6GSUA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLAHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsuA01
3TKPA 3LXZA 4KNDA 2I4AA 1FAAA 2IN3A 1TKDB 5F8BA 1JFUA 2PVOC 4F2IA 2IFQB 1AQWA 5GAND 3APOA 3L9SA 2FD3A 4BVXA 4J56E 4MJBA 3MWHA 3KGKA 4WKWA 3M1GA 3ME8A 6GSXA 3IA1A 1G7EA 4JR4A 4TVEA 5ELAA 5GAPD 1TU7A 4HJ2A 3FR3A 4MPFA 5BMUA 1WE0A 4PGTA 4HS1A 2LRTA 2MZCA 2K6VA 3DVXA 2EC4A 5G1KA 2PMTA 2NBSA 1VF3A 3P2AA 1WRYA 2CX3A 3HCZA 1FVJA 1OAZA 2HSHA 1MDKA 4KE3A 1S3AA 1HNBA 4XS4B 4YH2A 4P3YB 3EU4A 2L6DA 3LWAA 2F3MA 2XPDA 2QSIA 2LQOA 4QL9A 3GRXA 4DSRA 2LRCA 5FT3A 1GLQA 1YF1A 4KX4A 3IBHA 2XC2A 5J4UA 1RW1A 5IO0A 1S3CA 1SJZA 5CAXA 4BWSA 2HSNB 5E59A 5J5NA 3HYPA 5D8IA 3WGDA 3ZREA 4DVCA 3AY8A 3BCKA 5G5FA 2MBTA 2E0QA 1R26A 2GSTA 2PVQA 3HD5A 1AXDA 3QFBC 3KTBA 2ALBA 3GL3A 1XOBA 1SKSB 3KP8A 1O8XA 1K0DA 5CREA 1THXA 4CW9A 3O76A 5LNKe 4ZL8A 1H75A 4TKYA 5E4WA 1M9BA 3CBUA 3GKXA 2YOIA 3UMAA 3IE3A 2C0FA 4QL7A 2B7KA 1TXXA 2H72A 10GSA 2YWMA 3KM6A 3RDWA 1SL2B 1BJXA 3DGQA 1W4VA 4V2MA 1GSQA 4WR4A 1UC7A 1FO5A 4TOPA 5ECPB 3UOMA 4FQUA 1GL8A 2CA8A 2OJLA 1BG5A 3PH9A 4BVYA 3F4SA 2R3XA 1QFNA 1DSBA 4PURA 4PTSA 2HSYA 1KNGA 3ZLPA 3VI7A 1J08A 3QOUA 2IMFA 2YJ7A 1I9DA 2HYXA 5D9TA 4NV2A 2LS5A 1TRVA 1OKTA 1F37A 4ZB8A 5D9WA 1EP7A 2K9FA 2X64A 20GSA 1T7PB 1U6TA 1F2EA 1N2AA 2OACA 4X43A 4USSA 2CX4A 3TJGA 1Z5YE 1GNEA 3EVIA 1TK5B 1OC3A 4MF7A 3JCML 1NHOA 2WDUA 3L78A 4ZL9A 4GLTA 2DSAA 1U88A 2FHEA 1B48A 3F6FA 1PL2A 4ZXGA 2C80A 3M9JA 4GF0A 5GZZB 6GSYA 3L9VA 1TK0B 5J3RA 2H01A 2VCTA 1K0NA 1XVQA 4KF9A 4POKA 1OVNA 1LJRA 3VI5A 1Y25A 4I2UA 1UN2A 1MDIA 1PA3A 3ZIVA 1FW1A 1UVZA 2HSMB 2BMXA 4OCEA 2WCIA 5HFIA 3D5JA 4ID0A 5J41A 4D73A 2AHEA 2H76A 1V2AA 4ZBDA 2L5OA 3R2QA 1IYIA 1V58A 4O32A 4IQAA 4LMWA 2X99A 5D96A 1YEPA 1XW9A 1XCCA 2G0FA 4HI7A 2ON5A 1THOA 1A2LA 1FHEA 2FA4A 4JBBA 1J9BA 4EXJA 3ERFA 3D6IA 2JZSA 5ECKB 2H71A 3D4MA 3EYTA 1E2YA 1ERVA 3ZMKA 1M0UA 2MMOA 1B9YC 3LXTA 2KP2A 2FWHA 3ZFLA 4KGIA 4OCFA 2HZFA 2L5LA 2CVDA 5INYA 2CZ2A 1EOHA 2P0GA 3TCOA 3FEUA 2L57A 2RM5A 5JCGA 2N5BA 3A3TA 1ERWA 1V9WA 3GKMA 4K7NA 2DMLA 1X0RA 3TKSE 3C1SA 2FY6A 1QXHA 5AIXA 1WOUA 2PERA 3ERGA 2ES7A 4V2NA 1V40A 2I9HA 5B6MA 3FY7A 4V1Ap 3DD3A 3FR6A 3TJFA 1AC1A 3Q19A 2J23A 1K0BA 1KEBA 2P31A 1CQGA 1BYEA 3QR6A 2H0GA 1ML6A 2IIYA 1G0TA 2OBKA 3HXSA 1TU8A 2H30A 1USBA 2DJKA 3GH6A 5IMFA 2DBCA 17GSA 1BQ7A 4J2FA 1GTUA 4EL1A 1GULA 2XHFA 2YJHA 1AIUA 5IOWA 2L6CA 1Q4JA 2BTOT 2GS3A 5DAKB 4HQZA 3H93A 3GA4A 4K7IA 2B1KA 5KEJA 1VRSD 1JZRA 3TRXA 5AIVA 3D4TA 2JL4A 1SD9A 1R7HA 4K9ZA 2QGVA 3PPUA 2H73A 2LJRA 3F3QA 4GRFA 3IR4A 6GSTA 5HR3A 1HQOA 2YCDA 2FNOA 5JCWA 3Q18A 3RAZA 1XWBA 2C0EA 5DCGA 1OKDA 4IJIA 2PN8A 1WMJA 4V1Ag 1GRXA 4MDCA 3LFLA 3H8QA 1O6JA 4WR5A 1VGLA 2VL2A 2EIRA 1KTEA 2O85A 3J7Yk 2YANA 3TRPA 2VL9A 3ISOA 2IMEA 3M8NA 5ECHB 1SD8A 3KXOA 3PINA 1PX6A 1T1VA 2LEGA 1BX9A 4AGSA 1DBYA 2VCWA 5CNWA 1ZGNA 3GNJA 4MZWA 3EU3A 3GKKA 3LYPA 2O87A 2HRKA 3E9JB 5IIZA 4F0CA 4N11A 2C4JA 3QAGA 4MJAA 5HQPA 1X5CA 5ID2A 2VIMA 4F0BA 2DJ2A 2HZEA 5DALB 3I9V2 4GQCA 1TK8B 4HZ4A 5A4UA 1GTIA 4XCSA 1SU9A 5G1LA 2VM2A 3NZNA 4KB3A 4ZILA 2CAIA 1EOGA 1BAYA 3J7Yb 3UARA 2ZUPA 3BOAA 3BBYA 2IWTA 3P8WA 4ISDA 1GSDA 4NAXA 1JLVA 4CDOA 1DE2A 3RHCA 3LG6A 4PUAA 2H19A 1QMVA 2LNSA 2OA7A 1FVKA 3MSZA 3KIJA 3ZTLA 5D9XA 1Z7RA 2GT6A 2MYGA 4TR1B 2V41A 1M2DA 2R2JA 2V1MA 3TRQA 1PN9A 5ENUA 1AAZA 4ZB6A 1R4WA 2C0GA 3ZYWA 2IFQA 2JACA 3SBCA 1SYRA 3HZ4A 1WP0A 5JWQB 2A2SA 2FA8A 2V6KA 1YY7A 5ECQB 2MMNA 2AYTA 4MA9A 1O85A 4L5OA 3ME7A 4G0LA 3G7YA 3Q74A 2DJ0A 3UL3A 4BPYA 1IYHA 3H79A 5ECMB 3VFIA 4EDZA 3KH7A 4O92A 4OFMA 1GSYA 4K6XA 2K8SA 3H4KA 1K0OA 1B4PA 2C3QA 1O73A 4FYCA 2B1LA 2RM6A 5CYYA 5DJMA 3APQA 4OO5A 3WGXA 3TKSA 1TP9A 2O7KA 1OE8A 1ON4A 4JE1A 4BVXB 4ECJA 3FZAA 3GTUA 1TJDA 1F3BA 1GNWA 3MAKA 5LCZA 1GWCA 1OYJA 5KN2A 4I2TA 2IL3A 4WXTA 4K8MA 1PGTA 2O8VB 5DJLA 5IMAA 2I1UA 2H75A 3NOFA 4XHMA 2KP1A 1BEDA 7GSSA 5G30A 3G9BA 3PGTA 3D0ZA 14GSA 3HHVA 2JSYA 2H1GA 4KCAA 1XW5A 4ZB9A 2FCHA 4KUNA 2DIYA 5HR0A 2H0IA 4K0NA 5JCUA 3LGCA 2YWNA 3KP9A 5A4VA 2PWJA 2H66A 4OWYA 3P7XA 1DE1A 2F8FA 4IKHA 3I6AA 5ECIB 1U3IA 2OADA 4IBPA 3P90A 4KAEA 1V98A 3TGZA 3L9UA 4KDUA 5B6NA 2CZ3A 1XBSA 5LD0A 1EV9A 4G19A 4EO3A 3GH9A 1GLPA 2CAQA 2LUSA 3N9JA 5CRWA 4WF5A 3CSIA 1A0RP 5IMZA 4GQFA 1LBKA 1YQ1A 1O81A 5COHA 2A2RA 2O89A 3TOUA 1SKWB 2TRXA 4GCIA 3HKRA 4KSMA 3QDNA 3GV1A 4GSSA 3WGEA 4IELA 12GSA 3GX8A 5DVBA 2C0DA 4IN0A 3VLNA 3FK8A 4LLRA 5J9BA 3KTLA 4JZQA 3QCPA 2X8HA 1B9XC 1EEMA 5HFGA 1E6BA 4KA0A 5DQYA 6GSVA 4N0VA 2KUCA 2HI7A 3FR9A 4DSSB 4PQHA 3LQ7A 1RK4A 4MJEA 4I97A 3GMFA 3BJ5A 3O3TA 4POLA 2YPMA 4OFTA 3F4RA 1XWCA 3DXBA 3W8JA 1EV4A 2PGTA 3CMIA 1GUHA 1Y6EA 3DYRA 2AB6A 5A5KA 4FO5A 2H70A 2NDOA 3S9FA 4BVYB 5IMCA 4HDEA 3CRTA 1A2MA 3V1WA 4Q5RA 3OR5A 2L4CA 4RQRA 1SK0A 4LA1A 2ZCTA 1K3LA 3IAM2 5GSSA 2WFCA 4MLYA 5J9CA 2R5GA 5IQYA 4IQ1A 2E2MA 2H8LA 22GSA 4I5QA 3W6GA 3F3RA 1EGOA 2DJJA 4L5LA 3KH9A 2VLTA 4RI6A 5CO3A 2OE0A 2GDRA 3F4TA 3F8UA 4PUFC 2B3SA 2ZNMA 1U87A 3U5RE 2GQMA 1F6MC 2FUG2 1G6YA 4ACSA 3TB2A 3GSTA 5AGYA 4V2LA 2IMKA 2GVPA 4G2EA 1A0FA 1SJIA 3QMXA 3FZ5A 2OBIA 3VWXA 2RLIA 1WJKA 2QC7A 2N5FA 3H1NA 1XZOA 1MDJA 2P5RA 3K8NA 4HOJA 2HRNA 4J57E 4YQMA 1M2AA 1XOAA 2E2GA 3HY2A 4LL4B 3KMNA 4D73B 2FWGA 1PL1A 3GN3A 3KD0A 1ZOFA 3G7JA 4ZIJA 1VF1A 4FYUA 3KEBA 2MMAA 4TXOA 2V2GA 4YAVA 1N8JA 3O6TA 5EY6A 2YV9A 3UEMA 4IGJA 2DJ3A 1ZZYA 4RI7A 4KCEA 1ZYEA 1JZDA 1SK2A 4WF4A 4I8BA 3SWLA 1YDKA 3APSA 1OC9A 1A8YA 2NPBA 3VWWA 6GSUA 3HVVA 2VCZA 2N5AA 1HNAA 4WETA 6GSSA 4FH8A 5AISA 1XIYA 4TW5A 4G0KA 3RBTA 2KHPA 2H6ZA 2REMA 4MH3A 3FYGA 1LU4A 2HNLA 1TI3A 4H86A 4OO4A 2XBIA 4TR4A 3F9UA 3IC4A 3A2VA 4O7HA 1PD21 2A4VA 2D2ZA 4BL7A 3QPMA 4NMUA 3FZ9A 5F06A 5DAKA 1Z6NA 3ZL5A 3VWVA 1PRXA 2VAFA 2RUEA 3I43A 5F07A 3GUSA 3D21A 4EE0A 1SKRB 3HDCA 4MZBA 2XPEA 2PUKC 2DMMA 4G9HA 4EKZA 13GSA 2GSRA 2TIRA 3C73A 3LSZA 4K7OA 1WPIA 1MTCA 2LV3A 1PMTA 1QUWA 3QD9A 1GP1A 3IOSA 4XIHA 3KJYA 1H4OA 2DLXA 4ECIA 2CQ9A 1X9MB 2YP6A 3ED3A 2AAWA 6GSWA 4ECBA 3WYWA 2VL3A 3UVHA 3QAVA 2B5EA 5ECNB 1R5AA 1QGVA 4GSNA 1XWKA 5ECRB 3ERWA 4POMA 2VM1A 5G5EA 3FRCA 5F05A 1A24A 2UZ8A 3U6VA 3E0UA 4GXZA 2GT5A 1HNCA 1SYXA 1TRWA 1XFLA 1T4YA 2M46A 1QQ2A 4YQVA 5DDLA 2M80A 2R6KA 5EPFA 4WBJA 8GSSA 3CXGA 1K0MA 1XWGA 3US3A 3HJPA 4MPGA 1M7TA 1M99A 1TI1A 3RHBA 4KDXA 4MF6A 2F51A 1I5GA 1T4ZA 2LRNA 2F8AA 2M72A 2FGXA 5ELGA 5D73A 1AW9A 4DSQA 4MZCA 2FWEA 4X1UA 3TDGA 2X8GA 2VL2C 2HFDA 3CTGA 3QFAC 2WGRA 4L0WA 5CP1A 2HRKB 3FZ4A 4YQUA 3EMXA 3C71A 1GUKA 1V57A 2AJQB 4Q5NA 5ID2B 2H1BA 4MK3A 2B5XA 5KN3A 1JZOA 1MD4A 3MNGA 3WD6A 3FW2A 2XBQA 5JWRB 2YZHA 2HE3A 1O7UA 2VCVA 2FLSA 1XPVA 4ILFA 4RQXA 2YNXA 3DMLA 1PX7A 3UAPA 3UVTA 3ZFBA 5CRDA 5H5SA 2I3YA 1ERTA 3BD2A 4IHUA 1EP8A 2DC5A 2VUPA 2LKUA 2GTUA 1EGRA 4XRAA 2VD1A 3TKRA 1YJ6A 3DIEA 3M0FA 1VF2A 3PR8A 4AJ8A 5B7CA 2IJYA 2CT6A 4CHSA 3DKSA 2DIZA 3UBKA 3EE2A 3RPPA 4K0GA 4EVMA 4KH7A 2VLUA 1GUMA 4PQ1A 1YKAA 5A4WA 5D9VA 2HRAA 3TOTA 4XS4A 2VD0A 3WT2A 4EUYA 3ZIJA 3EWLA 5ECSA 3D22A 5JWOB 1EZKA 1NM3A 3GX0A 4F9ZA 3M9KA 2L4QA 3IK7A 5HR2A 2WB9A 2AUVA 2PU9C 5HFKA 1G7OA 4KW6A 1TW9A 2RIIA 2JU5A 1TDIA 3RPNA 2Z9SA 1NW2A 2P5QA 3G7IA 5ABRA 3WT1A 3DWVA 3HJOA 3F0IA 3KZQA 1AQVA 3IPZA 4TR0A 4PXOA 4AJ6A 2G2QA 1R5PA 16GSA 2PBJA 1F9MA 3GTUB 1XVWA 4YAPA 5EVOA 4RUVA 1HD2A 2VOCA 2GSSA 5B8AA 4OD7A 3L4NA 3CRUA 3TKSC 3E3EA 2B6MA 2HLSA 1NSWA 2OE1A 4TXVA 1X9SB 1ACVA 1WIKA 2VO4A 3DRNA 1ERUA 3IC8A 3IHQA 3Q6OA 4WBRD 1TOFA 2YN1A 3TKQA 1G6WA 3FHKA 1GSSA 2TRCP 4QQ7A 2FWFA 2EIOA 4NWYA 1Q98A 1GH2A 5DQSA 2JZTA 3GIXA 2K18A 4TRXA 1A2JA 3CYNA 4EDYA 2GQKA 2E7PA 4PQIA 1MD3A 2J9HA 3VPQA 1URMA 5HR1A 3ZVJD 3BCIA 1JZWA 2DJ1A 2GLRA 1JLWA 1ZL9A 1GSFA 2BJXA 1O8WA 2CV4A 1XW6A 1AQXA 4G10A 4MH2A 1T00A 4DSSA 3VURA 3C8EA 3GYKA 4MJCA 1X5EA 2B5YA 4XTSA 1X5DA 1MEKA 1UA5A 4MP4A 2OKAA 5IOXA 1ZCPA 2JZRA 4HZ2A 2K8VA 1YKCA 4ECCA 3GFKA 5IM9A 2GGTA 1S3DA 5IMVA 3VWUA 3HVSA 4HEA2 4IW9A 3A2WA 3MDKA 1TTZA 3KCMA 1U3AA 4E8HA 3UBLA 1NHYA 3I69A 2LQQA 4KSOA 1PKWA 1AUCA 2JSZA 2C1YA 2LNTA 11GSA 2OE3A 2YWOA 3TJKA 19GSA 1K0AA 2GSQA 1ZMAA 5IPGA 3IDVA 2YWIA 1K3YA 4LL1B 4EC0A 5H5RA 1SENA 1M9AA 4PNGA 4NV5A 2ON7A 3ZVJA 4IS0A 5KN0A 5AN1A 2EIQA 2H1AA 1YEXA 1SL0B 2LJAA 2LJKA 2IPAA 5C00A 2C3TA 1GSEA 2MBSA 4I6XA 2HSMA 1ST9A 2V6OA 4F03A 1YF0A 2WRTA 4K2DA 2WJUA 1XXUA 3LEFA 4HJMA 3QAWA 4ML1A 4IP6A 5CRHA 3EINA 4O5RA 4N0ZA 1TRSA 3CSJA 1ILOA 2H6XA 4OFNA 5EL8A 4Q5QA 3M3MA 5IO2A 1FG4A 5IMDA 2YV7A 4Q5FA 2NTOA 4XS1A 5G31A 2NVLA 2GZZA 3F6DA 3IK9A 3CSHA 4FIWA 2B7JA 4HU7A 2WULA 3GSSA 4MCUA 1A8LA 5L71A 5DCHA 2JADA 4IVFA 2L59A 4GTUA 4AF2A 4ZL7A 4L8EA 3R3EA 4G0IA 1Z3EA 3F63A 4MMMA 4MABA 2HRFA 3HA9A 4JRRA 2VCQA 4GSTA 3KMOA 4LMVA 3VK9A 4DEJA 1EEJA 5ECOB 5DBQA 3IXRA 5H5QA 2V32A 2H74A 3GHAA 2VLVA 2C3NA 2WS2A 2KLXA 1EWXA 3VPTA 4N30A 1OC8A 2RUFA 5ECLB 4TXOB 3GKNA 3CTFA 3IV4A 3HZ8A 3L0HA 2AV4A 3A2XA 1HYUA 1FB6A 3A5WA 3NIVA 3TJJA 5IPHA 4PNFA 4ULXA 1ZYQB 2LTKA 4N10A 1SJ6A 3UJ1A 1TRUA 3C7MA 2HQTA 4HUAA 1OC9B 4TN8A 2R37A 1QK8A 4PX1A 2GQLA 4FYBA 1SL1B 4K1FA 3EC3A 4AJ7A 1Z6MA 1RQMA 4L0UA 1SK1A 4IJ3A 1J0FA 4NHWA 1JHBA 3HJMA 3ZRDA 3GL5A 2MMZA 5FWGA 1VF4A 2C8UA 3HVXA 3TJBA 3UIWA 1A23A 1YZXA 18GSA 4E8EA 4BL7B 3LJRA 4MF5A 4F82A 2QKEA 3DEXA 1T3BA 3IAS2 3FKFA 2H0HA 2PPTA 4JU5A 2F9SA 2X8CA 2LSTA 4POBA 1B8XA 3ZMLA 9GSSA 4HU9A 2KOKA 5B8BA 3LYKA 2I81A 1B4QA 4JEDA 1XWAA 3EURA 5F0GA 3ZZXA 4HQSA 4ML6A 4XS6A 2GZPA 1FB0A 4X0XA 4TR3A 1W89A 2HXKA 4BA7A 1K0CA 4ZBBA 3C1RA 3LORA 3IRAA 1DUGA 4ZBAA 5DALA 1WWJA 1M2BA 2R4VA 4BWQA 1PQNA 4Z7XA 2IMDA 2YZUA 1Z9HA 4NXIA 4GWRA 5CRGA 2H6YA 1Z7PA 1T8EB 4IP1A 1GSUA 1K3OA 3DVWA 1KBNA 4WEYA 5KN1A 3TUEA 2CVKA 4XRDA 4NPBA 1CQHA 4TR1A 5GSTA 1PSQA 1FOVA 1X9WB 2VCXA 2HZEB 2CVBA 5D93A 2GZYA 1GTBA 2WZ9A 2H1DA 2IMIA 5G2ZA 4EF0A 1PKZA 2HT9A 1ABAA 4JR6A 5FHIA 3W8SA 1F3AA 3ZITA 5C04A 3GURA 1OE7A 3EMPA 1GTAA 4KDYA 3N5OA 4NHZA 4OMVA 1C72A
