6GSVA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLSHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 82
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsvA01
5F8BA 1ZZYA 4TXOB 4PNFA 1AQVA 5INYA 1WIKA 3D22A 4OWYA 1QGVA 2ZCTA 4BWSA 5CYYA 2P31A 3P7XA 1OAZA 1GSSA 3RPNA 2H0HA 1TK5B 4IBPA 5JCGA 3L9UA 4E8EA 3KXOA 1HYUA 2IMIA 3M0FA 3IK7A 1QQ2A 4MF5A 4MJBA 1SL2B 6GSUA 1M7TA 1PA3A 4MJEA 2V41A 3TKSE 2J23A 3ZRDA 2B5XA 3ED3A 1YF0A 3LGCA 1K0MA 1S3DA 3HVVA 5G1LA 2MZCA 4PURA 1G7OA 2HXKA 4PQIA 3F4TA 1YDKA 2IFQB 3EU3A 2GZYA 1PL1A 1VF1A 2C80A 1OKDA 3UL3A 3PINA 1ERWA 1KEBA 1U87A 2WZ9A 4PQ1A 3F6FA 3SBCA 4TR3A 3TOUA 2HRFA 3LXTA 2IMFA 5DBQA 1ZL9A 2HSMB 3VFIA 2RUEA 3KP9A 3TKQA 4TR4A 3C73A 2YN1A 4WBRD 2E7PA 1GWCA 5KN0A 3TKRA 3ZLPA 2AYTA 1PQNA 1M2AA 2H8LA 1AQXA 2JZSA 1QMVA 1A2MA 2LTKA 4I2TA 2VD1A 2B1LA 2CQ9A 1VF2A 5C00A 2HYXA 3E3EA 3M1GA 3GKMA 2CA8A 1OC3A 4Q5QA 1FB6A 2CV4A 2R4VA 3BBYA 2WB9A 4L5LA 3KH7A 2XC2A 4K7OA 4MA9A 5ECKB 4O32A 2PN8A 1EP8A 2DJ2A 1YKAA 3LORA 4GLTA 2WGRA 1FVKA 5IPGA 5ECMB 2FD3A 3W8SA 7GSSA 3O3TA 2C0EA 5ECHB 3VPTA 4ECBA 4TXOA 4YQVA 4TR0A 1U6TA 1YEXA 3DVXA 2BMXA 1GSEA 4HQZA 1EOGA 5DALB 2CAQA 4BWQA 4G9HA 4ML6A 3LQ7A 2MMAA 3F8UA 5IMAA 2X8HA 4QL7A 2VLTA 3EU4A 3ISOA 5CO3A 2FA8A 3C7MA 1O8WA 3APSA 4ILFA 2B7JA 2DMMA 1M2DA 3GIXA 3H8QA 2I4AA 4L0UA 3IDVA 1BX9A 2WULA 2DBCA 1EZKA 2H6XA 2XHFA 1AAZA 2IFQA 3ERGA 4GSSA 3IPZA 2AHEA 4IHUA 3TDGA 20GSA 2OE0A 2X8CA 3F4RA 2GZZA 9GSSA 1HNAA 3GKXA 4Z7XA 1UVZA 3A5WA 2HSHA 1J9BA 2KOKA 2VCQA 1Y6EA 3TCOA 3WGXA 4CHSA 2JZTA 2DJ1A 4O7HA 1GSUA 5A4UA 1V9WA 3BCKA 2WDUA 2VL2C 2QKEA 1SD8A 4J57E 1B4PA 5GZZB 2OACA 4I8BA 1F3BA 2H74A 4LL4B 1E2YA 1JZWA 2V2GA 2VCZA 