGV A;  2ALB A;  3BCK A;  1ZZY A;  4MPG A;  1WP0 A;  2NDO A;  1VF2 A;  4TXV A;  2QA2 A;  1TK0 B;  4IKH A;  1BF5 A;  1XWB A;  4DEJ A;  1PSQ A;  2UZ8 A;  2K6V A;  3ERW A;  1TTZ A;  3TJF A;  4GQC A;  3TKP A;  2YV7 A;  2PU9 C;  4EDZ A;  1A8L A;  1YVL A;  1VF1 A;  1GUM A;  1BED A;  5AIX A;  4LLR A;  3MSZ A;  3GST A;  4YQM A;  2E2M A;  3A2W A;  3VWW A;  1M99 A;  2C4J A;  2R37 A;  3HHV A;  2JU5 A;  4ZB6 A;  5L71 A;  3W8J A;  1USB A;  4G2E A;  1GSF A;  4POB A;  5CAX A;  3WYW A;  2X8G A;  5COH A;  1NW2 A;  5CRE A;  2P0G A;  2GSQ A;  1I5G A;  3KH9 A;  2OKA A;  2P5Q A;  2VO4 A;  3IPZ A;  4RI6 A;  1S3C A;  1TXX A;  1R4W A;  1ILO A;  2L5O A;  4NPB A;  2CA8 A;  3GTU B;  3FRC A;  2H73 A;  2F8A A;  3FY7 A;  1H75 A;  14GS A;  5JWQ B;  3HVV A;  3GH6 A;  4WF4 A;  3LSZ A;  1J08 A;  4BL7 B;  3L9S A;  1ML6 A;  1MDJ A;  1J0F A;  1GUL A;  1AC1 A;  2HSN B;  4E68 A;  1A2L A;  4TVE A;  3UIW A;  2WCI A;  3IA1 A;  1SL2 B;  1BG5 A;  3TUE A;  5D9V A;  3HDC A;  2DML A;  3H4K A;  5H5Q A;  1AXD A;  2LQO A;  4TR0 A;  2OAC A;  4ZIL A;  5JWR B;  4HS1 A;  1K3L A;  4HQS A;  5DAK A;  1WE0 A;  3ZZX A;  1GSU A;  1ACV A;  2IN3 A;  5CRG A;  3IAM 2;  4N0V A;  3EIN A;  3MAK A;  3FW2 A;  2DSA A;  1MTC A;  2M80 A;  2OBI A;  5GZZ B;  1EP7 A;  2IME A;  2WZS A;  3IC8 A;  2CVD A;  1EP8 A;  2H6X A;  4YQU A;  1OC8 A;  2X8C A;  2VL9 A;  2HSH A;  1HYU A;  5FHI A;  2H01 A;  4MH2 A;  4X4J A;  2JZT A;  5F06 A;  2C0G A;  2EIR A;  2LJA A;  2NBS A;  3RDW A;  1JZR A;  3F0I A;  4N3Z A;  4KW6 A;  1PD2 1;  3M0F A;  3I69 A;  4OCF A;  2PVQ A;  2IMD A;  3O3T A;  1N25 A;  2HFD A;  1PKZ A;  5B8B A;  3GNJ A;  4MLY A;  1QUW A;  3HYP A;  4EC0 A;  1NHY A;  1SL1 B;  5BRT A;  4EIP A;  1PKW A;  3LQ7 A;  3EMX A;  5A4W A;  3ZTL A;  3D5J A;  1SK0 A;  3BJ5 A;  4IGJ A;  5H5R A;  2OE0 A;  2UV8 G;  3D21 A;  1T4Y A;  1KTE A;  4G0I A;  4V2N A;  3C7M A;  2O87 A;  4MP4 A;  3LWA A;  4XS6 A;  5IM9 A;  3GSS A;  3JCM L;  4EDY A;  1XVQ A;  3TKQ A;  3GL3 A;  3F3Q A;  4PX1 A;  4EIQ A;  2H1G A;  5CYY A;  4HSC X;  3LFL A;  5DCG A;  5IMD A;  4MF6 A;  3O6T A;  4PXO A;  5F0G A;  2XC2 A; 
#chains in the Genus database with same CATH homology