chains in the Genus database with same CATH superfamily
3TKPA 3LXZA 4KNDA 2I4AA 1FAAA 2IN3A 1TKDB 5F8BA 1JFUA 2PVOC 4F2IA 2IFQB 1AQWA 5GAND 3APOA 3L9SA 2FD3A 4BVXA 4J56E 4MJBA 3MWHA 3KGKA 4WKWA 3M1GA 4X4JA 3ME8A 6GSXA 3IA1A 1G7EA 1S3RA 4JR4A 4TVEA 5ELAA 5GAPD 1TU7A 4HJ2A 3FR3A 4MPFA 5BMUA 1WE0A 4PGTA 4HS1A 2LRTA 2MZCA 2K6VA 3DVXA 2EC4A 5G1KA 2PMTA 2NBSA 1VF3A 3P2AA 1WRYA 2CX3A 3HCZA 1FVJA 1OAZA 2HSHA 1MDKA 4KE3A 1S3AA 1HNBA 4XS4B 4YH2A 4P3YB 3EU4A 2L6DA 3LWAA 2F3MA 2XPDA 2QSIA 2LQOA 4QL9A 3GRXA 4DSRA 2LRCA 5FT3A 1GLQA 1YF1A 4KX4A 3IBHA 2XC2A 5J4UA 4AKHA 1RW1A 5IO0A 1S3CA 1SJZA 4ICYA 5CAXA 4BWSA 2HSNB 5E59A 5J5NA 3HYPA 5D8IA 3WGDA 3ZREA 4DVCA 3AY8A 3BCKA 2EFDA 5G5FA 2MBTA 2E0QA 1R26A 2GSTA 2PVQA 3HD5A 1AXDA 3QFBC 3KTBA 2ALBA 3GL3A 1XOBA 1SKSB 2O3EA 3KP8A 1O8XA 1K0DA 5CREA 1THXA 3LW9A 4CW9A 3O76A 5LNKe 1Y1UA 4ZL8A 1H75A 4TKYA 5E4WA 1M9BA 3CBUA 4N3ZA 3GKXA 2YOIA 3UMAA 3IE3A 2C0FA 4QL7A 2B7KA 1TXXA 2H72A 10GSA 2YWMA 3KM6A 3RDWA 1SL2B 1BJXA 3DGQA 1W4VA 4V2MA 1GSQA 4WR4A 1UC7A 1FO5A 4TOPA 5ECPB 3UOMA 4FQUA 1GL8A 2CA8A 2OJLA 1BG5A 3PH9A 4BVYA 3F4SA 2R3XA 1QFNA 1DSBA 4PURA 4PTSA 2HSYA 1KNGA 3ZLPA 3VI7A 1J08A 3QOUA 2IMFA 2YJ7A 1I9DA 2HYXA 5D9TA 4NV2A 2LS5A 1TRVA 1OKTA 1F37A 4ZB8A 5D9WA 1EP7A 2K9FA 2X64A 20GSA 1T7PB 1U6TA 1F2EA 1N2AA 2OACA 4X43A 4USSA 2CX4A 3TJGA 3CHXC 1Z5YE 1GNEA 3EVIA 1TK5B 1OC3A 4MF7A 3JCML 5A34B 1NHOA 2WDUA 3L78A 4ZL9A 4GLTA 2DSAA 4Z2TA 1U88A 2FHEA 1B48A 3F6FA 1PL2A 4ZXGA 2C80A 3M9JA 4GF0A 5GZZB 6GSYA 3L9VA 1TK0B 5J3RA 1BG1A 2H01A 2VCTA 1K0NA 1XVQA 4KF9A 4POKA 1OVNA 1LJRA 3VI5A 1Y25A 4I2UA 1UN2A 1MDIA 5J4VA 1PA3A 3ZIVA 1FW1A 1UVZA 2HSMB 2BMXA 4OCEA 4PHZC 2WCIA 5HFIA 3D5JA 4ID0A 2EFCA 5J41A 4D73A 2AHEA 2H76A 4W66A 1V2AA 4ZBDA 2L5OA 3R2QA 4ZB7A 1IYIA 1V58A 4O32A 4IQAA 4LMWA 4AKIA 2X99A 5D96A 1YEPA 1XW9A 1XCCA 2G0FA 4HI7A 2ON5A 1THOA 1A2LA 1FHEA 2FA4A 4JBBA 1J9BA 4EXJA 3ERFA 3D6IA 2JZSA 5ECKB 2H71A 3D4MA 3EYTA 1E2YA 1ERVA 3ZMKA 1M0UA 2MMOA 1B9YC 3LXTA 2KP2A 2FWHA 3ZFLA 4KGIA 4OCFA 2HZFA 2L5LA 2CVDA 5INYA 2CZ2A 1EOHA 2P0GA 3TCOA 3FEUA 2L57A 2RM5A 5JCGA 2N5BA 3A3TA 1ERWA 1V9WA 3GKMA 4K7NA 2DMLA 1X0RA 3TKSE 3C1SA 2FY6A 1QXHA 5AIXA 1WOUA 2PERA 3ERGA 2ES7A 4V2NA 1V40A 5A1NA 2I9HA 5B6MA 3FY7A 4V1Ap 3DD3A 3FR6A 3TJFA 1AC1A 3Q19A 3CWGA 2J23A 1K0BA 1KEBA 2P31A 1CQGA 1BYEA 3QR6A 4E68A 2H0GA 1ML6A 4YKGA 2IIYA 1G0TA 2OBKA 4HSCX 3HXSA 1TU8A 2H30A 1USBA 2DJKA 3GH6A 5IMFA 2DBCA 17GSA 1BQ7A 3MIXA 4J2FA 1GTUA 4QMKA 4EL1A 1GULA 2XHFA 2YJHA 1AIUA 5IOWA 2L6CA 1Q4JA 2BTOT 4K5SA 2GS3A 5DAKB 4HQZA 3H93A 3GA4A 4K7IA 2WVXB 2B1KA 5KEJA 1M3JA 1VRSD 1JZRA 3TRXA 5AIVA 3D4TA 2JL4A 1SD9A 1R7HA 4K9ZA 2QGVA 3PPUA 2H73A 2LJRA 3F3QA 4GRFA 4PI0C 3IR4A 6GSTA 5HR3A 1HQOA 2YCDA 2FNOA 5JCWA 3Q18A 4Z2RA 3RAZA 1XWBA 2C0EA 5DCGA 1OKDA 4IJIA 2PN8A 1WMJA 4V1Ag 1GRXA 4MDCA 3LFLA 2H1LA 3H8QA 1O6JA 3MYDA 4WR5A 1VGLA 2VL2A 2EIRA 1KTEA 2O85A 3J7Yk 2YANA 3TRPA 2O36A 2VL9A 3ISOA 2IMEA 3M8NA 5ECHB 1SD8A 3KXOA 3PINA 1PX6A 1T1VA 2LEGA 1BX9A 4AGSA 1DBYA 2VCWA 5CNWA 1ZGNA 3GNJA 4MZWA 3EU3A 2X49A 5KOWA 3GKKA 3LYPA 2O87A 2HRKA 3E9JB 5IIZA 4F0CA 4N11A 2C4JA 3QAGA 4MJAA 5HQPA 1X5CA 5ID2A 2VIMA 4F0BA 2DJ2A 2HZEA 5DALB 3I9V2 4GQCA 1TK8B 4HZ4A 5A4UA 1GTIA 4XCSA 1SU9A 5G1LA 2VM2A 3NZNA 4KB3A 4ZILA 2CAIA 1EOGA 1BAYA 3J7Yb 3UARA 2ZUPA 3BOAA 3BBYA 2IWTA 3P8WA 1ZYNA 4ISDA 1GSDA 4NAXA 1JLVA 4CDOA 1DE2A 3RHCA 3LG6A 4PUAA 2O5VA 1SVOA 2H19A 1QMVA 2LNSA 2OA7A 1FVKA 3MSZA 3KIJA 3ZTLA 5D9XA 1Z7RA 2GT6A 2MYGA 4TR1B 2V41A 1M2DA 2R2JA 2V1MA 3TRQA 1PN9A 5ENUA 1AAZA 4ZB6A 1R4WA 2C0GA 3ZYWA 2IFQA 2DKIA 2JACA 3SBCA 1SYRA 3RFRC 3HZ4A 1WP0A 5JWQB 2A2SA 2FA8A 2V6KA 1YY7A 5ECQB 2MMNA 2AYTA 4MA9A 1O85A 4L5OA 3ME7A 4G0LA 3G7YA 3Q74A 4EIQA 4AKXB 2DJ0A 3UL3A 4BPYA 1IYHA 3H79A 1S4BP 5ECMB 3VFIA 4EDZA 3KH7A 4O92A 4OFMA 1GSYA 4K6XA 2K8SA 3H4KA 1K0OA 1B4PA 2C3QA 1O73A 4FYCA 2B1LA 2RM6A 5CYYA 5DJMA 3APQA 4OO5A 3WGXA 3TKSA 1TP9A 2O7KA 1OE8A 1ON4A 4JE1A 4BVXB 4ECJA 3FZAA 3GTUA 1TJDA 1F3BA 1GNWA 3MAKA 5LCZA 1GWCA 1OYJA 5KN2A 4I2TA 2IL3A 4WXTA 4K8MA 1PGTA 2O8VB 5DJLA 5IMAA 2I1UA 2H75A 2HSNA 3NOFA 2KP1A 4XHMA 1BEDA 7GSSA 5G30A 3G9BA 3PGTA 3D0ZA 14GSA 3HHVA 2JSYA 2H1GA 4KCAA 1XW5A 4ZB9A 2FCHA 4KUNA 2DIYA 2QA2A 5HR0A 2H0IA 4K0NA 5JCUA 3LGCA 2EFEA 2YWNA 3KP9A 5A4VA 2PWJA 2H66A 4OWYA 3P7XA 1DE1A 2F8FA 4IKHA 4CY8A 3I6AA 5ECIB 1U3IA 2OADA 3A5IA 4IBPA 3P90A 4KAEA 1V98A 4A5PA 3TGZA 3L9UA 2WW3A 4KDUA 5B6NA 2CZ3A 1XBSA 5LD0A 1EV9A 4G19A 4EO3A 3GH9A 1GLPA 2CAQA 1M3IA 2LUSA 3N9JA 5CRWA 4WF5A 3CSIA 1A0RP 5IMZA 4GQFA 1LBKA 1YQ1A 1O81A 5COHA 2A2RA 2O89A 3TOUA 1SKWB 2TRXA 4GCIA 3HKRA 4KSMA 3QDNA 3GV1A 4GSSA 3WGEA 4IELA 12GSA 3GX8A 5DVBA 2C0DA 4IN0A 3VLNA 3FK8A 4LLRA 5J9BA 3KTLA 4JZQA 3QCPA 2X8HA 1B9XC 1EEMA 5HFGA 1E6BA 5J4YA 4KA0A 5DQYA 6GSVA 4N0VA 2KUCA 4K5RA 2HI7A 4GDFA 3FR9A 4DSSB 1TXUA 4PQHA 3LQ7A 1RK4A 4MJEA 4I97A 3GMFA 3BJ5A 3O3TA 4POLA 2YPMA 4O5QA 4OFTA 3F4RA 1XWCA 3DXBA 3W8JA 1EV4A 2PGTA 3CMIA 1GUHA 1Y6EA 3DYRA 2AB6A 5A5KA 2H70A 4FO5A 4MNNA 2NDOA 3S9FA 4BVYB 5A34A 5IMCA 4HDEA 3CRTA 1A2MA 3V1WA 4Q5RA 3OR5A 2L4CA 4RQRA 1SK0A 4LA1A 2ZCTA 1K3LA 3IAM2 5GSSA 2WFCA 4MLYA 5J9CA 2R5GA 5IQYA 4IQ1A 2E2MA 2H8LA 22GSA 4Z2UA 4I5QA 3W6GA 3F3RA 1EGOA 2DJJA 4L5LA 3KH9A 2VLTA 4RI6A 5CO3A 2OE0A 2GDRA 3F4TA 3F8UA 4PUFC 2B3SA 2ZNMA 1U87A 3U5RE 2GQMA 1F6MC 2FUG2 1G6YA 4ACSA 2WVZA 2WW2A 3TB2A 3GSTA 5AGYA 4V2LA 2IMKA 2GVPA 3CQFA 4G2EA 1A0FA 1SJIA 3QMXA 4PI2C 3FZ5A 2OBIA 3VWXA 2RLIA 1WJKA 2QC7A 2N5FA 3H1NA 1XZOA 1MDJA 2P5RA 3K8NA 4HOJA 2HRNA 4J57E 4YQMA 1M2AA 1XOAA 3TU3B 2E2GA 3HY2A 4LL4B 3KMNA 4D73B 2FWGA 1PL1A 3GN3A 3KD0A 1ZOFA 3G7JA 4ZIJA 1VF1A 4FYUA 3KEBA 4AKGA 2MMAA 4TXOA 2V2GA 4YAVA 1N8JA 1YVLA 3O6TA 5EY6A 2YV9A 3UEMA 4IGJA 2DJ3A 1ZZYA 4RI7A 4KCEA 1ZYEA 1JZDA 1SK2A 4WF4A 4I8BA 3SWLA 1YDKA 3APSA 1OC9A 1A8YA 2NPBA 3VWWA 6GSUA 3HVVA 2VCZA 2N5AA 1HNAA 4WETA 6GSSA 4FH8A 5AISA 1XIYA 4TW5A 4G0KA 3RBTA 2KHPA 2H6ZA 2REMA 4MH3A 3FYGA 1LU4A 2HNLA 1TI3A 4H86A 4OO4A 2XBIA 4TR4A 3IC4A 3F9UA 3A2VA 4O7HA 1PD21 2A4VA 2D2ZA 4BL7A 3QPMA 4NMUA 3FZ9A 5F06A 5DAKA 1Z6NA 3ZL5A 3VWVA 1PRXA 2VAFA 2RUEA 3I43A 5F07A 3GUSA 3D21A 4EE0A 1SKRB 3HDCA 4MZBA 2XPEA 2PUKC 2DMMA 4G9HA 4EKZA 13GSA 2GSRA 2TIRA 3C73A 3LSZA 4K7OA 1WPIA 1MTCA 2LV3A 1PMTA 1QUWA 3QD9A 1GP1A 3IOSA 4XIHA 3KJYA 1H4OA 2DLXA 4ECIA 2CQ9A 1X9MB 2YP6A 3ED3A 2AAWA 6GSWA 4ECBA 3WYWA 2VL3A 3UVHA 3QAVA 2B5EA 5ECNB 1R5AA 1QGVA 4GSNA 1XWKA 5ECRB 3RGBC 3ERWA 4POMA 2VM1A 4CY6A 5G5EA 3FRCA 5F05A 1A24A 2UZ8A 3U6VA 3E0UA 4GXZA 2GT5A 2X4AA 1HNCA 1SYXA 1TRWA 1XFLA 1T4YA 2M46A 1QQ2A 4YQVA 5DDLA 2M80A 2R6KA 5EPFA 4WBJA 8GSSA 3CXGA 1K0MA 1XWGA 3IHGA 3HJPA 4MPGA 3US3A 1M7TA 1M99A 1TI1A 3RHBA 4O5UA 4KDXA 4MF6A 2F51A 1I5GA 1T4ZA 2LRNA 5A5HA 2F8AA 2M72A 2FGXA 5ELGA 5D73A 1AW9A 4DSQA 4MZCA 2FWEA 4X1UA 3TDGA 2X8GA 2VL2C 2HFDA 3CTGA 3QFAC 2WGRA 4L0WA 5CP1A 2HRKB 3FZ4A 4YQUA 3EMXA 3C71A 1GUKA 1V57A 2AJQB 4Q5NA 5ID2B 2H1BA 4MK3A 2B5XA 5KN3A 1JZOA 1MD4A 3MNGA 3WD6A 3FW2A 2XBQA 5JWRB 2YZHA 2HE3A 1O7UA 2VCVA 2FLSA 1XPVA 4ILFA 4RQXA 2YNXA 3DMLA 1PX7A 3UAPA 3UVTA 3ZFBA 5CRDA 5H5SA 2I3YA 1ERTA 3BD2A 4IHUA 1EP8A 2DC5A 2VUPA 2LKUA 2GTUA 1EGRA 2A4HA 4XRAA 2VD1A 3TKRA 1YJ6A 3DIEA 3M0FA 1VF2A 3PR8A 4AJ8A 5B7CA 2IJYA 2CT6A 4CHSA 5BRTA 3DKSA 2DIZA 3UBKA 3EE2A 3RPPA 4K0GA 4EVMA 1BF5A 4KH7A 2VLUA 1GUMA 4PQ1A 1YKAA 5A4WA 5D9VA 2HRAA 3TOTA 4XS4A 2VD0A 3WT2A 4EUYA 3ZIJA 3EWLA 5ECSA 3D22A 1PN0A 5JWOB 1EZKA 1NM3A 3GX0A 4F9ZA 3M9KA 2L4QA 3IK7A 5HR2A 2WB9A 2AUVA 2PU9C 5HFKA 1G7OA 5BMUB 4KW6A 1TW9A 2RIIA 2JU5A 1TDIA 3RPNA 2Z9SA 1NW2A 2P5QA 3G7IA 5ABRA 3WT1A 3DWVA 3HJOA 3F0IA 3KZQA 1AQVA 3IPZA 4TR0A 4PXOA 4AJ6A 2G2QA 1R5PA 16GSA 2PBJA 1F9MA 3GTUB 1XVWA 4YAPA 5EVOA 4RUVA 1HD2A 2VOCA 2GSSA 5B8AA 1XG8A 4K2XA 4OD7A 3L4NA 3CRUA 3TKSC 4AI6A 3E3EA 2B6MA 2HLSA 1NSWA 2OE1A 4TXVA 1X9SB 1ACVA 1WIKA 2VO4A 3DRNA 1ERUA 3IC8A 3IHQA 3Q6OA 4WBRD 2R0CA 1TOFA 2YN1A 3TKQA 1G6WA 3FHKA 1GSSA 2TRCP 4QQ7A 2FWFA 2EIOA 2DKHA 4NWYA 1Q98A 1GH2A 5DQSA 2JZTA 3GIXA 2K18A 4TRXA 1SVMA 1A2JA 4EDYA 2GQKA 3CYNA 4YKFA 2E7PA 4PQIA 1MD3A 2J9HA 3VPQA 1URMA 5KOXA 5HR1A 3ZVJD 3BCIA 1JZWA 2DJ1A 2GLRA 1JLWA 1ZL9A 1GSFA 2BJXA 1O8WA 2CV4A 1XW6A 1AQXA 4G10A 4MH2A 1T00A 4DSSA 3VURA 3C8EA 3GYKA 4MJCA 1X5EA 2B5YA 4XTSA 1X5DA 1MEKA 1UA5A 4MP4A 2OKAA 5IOXA 1ZCPA 2JZRA 4HZ2A 2K8VA 1YKCA 4ECCA 3GFKA 5IM9A 2GGTA 1S3DA 2QA1A 3VWUA 3HVSA 4HEA2 4IW9A 5IMVA 3A2WA 3MDKA 1TTZA 3KCMA 2WW0A 1U3AA 4E8HA 3UBLA 1NHYA 3I69A 2LQQA 4KSOA 1PKWA 2VKZG 1AUCA 2JSZA 2C1YA 2LNTA 11GSA 4BIKA 2WVYA 2OE3A 2YWOA 3TJKA 19GSA 1K0AA 1SVLA 2GSQA 1ZMAA 5IPGA 3IDVA 2YWIA 1K3YA 4LL1B 4EC0A 5H5RA 1SENA 1M9AA 4PNGA 4NV5A 2ON7A 3ZVJA 4IS0A 5KN0A 5AN1A 2EIQA 2R0GA 2H1AA 1YEXA 1SL0B 2LJAA 2LJKA 2IPAA 5C00A 2C3TA 1GSEA 2MBSA 4I6XA 2HSMA 3HMJG 4G01A 1ST9A 2V6OA 4F03A 1YF0A 2WRTA 4K2DA 2WJUA 1XXUA 3LEFA 4HJMA 3QAWA 4ML1A 4IP6A 5CRHA 3EINA 4O5RA 4N0ZA 1TRSA 3CSJA 1ILOA 2H6XA 4OFNA 5EL8A 4Q5QA 3M3MA 5IO2A 1FG4A 5IMDA 2YV7A 4Q5FA 2NTOA 4XS1A 5G31A 2NVLA 2GZZA 3F6DA 3IK9A 3CSHA 4FIWA 4FXYP 2B7JA 4HU7A 2WULA 3GSSA 4MCUA 1A8LA 5L71A 5DCHA 2JADA 3FMWA 4IVFA 2L59A 2EFHA 4GTUA 4AF2A 4ZL7A 4L8EA 3R3EA 4G0IA 1Z3EA 3EPTA 3F63A 4EIPA 4MMMA 4MABA 2HRFA 3HA9A 4JRRA 2VCQA 4GSTA 3KMOA 4LMVA 3VK9A 4DEJA 1EEJA 5ECOB 5DBQA 3IXRA 5H5QA 2V32A 2H74A 3GHAA 2VLVA 2C3NA 2WS2A 2KLXA 1EWXA 3VPTA 4N30A 1OC8A 2RUFA 5ECLB 4TXOB 2WZSA 3GKNA 3CTFA 3IV4A 3HZ8A 3L0HA 2AV4A 3A2XA 1HYUA 1FB6A 3A5WA 3NIVA 3TJJA 5IPHA 4PNFA 1N25A 4ULXA 1ZYQB 2LTKA 4N10A 1SJ6A 3UJ1A 1TRUA 3C7MA 2HQTA 4HUAA 1OC9B 4TN8A 2R37A 1QK8A 4PX1A 2GQLA 4FYBA 1SL1B 4K1FA 3EC3A 4AJ7A 1Z6MA 1RQMA 4L0UA 1SK1A 1YEWC 4IJ3A 1J0FA 2WVXA 4NHWA 5A1NB 1JHBA 3HJMA 3ZRDA 3GL5A 2MMZA 5FWGA 1VF4A 5J40A 2C8UA 3HVXA 1PFOA 3TJBA 3UIWA 1A23A 1YZXA 18GSA 4E8EA 4BL7B 3LJRA 4MF5A 4F82A 2QKEA 3DEXA 1T3BA 3IAS2 3FKFA 2H0HA 2UV8G 2PPTA 4JU5A 2F9SA 2X8CA 2LSTA 4POBA 1B8XA 3ZMLA 9GSSA 4HU9A 2KOKA 5B8BA 3LYKA 1ZYPA 2I81A 1B4QA 4JEDA 2OT3A 1XWAA 3EURA 5J47A 5F0GA 3ZZXA 4HQSA 4ML6A 4XS6A 2GZPA 1FB0A 4X0XA 4TR3A 1W89A 2HXKA 4BA7A 1K0CA 4ZBBA 3C1RA 3LORA 3IRAA 1DUGA 2R0PA 4ZBAA 5DALA 1WWJA 1M2BA 2R4VA 3HVNA 4BWQA 1PQNA 4Z7XA 2IMDA 2YZUA 1Z9HA 4NXIA 4GWRA 5CRGA 2H6YA 1Z7PA 1T8EB 4IP1A 1GSUA 1K3OA 3DVWA 1KBNA 4WEYA 5KN1A 3TUEA 2CVKA 4XRDA 4NPBA 1CQHA 1I1IP 4TR1A 5GSTA 1PSQA 1FOVA 1X9WB 2VCXA 2HZEB 2CVBA 5A5HB 5D93A 2GZYA 1GTBA 2WZ9A 2WW1A 2H1DA 2IMIA 5G2ZA 4EF0A 1PKZA 2HT9A 1ABAA 4JR6A 5FHIA 3W8SA 1F3AA 3ZITA 5C04A 3GURA 1OE7A 3EMPA 2A2PA 1FOHA 1GTAA 4KDYA 3N5OA 4NHZA 4OMVA 1C72A