1K0NA 3PH9A 3GL5A 4ID0A 4IJIA 3FZ5A 5C04A 5ELAA 3ZVJA 1PD21 5DDLA 2GVPA 2L6DA 2VIMA 3UOMA 2YPMA 1XCCA 5E4WA 4P3YB 3VI7A 5CAXA 2DIZA 4ZBAA 2CZ3A 3CRUA 3HD5A 3CBUA 4CDOA 1Z9HA 3GYKA 2TIRA 2FWFA 4V1Ap 1XW9A 3L9SA 2O85A 2AUVA 2KP2A 1X9MB 4NHWA 2MMZA 3GSSA 3ME8A 1K3OA 3QPMA 2K18A 2OJLA 1SK1A 4BVYB 1XVQA 5DALA 4H86A 3RAZA 5CRDA 4Q5NA 3O6TA 5EVOA 2KP1A 2AB6A 2H30A 1J08A 5LNKe 2VM1A 1EOHA 3LG6A 1M99A 1B9YC 1HD2A 5D96A 1A8LA 3ZMKA 4PUFC 1GL8A 3VURA 3TKSC 5F07A 4MABA 4POKA 5CP1A 1U88A 3RDWA 3IOSA 4ZB6A 17GSA 3VK9A 3N5OA 4EDYA 2CAIA 4DSSB 2IN3A 4GTUA 3IV4A 3ZMLA 2YCDA 3TOTA 6GSXA 1XPVA 1EGRA 3A2VA 2GZPA 1EGOA 2OBIA 1U3AA 4IS0A 4HUAA 3L9VA 2GSRA 4K1FA 1TJDA 3D4TA 2X99A 1OE8A 4MMMA 4KSMA 14GSA 5F0GA 3IK9A 1I9DA 2PGTA 1KNGA 2X8GA 4IP1A 4RUVA 5L71A 3FKFA 5IMVA 4OFNA 3TJFA 2FNOA 5LCZA 2UZ8A 4ISDA 2JACA 5IOWA 4HJ2A 1THOA 3KM6A 1GSFA 2DJKA 3LXZA 2LRCA 2ON5A 1TXXA 4G0LA 2LV3A 2X64A 4XIHA 2EIRA 4MH3A 2H0IA 5DQSA 5KN1A 4XS4A 3TB2A 3H93A 1PKZA 1NM3A 2ES7A 1QK8A 4BVYA 1QFNA 2G0FA 2RM5A 5ID2B 2VL2A 3Q74A 2LRTA 1XWGA 4WF5A 2I81A 3GMFA 1VRSD 3L4NA 4TVEA 2LKUA 3CSIA 5FWGA 4HJMA 4ACSA 3GH6A 3HHVA 1K3YA 2F8FA 4ECJA 2LJKA 4XRAA 2IMKA 10GSA 2N5FA 4GCIA 1F37A 1GULA 2LSTA 3VLNA 2DJ3A 4GSTA 3Q19A 3TJKA 1OKTA 2N5AA 3IRAA 3P2AA 3FRCA 2L4CA 4FIWA 5IMDA 1V98A 2WRTA 3GURA 2C8UA 4HZ2A 4N10A 3TRPA 5D9XA 1OC8A 1XIYA 3GUSA 4WR4A 1SENA 3P90A 4BA7A 4KDUA 1TOFA 3R3EA 4EXJA 6GSWA 3MSZA 2YNXA 4F0BA 1F3AA 3TRXA 4YAVA 4IGJA 3HJOA 4KAEA 1USBA 2JSZA 3FR6A 2H6YA 2VCVA 4ZBBA 4MPFA 5D9VA 1NW2A 1PMTA 1JFUA 1TRVA 3QAWA 3VPQA 1TU7A 3HA9A 1YF1A 3D21A 5HR1A 2HQTA 2FHEA 4DSRA 5J9BA 3TKSA 3HCZA 3TJGA 3QMXA 4TOPA 4ZIJA 2OA7A 3GX0A 2LRNA 3DWVA 5A4VA 