 3ZRD A;  2N5A A;  2YNX A;  5D73 A;  3HZ4 A;  1FG4 A;  3F8U A;  3K8N A;  1FVJ A;  5D9X A;  11GS A;  2M46 A;  2VCT A;  2CV4 A;  2CX3 A;  4OO5 A;  5AGY A;  1GUK A;  5IOX A;  1T3B A;  1K0M A;  3FR3 A;  1YDK A;  4E8H A;  3WGD A;  4HU7 A;  3BOA A;  4P3Y B;  1K0O A;  4ZXG A;  1OVN A;  2YZH A;  1K3Y A;  5DJM A;  2L5L A;  3DD3 A;  4XS4 B;  5JWO B;  4HQZ A;  1V40 A;  3IC4 A;  4FQU A;  5J9B A;  3CSI A;  1FO5 A;  4GF0 A;  5EY6 A;  2CZ2 A;  5E59 A;  22GS A;  3C1S A;  3ZYW A;  3TOT A;  4KAE A;  3KTB A;  4G10 A;  3VI7 A;  3F4S A;  3UEM A;  5JCU A;  1T4Z A;  2KP1 A;  2DIY A;  3LGC A;  3FR6 A;  1AQW A;  2GQM A;  1W4V A;  1XW5 A;  2GSR A;  4BL7 A;  2JZS A;  3TU3 B;  1PRX A;  4JE1 A;  4DSS B;  4HZ4 A;  2O85 A;  2HSN A;  2EFH A;  5D8I A;  1JHB A;  1LJR A;  5J41 A;  3C73 A;  3WD6 A;  2A2P A;  4MDC A;  3HVX A;  3WT2 A;  1UN2 A;  4JR4 A;  5DVB A;  1S3D A;  2JSZ A;  2EFD A;  1AIU A;  4EKZ A;  3D22 A;  1GSQ A;  3GYK A;  1YEP A;  4GST A;  1HNC A;  3ERF A;  3WT1 A;  3MDK A;  3M3M A;  2L4C A;  1SD9 A;  2M72 A;  1N8J A;  2R6K A;  4KCA A;  2L57 A;  3FMW A;  2QSI A;  2RM6 A;  4GQF A;  1B4Q A;  1ST9 A;  1Z7R A;  3KP8 A;  4HJM A;  5KN0 A;  1WMJ A;  2HRN A;  2CVK A;  1T1V A;  1Z5Y E;  1OE8 A;  2LRT A;  2R3X A;  1RW1 A;  4USS A;  1XWG A;  4HEA 2;  3HJM A;  3I6A A;  2AYT A;  2E0Q A;  2FWG A;  3OR5 A;  3SBC A;  3GX8 A;  1JLW A;  3CMI A;  2WDU A;  2H30 A;  4G01 A;  1YZX A;  2AB6 A;  3I9V 2;  3KH7 A;  4OCE A;  1K3O A;  3G7I A;  3LG6 A;  4HZ2 A;  5FT3 A;  2FY6 A;  3FEU A;  3N9J A;  3DKS A;  2LRN A;  3KD0 A;  1Q4J A;  4TN8 A;  2GVP A;  3ISO A;  5HQP A;  1AAZ A;  3IAS 2;  4IBP A;  1TRW A;  2YWI A;  5IMV A;  4IP6 A;  3GKN A;  2LKU A;  2HZE B;  3PGT A;  3O76 A;  5AN1 A;  3U5R E;  2E7P A;  3E9J B;  2H71 A;  4IJ3 A;  4J2F A;  4WKW A;  4XTS A;  4WXT A;  3P8W A;  3PH9 A;  5ECI B;  2HI7 A;  1EWX A;  3W8S A;  4J57 E;  4L0U A;  3TJG A;  2FA8 A;  2QKE A;  3VPT A;  3J7Y k;  2H8L A;  3ZIJ A;  1X0R A;  4I97 A;  2G0F A;  2HSY A;  2IJY A;  1CQG A;  1OC3 A;  4OFT A;  2X49 A;  3KCM A;  3R3E A;  2RUE A;  3HZ8 A;  2AAW A;  1I9D A;  1VF3 A;  3VLN A;  3G9B A;  1YF0 A;  4K6X A;  1PX6 A;  4AKX B;  1U6T A;  4JRR A;  4CHS