chains in the Genus database with same CATH topology
3TKPA 3LXZA 4KNDA 2I4AA 1FAAA 2IN3A 1TKDB 5F8BA 1JFUA 2PVOC 4F2IA 2IFQB 1AQWA 5GAND 3APOA 3L9SA 2FD3A 4BVXA 4J56E 4MJBA 3MWHA 3KGKA 4WKWA 3M1GA 4X4JA 3ME8A 6GSXA 3IA1A 1G7EA 4JR4A 4TVEA 5ELAA 5GAPD 1TU7A 4HJ2A 3FR3A 4MPFA 5BMUA 1WE0A 4PGTA 4HS1A 2LRTA 2MZCA 2K6VA 3DVXA 2EC4A 5G1KA 2PMTA 2NBSA 1VF3A 3P2AA 1WRYA 2CX3A 3HCZA 1FVJA 1OAZA 2HSHA 1MDKA 4KE3A 1S3AA 1HNBA 4XS4B 4YH2A 4P3YB 3EU4A 2L6DA 3LWAA 2F3MA 2XPDA 2QSIA 2LQOA 4QL9A 3GRXA 4DSRA 2LRCA 5FT3A 1GLQA 1YF1A 4KX4A 3IBHA 2XC2A 5J4UA 4AKHA 1RW1A 5IO0A 1S3CA 1SJZA 4ICYA 5CAXA 4BWSA 2HSNB 5E59A 5J5NA 3HYPA 5D8IA 3WGDA 3ZREA 4DVCA 3AY8A 3BCKA 2EFDA 5G5FA 2MBTA 2E0QA 1R26A 2GSTA 2PVQA 3HD5A 1AXDA 3QFBC 3KTBA 2ALBA 3GL3A 1XOBA 1SKSB 3KP8A 1O8XA 1K0DA 5CREA 1THXA 3LW9A 4CW9A 3O76A 5LNKe 1Y1UA 4ZL8A 1H75A 4TKYA 5E4WA 1M9BA 3CBUA 4N3ZA 3GKXA 2YOIA 3UMAA 3IE3A 2C0FA 4QL7A 2B7KA 1TXXA 2H72A 10GSA 2YWMA 3KM6A 3RDWA 1SL2B 1BJXA 3DGQA 1W4VA 4V2MA 1GSQA 4WR4A 1UC7A 1FO5A 4TOPA 5ECPB 3UOMA 4FQUA 1GL8A 2CA8A 2OJLA 1BG5A 3PH9A 4BVYA 3F4SA 2R3XA 1QFNA 1DSBA 4PURA 4PTSA 2HSYA 1KNGA 3ZLPA 3VI7A 1J08A 3QOUA 2IMFA 2YJ7A 1I9DA 2HYXA 5D9TA 4NV2A 2LS5A 1TRVA 1OKTA 1F37A 4ZB8A 5D9WA 1EP7A 2K9FA 2X64A 20GSA 1T7PB 1U6TA 1F2EA 1N2AA 2OACA 4X43A 4USSA 2CX4A 3TJGA 1Z5YE 1GNEA 3EVIA 1TK5B 1OC3A 4MF7A 3JCML 5A34B 1NHOA 2WDUA 3L78A 4ZL9A 4GLTA 2DSAA 4Z2TA 1U88A 2FHEA 1B48A 3F6FA 1PL2A 4ZXGA 2C80A 3M9JA 4GF0A 5GZZB 6GSYA 3L9VA 1TK0B 5J3RA 1BG1A 2H01A 2VCTA 1K0NA 1XVQA 4KF9A 4POKA 1OVNA 1LJRA 3VI5A 1Y25A 4I2UA 1UN2A 1MDIA 5J4VA 1PA3A 3ZIVA 1FW1A 1UVZA 2HSMB 2BMXA 4OCEA 2WCIA 5HFIA 3D5JA 4ID0A 2EFCA 5J41A 4D73A 2AHEA 2H76A 4W66A 1V2AA 4ZBDA 2L5OA 3R2QA 4ZB7A 1IYIA 1V58A 4O32A 4IQAA 4LMWA 4AKIA 2X99A 5D96A 1YEPA 1XW9A 1XCCA 2G0FA 4HI7A 2ON5A 1THOA 1A2LA 1FHEA 2FA4A 4JBBA 1J9BA 4EXJA 3ERFA 3D6IA 2JZSA 5ECKB 2H71A 3D4MA 3EYTA 1E2YA 1ERVA 3ZMKA 1M0UA 2MMOA 1B9YC 3LXTA 2KP2A 2FWHA 3ZFLA 4KGIA 4OCFA 2HZFA 2L5LA 2CVDA 5INYA 2CZ2A 1EOHA 2P0GA 3TCOA 3FEUA 2L57A 2RM5A 5JCGA 2N5BA 3A3TA 1ERWA 1V9WA 3GKMA 4K7NA 2DMLA 1X0RA 3TKSE 3C1SA 2FY6A 1QXHA 5AIXA 1WOUA 2PERA 3ERGA 2ES7A 4V2NA 1V40A 5A1NA 2I9HA 5B6MA 3FY7A 4V1Ap 3DD3A 3FR6A 3TJFA 1AC1A 3Q19A 3CWGA 2J23A 1K0BA 1KEBA 2P31A 1CQGA 1BYEA 3QR6A 4E68A 2H0GA 1ML6A 4YKGA 2IIYA 1G0TA 2OBKA 3HXSA 1TU8A 2H30A 1USBA 2DJKA 3GH6A 5IMFA 2DBCA 17GSA 1BQ7A 3MIXA 4J2FA 1GTUA 4QMKA 4EL1A 1GULA 2XHFA 2YJHA 1AIUA 5IOWA 2L6CA 1Q4JA 2BTOT 4K5SA 2GS3A 5DAKB 4HQZA 3H93A 3GA4A 4K7IA 2B1KA 5KEJA 1VRSD 1JZRA 3TRXA 5AIVA 3D4TA 2JL4A 1SD9A 1R7HA 4K9ZA 2QGVA 3PPUA 2H73A 2LJRA 3F3QA 4GRFA 3IR4A 6GSTA 5HR3A 1HQOA 2YCDA 2FNOA 5JCWA 3Q18A 4Z2RA 3RAZA 1XWBA 2C0EA 5DCGA 1OKDA 4IJIA 2PN8A 1WMJA 4V1Ag 1GRXA 4MDCA 3LFLA 2H1LA 3H8QA 1O6JA 3MYDA 4WR5A 1VGLA 2VL2A 2EIRA 1KTEA 2O85A 3J7Yk 2YANA 3TRPA 2VL9A 3ISOA 2IMEA 3M8NA 5ECHB 1SD8A 3KXOA 3PINA 1PX6A 1T1VA 2LEGA 1BX9A 4AGSA 1DBYA 2VCWA 5CNWA 1ZGNA 3GNJA 4MZWA 3EU3A 2X49A 5KOWA 3GKKA 3LYPA 2O87A 2HRKA 3E9JB 5IIZA 4F0CA 4N11A 2C4JA 3QAGA 4MJAA 5HQPA 1X5CA 5ID2A 2VIMA 4F0BA 2DJ2A 2HZEA 5DALB 3I9V2 4GQCA 1TK8B 4HZ4A 5A4UA 1GTIA 4XCSA 1SU9A 5G1LA 2VM2A 3NZNA 4KB3A 4ZILA 2CAIA 1EOGA 1BAYA 3J7Yb 3UARA 2ZUPA 3BOAA 3BBYA 2IWTA 3P8WA 1ZYNA 4ISDA 1GSDA 4NAXA 1JLVA 4CDOA 1DE2A 3RHCA 3LG6A 4PUAA 2O5VA 1SVOA 2H19A 1QMVA 2LNSA 2OA7A 1FVKA 3MSZA 3KIJA 3ZTLA 5D9XA 1Z7RA 2GT6A 2MYGA 4TR1B 2V41A 1M2DA 2R2JA 2V1MA 3TRQA 1PN9A 5ENUA 1AAZA 4ZB6A 1R4WA 2C0GA 3ZYWA 2IFQA 2DKIA 2JACA 3SBCA 1SYRA 3HZ4A 1WP0A 5JWQB 2A2SA 2FA8A 2V6KA 1YY7A 5ECQB 2MMNA 2AYTA 4MA9A 1O85A 4L5OA 3ME7A 4G0LA 3G7YA 3Q74A 4EIQA 4AKXB 2DJ0A 3UL3A 4BPYA 1IYHA 3H79A 5ECMB 3VFIA 4EDZA 3KH7A 4O92A 4OFMA 1GSYA 4K6XA 2K8SA 3H4KA 1K0OA 1B4PA 2C3QA 1O73A 4FYCA 2B1LA 2RM6A 5CYYA 5DJMA 3APQA 4OO5A 3WGXA 3TKSA 1TP9A 2O7KA 1OE8A 1ON4A 4JE1A 4BVXB 4ECJA 3FZAA 3GTUA 1TJDA 1F3BA 1GNWA 3MAKA 5LCZA 1GWCA 1OYJA 5KN2A 4I2TA 2IL3A 4WXTA 4K8MA 1PGTA 2O8VB 5DJLA 5IMAA 2I1UA 2H75A 2HSNA 3NOFA 2KP1A 4XHMA 1BEDA 7GSSA 5G30A 3G9BA 3PGTA 3D0ZA 14GSA 3HHVA 2JSYA 2H1GA 4KCAA 1XW5A 4ZB9A 2FCHA 4KUNA 2DIYA 2QA2A 5HR0A 2H0IA 4K0NA 5JCUA 3LGCA 2EFEA 2YWNA 3KP9A 5A4VA 2PWJA 2H66A 4OWYA 3P7XA 1DE1A 2F8FA 4IKHA 4CY8A 3I6AA 5ECIB 1U3IA 2OADA 3A5IA 4IBPA 3P90A 4KAEA 1V98A 4A5PA 3TGZA 3L9UA 4KDUA 5B6NA 2CZ3A 1XBSA 5LD0A 1EV9A 4G19A 4EO3A 3GH9A 1GLPA 2CAQA 2LUSA 3N9JA 5CRWA 4WF5A 3CSIA 1A0RP 5IMZA 4GQFA 1LBKA 1YQ1A 1O81A 5COHA 2A2RA 2O89A 3TOUA 1SKWB 2TRXA 4GCIA 3HKRA 4KSMA 3QDNA 3GV1A 4GSSA 3WGEA 4IELA 12GSA 3GX8A 5DVBA 2C0DA 4IN0A 3VLNA 3FK8A 4LLRA 5J9BA 3KTLA 4JZQA 3QCPA 2X8HA 1B9XC 1EEMA 5HFGA 1E6BA 5J4YA 4KA0A 5DQYA 6GSVA 4N0VA 2KUCA 4K5RA 2HI7A 4GDFA 3FR9A 4DSSB 1TXUA 4PQHA 3LQ7A 1RK4A 4MJEA 4I97A 3GMFA 3BJ5A 3O3TA 4POLA 2YPMA 4O5QA 4OFTA 3F4RA 1XWCA 3DXBA 3W8JA 1EV4A 2PGTA 3CMIA 1GUHA 1Y6EA 3DYRA 2AB6A 5A5KA 2H70A 4FO5A 4MNNA 2NDOA 3S9FA 4BVYB 5A34A 5IMCA 4HDEA 3CRTA 1A2MA 3V1WA 4Q5RA 3OR5A 2L4CA 4RQRA 1SK0A 4LA1A 2ZCTA 1K3LA 3IAM2 5GSSA 2WFCA 4MLYA 5J9CA 2R5GA 5IQYA 4IQ1A 2E2MA 2H8LA 22GSA 4Z2UA 4I5QA 3W6GA 3F3RA 1EGOA 2DJJA 4L5LA 3KH9A 2VLTA 4RI6A 5CO3A 2OE0A 2GDRA 3F4TA 3F8UA 4PUFC 2B3SA 2ZNMA 1U87A 3U5RE 2GQMA 1F6MC 2FUG2 1G6YA 4ACSA 3TB2A 3GSTA 5AGYA 4V2LA 2IMKA 2GVPA 4G2EA 1A0FA 1SJIA 3QMXA 3FZ5A 2OBIA 3VWXA 2RLIA 1WJKA 2QC7A 2N5FA 3H1NA 1XZOA 1MDJA 2P5RA 3K8NA 4HOJA 2HRNA 4J57E 4YQMA 1M2AA 1XOAA 3TU3B 2E2GA 3HY2A 4LL4B 3KMNA 4D73B 2FWGA 1PL1A 3GN3A 3KD0A 1ZOFA 3G7JA 4ZIJA 1VF1A 4FYUA 3KEBA 4AKGA 2MMAA 4TXOA 2V2GA 4YAVA 1N8JA 1YVLA 3O6TA 5EY6A 2YV9A 3UEMA 4IGJA 2DJ3A 1ZZYA 4RI7A 4KCEA 1ZYEA 1JZDA 1SK2A 4WF4A 4I8BA 3SWLA 1YDKA 3APSA 1OC9A 1A8YA 2NPBA 3VWWA 6GSUA 3HVVA 2VCZA 2N5AA 1HNAA 4WETA 6GSSA 4FH8A 5AISA 1XIYA 4TW5A 4G0KA 3RBTA 2KHPA 2H6ZA 2REMA 4MH3A 3FYGA 1LU4A 2HNLA 1TI3A 4H86A 4OO4A 2XBIA 4TR4A 3IC4A 3F9UA 3A2VA 4O7HA 1PD21 2A4VA 2D2ZA 4BL7A 3QPMA 4NMUA 3FZ9A 5F06A 5DAKA 1Z6NA 3ZL5A 3VWVA 1PRXA 2VAFA 2RUEA 3I43A 5F07A 3GUSA 3D21A 4EE0A 1SKRB 3HDCA 4MZBA 2XPEA 2PUKC 2DMMA 4G9HA 4EKZA 13GSA 2GSRA 2TIRA 3C73A 3LSZA 4K7OA 1WPIA 1MTCA 2LV3A 1PMTA 1QUWA 3QD9A 1GP1A 3IOSA 4XIHA 3KJYA 1H4OA 2DLXA 4ECIA 2CQ9A 1X9MB 2YP6A 3ED3A 2AAWA 6GSWA 4ECBA 3WYWA 2VL3A 3UVHA 3QAVA 2B5EA 5ECNB 1R5AA 1QGVA 4GSNA 1XWKA 5ECRB 3ERWA 4POMA 2VM1A 4CY6A 5G5EA 3FRCA 5F05A 1A24A 2UZ8A 3U6VA 3E0UA 4GXZA 2GT5A 2X4AA 1HNCA 1SYXA 1TRWA 1XFLA 1T4YA 2M46A 1QQ2A 4YQVA 5DDLA 2M80A 2R6KA 5EPFA 4WBJA 8GSSA 3CXGA 1K0MA 1XWGA 3IHGA 3HJPA 4MPGA 3US3A 1M7TA 1M99A 1TI1A 3RHBA 4O5UA 4KDXA 4MF6A 2F51A 1I5GA 1T4ZA 2LRNA 5A5HA 2F8AA 2M72A 2FGXA 5ELGA 5D73A 1AW9A 4DSQA 4MZCA 2FWEA 4X1UA 3TDGA 2X8GA 2VL2C 2HFDA 3CTGA 3QFAC 2WGRA 4L0WA 5CP1A 2HRKB 3FZ4A 4YQUA 3EMXA 3C71A 1GUKA 1V57A 2AJQB 4Q5NA 5ID2B 2H1BA 4MK3A 2B5XA 5KN3A 1JZOA 1MD4A 3MNGA 3WD6A 3FW2A 2XBQA 5JWRB 2YZHA 2HE3A 1O7UA 2VCVA 2FLSA 1XPVA 4ILFA 4RQXA 2YNXA 3DMLA 1PX7A 3UAPA 3UVTA 3ZFBA 5CRDA 5H5SA 2I3YA 1ERTA 3BD2A 4IHUA 1EP8A 2DC5A 2VUPA 2LKUA 2GTUA 1EGRA 2A4HA 4XRAA 2VD1A 3TKRA 1YJ6A 3DIEA 3M0FA 1VF2A 3PR8A 4AJ8A 5B7CA 2IJYA 2CT6A 4CHSA 5BRTA 3DKSA 2DIZA 3UBKA 3EE2A 3RPPA 4K0GA 4EVMA 1BF5A 4KH7A 2VLUA 1GUMA 4PQ1A 1YKAA 5A4WA 5D9VA 2HRAA 3TOTA 4XS4A 2VD0A 3WT2A 4EUYA 3ZIJA 3EWLA 5ECSA 3D22A 1PN0A 5JWOB 1EZKA 1NM3A 3GX0A 4F9ZA 3M9KA 2L4QA 3IK7A 5HR2A 2WB9A 2AUVA 2PU9C 5HFKA 1G7OA 5BMUB 4KW6A 1TW9A 2RIIA 2JU5A 1TDIA 3RPNA 2Z9SA 1NW2A 2P5QA 3G7IA 5ABRA 3WT1A 3DWVA 3HJOA 3F0IA 3KZQA 1AQVA 3IPZA 4TR0A 4PXOA 4AJ6A 2G2QA 1R5PA 16GSA 2PBJA 1F9MA 3GTUB 1XVWA 4YAPA 5EVOA 4RUVA 1HD2A 2VOCA 2GSSA 5B8AA 4K2XA 4OD7A 3L4NA 3CRUA 3TKSC 4AI6A 3E3EA 2B6MA 2HLSA 1NSWA 2OE1A 4TXVA 1X9SB 1ACVA 1WIKA 2VO4A 3DRNA 1ERUA 3IC8A 3IHQA 3Q6OA 4WBRD 2R0CA 1TOFA 2YN1A 3TKQA 1G6WA 3FHKA 1GSSA 2TRCP 4QQ7A 2FWFA 2EIOA 2DKHA 4NWYA 1Q98A 1GH2A 5DQSA 2JZTA 3GIXA 2K18A 4TRXA 1SVMA 1A2JA 4EDYA 2GQKA 3CYNA 4YKFA 2E7PA 4PQIA 1MD3A 2J9HA 3VPQA 1URMA 5KOXA 5HR1A 3ZVJD 3BCIA 1JZWA 2DJ1A 2GLRA 1JLWA 1ZL9A 1GSFA 2BJXA 1O8WA 2CV4A 1XW6A 1AQXA 4G10A 4MH2A 1T00A 4DSSA 3VURA 3C8EA 3GYKA 4MJCA 1X5EA 2B5YA 4XTSA 1X5DA 1MEKA 1UA5A 4MP4A 2OKAA 5IOXA 1ZCPA 2JZRA 4HZ2A 2K8VA 1YKCA 4ECCA 3GFKA 5IM9A 2GGTA 1S3DA 2QA1A 3VWUA 3HVSA 4HEA2 4IW9A 5IMVA 3A2WA 3MDKA 1TTZA 3KCMA 1U3AA 4E8HA 3UBLA 1NHYA 3I69A 2LQQA 4KSOA 1PKWA 2VKZG 1AUCA 2JSZA 2C1YA 2LNTA 