1MEKA 1MDJA 2B5YA 3UVTA 2CVDA 3G7YA 1Q98A 4IN0A 3U6VA 2VL3A 2C0GA 3ZREA 3G9BA 1T4ZA 1SU9A 4WF4A 5HFIA 2AV4A 2H73A 3E0UA 1HNCA 2P5QA 1U3IA 2DIYA 2EIOA 1RK4A 3BOAA 1XVWA 1I5GA 2H72A 3DKSA 3H4KA 1VF3A 2IMDA 2K9FA 2DMLA 4EC0A 3ZZXA 3WD6A 1TI1A 4PGTA 4RI7A 4TR1B 5IQYA 5ENUA 1O6JA 4AF2A 3APOA 2VUPA 4F9ZA 2CVKA 3KMOA 5CRWA 16GSA 2L57A 2A2SA 2R5GA 1TI3A 4G10A 1XW6A 1YQ1A 1SJIA 2ZNMA 1XZOA 4DSQA 1Y25A 4KCEA 2H1AA 2BJXA 2H71A 4FYBA 11GSA 1OC9A 1EV4A 2IPAA 3EYTA 2YV7A 3KTLA 4KGIA 3VI5A 4KE3A 1RQMA 2GQMA 3VWVA 1W4VA 1BEDA 3FZ4A 1GTBA 1O7UA 2JU5A 2H01A 3CMIA 1G6YA 2H75A 4BPYA 1XXUA 2GSTA 3FW2A 2HNLA 3KCMA 3ZIJA 2GTUA 2PU9C 1F9MA 1Z6NA 4N0VA 1FAAA 2VO4A 4OCEA 2VCXA 3I9V2 4MH2A 3CSHA 2FLSA 1A0FA 3WYWA 1URMA 2HZEB 3GSTA 2WJUA 1BJXA 1A2JA 3NIVA 4EUYA 3DYRA 2HLSA 4ZL7A 3D5JA 1HQOA 1K0DA 3RBTA 1M2BA 2LUSA 1O81A 5DCGA 3CTFA 3KEBA 4LA1A 3VWXA 18GSA 2HRKB 3I69A 3CYNA 1HNBA 1WJKA 3FYGA 5E59A 2P5RA 1NHOA 5DAKB 3WGDA 1SL0B 3KD0A 4EO3A 3WT1A 3M9KA 1SD9A 3F63A 4TN8A 4KNDA 2GGTA 2CT6A 3ERFA 1AIUA 1N8JA 1K3LA 2O89A 3C1RA 4NWYA 1DSBA 3PR8A 4JU5A 2YZUA 4OO5A 2XBQA 1JZRA 2IJYA 3A2WA 4G2EA 4F03A 1T4YA 1GSYA 2HFDA 2I9HA 4DEJA 2LEGA 1ON4A 3QFAC 4YQMA 2IIYA 5CRGA 2GDRA 1ZGNA 5KN2A 3GHAA 1GRXA 3GKNA 3K8NA 2HSMA 4PX1A 2XBIA 2AAWA 3AY8A 2FWGA 4DVCA 4QL9A 4L0WA 2YANA 4Q5RA 1Z7PA 3LWAA 3ERWA 5FT3A 4QQ7A 1DE2A 1PGTA 2PUKC 4HI7A 4K9ZA 5AN1A 4NV2A 1F2EA 3ZYWA 5A5KA 3FY7A 4GQCA 2GSQA 1K0AA 3R2QA 4KDYA 4O92A 4GXZA 3TJBA 1VF4A 1B4QA 4JR4A 4HDEA 2NTOA 1T7PB 4WR5A 4ML1A 2XPEA 2GT5A 2HSYA 4I5QA 2VOCA 4EL1A 2YZHA 3KH9A 3GTUB 5ECQB 1LJRA 2IMEA 2F8AA 4EKZA 2IWTA 2FWHA 1Z7RA 1IYHA 5H5QA 1SJZA 2V6KA 1SKWB 4OFMA 1B48A 4EVMA 1WP0A 4YAPA 