A;  1YF1 A;  1UA5 A;  1J9B A;  1KEB A;  5A5H B;  3F4T A;  4F82 A;  4XS4 A;  3L0H A;  5B7C A;  4FYB A;  5GSS A;  2H75 A;  3DXB A;  4WET A;  2C0E A;  2OAD A;  4DSR A;  3CSH A;  4TR4 A;  2K9F A;  1HNA A;  1K0C A;  4L5O A;  2HNL A;  4KA0 A;  2DIZ A;  1Z6N A;  3LW9 A;  3DRN A;  2VD1 A;  1BQ7 A;  4ACS A;  2H76 A;  2HRK B;  2JL4 A;  5B8A A;  2IIY A;  1ERT A;  5G5E A;  5GST A;  2WZ9 A;  2DLX A;  3FZ9 A;  3PIN A;  1GLQ A;  5A1N A;  2B5X A;  3N5O A;  3UAP A;  1FB6 A;  3C8E A;  4DSS A;  4ZBD A;  2VLT A;  4HU9 A;  4A5P A;  1YKC A;  1GSD A;  4WR4 A;  3M9J A;  4V1A g;  1Z7P A;  2GQL A;  3KZQ A;  4RQR A;  4KDU A;  2I9H A;  5DAL B;  3UVH A;  4E8E A;  4FO5 A;  1DE2 A;  3APS A;  4K2X A;  5IOW A;  5F8B A;  1Y6E A;  2H74 A;  2K18 A;  2DKI A;  4YQV A;  4ZB9 A;  1M2B A;  4QMK A;  3QAW A;  1X5E A;  3GMF A;  2O5V A;  2P5R A;  2V41 A;  2VM1 A;  3EE2 A;  2WFC A;  2V6O A;  5H5S A;  2TRX A;  4ECJ A;  5J4Y A;  1TU7 A;  3CTF A;  1NHO A;  2TRC P;  4GDF A;  3RHC A;  4F0B A;  4YAV A;  4KND A;  2IL3 A;  2LRC A;  2H0H A;  2OT3 A;  2PUK C;  4WF5 A;  5IO2 A;  5KN3 A;  2ES7 A;  3UMA A;  4CDO A;  2O8V B;  1X5C A;  2AHE A;  4IHU A;  3EUR A;  2B1L A;  2IPA A;  4PNF A;  1DBY A;  3GL5 A;  1OC9 A;  4L8E A;  1QFN A;  4GSN A;  2ZUP A;  4XHM A;  2H72 A;  5IPH A;  2DJK A;  1MDI A;  1AQV A;  12GS A;  2I81 A;  3KXO A;  1Z6M A;  5G2Z A;  5HR0 A;  2F51 A;  4TR1 B;  5LD0 A;  2PMT A;  1TXU A;  2PVO C;  1SEN A;  1TKD B;  5DJL A;  4FH8 A;  4EL1 A;  4PUA A;  2HZE A;  4PUR A;  2KHP A;  2I4A A;  2ON7 A;  2MMZ A;  5ECN B;  2N5F A;  1E2Y A;  1OYJ A;  2KP2 A;  5HFG A;  3HJO A;  5GAN D;  4YKF A;  3E3E A;  4NV5 A;  2JZR A;  1WIK A;  4POM A;  3I43 A;  8GSS A;  5JCG A;  1O8W A;  1FOH A;  5LNK e;  2IMF A;  3APO A;  4MZW A;  2LV3 A;  3HJP A;  3M1G A;  16GS A;  5A4U A;  1S3A A;  1OKT A;  4MZB A;  5ECO B;  4AJ8 A;  4MA9 A;  2L6D A;  5A5H A;  3F6D A;  3ZL5 A;  2X8H A;  3FHK A;  4KDY A;  1O81 A;  9GSS A;  1Q98 A;  1XFL A;  2ZNM A;  4G0K A;  4RUV A;  3TJB A;  2RM5 A;  3IV4 A;  3TJK A;  3HY2 A;  5E4W A;  3LXZ A;  2HRK A;  4TW5 A;  5ENU A;  3H93 A;  1U87 A;  1G6Y A;  2EIO A;  2JAC A;  3R2Q A;  4F0C A;  1FW1 A;  5C04 A;  4V1A