11GSA 2OE3A 2YWOA 3TJKA 19GSA 1K0AA 1SVLA 2GSQA 1ZMAA 5IPGA 3IDVA 2YWIA 1K3YA 4LL1B 4EC0A 5H5RA 1SENA 1M9AA 4PNGA 4NV5A 2ON7A 3ZVJA 4IS0A 5KN0A 5AN1A 2EIQA 2R0GA 2H1AA 1YEXA 1SL0B 2LJAA 2LJKA 2IPAA 5C00A 2C3TA 1GSEA 2MBSA 4I6XA 2HSMA 3HMJG 4G01A 1ST9A 2V6OA 4F03A 1YF0A 2WRTA 4K2DA 2WJUA 1XXUA 3LEFA 4HJMA 3QAWA 4ML1A 4IP6A 5CRHA 3EINA 4O5RA 4N0ZA 1TRSA 3CSJA 1ILOA 2H6XA 4OFNA 5EL8A 4Q5QA 3M3MA 5IO2A 1FG4A 5IMDA 2YV7A 4Q5FA 2NTOA 4XS1A 5G31A 2NVLA 2GZZA 3F6DA 3IK9A 3CSHA 4FIWA 2B7JA 4HU7A 2WULA 3GSSA 4MCUA 1A8LA 5L71A 5DCHA 2JADA 3FMWA 4IVFA 2L59A 2EFHA 4GTUA 4AF2A 4ZL7A 4L8EA 3R3EA 4G0IA 1Z3EA 3EPTA 3F63A 4EIPA 4MMMA 4MABA 2HRFA 3HA9A 4JRRA 2VCQA 4GSTA 3KMOA 4LMVA 3VK9A 4DEJA 1EEJA 5ECOB 5DBQA 3IXRA 5H5QA 2V32A 2H74A 3GHAA 2VLVA 2C3NA 2WS2A 2KLXA 1EWXA 3VPTA 4N30A 1OC8A 2RUFA 5ECLB 4TXOB 3GKNA 3CTFA 3IV4A 3HZ8A 3L0HA 2AV4A 3A2XA 1HYUA 1FB6A 3A5WA 3NIVA 3TJJA 5IPHA 4PNFA 1N25A 4ULXA 1ZYQB 2LTKA 4N10A 1SJ6A 3UJ1A 1TRUA 3C7MA 2HQTA 4HUAA 1OC9B 4TN8A 2R37A 1QK8A 4PX1A 2GQLA 4FYBA 1SL1B 4K1FA 3EC3A 4AJ7A 1Z6MA 1RQMA 4L0UA 1SK1A 4IJ3A 1J0FA 4NHWA 5A1NB 1JHBA 3HJMA 3ZRDA 3GL5A 2MMZA 5FWGA 1VF4A 5J40A 2C8UA 3HVXA 3TJBA 3UIWA 1A23A 1YZXA 18GSA 4E8EA 4BL7B 3LJRA 4MF5A 4F82A 2QKEA 3DEXA 1T3BA 3IAS2 3FKFA 2H0HA 2UV8G 2PPTA 4JU5A 2F9SA 2X8CA 2LSTA 4POBA 1B8XA 3ZMLA 9GSSA 4HU9A 2KOKA 5B8BA 3LYKA 1ZYPA 2I81A 1B4QA 4JEDA 2OT3A 1XWAA 3EURA 5J47A 5F0GA 3ZZXA 4HQSA 4ML6A 4XS6A 2GZPA 1FB0A 4X0XA 4TR3A 1W89A 2HXKA 4BA7A 1K0CA 4ZBBA 3C1RA 3LORA 3IRAA 1DUGA 2R0PA 4ZBAA 5DALA 1WWJA 1M2BA 2R4VA 4BWQA 1PQNA 4Z7XA 2IMDA 2YZUA 1Z9HA 4NXIA 4GWRA 5CRGA 2H6YA 1Z7PA 1T8EB 4IP1A 1GSUA 1K3OA 3DVWA 1KBNA 4WEYA 5KN1A 3TUEA 2CVKA 4XRDA 4NPBA 1CQHA 4TR1A 5GSTA 1PSQA 1FOVA 1X9WB 2VCXA 2HZEB 2CVBA 5A5HB 5D93A 2GZYA 1GTBA 2WZ9A 2H1DA 2IMIA 5G2ZA 4EF0A 1PKZA 2HT9A 1ABAA 4JR6A 5FHIA 3W8SA 1F3AA 3ZITA 5C04A 3GURA 1OE7A 3EMPA 2A2PA 1FOHA 1GTAA 4KDYA 3N5OA 4NHZA 4OMVA 1C72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKP A;  3LXZ A;  4KND A;  2I4A A;  1FAA A;  2IN3 A;  1TKD B;  5F8B A;  1JFU A;  2PVO C;  4F2I A;  2IFQ B;  1AQW A;  5GAN D;  3APO A;  3L9S A;  2FD3 A;  4BVX A;  4J56 E;  4MJB A;  3MWH A;  3KGK A;  4WKW A;  3M1G A;  3ME8 A;  6GSX A;  3IA1 A;  1G7E A;  4JR4 A;  4TVE A;  5ELA A;  5GAP D;  1TU7 A;  4HJ2 A;  3FR3 A;  4MPF A;  5BMU A;  1WE0 A;  4PGT A;  4HS1 A;  2LRT A;  2MZC A;  2K6V A;  3DVX A;  2EC4 A;  5G1K A;  2PMT A;  2NBS A;  1VF3 A;  3P2A A;  1WRY A;  2CX3 A;  3HCZ A;  1FVJ A;  1OAZ A;  2HSH A;  1MDK A;  4KE3 A;  1S3A A;  1HNB A;  4XS4 B;  4YH2 A;  4P3Y B;  3EU4 A;  2L6D A;  3LWA A;  2F3M A;  2XPD A;  2QSI A;  2LQO A;  4QL9 A;  3GRX A;  4DSR A;  2LRC A;  5FT3 A;  1GLQ A;  1YF1 A;  4KX4 A;  3IBH A;  2XC2 A;  5J4U A;  1RW1 A;  5IO0 A;  1S3C A;  1SJZ A;  5CAX A;  4BWS A;  2HSN B;  5E59 A;  5J5N A;  3HYP A;  5D8I A;  3WGD A;  3ZRE A;  4DVC A;  3AY8 A;  3BCK A;  5G5F A;  2MBT A;  2E0Q A;  1R26 A;  2GST A;  2PVQ A;  3HD5 A;  1AXD A;  3QFB C;  3KTB A;  2ALB A;  3GL3 A;  1XOB A;  1SKS B;  3KP8 A;  1O8X A;  1K0D A;  5CRE A;  1THX A;  4CW9 A;  3O76 A;  5LNK e;  4ZL8 A;  1H75 A;  4TKY A;  5E4W A;  1M9B A;  3CBU A;  3GKX A;  2YOI A;  3UMA A;  3IE3 A;  2C0F A;  4QL7 A;  2B7K A;  1TXX A;  2H72 A;  10GS A;  2YWM A;  3KM6 A;  3RDW A;  1SL2 B;  1BJX A;  3DGQ A;  1W4V A;  4V2M A;  1GSQ A;  4WR4 A;  1UC7 A;  1FO5 A;  4TOP A;  5ECP B;  3UOM A;  4FQU A;  1GL8 A;  2CA8 A;  2OJL A;  1BG5 A;  3PH9 A;  4BVY A;  3F4S A;  2R3X A;  1QFN A;  1DSB A;  4PUR A;  4PTS A;  2HSY A;  1KNG A;  3ZLP A;  3VI7 A;  1J08 A;  3QOU A;  2IMF A;  2YJ7 A;  1I9D A;  2HYX A;  5D9T A;  4NV2 A;  2LS5 A;  1TRV A;  1OKT A;  1F37 A;  4ZB8 A;  5D9W A;  1EP7 A;  2K9F A;  2X64 A;  20GS A;  1T7P B;  1U6T A;  1F2E A;  1N2A A;  2OAC A;  4X43 A;  4USS A;  2CX4 A;  3TJG A;  1Z5Y E;  1GNE A;  3EVI A;  1TK5 B;  1OC3 A;  4MF7 A;  3JCM L;  1NHO A;  2WDU A;  3L78 A;  4ZL9 A;  4GLT A;  2DSA A;  1U88 A;  2FHE A;  1B48 A;  3F6F A;  1PL2 A;  4ZXG A;  2C80 A;  3M9J A;  4GF0 A;  5GZZ B;  6GSY A;  3L9V A;  1TK0 B;  5J3R A;  2H01 A;  2VCT A;  1K0N A;  1XVQ A;  4KF9 A;  4POK A;  1OVN A;  1LJR A;  3VI5 A;  1Y25 A;  4I2U A;  1UN2 A;  1MDI A;  1PA3 A;  3ZIV A;  1FW1 A;  1UVZ A;  2HSM B;  2BMX A;  4OCE A;  2WCI A;  5HFI A;  3D5J A;  4ID0 A;  5J41 A;  4D73 A;  2AHE A;  2H76 A;  1V2A A;  4ZBD A;  2L5O A;  3R2Q A;  1IYI A;  1V58 A;  4O32 A;  4IQA A;  4LMW A;  2X99 A;  5D96 A;  1YEP A;  1XW9 A;  1XCC A;  2G0F A;  4HI7 A;  2ON5 A;  1THO A;  1A2L A;  1FHE A;  2FA4 A;  4JBB A;  1J9B A;  4EXJ A;  3ERF A;  3D6I A;  2JZS A;  5ECK B;  2H71 A;  3D4M A;  3EYT A;  1E2Y A;  1ERV A;  3ZMK A;  1M0U A;  2MMO A;  1B9Y C;  3LXT A;  2KP2 A;  2FWH A;  3ZFL A;  4KGI A;  4OCF A;  2HZF A;  2L5L A;  2CVD A;  5INY A;  2CZ2 A;  1EOH A;  2P0G A;  3TCO A;  3FEU A;  2L57 A;  2RM5 A;  5JCG A;  2N5B A;  3A3T A;  1ERW A;  1V9W A;  3GKM A;  4K7N A;  2DML A;  1X0R A;  3TKS E;  3C1S A;  2FY6 A;  1QXH A;  5AIX A;  1WOU A;  2PER A;  3ERG A;  2ES7 A;  4V2N A;  1V40 A;  2I9H A;  5B6M A;  3FY7 A;  4V1A p;  3DD3 A;  3FR6 A;  3TJF A;  1AC1 A;  3Q19 A;  2J23 A;  1K0B A;  1KEB A;  2P31 A;  1CQG A;  1BYE A;  3QR6 A;  2H0G A;  1ML6 A;  2IIY A;  1G0T A;  2OBK A;  3HXS A;  1TU8 A;  2H30 A;  1USB A;  2DJK A;  3GH6 A;  5IMF A;  2DBC A;  17GS A;  1BQ7 A;  4J2F A;  1GTU A;  4EL1 A;  1GUL A;  2XHF A;  2YJH A;  1AIU A;  5IOW A;  2L6C A;  1Q4J A;  2BTO T;  2GS3 A;  5DAK B;  4HQZ A;  3H93 A;  3GA4 A;  4K7I A;  2B1K A;  5KEJ A;  1VRS D;  1JZR A;  3TRX A;  5AIV A;  3D4T A;  2JL4 A;  1SD9 A;  1R7H A;  4K9Z A;  2QGV A;  3PPU A;  2H73 A;  2LJR A;  3F3Q A;  4GRF A;  3IR4 A;  6GST A;  5HR3 A;  1HQO A;  2YCD A;  2FNO A;  5JCW A;  3Q18 A;  3RAZ A;  1XWB A;  2C0E A;  5DCG A;  1OKD A;  4IJI A;  2PN8 A;  1WMJ A;  4V1A g;  1GRX A;  4MDC A;  3LFL A;  3H8Q A;  1O6J A;  4WR5 A;  1VGL A;  2VL2 A;  2EIR A;  1KTE A;  2O85 A;  3J7Y k;  2YAN A;  3TRP A;  2VL9 A;  3ISO A;  2IME A;  3M8N A;  5ECH B;  1SD8 A;  3KXO A;  3PIN A;  1PX6 A;  1T1V A;  2LEG A;  1BX9 A;  4AGS A;  1DBY A;  2VCW A;  5CNW A;  1ZGN A;  3GNJ A;  4MZW A;  3EU3 A;  3GKK A;  3LYP A;  2O87 A;  2HRK A;  3E9J B;  5IIZ A;  4F0C A;  4N11 A;  2C4J A;  3QAG A;  4MJA A;  5HQP A;  1X5C A;  5ID2 A;  2VIM A;  4F0B A;  2DJ2 A;  2HZE A;  5DAL B;  3I9V 2;  4GQC A;  1TK8 B;  4HZ4 A;  5A4U A;  1GTI A;  4XCS A;  1SU9 A;  5G1L A;  2VM2 A;  3NZN A;  4KB3 A;  4ZIL A;  2CAI A;  1EOG A;  1BAY A;  3J7Y b;  3UAR A;  2ZUP A;  3BOA A;  3BBY A;  2IWT A;  3P8W A;  4ISD A;  1GSD A;  4NAX A;  1JLV A;  4CDO A;  1DE2 A;  3RHC A;  3LG6 A;  4PUA A;  2H19 A;  1QMV A;  2LNS A;  2OA7 A;  1FVK A;  3MSZ A;  3KIJ A;  3ZTL A;  5D9X A;  1Z7R A;  2GT6 A;  2MYG A;  4TR1 B;  2V41 A;  1M2D A;  2R2J A;  2V1M A;  3TRQ A;  1PN9 A;  5ENU A;  1AAZ A;  4ZB6 A;  1R4W A;  2C0G A;  3ZYW A;  2IFQ A;  2JAC A;  3SBC A;  1SYR A;  3HZ4 A;  1WP0 A;  5JWQ B;  2A2S A;  2FA8 A;  2V6K A;  1YY7 A;  5ECQ B;  2MMN A;  2AYT A;  4MA9 A;  1O85 A;  4L5O A;  3ME7 A;  4G0L A;  3G7Y A;  3Q74 A;  2DJ0 A;  3UL3 A;  4BPY A;  1IYH A;  3H79 A;  5ECM B;  3VFI A;  4EDZ A;  3KH7 A;  4O92 A;  4OFM A;  1GSY A;  4K6X A;  2K8S A;  3H4K A;  1K0O A;  1B4P A;  2C3Q A;  1O73 A;  4FYC A;  2B1L A;  2RM6 A;  5CYY A;  5DJM A;  3APQ A;  4OO5 A;  3WGX A;  3TKS A;  1TP9 A;  2O7K A;  1OE8 A;  1ON4 A;  4JE1 A;  4BVX B;  4ECJ A;  3FZA A;  3GTU A;  1TJD A;  1F3B A;  1GNW A;  3MAK A;  5LCZ A;  1GWC A;  1OYJ A;  5KN2 A;  4I2T A;  2IL3 A;  4WXT A;  4K8M A;  1PGT A;  2O8V B;  5DJL A;  5IMA A;  2I1U A;  2H75 A;  3NOF A;  4XHM A;  2KP1 A;  1BED A;  7GSS A;  5G30 A;  3G9B A;  3PGT A;  3D0Z A;  14GS A;  3HHV A;  2JSY A;  2H1G A;  4KCA A;  1XW5 A;  4ZB9 A;  2FCH A;  4KUN A;  2DIY A;  5HR0 A;  2H0I A;  4K0N A;  5JCU A;  3LGC A;  2YWN A;  3KP9 A;  5A4V A;  2PWJ A;  2H66 A;  4OWY A;  3P7X A;  1DE1 A;  2F8F A;  4IKH A;  3I6A A;  5ECI B;  1U3I A;  2OAD A;  4IBP A;  3P90 A;  4KAE A;  1V98 A;  3TGZ A;  3L9U A;  4KDU A;  5B6N A;  2CZ3 A;  1XBS A;  5LD0 A;  1EV9 A;  4G19 A;  4EO3 A;  3GH9 A;  1GLP A;  2CAQ A;  2LUS A;  3N9J A;  5CRW A;  4WF5 A;  3CSI A;  1A0R P;  5IMZ A;  4GQF A;  1LBK A;  1YQ1 A;  1O81 A;  5COH A;  2A2R A;  2O89 A;  3TOU A;  1SKW B;  2TRX A;  4GCI A;  3HKR A;  4KSM A;  3QDN A;  3GV1 A;  4GSS A;  3WGE A;  4IEL A;  12GS A;  3GX8 A;  5DVB A;  2C0D A;  4IN0 A;  3VLN A;  3FK8 A;  4LLR A;  5J9B A;  3KTL A;  4JZQ A;  3QCP A;  2X8H A;  1B9X C;  1EEM A;  5HFG A;  1E6B A;  4KA0 A;  5DQY A;  6GSV A;  4N0V A;  2KUC A;  2HI7 A;  3FR9 A;  4DSS B;  4PQH A;  3LQ7 A;  1RK4 A;  4MJE A;  4I97 A;  3GMF A;  3BJ5 A;  3O3T A;  4POL A;  2YPM A;  4OFT A;  3F4R A;  1XWC A;  3DXB A;  3W8J A;  1EV4 A;  2PGT A;  3CMI A;  1GUH A;  1Y6E A;  3DYR A;  2AB6 A;  5A5K A;  4FO5 A;  2H70 A;  2NDO A;  3S9F A;  4BVY B;  5IMC A;  4HDE A;  3CRT A;  1A2M A;  3V1W A;  4Q5R A;  3OR5 A;  2L4C A;  4RQR A;  1SK0 A;  4LA1 A;  2ZCT A;  1K3L A;  3IAM 2;  5GSS A;  2WFC A;  4MLY A;  5J9C A;  2R5G A;  5IQY A;  4IQ1 A;  2E2M A;  2H8L A;  22GS A;  4I5Q A;  3W6G A;  3F3R A;  1EGO A;  2DJJ A;  4L5L A;  3KH9 A;  2VLT A;  4RI6 A;  5CO3 A;  2OE0 A;  2GDR A;  3F4T A;  3F8U A;  4PUF C;  2B3S A;  2ZNM A;  1U87 A;  3U5R E;  2GQM A;  1F6M C;  2FUG 2;  1G6Y A;  4ACS A;  3TB2 A;  3GST A;  5AGY A;  4V2L A;  2IMK A;  2GVP A;  4G2E A;  1A0F A;  1SJI A;  3QMX A;  3FZ5 A;  2OBI A;  3VWX A;  2RLI A;  1WJK A;  2QC7 A;  2N5F A;  3H1N A;  1XZO A;  1MDJ A;  2P5R A;  3K8N A;  4HOJ A;  2HRN A;  4J57 E;  4YQM A;  1M2A A;  1XOA A;  2E2G A;  3HY2 A;  4LL4 B;  3KMN A;  4D73 B;  2FWG A;  1PL1 A;  3GN3 A;  3KD0 A;  1ZOF A;  3G7J A;  4ZIJ A;  1VF1 A;  4FYU A;  3KEB A;  2MMA A;  4TXO A;  2V2G A;  4YAV A;  1N8J A;  3O6T A;  5EY6 A;  2YV9 A;  3UEM A;  4IGJ A;  2DJ3 A;  1ZZY A;  4RI7 A;  4KCE A;  1ZYE A;  1JZD A;  1SK2 A;  4WF4 A;  4I8B A;  3SWL A;  1YDK A;  3APS A;  1OC9 A;  1A8Y A;  2NPB A;  3VWW A;  6GSU A;  3HVV A;  2VCZ A;  2N5A A;  1HNA A;  4WET A;  6GSS A;  4FH8 A;  5AIS A;  1XIY A;  4TW5 A;  4G0K A;  3RBT A;  2KHP A;  2H6Z A;  2REM A;  4MH3 A;  3FYG A;  1LU4 A;  2HNL A;  1TI3 A;  4H86 A;  4OO4 A;  2XBI A;  4TR4 A;  3F9U A;  3IC4 A;  3A2V A;  4O7H A;  1PD2 1;  2A4V A;  2D2Z A;  4BL7 A;  3QPM A;  4NMU A;  3FZ9 A;  5F06 A;  5DAK A;  1Z6N A;  3ZL5 A;  3VWV A;  1PRX A;  2VAF A;  2RUE A;  3I43 A;  5F07 A;  3GUS A;  3D21 A;  4EE0 A;  1SKR B;  3HDC A;  4MZB A;  2XPE A;  2PUK C;  2DMM A;  4G9H A;  4EKZ A;  13GS A;  2GSR A;  2TIR A;  3C73 A;  3LSZ A;  4K7O A;  1WPI A;  1MTC A;  2LV3 A;  1PMT A;  1QUW A;  3QD9 A;  1GP1 A;  3IOS A;  4XIH A;  3KJY A;  1H4O A;  2DLX A;  4ECI A;  2CQ9 A;  1X9M B;  2YP6 A;  3ED3 A;  2AAW A;  6GSW A;  4ECB A;  3WYW A;  2VL3 A;  3UVH A;  3QAV A;  2B5E A;  5ECN B;  1R5A A;  1QGV A;  4GSN A;  1XWK A;  5ECR B;  3ERW A;  4POM A;  2VM1 A;  5G5E A;  3FRC A;  5F05 A;  1A24 A;  2UZ8 A;  3U6V A;  3E0U A;  4GXZ A;  2GT5 A;  1HNC A;  1SYX A;  1TRW A;  1XFL A;  1T4Y A;  2M46 A;  1QQ2 A;  4YQV A;  5DDL A;  2M80 A;  2R6K A;  5EPF A;  4WBJ A;  8GSS A;  3CXG A;  1K0M A;  1XWG A;  3US3 A;  3HJP A;  4MPG A;  1M7T A;  1M99 A;  1TI1 A;  3RHB A;  4KDX A;  4MF6 A;  2F51 A;  1I5G A;  1T4Z A;  2LRN A;  2F8A A;  2M72 A;  2FGX A;  5ELG A;  5D73 A;  1AW9 A;  4DSQ A;  4MZC A;  2FWE A;  4X1U A;  3TDG A;  2X8G A;  2VL2 C;  2HFD A;  3CTG A;  3QFA C;  2WGR A;  4L0W A;  5CP1 A;  2HRK B;  3FZ4 A;  4YQU A;  3EMX A;  3C71 A;  1GUK A;  1V57 A;  2AJQ B;  4Q5N A;  5ID2 B;  2H1B A;  4MK3 A;  2B5X A;  5KN3 A;  1JZO A;  1MD4 A;  3MNG A;  3WD6 A;  3FW2 A;  2XBQ A;  5JWR B;  2YZH A;  2HE3 A;  1O7U A;  2VCV A;  2FLS A;  1XPV A;  4ILF A;  4RQX A;  2YNX A;  3DML A;  1PX7 A;  3UAP A;  3UVT A;  3ZFB A;  5CRD A;  5H5S A;  2I3Y A;  1ERT A;  3BD2 A;  4IHU A;  1EP8 A;  2DC5 A;  2VUP A;  2LKU A;  2GTU A;  1EGR A;  4XRA A;  2VD1 A;  3TKR A;  1YJ6 A;  3DIE A;  3M0F A;  1VF2 A;  3PR8 A;  4AJ8 A;  5B7C A;  2IJY A;  2CT6 A;  4CHS A;  3DKS A;  2DIZ A;  3UBK A;  3EE2 A;  3RPP A;  4K0G A;  4EVM A;  4KH7 A;  2VLU A;  1GUM A;  4PQ1 A;  1YKA A;  5A4W A;  5D9V A;  2HRA A;  3TOT A;  4XS4 A;  2VD0 A;  3WT2 A;  4EUY A;  3ZIJ A;  3EWL A;  5ECS A;  3D22 A;  5JWO B;  1EZK A;  1NM3 A;  3GX0 A;  4F9Z A;  3M9K A;  2L4Q A;  3IK7 A;  5HR2 A;  2WB9 A;  2AUV A;  2PU9 C;  5HFK A;  1G7O A;  4KW6 A;  1TW9 A;  2RII A;  2JU5 A;  1TDI A;  3RPN A;  2Z9S A;  1NW2 A;  2P5Q A;  3G7I A;  5ABR A;  3WT1 A;  3DWV A;  3HJO A;  3F0I A;  3KZQ A;  1AQV A;  3IPZ A;  4TR0 A;  4PXO A;  4AJ6 A;  2G2Q A;  1R5P A;  16GS A;  2PBJ A;  1F9M A;  3GTU B;  1XVW A;  4YAP A;  5EVO A;  4RUV A;  1HD2 A;  2VOC A;  2GSS A;  5B8A A;  4OD7 A;  3L4N A;  3CRU A;  3TKS C;  3E3E A;  2B6M A;  2HLS A;  1NSW A;  2OE1 A;  4TXV A;  1X9S B;  1ACV A;  1WIK A;  2VO4 A;  3DRN A;  1ERU A;  3IC8 A;  3IHQ A;  3Q6O A;  4WBR D;  1TOF A;  2YN1 A;  3TKQ A;  1G6W A;  3FHK A;  1GSS A;  2TRC P;  4QQ7 A;  2FWF A;  2EIO A;  4NWY A;  1Q98 A;  1GH2 A;  5DQS A;  2JZT A;  3GIX A;  2K18 A;  4TRX A;  1A2J A;  3CYN A;  4EDY A;  2GQK A;  2E7P A;  4PQI A;  1MD3 A;  2J9H A;  3VPQ A;  1URM A;  5HR1 A;  3ZVJ D;  3BCI A;  1JZW A;  2DJ1 A;  2GLR A;  1JLW A;  1ZL9 A;  1GSF A;  2BJX A;  1O8W A;  2CV4 A;  1XW6 A;  1AQX A;  4G10 A;  4MH2 A;  1T00 A;  4DSS A;  3VUR A;  3C8E A;  3GYK A;  4MJC A;  1X5E A;  2B5Y A;  4XTS A;  1X5D A;  1MEK A;  1UA5 A;  4MP4 A;  2OKA A;  5IOX A;  1ZCP A;  2JZR A;  4HZ2 A;  2K8V A;  1YKC A;  4ECC A;  3GFK A;  5IM9 A;  2GGT A;  1S3D A;  5IMV A;  3VWU A;  3HVS A;  4HEA 2;  4IW9 A;  3A2W A;  3MDK A;  1TTZ A;  3KCM A;  1U3A A;  4E8H A;  3UBL A;  1NHY A;  3I69 A;  2LQQ A;  4KSO A;  1PKW A;  1AUC A;  2JSZ A;  2C1Y A;  2LNT A;  11GS A;  2OE3 A;  2YWO A;  3TJK A;  19GS A;  1K0A A;  2GSQ A;  1ZMA A;  5IPG A;  3IDV A;  2YWI A;  1K3Y A;  4LL1 B;  4EC0 A;  5H5R A;  1SEN A;  1M9A A;  4PNG A;  4NV5 A;  2ON7 A;  3ZVJ A;  4IS0 A;  5KN0 A;  5AN1 A;  2EIQ A;  2H1A A;  1YEX A;  1SL0 B;  2LJA A;  2LJK A;  2IPA A;  5C00 A;  2C3T A;  1GSE A;  2MBS A;  4I6X A;  2HSM A;  1ST9 A;  2V6O A;  4F03 A;  1YF0 A;  2WRT A;  4K2D A;  2WJU A;  1XXU A;  3LEF A;  4HJM A;  3QAW A;  4ML1 A;  4IP6 A;  5CRH A;  3EIN A;  4O5R A;  4N0Z A;  1TRS A;  3CSJ A;  1ILO A;  2H6X A;  4OFN A;  5EL8 A;  4Q5Q A;  3M3M A;  5IO2 A;  1FG4 A;  5IMD A;  2YV7 A;  4Q5F A;  2NTO A;  4XS1 A;  5G31 A;  2NVL A;  2GZZ A;  3F6D A;  3IK9 A;  3CSH A;  4FIW A;  2B7J A;  4HU7 A;  2WUL A;  3GSS A;  4MCU A;  1A8L A;  5L71 A;  5DCH A;  2JAD A;  4IVF A;  2L59 A;  4GTU A;  4AF2 A;  4ZL7 A;  4L8E A;  3R3E A;  4G0I A;  1Z3E A;  3F63 A;  4MMM A;  4MAB A;  2HRF A;  3HA9 A;  4JRR A;  2VCQ A;  4GST A;  3KMO A;  4LMV A;  3VK9 A;  4DEJ A;  1EEJ A;  5ECO B;  5DBQ A;  3IXR A;  5H5Q A;  2V32 A;  2H74 A;  3GHA A;  2VLV A;  2C3N A;  2WS2 A;  2KLX A;  1EWX A;  3VPT A;  4N30 A;  1OC8 A;  2RUF A;  5ECL B;  4TXO B;  3GKN A;  3CTF A;  3IV4 A;  3HZ8 A;  3L0H A;  2AV4 A;  3A2X A;  1HYU A;  1FB6 A;  3A5W A;  3NIV A;  3TJJ A;  5IPH A;  4PNF A;  4ULX A;  1ZYQ B;  2LTK A;  4N10 A;  1SJ6 A;  3UJ1 A;  1TRU A;  3C7M A;  2HQT A;  4HUA A;  1OC9 B;  4TN8 A;  2R37 A;  1QK8 A;  4PX1 A;  2GQL A;  4FYB A;  1SL1 B;  4K1F A;  3EC3 A;  4AJ7 A;  1Z6M A;  1RQM A;  4L0U A;  1SK1 A;  4IJ3 A;  1J0F A;  4NHW A;  1JHB A;  3HJM A;  3ZRD A;  3GL5 A;  2MMZ A;  5FWG A;  1VF4 A;  2C8U A;  3HVX A;  3TJB A;  3UIW A;  1A23 A;  1YZX A;  18GS A;  4E8E A;  4BL7 B;  3LJR A;  4MF5 A;  4F82 A;  2QKE A;  3DEX A;  1T3B A;  3IAS 2;  3FKF A;  2H0H A;  2PPT A;  4JU5 A;  2F9S A;  2X8C A;  2LST A;  4POB A;  1B8X A;  3ZML A;  9GSS A;  4HU9 A;  2KOK A;  5B8B A;  3LYK A;  2I81 A;  1B4Q A;  4JED A;  1XWA A;  3EUR A;  5F0G A;  3ZZX A;  4HQS A;  4ML6 A;  4XS6 A;  2GZP A;  1FB0 A;  4X0X A;  4TR3 A;  1W89 A;  2HXK A;  4BA7 A;  1K0C A;  4ZBB A;  3C1R A;  3LOR A;  3IRA A;  1DUG A;  4ZBA A;  5DAL A;  1WWJ A;  1M2B A;  2R4V A;  4BWQ A;  1PQN A;  4Z7X A;  2IMD A;  2YZU A;  1Z9H A;  4NXI A;  4GWR A;  5CRG A;  2H6Y A;  1Z7P A;  1T8E B;  4IP1 A;  1GSU A;  1K3O A;  3DVW A;  1KBN A;  4WEY A;  5KN1 A;  3TUE A;  2CVK A;  4XRD A;  4NPB A;  1CQH A;  4TR1 A;  5GST A;  1PSQ A;  1FOV A;  1X9W B;  2VCX A;  2HZE B;  2CVB A;  5D93 A;  2GZY A;  1GTB A;  2WZ9 A;  2H1D A;  2IMI A;  5G2Z A;  4EF0 A;  1PKZ A;  2HT9 A;  1ABA A;  4JR6 A;  5FHI A;  3W8S A;  1F3A A;  3ZIT A;  5C04 A;  3GUR A;  1OE7 A;  3EMP A;  1GTA A;  4KDY A;  3N5O A;  4NHZ A;  4OMV A;  1C72 A; 
#chains in the Genus database with same CATH topology
 3TKP A;  3LXZ A;  4KND A;  2I4A A;  1FAA A;  2IN3 A;  1TKD B;  5F8B A;  1JFU A;  2PVO C;  4F2I A;  2IFQ B;  1AQW A;  5GAN D;  3APO A;  3L9S A;  2FD3 A;  4BVX A;  4J56 E;  4MJB A;  3MWH A;  3KGK A;  4WKW A;  3M1G A;  4X4J A;  3ME8 A;  6GSX A;  3IA1 A;  1G7E A;  1S3R A;  4JR4 A;  4TVE A;  5ELA A;  5GAP D;  1TU7 A;  4HJ2 A;  3FR3 A;  4MPF A;  5BMU A;  1WE0 A;  4PGT A;  4HS1 A;  2LRT A;  2MZC A;  2K6V A;  3DVX A;  2EC4 A;  5G1K A;  2PMT A;  2NBS A;  1VF3 A;  3P2A A;  1WRY A;  2CX3 A;  3HCZ A;  1FVJ A;  1OAZ A;  2HSH A;  1MDK A;  4KE3 A;  1S3A A;  1HNB A;  4XS4 B;  4YH2 A;  4P3Y B;  3EU4 A;  2L6D A;  3LWA A;  2F3M A;  2XPD A;  2QSI A;  2LQO A;  4QL9 A;  3GRX A;  4DSR A;  2LRC A;  5FT3 A;  1GLQ A;  1YF1 A;  4KX4 A;  3IBH A;  2XC2 A;  5J4U A;  4AKH A;  1RW1 A;  5IO0 A;  1S3C A;  1SJZ A;  4ICY A;  5CAX A;  4BWS A;  2HSN B;  5E59 A;  5J5N A;  3HYP A;  5D8I A;  3WGD A;  3ZRE A;  4DVC A;  3AY8 A;  3BCK A;  2EFD A;  5G5F A;  2MBT A;  2E0Q A;  1R26 A;  2GST A;  2PVQ A;  3HD5 A;  1AXD A;  3QFB C;  3KTB A;  2ALB A;  3GL3 A;  1XOB A;  1SKS B;  2O3E A;  3KP8 A;  1O8X A;  1K0D A;  5CRE A;  1THX A;  3LW9 A;  4CW9 A;  3O76 A;  5LNK e;  1Y1U A;  4ZL8 A;  1H75 A;  4TKY A;  5E4W A;  1M9B A;  3CBU A;  4N3Z A;  3GKX A;  2YOI A;  3UMA A;  3IE3 A;  2C0F A;  4QL7 A;  2B7K A;  1TXX A;  2H72 A;  10GS A;  2YWM A;  3KM6 A;  3RDW A;  1SL2 B;  1BJX A;  3DGQ A;  1W4V A;  4V2M A;  1GSQ A;  4WR4 A;  1UC7 A;  1FO5 A;  4TOP A;  5ECP B;  3UOM A;  4FQU A;  1GL8 A;  2CA8 A;  2OJL A;  1BG5 A;  3PH9 A;  4BVY A;  3F4S A;  2R3X A;  1QFN A;  1DSB A;  4PUR A;  4PTS A;  2HSY A;  1KNG A;  3ZLP A;  3VI7 A;  1J08 A;  3QOU A;  2IMF A;  2YJ7 A;  1I9D A;  2HYX A;  5D9T A;  4NV2 A;  2LS5 A;  1TRV A;  1OKT A;  1F37 A;  4ZB8 A;  5D9W A;  1EP7 A;  2K9F A;  2X64 A;  20GS A;  1T7P B;  1U6T A;  1F2E A;  1N2A A;  2OAC A;  4X43 A;  4USS A;  2CX4 A;  3TJG A;  3CHX C;  1Z5Y E;  1GNE A;  3EVI A;  1TK5 B;  1OC3 A;  4MF7 A;  3JCM L;  5A34 B;  1NHO A;  2WDU A;  3L78 A;  4ZL9 A;  4GLT A;  2DSA A;  4Z2T A;  1U88 A;  2FHE A;  1B48 A;  3F6F A;  1PL2 A;  4ZXG A;  2C80 A;  3M9J A;  4GF0 A;  5GZZ B;  6GSY A;  3L9V A;  1TK0 B;  5J3R A;  1BG1 A;  2H01 A;  2VCT A;  1K0N A;  1XVQ A;  4KF9 A;  4POK A;  1OVN A;  1LJR A;  3VI5 A;  1Y25 A;  4I2U A;  1UN2 A;  1MDI A;  5J4V A;  1PA3 A;  3ZIV A;  1FW1 A;  1UVZ A;  2HSM B;  2BMX A;  4OCE A;  4PHZ C;  2WCI A;  5HFI A;  3D5J A;  4ID0 A;  2EFC A;  5J41 A;  