p;  2VCX A;  1KNG A;  1X5D A;  3F6F A;  4I8B A;  3A5I A;  5ID2 B;  1FB0 A;  1M7T A;  3C1R A;  3QFA C;  1Z9H A;  2GQK A;  1A24 A;  4KSO A;  3P7X A;  1B9X C;  4I6X A;  5CRW A;  3CSJ A;  2MBS A;  4KB3 A;  7GSS A;  5A5K A;  1XOA A;  4K7I A;  3UOM A;  1G7E A;  2L59 A;  5IMF A;  5DAL A;  2VCQ A;  10GS A;  4ECB A;  3D4T A;  4FIW A;  4TKY A;  2C0D A;  5HR2 A;  1GTB A;  4ID0 A;  1ZYP A;  5G1L A;  1GTI A;  1B48 A;  5EVO A;  4F03 A;  2YP6 A;  2H19 A;  2V32 A;  4L5L A;  1ERV A;  2XPD A;  5HR1 A;  4CW9 A;  2FD3 A;  3EMP A;  2OJL A;  1R5A A;  3HD5 A;  3KJY A;  2DMM A;  4GSS A;  1SVO A;  4YKG A;  4ZL9 A;  18GS A;  3UVT A;  4WBR D;  5D9W A;  5A34 B;  4HOJ A;  6GSS A;  1XVW A;  2YN1 A;  1XOB A;  3FR9 A;  1ABA A;  2CX4 A;  1O73 A;  4I2U A;  5G5F A;  4PGT A;  3ME8 A;  1SU9 A;  2PER A;  2NVL A;  4WEY A;  4XCS A;  2J23 A;  5KOW A;  1LU4 A;  1XCC A;  3ZMK A;  2OE1 A;  1MEK A;  4NWY A;  3DYR A;  1QK8 A;  1JLV A;  1WRY A;  5B6N A;  4ML6 A;  1NSW A;  3GTU A;  3E0U A;  19GS A;  1T7P B;  2VIM A;  4LMW A;  4TR1 A;  2I3Y A;  4O5R A;  1MDK A;  1K0B A;  4G9H A;  3IRA A;  3GA4 A;  1XXU A;  4OFN A;  2HRF A;  1XPV A;  1ERW A;  4BVY B;  2VL3 A;  3FYG A;  1EZK A;  3IE3 A;  2HLS A;  3NZN A;  2ON5 A;  4GRF A;  4ML1 A;  2R0G A;  2X64 A;  5B6M A;  3QCP A;  3LXT A;  3TKS C;  5FWG A;  2R4V A;  2YWM A;  1X9S B;  2CQ9 A;  2JSY A;  3ZFL A;  1XIY A;  3ED3 A;  1LBK A;  2FNO A;  3G7Y A;  2R5G A;  1ZCP A;  1PGT A;  1XWK A;  2LJR A;  5ECS A;  2CAI A;  4KX4 A;  3QAG A;  2YJ7 A;  4KUN A;  1PN9 A;  3VI5 A;  2I1U A;  1PL1 A;  1XWC A;  3CWG A;  2HE3 A;  3TCO A;  1SK1 A;  5ECM B;  1GTU A;  1F37 A;  1X9W B;  3TGZ A;  2A2R A;  1F3B A;  4NHZ A;  1FOV A;  3GH9 A;  4ECI A;  3Q19 A;  2DBC A;  3RBT A;  3UL3 A;  1G6W A;  5J5N A;  4DVC A;  3ERG A;  2VM2 A;  3US3 A;  5J47 A;  1GWC A;  2DJ1 A;  2FWH A;  3TRX A;  5KN1 A;  3RPN A;  2VUP A;  3H79 A;  1YEX A;  2NPB A;  4KH7 A;  4ZB7 A;  1G7O A;  2P31 A;  3IBH A;  2FUG 2;  2YZU A;  3IK7 A;  4XIH A;  5G30 A;  4MJB A;  2YAN A;  5ID2 A;  2C8U A;  1V58 A;  2IMK A;  1YQ1 A;  2MZC A;  2C3N A;  3KM6 A;  4V2M A;  3ZRE A;  4V2L A;  2D2Z A;  4AKI A;  2DJ0 A;  4IP1 A;  1KBN A;  1R7H A;  5JCW A;  2FLS A;  3D0Z A;  2F9S A;  5HFK A;  1EGO A;  1EV4 A;  2VLU A;  3TRQ A;  3GKX A;  2H1L A;  4JBB A;  1EOG A;  3DVX A;  4PQ1 A;  3GN3 A;  5ECR B;  3IOS A;  3Q74 A;  4XRA A;  1TI3 A;  1F6M C;  1T00 A;  4GWR A;  2KOK A;  1YY7 A;  3KTL A;  1XWA A;  5IMA A;  2IFQ B;  1B4P A;  4BWQ A;  3GRX A;  3GX0 A;  1EV9 A;  3HVS A;  2PN8 A;  2VCZ A;  5ECK B;  4CY6 A;  2DC5 A;  3FZA A;  4ZL8 A;  1ZL9 A;  2LQQ A;  1IYI A;  3AY8 A;  1U3I A;  2RLI A;  4NV2 A;  2H1A A;  1HD2 A;  1SKS B;  3QMX A;  2LNT A;  2GZY A;  2J9H A;  4QQ7 A;  4X0X A;  4BVX B;  1VRS D;  1N2A A;  1V98 A;  4TR3 A;  1K0N A;  3W6G A;  1TRS A;  4JU5 A;  4IQ1 A;  2E2G A;  1PA3 A;  3Q6O A;  3KGK A;  2FWE A;  3ZVJ A;  1BJX A;  2C3T A;  4N11 A;  4NAX A;  4MZC A;  5ABR A;  4ISD A;  4Q5F A;  3BCI A;  2HXK A;  4N30 A;  4GXZ A;  4LL4 B;  3DIE A;  1URM A;  2FWF A;  1TRU A;  3EPT A;  3S9F A;  4K2D A;  1Y1U A;  1A2J A;  3QPM A;  2MMO A;  4K0N A;  4AI6 A;  3FZ4 A;  4HDE A;  2AUV A;  2KUC A;  4PNG A;  4HI7 A;  4POL A;  5INY A;  2N5B A;  2VCW A;  2DJ3 A;  4LA1 A;  4MJE A;  2XHF A;  3IK9 A;  3UBL A;  4MCU A;  5CRD A;  3UAR A;  2AJQ B;  4BVY A;  1T8E B;  4PQI A;  2DJ2 A;  5KEJ A;  4O5U A;  2WJU A;  2O89 A;  1XW9 A;  3LYP A;  2K8V A;  4MNN A;  2XPE A;  4OWY A;  3A2V A;  5J9C A;  4JZQ A;  1WWJ A;  1ZYN A;  1GH2 A;  3DWV A;  1BYE A;  1SK2 A;  2YCD A;  4Q5Q A;  2H1D A;  5ECP B;  2B7K A;  2DJJ A;  4K5S A;  3QOU A;  5DQS A;  2OA7 A;  1XBS A;  5G31 A;  4MAB A;  4O5Q A;  3KMO A;  2A2S A;  2X99 A;  4IN0 A;  3VUR A;  4YH2 A;  3BBY A;  5CNW A;  3UJ1 A;  2FGX A;  2MMA A;  2B5E A;  4RQX A;  1QGV A;  3GUR A;  2RUF A;  2K8S A;  2GGT A;  2Z9S A;  4IJI A;  3UBK A;  2GLR A;  1A2M A;  3GV1 A;  1MD3 A;  3P90 A;  3P2A A;  2B6M A;  1EGR A;  4POK A;  1YJ6 A;  4MH3 A;  4I5Q A;  4Z2U A;  1IYH A;  4MJC A;  5D96 A;  3L9U A;  1OAZ A;  5D93 A;  1GUH A;  2BJX A;  5CO3 A;  2FA4 A;  4X1U A;  2DKH A;  1GTA A;  4KGI A;  1SYX A;  4W66 A;  4KE3 A;  5J3R A;  1TJD A;  1G0T A;  2NTO A;  3LJR A;  1M2A A;  4F2I A;  1A0R P;  1CQH A;  4IQA A;  2CAQ A;  2GT6 A;  3F4R A;  5IO0 A;  3ME7 A;  4H86 A;  4K1F A;  4NXI A;  4HJ2 A;  5G1K A;  2PBJ A;  2H0G A;  