4D73 A;  2AHE A;  2H76 A;  4W66 A;  1V2A A;  4ZBD A;  2L5O A;  3R2Q A;  4ZB7 A;  1IYI A;  1V58 A;  4O32 A;  4IQA A;  4LMW A;  4AKI A;  2X99 A;  5D96 A;  1YEP A;  1XW9 A;  1XCC A;  2G0F A;  4HI7 A;  2ON5 A;  1THO A;  1A2L A;  1FHE A;  2FA4 A;  4JBB A;  1J9B A;  4EXJ A;  3ERF A;  3D6I A;  2JZS A;  5ECK B;  2H71 A;  3D4M A;  3EYT A;  1E2Y A;  1ERV A;  3ZMK A;  1M0U A;  2MMO A;  1B9Y C;  3LXT A;  2KP2 A;  2FWH A;  3ZFL A;  4KGI A;  4OCF A;  2HZF A;  2L5L A;  2CVD A;  5INY A;  2CZ2 A;  1EOH A;  2P0G A;  3TCO A;  3FEU A;  2L57 A;  2RM5 A;  5JCG A;  2N5B A;  3A3T A;  1ERW A;  1V9W A;  3GKM A;  4K7N A;  2DML A;  1X0R A;  3TKS E;  3C1S A;  2FY6 A;  1QXH A;  5AIX A;  1WOU A;  2PER A;  3ERG A;  2ES7 A;  4V2N A;  1V40 A;  5A1N A;  2I9H A;  5B6M A;  3FY7 A;  4V1A p;  3DD3 A;  3FR6 A;  3TJF A;  1AC1 A;  3Q19 A;  3CWG A;  2J23 A;  1K0B A;  1KEB A;  2P31 A;  1CQG A;  1BYE A;  3QR6 A;  4E68 A;  2H0G A;  1ML6 A;  4YKG A;  2IIY A;  1G0T A;  2OBK A;  4HSC X;  3HXS A;  1TU8 A;  2H30 A;  1USB A;  2DJK A;  3GH6 A;  5IMF A;  2DBC A;  17GS A;  1BQ7 A;  3MIX A;  4J2F A;  1GTU A;  4QMK A;  4EL1 A;  1GUL A;  2XHF A;  2YJH A;  1AIU A;  5IOW A;  2L6C A;  1Q4J A;  2BTO T;  4K5S A;  2GS3 A;  5DAK B;  4HQZ A;  3H93 A;  3GA4 A;  4K7I A;  2WVX B;  2B1K A;  5KEJ A;  1M3J A;  1VRS D;  1JZR A;  3TRX A;  5AIV A;  3D4T A;  2JL4 A;  1SD9 A;  1R7H A;  4K9Z A;  2QGV A;  3PPU A;  2H73 A;  2LJR A;  3F3Q A;  4GRF A;  4PI0 C;  3IR4 A;  6GST A;  5HR3 A;  1HQO A;  2YCD A;  2FNO A;  5JCW A;  3Q18 A;  4Z2R A;  3RAZ A;  1XWB A;  2C0E A;  5DCG A;  1OKD A;  4IJI A;  2PN8 A;  1WMJ A;  4V1A g;  1GRX A;  4MDC A;  3LFL A;  2H1L A;  3H8Q A;  1O6J A;  3MYD A;  4WR5 A;  1VGL A;  2VL2 A;  2EIR A;  1KTE A;  2O85 A;  3J7Y k;  2YAN A;  3TRP A;  2O36 A;  2VL9 A;  3ISO A;  2IME A;  3M8N A;  5ECH B;  1SD8 A;  3KXO A;  3PIN A;  1PX6 A;  1T1V A;  2LEG A;  1BX9 A;  4AGS A;  1DBY A;  2VCW A;  5CNW A;  1ZGN A;  3GNJ A;  4MZW A;  3EU3 A;  2X49 A;  5KOW A;  3GKK A;  3LYP A;  2O87 A;  2HRK A;  3E9J B;  5IIZ A;  4F0C A;  4N11 A;  2C4J A;  3QAG A;  4MJA A;  5HQP A;  1X5C A;  5ID2 A;  2VIM A;  4F0B A;  2DJ2 A;  2HZE A;  5DAL B;  3I9V 2;  4GQC A;  1TK8 B;  4HZ4 A;  5A4U A;  1GTI A;  4XCS A;  1SU9 A;  5G1L A;  2VM2 A;  3NZN A;  4KB3 A;  4ZIL A;  2CAI A;  1EOG A;  1BAY A;  3J7Y b;  3UAR A;  2ZUP A;  3BOA A;  3BBY A;  2IWT A;  3P8W A;  1ZYN A;  4ISD A;  1GSD A;  4NAX A;  1JLV A;  4CDO A;  1DE2 A;  3RHC A;  3LG6 A;  4PUA A;  2O5V A;  1SVO A;  2H19 A;  1QMV A;  2LNS A;  2OA7 A;  1FVK A;  3MSZ A;  3KIJ A;  3ZTL A;  5D9X A;  1Z7R A;  2GT6 A;  2MYG A;  4TR1 B;  2V41 A;  1M2D A;  2R2J A;  2V1M A;  3TRQ A;  1PN9 A;  5ENU A;  1AAZ A;  4ZB6 A;  1R4W A;  2C0G A;  3ZYW A;  2IFQ A;  2DKI A;  2JAC A;  3SBC A;  1SYR A;  3RFR C;  3HZ4 A;  1WP0 A;  5JWQ B;  2A2S A;  2FA8 A;  2V6K A;  1YY7 A;  5ECQ B;  2MMN A;  2AYT A;  4MA9 A;  1O85 A;  4L5O A;  3ME7 A;  4G0L A;  3G7Y A;  3Q74 A;  4EIQ A;  4AKX B;  2DJ0 A;  3UL3 A;  4BPY A;  1IYH A;  3H79 A;  1S4B P;  5ECM B;  3VFI A;  4EDZ A;  3KH7 A;  4O92 A;  4OFM A;  1GSY A;  4K6X A;  2K8S A;  3H4K A;  1K0O A;  1B4P A;  2C3Q A;  1O73 A;  4FYC A;  2B1L A;  2RM6 A;  5CYY A;  5DJM A;  3APQ A;  4OO5 A;  3WGX A;  3TKS A;  1TP9 A;  2O7K A;  1OE8 A;  1ON4 A;  4JE1 A;  4BVX B;  4ECJ A;  3FZA A;  3GTU A;  1TJD A;  1F3B A;  1GNW A;  3MAK A;  5LCZ A;  1GWC A;  1OYJ A;  5KN2 A;  4I2T A;  2IL3 A;  4WXT A;  4K8M A;  1PGT A;  2O8V B;  5DJL A;  5IMA A;  2I1U A;  2H75 A;  2HSN A;  3NOF A;  2KP1 A;  4XHM A;  1BED A;  7GSS A;  5G30 A;  3G9B A;  3PGT A;  3D0Z A;  14GS A;  3HHV A;  2JSY A;  2H1G A;  4KCA A;  1XW5 A;  4ZB9 A;  2FCH A;  4KUN A;  2DIY A;  2QA2 A;  5HR0 A;  2H0I A;  4K0N A;  5JCU A;  3LGC A;  2EFE A;  2YWN A;  3KP9 A;  5A4V A;  2PWJ A;  2H66 A;  4OWY A;  3P7X A;  1DE1 A;  2F8F A;  4IKH A;  4CY8 A;  3I6A A;  5ECI B;  1U3I A;  2OAD A;  3A5I A;  4IBP A;  3P90 A;  4KAE A;  1V98 A;  4A5P A;  3TGZ A;  3L9U A;  2WW3 A;  4KDU A;  5B6N A;  2CZ3 A;  1XBS A;  5LD0 A;  1EV9 A;  4G19 A;  4EO3 A;  3GH9 A;  1GLP A;  2CAQ A;  1M3I A;  2LUS A;  3N9J A;  5CRW A;  4WF5 A;  3CSI A;  1A0R P;  5IMZ A;  4GQF A;  1LBK A;  1YQ1 A;  1O81 A;  5COH A;  2A2R A;  2O89 A;  3TOU A;  1SKW B;  2TRX A;  4GCI A;  3HKR A;  4KSM A;  3QDN A;  3GV1 A;  4GSS A;  3WGE A;  4IEL A;  12GS A;  3GX8 A;  5DVB A;  2C0D A;  4IN0 A;  3VLN A;  3FK8 A;  4LLR A;  5J9B A;  3KTL A;  4JZQ A;  3QCP A;  2X8H A;  1B9X C;  1EEM A;  5HFG A;  1E6B A;  5J4Y A;  4KA0 A;  5DQY A;  6GSV A;  4N0V A;  2KUC A;  4K5R A;  2HI7 A;  4GDF A;  3FR9 A;  4DSS B;  1TXU A;  4PQH A;  3LQ7 A;  1RK4 A;  4MJE A;  4I97 A;  3GMF A;  3BJ5 A;  3O3T A;  4POL A;  2YPM A;  4O5Q A;  4OFT A;  3F4R A;  1XWC A;  3DXB A;  3W8J A;  1EV4 A;  2PGT A;  3CMI A;  1GUH A;  1Y6E A;  3DYR A;  2AB6 A;  5A5K A;  2H70 A;  4FO5 A;  4MNN A;  2NDO A;  3S9F A;  4BVY B;  5A34 A;  5IMC A;  4HDE A;  3CRT A;  1A2M A;  3V1W A;  4Q5R A;  3OR5 A;  2L4C A;  4RQR A;  1SK0 A;  4LA1 A;  2ZCT A;  1K3L A;  3IAM 2;  5GSS A;  2WFC A;  4MLY A;  5J9C A;  2R5G A;  5IQY A;  4IQ1 A;  2E2M A;  2H8L A;  22GS A;  4Z2U A;  4I5Q A;  3W6G A;  3F3R A;  1EGO A;  2DJJ A;  4L5L A;  3KH9 A;  2VLT A;  4RI6 A;  5CO3 A;  2OE0 A;  2GDR A;  3F4T A;  3F8U A;  4PUF C;  2B3S A;  2ZNM A;  1U87 A;  3U5R E;  2GQM A;  1F6M C;  2FUG 2;  1G6Y A;  4ACS A;  2WVZ A;  2WW2 A;  3TB2 A;  3GST A;  5AGY A;  4V2L A;  2IMK A;  2GVP A;  3CQF A;  4G2E A;  1A0F A;  1SJI A;  3QMX A;  4PI2 C;  3FZ5 A;  2OBI A;  3VWX A;  2RLI A;  1WJK A;  2QC7 A;  2N5F A;  3H1N A;  1XZO A;  1MDJ A;  2P5R A;  3K8N A;  4HOJ A;  2HRN A;  4J57 E;  4YQM A;  1M2A A;  1XOA A;  3TU3 B;  2E2G A;  3HY2 A;  4LL4 B;  3KMN A;  4D73 B;  2FWG A;  1PL1 A;  3GN3 A;  3KD0 A;  1ZOF A;  3G7J A;  4ZIJ A;  1VF1 A;  4FYU A;  3KEB A;  4AKG A;  2MMA A;  4TXO A;  2V2G A;  4YAV A;  1N8J A;  1YVL A;  3O6T A;  5EY6 A;  2YV9 A;  3UEM A;  4IGJ A;  2DJ3 A;  1ZZY A;  4RI7 A;  4KCE A;  1ZYE A;  1JZD A;  1SK2 A;  4WF4 A;  4I8B A;  3SWL A;  1YDK A;  3APS A;  1OC9 A;  1A8Y A;  2NPB A;  3VWW A;  6GSU A;  3HVV A;  2VCZ A;  2N5A A;  1HNA A;  4WET A;  6GSS A;  4FH8 A;  5AIS A;  1XIY A;  4TW5 A;  4G0K A;  3RBT A;  2KHP A;  2H6Z A;  2REM A;  4MH3 A;  3FYG A;  1LU4 A;  2HNL A;  1TI3 A;  4H86 A;  4OO4 A;  2XBI A;  4TR4 A;  3IC4 A;  3F9U A;  3A2V A;  4O7H A;  1PD2 1;  2A4V A;  2D2Z A;  4BL7 A;  3QPM A;  4NMU A;  3FZ9 A;  5F06 A;  5DAK A;  1Z6N A;  3ZL5 A;  3VWV A;  1PRX A;  2VAF A;  2RUE A;  3I43 A;  5F07 A;  3GUS A;  3D21 A;  4EE0 A;  1SKR B;  3HDC A;  4MZB A;  2XPE A;  2PUK C;  2DMM A;  4G9H A;  4EKZ A;  13GS A;  2GSR A;  2TIR A;  3C73 A;  3LSZ A;  4K7O A;  1WPI A;  1MTC A;  2LV3 A;  1PMT A;  1QUW A;  3QD9 A;  1GP1 A;  3IOS A;  4XIH A;  3KJY A;  1H4O A;  2DLX A;  4ECI A;  2CQ9 A;  1X9M B;  2YP6 A;  3ED3 A;  2AAW A;  6GSW A;  4ECB A;  3WYW A;  2VL3 A;  3UVH A;  3QAV A;  2B5E A;  5ECN B;  1R5A A;  1QGV A;  4GSN A;  1XWK A;  5ECR B;  3RGB C;  3ERW A;  4POM A;  2VM1 A;  4CY6 A;  5G5E A;  3FRC A;  5F05 A;  1A24 A;  2UZ8 A;  3U6V A;  3E0U A;  4GXZ A;  2GT5 A;  2X4A A;  1HNC A;  1SYX A;  1TRW A;  1XFL A;  1T4Y A;  2M46 A;  1QQ2 A;  4YQV A;  5DDL A;  2M80 A;  2R6K A;  5EPF A;  4WBJ A;  8GSS A;  3CXG A;  1K0M A;  1XWG A;  3IHG A;  3HJP A;  4MPG A;  3US3 A;  1M7T A;  1M99 A;  1TI1 A;  3RHB A;  4O5U A;  4KDX A;  4MF6 A;  2F51 A;  1I5G A;  1T4Z A;  2LRN A;  5A5H A;  2F8A A;  2M72 A;  2FGX A;  5ELG A;  5D73 A;  1AW9 A;  4DSQ A;  4MZC A;  2FWE A;  4X1U A;  3TDG A;  2X8G A;  2VL2 C;  2HFD A;  3CTG A;  3QFA C;  2WGR A;  4L0W A;  5CP1 A;  2HRK B;  3FZ4 A;  4YQU A;  3EMX A;  3C71 A;  1GUK A;  1V57 A;  2AJQ B;  4Q5N A;  5ID2 B;  2H1B A;  4MK3 A;  2B5X A;  5KN3 A;  1JZO A;  1MD4 A;  3MNG A;  3WD6 A;  3FW2 A;  2XBQ A;  5JWR B;  2YZH A;  2HE3 A;  1O7U A;  2VCV A;  2FLS A;  1XPV A;  4ILF A;  4RQX A;  2YNX A;  3DML A;  1PX7 A;  3UAP A;  3UVT A;  3ZFB A;  5CRD A;  5H5S A;  2I3Y A;  1ERT A;  3BD2 A;  4IHU A;  1EP8 A;  2DC5 A;  2VUP A;  2LKU A;  2GTU A;  1EGR A;  2A4H A;  4XRA A;  2VD1 A;  3TKR A;  1YJ6 A;  3DIE A;  3M0F A;  1VF2 A;  3PR8 A;  4AJ8 A;  5B7C A;  2IJY A;  2CT6 A;  4CHS A;  5BRT A;  3DKS A;  2DIZ A;  3UBK A;  3EE2 A;  3RPP A;  4K0G A;  4EVM A;  1BF5 A;  4KH7 A;  2VLU A;  1GUM A;  4PQ1 A;  1YKA A;  5A4W A;  5D9V A;  2HRA A;  3TOT A;  4XS4 A;  2VD0 A;  3WT2 A;  4EUY A;  3ZIJ A;  3EWL A;  5ECS A;  3D22 A;  1PN0 A;  5JWO B;  1EZK A;  1NM3 A;  3GX0 A;  4F9Z A;  3M9K A;  2L4Q A;  3IK7 A;  5HR2 A;  2WB9 A;  2AUV A;  2PU9 C;  5HFK A;  1G7O A;  5BMU B;  4KW6 A;  1TW9 A;  2RII A;  2JU5 A;  1TDI A;  3RPN A;  2Z9S A;  1NW2 A;  2P5Q A;  3G7I A;  5ABR A;  3WT1 A;  3DWV A;  3HJO A;  3F0I A;  3KZQ A;  1AQV A;  3IPZ A;  4TR0 A;  4PXO A;  4AJ6 A;  2G2Q A;  1R5P A;  16GS A;  2PBJ A;  1F9M A;  3GTU B;  1XVW A;  4YAP A;  5EVO A;  4RUV A;  1HD2 A;  2VOC A;  2GSS A;  5B8A A;  1XG8 A;  4K2X A;  4OD7 A;  3L4N A;  3CRU A;  3TKS C;  4AI6 A;  3E3E A;  2B6M A;  2HLS A;  1NSW A;  2OE1 A;  4TXV A;  1X9S B;  1ACV A;  1WIK A;  2VO4 A;  3DRN A;  1ERU A;  3IC8 A;  3IHQ A;  3Q6O A;  4WBR D;  2R0C A;  1TOF A;  2YN1 A;  3TKQ A;  1G6W A;  3FHK A;  1GSS A;  2TRC P;  4QQ7 A;  2FWF A;  2EIO A;  2DKH A;  4NWY A;  1Q98 A;  1GH2 A;  5DQS A;  2JZT A;  3GIX A;  2K18 A;  4TRX A;  1SVM A;  1A2J A;  4EDY A;  2GQK A;  3CYN A;  4YKF A;  2E7P A;  4PQI A;  1MD3 A;  2J9H A;  3VPQ A;  1URM A;  5KOX A;  5HR1 A;  3ZVJ D;  3BCI A;  1JZW A;  