3EYT A;  3HA9 A;  4KCE A;  1SYR A;  3DGQ A;  1XZO A;  1O6J A;  1BAY A;  1ZGN A;  3MWH A;  5A4V A;  4X43 A;  1UVZ A;  4MPF A;  2YOI A;  2IWT A;  1TP9 A;  5EPF A;  2VLV A;  3HMJ G;  1TK5 B;  1PMT A;  2XBI A;  2IFQ A;  4WR5 A;  2PWJ A;  2HYX A;  3D4M A;  4IEL A;  1HQO A;  2R0P A;  2TIR A;  4MJA A;  1R26 A;  2L6C A;  3TJJ A;  3VFI A;  6GSW A;  5D9T A;  3TKR A;  3ZIV A;  2VKZ G;  3H1N A;  3LEF A;  3L4N A;  1F2E A;  4BVX A;  1AW9 A;  3J7Y b;  2B7J A;  1MD4 A;  4IW9 A;  4ILF A;  3KMN A;  4I2T A;  3IXR A;  4K8M A;  1DE1 A;  3HCZ A;  2LTK A;  1PL2 A;  3IHQ A;  3CTG A;  2LNS A;  1Y25 A;  4K5R A;  2HSM B;  5ELA A;  1QMV A;  4D73 B;  5J4V A;  5J40 A;  3CBU A;  4EUY A;  1GNE A;  4EXJ A;  3CYN A;  2YV9 A;  2IMI A;  2KLX A;  1R5P A;  2C1Y A;  3F3R A;  1PX7 A;  3U6V A;  4OD7 A;  1YKA A;  2LEG A;  1V2A A;  2XBQ A;  3KEB A;  1X9M B;  4Q5N A;  1TI1 A;  4TXO B;  2GS3 A;  1A23 A;  4GTU A;  2GST A;  3DML A;  4DSQ A;  6GSV A;  4OFM A;  1TOF A;  1H4O A;  4EF0 A;  3PPU A;  2YWN A;  1M0U A;  4MF5 A;  3VWU A;  4HUA A;  2MYG A;  3EC3 A;  3H8Q A;  4QL9 A;  3VPQ A;  1FVK A;  5J4U A;  2GDR A;  1QXH A;  2V2G A;  1DUG A;  4EVM A;  3KIJ A;  1U3A A;  6GSY A;  3WGE A;  2BTO T;  5ECL B;  2GT5 A;  3F63 A;  17GS A;  3KP9 A;  4TRX A;  1GSY A;  2YJH A;  4FYC A;  4FYU A;  4KDX A;  4K7O A;  2EFE A;  4QL7 A;  1EEM A;  1OKD A;  3FK8 A;  1FHE A;  3IDV A;  1SVL A;  3GHA A;  3EVI A;  4O32 A;  1OE7 A;  1UC7 A;  3F9U A;  1TK8 B;  4ICY A;  4J56 E;  2C0F A;  4PUF C;  4K9Z A;  4AJ6 A;  2GZZ A;  1W89 A;  2EIQ A;  1SVM A;  2H1B A;  1TDI A;  2WRT A;  3ZFB A;  1V57 A;  1GSE A;  2JAD A;  5DDL A;  1BX9 A;  1PQN A;  2GZP A;  2VAF A;  1NM3 A;  4AJ7 A;  4N10 A;  1THX A;  3M9K A;  5ECQ B;  4AGS A;  1TU8 A;  3IHG A;  4ECC A;  1SL0 B;  2X4A A;  1DSB A;  1SJZ A;  4XRD A;  5IMC A;  5LCZ A;  3RPP A;  3FKF A;  2R2J A;  2YWO A;  4MMM A;  3PR8 A;  2MBT A;  2V6K A;  3RHB A;  1FAA A;  5CRH A;  1TRV A;  4LL1 B;  5EL8 A;  3TRP A;  2VCV A;  3APQ A;  6GSX A;  4IS0 A;  4RI7 A;  1THO A;  3L78 A;  4KF9 A;  3VWV A;  3V1W A;  2G2Q A;  5A1N B;  5BMU B;  1JZO A;  2C80 A;  2LJK A;  5GAP D;  3MYD A;  1PN0 A;  3DVW A;  6GSU A;  1WPI A;  1JZW A;  2EC4 A;  2PPT A;  2VOC A;  4ZBB A;  1A0F A;  4G19 A;  3TOU A;  1F3A A;  3QR6 A;  1RK4 A;  5KOX A;  4BPY A;  5IQY A;  4O92 A;  2A4V A;  2B1K A;  13GS A;  1GNW A;  3GFK A;  2BMX A;  2WB9 A;  4BWS A;  2HRA A;  4ZB8 A;  1XW6 A;  3CRT A;  5CP1 A;  1ZYQ B;  2OE3 A;  5ECH B;  2MMN A;  1WOU A;  2LUS A;  2HSM A;  1M9A A;  2CT6 A;  3CRU A;  4D73 A;  1AQX A;  3QFB C;  5HFI A;  2B5Y A;  5IPG A;  3M8N A;  5AIS A;  4K0G A;  3TKS A;  4EO3 A;  3ZVJ D;  3A3T A;  1V9W A;  3ZLP A;  5DBQ A;  4AKG A;  1BG1 A;  5DCH A;  3G7J A;  3TB2 A;  2QA1 A;  1O85 A;  5F05 A;  2VL2 C;  2VD0 A;  4ZIJ A;  1VGL A;  3NIV A;  4NHW A;  2LST A;  3MNG A;  3WGX A;  1GP1 A;  4TXO A;  3Q18 A;  3MIX A;  3EWL A;  1E6B A;  4G0L A;  4WBJ A;  3GUS A;  4Z2R A;  4MK3 A;  1SJ6 A;  1AUC A;  3ZIT A;  3FZ5 A;  1OC9 B;  1U88 A;  4PQH A;  3BD2 A;  5ELG A;  1GL8 A;  4EE0 A;  4O7H A;  2YPM A;  5DQY A;  1GSS A;  3LOR A;  4JED A;  1SD8 A;  5KN2 A;  2GSS A;  2V1M A;  5IIZ A;  6GST A;  2RII A;  2ZCT A;  3GKM A;  2F8F A;  1M2D A;  3QDN A;  1K0A A;  2B3S A;  2VL2 A;  1SJI A;  4OO4 A;  1HNB A;  4OMV A;  2L4Q A;  3VWX A;  2PGT A;  2WS2 A;  1B9Y C;  5C00 A;  3EU4 A;  3TDG A;  3IR4 A;  5A34 A;  2WUL A;  4XS1 A;  1O8X A;  4Z7X A;  1SKW B;  4AKH A;  5DAK B;  1K0D A;  4ZL7 A;  4PTS A;  1A8Y A;  1GLP A;  1C72 A;  2AV4 A;  4ZBA A;  1F9M A;  4NMU A;  4TOP A;  1TW9 A;  4F9Z A;  4YAP A;  3L9V A;  1RQM A;  2H0I A;  3CXG A;  1QQ2 A;  3HKR A;  1GRX A;  4CY8 A;  3NOF A;  5AIV A;  4GCI A;  1Z3E A;  3ZML A;  1ON4 A;  1SKR B;  1JFU A;  2H6Z A;  3QD9 A;  4Z2T A;  4BA7 A;  4IVF A;  2GTU A;  2H70 A;  3SWL A;  2QC7 A;  5F07 A;  1ZOF A;  3EU3 A;  2F3M A;  1EEJ A;  20GS A;  3D6I A;  2EFC A;  1B8X A;  4AF2 A;  5IMZ A;  4ULX A;  3GIX A;  2FCH A;  4LMV A;  4Q5R A;  1ZMA A;  4N0Z A;  2LS5 A;  2FHE A;  5BMU A;  1ZYE A;  1VF4 A;  5HR3 A;  2HQT A;  3VK9 A;  4L0W A;  2HZF A;  4GLT A;  2REM A;  4K7N A;  2R0C A;  3GKK A;  1ERU A;  2OBK A;  1M9B A;  3QAV A;  3HXS A;  3LYK A;  2CZ3 A;  2WGR A;  2O7K A;  1O7U A;  3C71 A;  2H66 A;  4KSM A;  2HT9 A;  1EOH A;  1WJK A;  1JZD A;  4JR6 A;  3TKS E;  3RAZ A;  2A4H A;  3A5W A;  3DEX A;  4MF7 A;  3A2X