2DJ1 A;  2GLR A;  1JLW A;  1ZL9 A;  1GSF A;  2BJX A;  1O8W A;  2CV4 A;  1XW6 A;  1AQX A;  4G10 A;  4MH2 A;  1T00 A;  4DSS A;  3VUR A;  3C8E A;  3GYK A;  4MJC A;  1X5E A;  2B5Y A;  4XTS A;  1X5D A;  1MEK A;  1UA5 A;  4MP4 A;  2OKA A;  5IOX A;  1ZCP A;  2JZR A;  4HZ2 A;  2K8V A;  1YKC A;  4ECC A;  3GFK A;  5IM9 A;  2GGT A;  1S3D A;  2QA1 A;  3VWU A;  3HVS A;  4HEA 2;  4IW9 A;  5IMV A;  3A2W A;  3MDK A;  1TTZ A;  3KCM A;  2WW0 A;  1U3A A;  4E8H A;  3UBL A;  1NHY A;  3I69 A;  2LQQ A;  4KSO A;  1PKW A;  2VKZ G;  1AUC A;  2JSZ A;  2C1Y A;  2LNT A;  11GS A;  4BIK A;  2WVY A;  2OE3 A;  2YWO A;  3TJK A;  19GS A;  1K0A A;  1SVL A;  2GSQ A;  1ZMA A;  5IPG A;  3IDV A;  2YWI A;  1K3Y A;  4LL1 B;  4EC0 A;  5H5R A;  1SEN A;  1M9A A;  4PNG A;  4NV5 A;  2ON7 A;  3ZVJ A;  4IS0 A;  5KN0 A;  5AN1 A;  2EIQ A;  2R0G A;  2H1A A;  1YEX A;  1SL0 B;  2LJA A;  2LJK A;  2IPA A;  5C00 A;  2C3T A;  1GSE A;  2MBS A;  4I6X A;  2HSM A;  3HMJ G;  4G01 A;  1ST9 A;  2V6O A;  4F03 A;  1YF0 A;  2WRT A;  4K2D A;  2WJU A;  1XXU A;  3LEF A;  4HJM A;  3QAW A;  4ML1 A;  4IP6 A;  5CRH A;  3EIN A;  4O5R A;  4N0Z A;  1TRS A;  3CSJ A;  1ILO A;  2H6X A;  4OFN A;  5EL8 A;  4Q5Q A;  3M3M A;  5IO2 A;  1FG4 A;  5IMD A;  2YV7 A;  4Q5F A;  2NTO A;  4XS1 A;  5G31 A;  2NVL A;  2GZZ A;  3F6D A;  3IK9 A;  3CSH A;  4FIW A;  4FXY P;  2B7J A;  4HU7 A;  2WUL A;  3GSS A;  4MCU A;  1A8L A;  5L71 A;  5DCH A;  2JAD A;  3FMW A;  4IVF A;  2L59 A;  2EFH A;  4GTU A;  4AF2 A;  4ZL7 A;  4L8E A;  3R3E A;  4G0I A;  1Z3E A;  3EPT A;  3F63 A;  4EIP A;  4MMM A;  4MAB A;  2HRF A;  3HA9 A;  4JRR A;  2VCQ A;  4GST A;  3KMO A;  4LMV A;  3VK9 A;  4DEJ A;  1EEJ A;  5ECO B;  5DBQ A;  3IXR A;  5H5Q A;  2V32 A;  2H74 A;  3GHA A;  2VLV A;  2C3N A;  2WS2 A;  2KLX A;  1EWX A;  3VPT A;  4N30 A;  1OC8 A;  2RUF A;  5ECL B;  4TXO B;  2WZS A;  3GKN A;  3CTF A;  3IV4 A;  3HZ8 A;  3L0H A;  2AV4 A;  3A2X A;  1HYU A;  1FB6 A;  3A5W A;  3NIV A;  3TJJ A;  5IPH A;  4PNF A;  1N25 A;  4ULX A;  1ZYQ B;  2LTK A;  4N10 A;  1SJ6 A;  3UJ1 A;  1TRU A;  3C7M A;  2HQT A;  4HUA A;  1OC9 B;  4TN8 A;  2R37 A;  1QK8 A;  4PX1 A;  2GQL A;  4FYB A;  1SL1 B;  4K1F A;  3EC3 A;  4AJ7 A;  1Z6M A;  1RQM A;  4L0U A;  1SK1 A;  1YEW C;  4IJ3 A;  1J0F A;  2WVX A;  4NHW A;  5A1N B;  1JHB A;  3HJM A;  3ZRD A;  3GL5 A;  2MMZ A;  5FWG A;  1VF4 A;  5J40 A;  2C8U A;  3HVX A;  1PFO A;  3TJB A;  3UIW A;  1A23 A;  1YZX A;  18GS A;  4E8E A;  4BL7 B;  3LJR A;  4MF5 A;  4F82 A;  2QKE A;  3DEX A;  1T3B A;  3IAS 2;  3FKF A;  2H0H A;  2UV8 G;  2PPT A;  4JU5 A;  2F9S A;  2X8C A;  2LST A;  4POB A;  1B8X A;  3ZML A;  9GSS A;  4HU9 A;  2KOK A;  5B8B A;  3LYK A;  1ZYP A;  2I81 A;  1B4Q A;  4JED A;  2OT3 A;  1XWA A;  3EUR A;  5J47 A;  5F0G A;  3ZZX A;  4HQS A;  4ML6 A;  4XS6 A;  2GZP A;  1FB0 A;  4X0X A;  4TR3 A;  1W89 A;  2HXK A;  4BA7 A;  1K0C A;  4ZBB A;  3C1R A;  3LOR A;  3IRA A;  1DUG A;  2R0P A;  4ZBA A;  5DAL A;  1WWJ A;  1M2B A;  2R4V A;  3HVN A;  4BWQ A;  1PQN A;  4Z7X A;  2IMD A;  2YZU A;  1Z9H A;  4NXI A;  4GWR A;  5CRG A;  2H6Y A;  1Z7P A;  1T8E B;  4IP1 A;  1GSU A;  1K3O A;  3DVW A;  1KBN A;  4WEY A;  5KN1 A;  3TUE A;  2CVK A;  4XRD A;  4NPB A;  1CQH A;  1I1I P;  4TR1 A;  5GST A;  1PSQ A;  1FOV A;  1X9W B;  2VCX A;  2HZE B;  2CVB A;  5A5H B;  5D93 A;  2GZY A;  1GTB A;  2WZ9 A;  2WW1 A;  2H1D A;  2IMI A;  5G2Z A;  4EF0 A;  1PKZ A;  2HT9 A;  1ABA A;  4JR6 A;  5FHI A;  3W8S A;  1F3A A;  3ZIT A;  5C04 A;  3GUR A;  1OE7 A;  3EMP A;  2A2P A;  1FOH A;  1GTA A;  4KDY A;  3N5O A;  4NHZ A;  4OMV A;  1C72 A; 
#chains in the Genus database with same CATH homology
 3TKP A;  3LXZ A;  4KND A;  2I4A A;  1FAA A;  2IN3 A;  1TKD B;  5F8B A;  1JFU A;  2PVO C;  4F2I A;  2IFQ B;  1AQW A;  5GAN D;  3APO A;  3L9S A;  2FD3 A;  4BVX A;  4J56 E;  4MJB A;  3MWH A;  3KGK A;  4WKW A;  3M1G A;  4X4J A;  3ME8 A;  6GSX A;  3IA1 A;  1G7E A;  4JR4 A;  4TVE A;  5ELA A;  5GAP D;  1TU7 A;  4HJ2 A;  3FR3 A;  4MPF A;  5BMU A;  1WE0 A;  4PGT A;  4HS1 A;  2LRT A;  2MZC A;  2K6V A;  3DVX A;  2EC4 A;  5G1K A;  2PMT A;  2NBS A;  1VF3 A;  3P2A A;  1WRY A;  2CX3 A;  3HCZ A;  1FVJ A;  1OAZ A;  2HSH A;  1MDK A;  4KE3 A;  1S3A A;  1HNB A;  4XS4 B;  4YH2 A;  4P3Y B;  3EU4 A;  2L6D A;  3LWA A;  2F3M A;  2XPD A;  2QSI A;  2LQO A;  4QL9 A;  3GRX A;  4DSR A;  2LRC A;  5FT3 A;  1GLQ A;  1YF1 A;  4KX4 A;  3IBH A;  2XC2 A;  5J4U A;  4AKH A;  1RW1 A;  5IO0 A;  1S3C A;  1SJZ A;  4ICY A;  5CAX A;  4BWS A;  2HSN B;  5E59 A;  5J5N A;  3HYP A;  5D8I A;  3WGD A;  3ZRE A;  4DVC A;  3AY8 A;  3BCK A;  2EFD A;  5G5F A;  2MBT A;  2E0Q A;  1R26 A;  2GST A;  2PVQ A;  3HD5 A;  1AXD A;  3QFB C;  3KTB A;  2ALB A;  3GL3 A;  1XOB A;  1SKS B;  3KP8 A;  1O8X A;  1K0D A;  5CRE A;  1THX A;  3LW9 A;  4CW9 A;  3O76 A;  5LNK e;  1Y1U A;  4ZL8 A;  1H75 A;  4TKY A;  5E4W A;  1M9B A;  3CBU A;  4N3Z A;  3GKX A;  2YOI A;  3UMA A;  3IE3 A;  2C0F A;  4QL7 A;  2B7K A;  1TXX A;  2H72 A;  10GS A;  2YWM A;  3KM6 A;  3RDW A;  1SL2 B;  1BJX A;  3DGQ A;  1W4V A;  4V2M A;  1GSQ A;  4WR4 A;  1UC7 A;  1FO5 A;  4TOP A;  5ECP B;  3UOM A;  4FQU A;  1GL8 A;  2CA8 A;  2OJL A;  1BG5 A;  3PH9 A;  4BVY A;  3F4S A;  2R3X A;  1QFN A;  1DSB A;  4PUR A;  4PTS A;  2HSY A;  1KNG A;  3ZLP A;  3VI7 A;  1J08 A;  3QOU A;  2IMF A;  2YJ7 A;  1I9D A;  2HYX A;  5D9T A;  4NV2 A;  2LS5 A;  1TRV A;  1OKT A;  1F37 A;  4ZB8 A;  5D9W A;  1EP7 A;  2K9F A;  2X64 A;  20GS A;  1T7P B;  1U6T A;  1F2E A;  1N2A A;  2OAC A;  4X43 A;  4USS A;  2CX4 A;  3TJG A;  1Z5Y E;  1GNE A;  3EVI A;  1TK5 B;  1OC3 A;  4MF7 A;  3JCM L;  5A34 B;  1NHO A;  2WDU A;  3L78 A;  4ZL9 A;  4GLT A;  2DSA A;  4Z2T A;  1U88 A;  2FHE A;  1B48 A;  3F6F A;  1PL2 A;  4ZXG A;  2C80 A;  3M9J A;  4GF0 A;  5GZZ B;  6GSY A;  3L9V A;  1TK0 B;  5J3R A;  1BG1 A;  2H01 A;  2VCT A;  1K0N A;  1XVQ A;  4KF9 A;  4POK A;  1OVN A;  1LJR A;  3VI5 A;  1Y25 A;  4I2U A;  1UN2 A;  1MDI A;  5J4V A;  1PA3 A;  3ZIV A;  1FW1 A;  1UVZ A;  2HSM B;  2BMX A;  4OCE A;  2WCI A;  5HFI A;  3D5J A;  4ID0 A;  2EFC A;  5J41 A;  4D73 A;  2AHE A;  2H76 A;  4W66 A;  1V2A A;  4ZBD A;  2L5O A;  3R2Q A;  4ZB7 A;  1IYI A;  1V58 A;  4O32 A;  4IQA A;  4LMW A;  4AKI A;  2X99 A;  5D96 A;  1YEP A;  1XW9 A;  1XCC A;  2G0F A;  4HI7 A;  2ON5 A;  1THO A;  1A2L A;  1FHE A;  2FA4 A;  4JBB A;  1J9B A;  4EXJ A;  3ERF A;  3D6I A;  2JZS A;  5ECK B;  2H71 A;  3D4M A;  3EYT A;  1E2Y A;  1ERV A;  3ZMK A;  1M0U A;  2MMO A;  1B9Y C;  3LXT A;  2KP2 A;  2FWH A;  3ZFL A;  4KGI A;  4OCF A;  2HZF A;  2L5L A;  2CVD A;  5INY A;  2CZ2 A;  1EOH A;  2P0G A;  3TCO A;  3FEU A;  2L57 A;  2RM5 A;  5JCG A;  2N5B A;  3A3T A;  1ERW A;  1V9W A;  3GKM A;  4K7N A;  2DML A;  1X0R A;  3TKS E;  3C1S A;  2FY6 A;  1QXH A;  5AIX A;  1WOU A;  2PER A;  3ERG A;  2ES7 A;  4V2N A;  1V40 A;  5A1N A;  2I9H A;  5B6M A;  3FY7 A;  4V1A p;  3DD3 A;  3FR6 A;  3TJF A;  1AC1 A;  3Q19 A;  3CWG A;  2J23 A;  1K0B A;  1KEB A;  2P31 A;  1CQG A;  1BYE A;  3QR6 A;  4E68 A;  2H0G A;  1ML6 A;  4YKG A;  2IIY A;  1G0T A;  2OBK A;  3HXS A;  1TU8 A;  2H30 A;  1USB A;  2DJK A;  3GH6 A;  5IMF A;  2DBC A;  17GS A;  1BQ7 A;  3MIX A;  4J2F A;  1GTU A;  4QMK A;  4EL1 A;  1GUL A;  2XHF A;  2YJH A;  1AIU A;  5IOW A;  2L6C A;  1Q4J A;  2BTO T;  4K5S A;  2GS3 A;  5DAK B;  4HQZ A;  3H93 A;  3GA4 A;  4K7I A;  2B1K A;  5KEJ A;  1VRS D;  1JZR A;  3TRX A;  5AIV A;  3D4T A;  2JL4 A;  1SD9 A;  1R7H A;  4K9Z A;  2QGV A;  3PPU A;  2H73 A;  2LJR A;  3F3Q A;  4GRF A;  3IR4 A;  6GST A;  5HR3 A;  1HQO A;  2YCD A;  2FNO A;  5JCW A;  3Q18 A;  4Z2R A;  3RAZ A;  1XWB A;  2C0E A;  5DCG A;  1OKD A;  4IJI A;  2PN8 A;  1WMJ A;  4V1A g;  1GRX A;  4MDC A;  3LFL A;  2H1L A;  3H8Q A;  1O6J A;  3MYD A;  4WR5 A;  1VGL A;  2VL2 A;  2EIR A;  1KTE A;  2O85 A;  3J7Y k;  2YAN A;  3TRP A;  2VL9 A;  3ISO A;  2IME A;  3M8N A;  5ECH B;  1SD8 A;  3KXO A;  3PIN A;  1PX6 A;  1T1V A;  2LEG A;  1BX9 A;  4AGS A;  1DBY A;  2VCW A;  5CNW A;  1ZGN A;  3GNJ A;  4MZW A;  3EU3 A;  2X49 A;  5KOW A;  3GKK A;  3LYP A;  2O87 A;  2HRK A;  3E9J B;  5IIZ A;  4F0C A;  4N11 A;  2C4J A;  3QAG A;  4MJA A;  5HQP A;  1X5C A;  5ID2 A;  2VIM A;  4F0B A;  2DJ2 A;  2HZE A;  5DAL B;  3I9V 2;  4GQC A;  1TK8 B;  4HZ4 A;  5A4U A;  1GTI A;  4XCS A;  1SU9 A;  5G1L A;  2VM2 A;  3NZN A;  4KB3 A;  4ZIL A;  2CAI A;  1EOG A;  1BAY A;  3J7Y b;  3UAR A;  2ZUP A;  3BOA A;  3BBY A;  2IWT A;  3P8W A;  1ZYN A;  4ISD A;  1GSD A;  4NAX A;  1JLV A;  4CDO A;  1DE2 A;  3RHC A;  3LG6 A;  4PUA A;  2O5V A;  1SVO A;  2H19 A;  1QMV A;  2LNS A;  2OA7 A;  1FVK A;  3MSZ A;  3KIJ A;  3ZTL A;  5D9X A;  1Z7R A;  2GT6 A;  2MYG A;  4TR1 B;  2V41 A;  1M2D A;  2R2J A;  2V1M A;  3TRQ A;  1PN9 A;  5ENU A;  1AAZ A;  4ZB6 A;  1R4W A;  2C0G A;  3ZYW A;  2IFQ A;  2DKI A;  2JAC A;  3SBC A;  1SYR A;  3HZ4 A;  1WP0 A;  5JWQ B;  2A2S A;  2FA8 A;  2V6K A;  1YY7 A;  5ECQ B;  2MMN A;  2AYT A;  4MA9 A;  1O85 A;  4L5O A;  3ME7 A;  4G0L A;  3G7Y A;  3Q74 A;  4EIQ A;  4AKX B;  2DJ0 A;  3UL3 A;  4BPY A;  1IYH A;  3H79 A;  5ECM B;  3VFI A;  4EDZ A;  3KH7 A;  4O92 A;  4OFM A;  1GSY A;  4K6X A;  2K8S A;  3H4K A;  1K0O A;  1B4P A;  2C3Q A;  1O73 A;  4FYC A;  2B1L A;  2RM6 A;  5CYY A;  5DJM A;  3APQ A;  4OO5 A;  3WGX A;  3TKS A;  1TP9 A;  2O7K A;  1OE8 A;  1ON4 A;  4JE1 A;  4BVX B;  4ECJ A;  3FZA A;  3GTU A;  1TJD A;  1F3B A;  1GNW A;  3MAK A;  5LCZ A;  1GWC A;  1OYJ A;  5KN2 A;  4I2T A;  2IL3 A;  4WXT A;  4K8M A;  1PGT