A;  2C3Q A;  2CVB A;  2H6Y A;  2QGV A;  2ALB A;  3BCK A;  1ZZY A;  4MPG A;  1WP0 A;  2NDO A;  1VF2 A;  4TXV A;  2QA2 A;  1TK0 B;  4IKH A;  1BF5 A;  1XWB A;  4DEJ A;  1PSQ A;  2UZ8 A;  2K6V A;  3ERW A;  1TTZ A;  3TJF A;  4GQC A;  3TKP A;  2YV7 A;  2PU9 C;  4EDZ A;  1A8L A;  1YVL A;  1VF1 A;  1GUM A;  1BED A;  5AIX A;  4LLR A;  3MSZ A;  3GST A;  4YQM A;  2E2M A;  3A2W A;  3VWW A;  1M99 A;  2C4J A;  2R37 A;  3HHV A;  2JU5 A;  4ZB6 A;  5L71 A;  3W8J A;  1USB A;  4G2E A;  1GSF A;  4POB A;  5CAX A;  3WYW A;  2X8G A;  5COH A;  1NW2 A;  5CRE A;  2P0G A;  2GSQ A;  1I5G A;  3KH9 A;  2OKA A;  2P5Q A;  2VO4 A;  3IPZ A;  4RI6 A;  1S3C A;  1TXX A;  1R4W A;  1ILO A;  2L5O A;  4NPB A;  2CA8 A;  3GTU B;  3FRC A;  2H73 A;  2F8A A;  3FY7 A;  1H75 A;  14GS A;  5JWQ B;  3HVV A;  3GH6 A;  4WF4 A;  3LSZ A;  1J08 A;  4BL7 B;  3L9S A;  1ML6 A;  1MDJ A;  1J0F A;  1GUL A;  1AC1 A;  2HSN B;  4E68 A;  1A2L A;  4TVE A;  3UIW A;  2WCI A;  3IA1 A;  1SL2 B;  1BG5 A;  3TUE A;  5D9V A;  3HDC A;  2DML A;  3H4K A;  5H5Q A;  1AXD A;  2LQO A;  4TR0 A;  2OAC A;  4ZIL A;  5JWR B;  4HS1 A;  1K3L A;  4HQS A;  5DAK A;  1WE0 A;  3ZZX A;  1GSU A;  1ACV A;  2IN3 A;  5CRG A;  3IAM 2;  4N0V A;  3EIN A;  3MAK A;  3FW2 A;  2DSA A;  1MTC A;  2M80 A;  2OBI A;  5GZZ B;  1EP7 A;  2IME A;  3IC8 A;  2CVD A;  1EP8 A;  2H6X A;  4YQU A;  1OC8 A;  2X8C A;  2VL9 A;  2HSH A;  1HYU A;  5FHI A;  2H01 A;  4MH2 A;  4X4J A;  2JZT A;  5F06 A;  2C0G A;  2EIR A;  2LJA A;  2NBS A;  3RDW A;  1JZR A;  3F0I A;  4N3Z A;  4KW6 A;  1PD2 1;  3M0F A;  3I69 A;  4OCF A;  2PVQ A;  2IMD A;  3O3T A;  1N25 A;  2HFD A;  1PKZ A;  5B8B A;  3GNJ A;  4MLY A;  1QUW A;  3HYP A;  4EC0 A;  1NHY A;  1SL1 B;  5BRT A;  4EIP A;  1PKW A;  3LQ7 A;  3EMX A;  5A4W A;  3ZTL A;  3D5J A;  1SK0 A;  3BJ5 A;  4IGJ A;  5H5R A;  2OE0 A;  2UV8 G;  3D21 A;  1T4Y A;  1KTE A;  4G0I A;  4V2N A;  3C7M A;  2O87 A;  4MP4 A;  3LWA A;  4XS6 A;  5IM9 A;  3GSS A;  3JCM L;  4EDY A;  1XVQ A;  3TKQ A;  3GL3 A;  3F3Q A;  4PX1 A;  4EIQ A;  2H1G A;  5CYY A;  3LFL A;  5DCG A;  5IMD A;  4MF6 A;  3O6T A;  4PXO A;  5F0G A;  2XC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...