A;  2O8V B;  5DJL A;  5IMA A;  2I1U A;  2H75 A;  2HSN A;  3NOF A;  2KP1 A;  4XHM A;  1BED A;  7GSS A;  5G30 A;  3G9B A;  3PGT A;  3D0Z A;  14GS A;  3HHV A;  2JSY A;  2H1G A;  4KCA A;  1XW5 A;  4ZB9 A;  2FCH A;  4KUN A;  2DIY A;  2QA2 A;  5HR0 A;  2H0I A;  4K0N A;  5JCU A;  3LGC A;  2EFE A;  2YWN A;  3KP9 A;  5A4V A;  2PWJ A;  2H66 A;  4OWY A;  3P7X A;  1DE1 A;  2F8F A;  4IKH A;  4CY8 A;  3I6A A;  5ECI B;  1U3I A;  2OAD A;  3A5I A;  4IBP A;  3P90 A;  4KAE A;  1V98 A;  4A5P A;  3TGZ A;  3L9U A;  4KDU A;  5B6N A;  2CZ3 A;  1XBS A;  5LD0 A;  1EV9 A;  4G19 A;  4EO3 A;  3GH9 A;  1GLP A;  2CAQ A;  2LUS A;  3N9J A;  5CRW A;  4WF5 A;  3CSI A;  1A0R P;  5IMZ A;  4GQF A;  1LBK A;  1YQ1 A;  1O81 A;  5COH A;  2A2R A;  2O89 A;  3TOU A;  1SKW B;  2TRX A;  4GCI A;  3HKR A;  4KSM A;  3QDN A;  3GV1 A;  4GSS A;  3WGE A;  4IEL A;  12GS A;  3GX8 A;  5DVB A;  2C0D A;  4IN0 A;  3VLN A;  3FK8 A;  4LLR A;  5J9B A;  3KTL A;  4JZQ A;  3QCP A;  2X8H A;  1B9X C;  1EEM A;  5HFG A;  1E6B A;  5J4Y A;  4KA0 A;  5DQY A;  6GSV A;  4N0V A;  2KUC A;  4K5R A;  2HI7 A;  4GDF A;  3FR9 A;  4DSS B;  1TXU A;  4PQH A;  3LQ7 A;  1RK4 A;  4MJE A;  4I97 A;  3GMF A;  3BJ5 A;  3O3T A;  4POL A;  2YPM A;  4O5Q A;  4OFT A;  3F4R A;  1XWC A;  3DXB A;  3W8J A;  1EV4 A;  2PGT A;  3CMI A;  1GUH A;  1Y6E A;  3DYR A;  2AB6 A;  5A5K A;  2H70 A;  4FO5 A;  4MNN A;  2NDO A;  3S9F A;  4BVY B;  5A34 A;  5IMC A;  4HDE A;  3CRT A;  1A2M A;  3V1W A;  4Q5R A;  3OR5 A;  2L4C A;  4RQR A;  1SK0 A;  4LA1 A;  2ZCT A;  1K3L A;  3IAM 2;  5GSS A;  2WFC A;  4MLY A;  5J9C A;  2R5G A;  5IQY A;  4IQ1 A;  2E2M A;  2H8L A;  22GS A;  4Z2U A;  4I5Q A;  3W6G A;  3F3R A;  1EGO A;  2DJJ A;  4L5L A;  3KH9 A;  2VLT A;  4RI6 A;  5CO3 A;  2OE0 A;  2GDR A;  3F4T A;  3F8U A;  4PUF C;  2B3S A;  2ZNM A;  1U87 A;  3U5R E;  2GQM A;  1F6M C;  2FUG 2;  1G6Y A;  4ACS A;  3TB2 A;  3GST A;  5AGY A;  4V2L A;  2IMK A;  2GVP A;  4G2E A;  1A0F A;  1SJI A;  3QMX A;  3FZ5 A;  2OBI A;  3VWX A;  2RLI A;  1WJK A;  2QC7 A;  2N5F A;  3H1N A;  1XZO A;  1MDJ A;  2P5R A;  3K8N A;  4HOJ A;  2HRN A;  4J57 E;  4YQM A;  1M2A A;  1XOA A;  3TU3 B;  2E2G A;  3HY2 A;  4LL4 B;  3KMN A;  4D73 B;  2FWG A;  1PL1 A;  3GN3 A;  3KD0 A;  1ZOF A;  3G7J A;  4ZIJ A;  1VF1 A;  4FYU A;  3KEB A;  4AKG A;  2MMA A;  4TXO A;  2V2G A;  4YAV A;  1N8J A;  1YVL A;  3O6T A;  5EY6 A;  2YV9 A;  3UEM A;  4IGJ A;  2DJ3 A;  1ZZY A;  4RI7 A;  4KCE A;  1ZYE A;  1JZD A;  1SK2 A;  4WF4 A;  4I8B A;  3SWL A;  1YDK A;  3APS A;  1OC9 A;  1A8Y A;  2NPB A;  3VWW A;  6GSU A;  3HVV A;  2VCZ A;  2N5A A;  1HNA A;  4WET A;  6GSS A;  4FH8 A;  5AIS A;  1XIY A;  4TW5 A;  4G0K A;  3RBT A;  2KHP A;  2H6Z A;  2REM A;  4MH3 A;  3FYG A;  1LU4 A;  2HNL A;  1TI3 A;  4H86 A;  4OO4 A;  2XBI A;  4TR4 A;  3IC4 A;  3F9U A;  3A2V A;  4O7H A;  1PD2 1;  2A4V A;  2D2Z A;  4BL7 A;  3QPM A;  4NMU A;  3FZ9 A;  5F06 A;  5DAK A;  1Z6N A;  3ZL5 A;  3VWV A;  1PRX A;  2VAF A;  2RUE A;  3I43 A;  5F07 A;  3GUS A;  3D21 A;  4EE0 A;  1SKR B;  3HDC A;  4MZB A;  2XPE A;  2PUK C;  2DMM A;  4G9H A;  4EKZ A;  13GS A;  2GSR A;  2TIR A;  3C73 A;  3LSZ A;  4K7O A;  1WPI A;  1MTC A;  2LV3 A;  1PMT A;  1QUW A;  3QD9 A;  1GP1 A;  3IOS A;  4XIH A;  3KJY A;  1H4O A;  2DLX A;  4ECI A;  2CQ9 A;  1X9M B;  2YP6 A;  3ED3 A;  2AAW A;  6GSW A;  4ECB A;  3WYW A;  2VL3 A;  3UVH A;  3QAV A;  2B5E A;  5ECN B;  1R5A A;  1QGV A;  4GSN A;  1XWK A;  5ECR B;  3ERW A;  4POM A;  2VM1 A;  4CY6 A;  5G5E A;  3FRC A;  5F05 A;  1A24 A;  2UZ8 A;  3U6V A;  3E0U A;  4GXZ A;  2GT5 A;  2X4A A;  1HNC A;  1SYX A;  1TRW A;  1XFL A;  1T4Y A;  2M46 A;  1QQ2 A;  4YQV A;  5DDL A;  2M80 A;  2R6K A;  5EPF A;  4WBJ A;  8GSS A;  3CXG A;  1K0M A;  1XWG A;  3IHG A;  3HJP A;  4MPG A;  3US3 A;  1M7T A;  1M99 A;  1TI1 A;  3RHB A;  4O5U A;  4KDX A;  4MF6 A;  2F51 A;  1I5G A;  1T4Z A;  2LRN A;  5A5H A;  2F8A A;  2M72 A;  2FGX A;  5ELG A;  5D73 A;  1AW9 A;  4DSQ A;  4MZC A;  2FWE A;  4X1U A;  3TDG A;  2X8G A;  2VL2 C;  2HFD A;  3CTG A;  3QFA C;  2WGR A;  4L0W A;  5CP1 A;  2HRK B;  3FZ4 A;  4YQU A;  3EMX A;  3C71 A;  1GUK A;  1V57 A;  2AJQ B;  4Q5N A;  5ID2 B;  2H1B A;  4MK3 A;  2B5X A;  5KN3 A;  1JZO A;  1MD4 A;  3MNG A;  3WD6 A;  3FW2 A;  2XBQ A;  5JWR B;  2YZH A;  2HE3 A;  1O7U A;  2VCV A;  2FLS A;  1XPV A;  4ILF A;  4RQX A;  2YNX A;  3DML A;  1PX7 A;  3UAP A;  3UVT A;  3ZFB A;  5CRD A;  5H5S A;  2I3Y A;  1ERT A;  3BD2 A;  4IHU A;  1EP8 A;  2DC5 A;  2VUP A;  2LKU A;  2GTU A;  1EGR A;  2A4H A;  4XRA A;  2VD1 A;  3TKR A;  1YJ6 A;  3DIE A;  3M0F A;  1VF2 A;  3PR8 A;  4AJ8 A;  5B7C A;  2IJY A;  2CT6 A;  4CHS A;  5BRT A;  3DKS A;  2DIZ A;  3UBK A;  3EE2 A;  3RPP A;  4K0G A;  4EVM A;  1BF5 A;  4KH7 A;  2VLU A;  1GUM A;  4PQ1 A;  1YKA A;  5A4W A;  5D9V A;  2HRA A;  3TOT A;  4XS4 A;  2VD0 A;  3WT2 A;  4EUY A;  3ZIJ A;  3EWL A;  5ECS A;  3D22 A;  1PN0 A;  5JWO B;  1EZK A;  1NM3 A;  3GX0 A;  4F9Z A;  3M9K A;  2L4Q A;  3IK7 A;  5HR2 A;  2WB9 A;  2AUV A;  2PU9 C;  5HFK A;  1G7O A;  5BMU B;  4KW6 A;  1TW9 A;  2RII A;  2JU5 A;  1TDI A;  3RPN A;  2Z9S A;  1NW2 A;  2P5Q A;  3G7I A;  5ABR A;  3WT1 A;  3DWV A;  3HJO A;  3F0I A;  3KZQ A;  1AQV A;  3IPZ A;  4TR0 A;  4PXO A;  4AJ6 A;  2G2Q A;  1R5P A;  16GS A;  2PBJ A;  1F9M A;  3GTU B;  1XVW A;  4YAP A;  5EVO A;  4RUV A;  1HD2 A;  2VOC A;  2GSS A;  5B8A A;  4K2X A;  4OD7 A;  3L4N A;  3CRU A;  3TKS C;  4AI6 A;  3E3E A;  2B6M A;  2HLS A;  1NSW A;  2OE1 A;  4TXV A;  1X9S B;  1ACV A;  1WIK A;  2VO4 A;  3DRN A;  1ERU A;  3IC8 A;  3IHQ A;  3Q6O A;  4WBR D;  2R0C A;  1TOF A;  2YN1 A;  3TKQ A;  1G6W A;  3FHK A;  1GSS A;  2TRC P;  4QQ7 A;  2FWF A;  2EIO A;  2DKH A;  4NWY A;  1Q98 A;  1GH2 A;  5DQS A;  2JZT A;  3GIX A;  2K18 A;  4TRX A;  1SVM A;  1A2J A;  4EDY A;  2GQK A;  3CYN A;  4YKF A;  2E7P A;  4PQI A;  1MD3 A;  2J9H A;  3VPQ A;  1URM A;  5KOX A;  5HR1 A;  3ZVJ D;  3BCI A;  1JZW A;  2DJ1 A;  2GLR A;  1JLW A;  1ZL9 A;  1GSF A;  2BJX A;  1O8W A;  2CV4 A;  1XW6 A;  1AQX A;  4G10 A;  4MH2 A;  1T00 A;  4DSS A;  3VUR A;  3C8E A;  3GYK A;  4MJC A;  1X5E A;  2B5Y A;  4XTS A;  1X5D A;  1MEK A;  1UA5 A;  4MP4 A;  2OKA A;  5IOX A;  1ZCP A;  2JZR A;  4HZ2 A;  2K8V A;  1YKC A;  4ECC A;  3GFK A;  5IM9 A;  2GGT A;  1S3D A;  2QA1 A;  3VWU A;  3HVS A;  4HEA 2;  4IW9 A;  5IMV A;  3A2W A;  3MDK A;  1TTZ A;  3KCM A;  1U3A A;  4E8H A;  3UBL A;  1NHY A;  3I69 A;  2LQQ A;  4KSO A;  1PKW A;  2VKZ G;  1AUC A;  2JSZ A;  2C1Y A;  2LNT A;  11GS A;  2OE3 A;  2YWO A;  3TJK A;  19GS A;  1K0A A;  1SVL A;  2GSQ A;  1ZMA A;  5IPG A;  3IDV A;  2YWI A;  1K3Y A;  4LL1 B;  4EC0 A;  5H5R A;  1SEN A;  1M9A A;  4PNG A;  4NV5 A;  2ON7 A;  3ZVJ A;  4IS0 A;  5KN0 A;  5AN1 A;  2EIQ A;  2R0G A;  2H1A A;  1YEX A;  1SL0 B;  2LJA A;  2LJK A;  2IPA A;  5C00 A;  2C3T A;  1GSE A;  2MBS A;  4I6X A;  2HSM A;  3HMJ G;  4G01 A;  1ST9 A;  2V6O A;  4F03 A;  1YF0 A;  2WRT A;  4K2D A;  2WJU A;  1XXU A;  3LEF A;  4HJM A;  3QAW A;  4ML1 A;  4IP6 A;  5CRH A;  3EIN A;  4O5R A;  4N0Z A;  1TRS A;  3CSJ A;  1ILO A;  2H6X A;  4OFN A;  5EL8 A;  4Q5Q A;  3M3M A;  5IO2 A;  1FG4 A;  5IMD A;  2YV7 A;  4Q5F A;  2NTO A;  4XS1 A;  5G31 A;  2NVL A;  2GZZ A;  3F6D A;  3IK9 A;  3CSH A;  4FIW A;  2B7J A;  4HU7 A;  2WUL A;  3GSS A;  4MCU A;  1A8L A;  5L71 A;  5DCH A;  2JAD A;  3FMW A;  4IVF A;  2L59 A;  2EFH A;  4GTU A;  4AF2 A;  4ZL7 A;  4L8E A;  3R3E A;  4G0I A;  1Z3E A;  3EPT A;  3F63 A;  4EIP A;  4MMM A;  4MAB A;  2HRF A;  3HA9 A;  4JRR A;  2VCQ A;  4GST A;  3KMO A;  4LMV A;  3VK9 A;  4DEJ A;  1EEJ A;  5ECO B;  5DBQ A;  3IXR A;  5H5Q A;  2V32 A;  2H74 A;  3GHA A;  2VLV A;  2C3N A;  2WS2 A;  2KLX A;  1EWX A;  3VPT A;  4N30 A;  1OC8 A;  2RUF A;  5ECL B;  4TXO B;  3GKN A;  3CTF A;  3IV4 A;  3HZ8 A;  3L0H A;  2AV4 A;  3A2X A;  1HYU A;  1FB6 A;  3A5W A;  3NIV A;  3TJJ A;  5IPH A;  4PNF A;  1N25 A;  4ULX A;  1ZYQ B;  2LTK A;  4N10 A;  1SJ6 A;  3UJ1 A;  1TRU A;  3C7M A;  2HQT A;  4HUA A;  1OC9 B;  4TN8 A;  2R37 A;  1QK8 A;  4PX1 A;  2GQL A;  4FYB A;  1SL1 B;  4K1F A;  3EC3 A;  4AJ7 A;  1Z6M A;  1RQM A;  4L0U A;  1SK1 A;  4IJ3 A;  1J0F A;  4NHW A;  5A1N B;  1JHB A;  3HJM A;  3ZRD A;  3GL5 A;  2MMZ A;  5FWG A;  1VF4 A;  5J40 A;  2C8U A;  3HVX A;  3TJB A;  3UIW A;  1A23 A;  1YZX A;  18GS A;  4E8E A;  4BL7 B;  3LJR A;  4MF5 A;  4F82 A;  2QKE A;  3DEX A;  1T3B A;  3IAS 2;  3FKF A;  2H0H A;  2UV8 G;  2PPT A;  4JU5 A;  2F9S A;  2X8C A;  2LST A;  4POB A;  1B8X A;  3ZML A;  9GSS A;  4HU9 A;  2KOK A;  5B8B A;  3LYK A;  1ZYP A;  2I81 A;  1B4Q A;  4JED A;  2OT3 A;  1XWA A;  3EUR A;  5J47 A;  5F0G A;  3ZZX A;  4HQS A;  4ML6 A;  4XS6 A;  2GZP A;  1FB0 A;  4X0X A;  4TR3 A;  1W89 A;  2HXK A;  4BA7 A;  1K0C A;  4ZBB A;  3C1R A;  3LOR A;  3IRA A;  1DUG A;  2R0P A;  4ZBA A;  5DAL A;  1WWJ A;  1M2B A;  2R4V A;  4BWQ A;  1PQN A;  4Z7X A;  2IMD A;  2YZU A;  1Z9H A;  4NXI A;  4GWR A;  5CRG A;  2H6Y A;  1Z7P A;  1T8E B;  4IP1 A;  1GSU A;  1K3O A;  3DVW A;  1KBN A;  4WEY A;  5KN1 A;  3TUE A;  2CVK A;  4XRD A;  4NPB A;  1CQH A;  4TR1 A;  5GST A;  1PSQ A;  1FOV A;  1X9W B;  2VCX A;  2HZE B;  2CVB A;  5A5H B;  5D93 A;  2GZY A;  1GTB A;  2WZ9 A;  2H1D A;  2IMI A;  5G2Z A;  4EF0 A;  1PKZ A;  2HT9 A;  1ABA A;  4JR6 A;  5FHI A;  3W8S A;  1F3A A;  3ZIT A;  5C04 A;  3GUR A;  1OE7 A;  3EMP A;  2A2P A;  1FOH A;  1GTA A;  4KDY A;  3N5O A;  4NHZ A;  4OMV A;  1C72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...