4I97A 1K0OA 2L4QA 5GAND 3UBKA 5DQYA 1YZXA 1VGLA 3M3MA 1G6WA 1O73A 3LJRA 3QAVA 3EWLA 4L5OA 5CRHA 4ZL8A 3J7Yb 4AGSA 1AUCA 3D6IA 4KH7A 5EPFA 5D9WA 4MJCA 1G7EA 1M9BA 4MP4A 2F3MA 4EF0A 1JLWA 4IQ1A 1QUWA 1FVJA 6GSTA 2FA4A 1S3AA 2YJHA 3GV1A 2HRNA 2VD0A 3CTGA 1E6BA 3J7Yk 5H5RA 1X9SB 2DJ0A 5F06A 2VCTA 1R7HA 3F3QA 3DRNA 1GSDA 2ALBA 2YOIA 3EMXA 4BL7B 3HJPA 5G1KA 4BVXB 2O8VB 2WS2A 1GH2A 3US3A 3TRQA 5CNWA 5J4UA 4KA0A 1ABAA 5FHIA 2YWIA 1YKCA 1F6MC 1EEMA 1NSWA 1UN2A 3WT2A 1GTIA 2OKAA 4ZB8A 1TW9A 2WCIA 2JSYA 3BJ5A 5ECPB 4KCAA 1FOVA 4PQHA 13GSA 3I6AA 2ZUPA 1TDIA 3C8EA 3KIJA 2OBKA 3LYKA 2YWOA 1PX6A 4XTSA 5CREA 1YEPA 2O7KA 1QXHA 3ZL5A 5IO0A 3DVWA 2A2RA 5ECSA 2DC5A 1WMJA 4USSA 1WRYA 3HXSA 3IC8A 1BQ7A 3DIEA 2HZFA 1A2LA 3QFBC 3VWWA 5EY6A 2ON7A 3LSZA 1EP7A 3S9FA 1UC7A 2FUG2 2H66A 2L5OA 2Z9SA 4G0KA 4JZQA 1SK0A 2MYGA 3QCPA 4AJ7A 5GSSA 1PSQA 2VAFA 1ERTA 3GRXA 1Z5YE 2RUFA 3HVSA 2D2ZA 5IO2A 2PPTA 4HU7A 1NHYA 3A3TA 3I43A 5ECIB 5H5SA 2R37A 3F3RA 1T1VA 2VLVA 2K8VA 2L59A 1JHBA 3EINA 2M80A 2LNTA 1PRXA 2LQQA 5G5FA 2K8SA 3C71A 3RPPA 1JZOA 4K2DA 4KUNA 4POBA 1SKRB 3UBLA 3QR6A 3V1WA 3M9JA 1O85A 2H70A 5G2ZA 1AXDA 4ECIA 1G0TA 4DSSA 2YP6A 3GX8A 5BMUA 4BL7A 2K6VA 1WWJA 4MF6A 3TJJA 1GUKA 1BAYA 1A23A 5HFGA 1GNEA 1EWXA 5F05A 5HQPA 3IR4A 2M46A 4K0GA 4MZCA 2MBSA 4N0ZA 3UVHA 4K8MA 5DJLA 2HE3A 4XCSA 3UMAA 4WXTA 4FO5A 3RHBA 2B6MA 3KP8A 1H75A 4YQUA 3ZVJD 4AJ6A 3DGQA 4HU9A 4KB3A 1EV9A 4FH8A 1V57A 3KJYA 4G19A 5EL8A 3GL3A 1OE7A 3KTBA 1WOUA 3CSJA 1ZCPA 3BD2A 3D0ZA 3NZNA 5ELGA 1DUGA 2F51A 3HZ4A 2LNSA 5DCHA 4F82A 2A4VA 2YWMA 3ZFBA 3QD9A 2PMTA 2C0FA 1CQGA 4PNGA 1M0UA 1WPIA 2E2MA 4IVFA 4EDZA 2R2JA 5AGYA 1SL1B 4MZBA 1BG5A 2V32A 1T3BA 2GQKA 1TU8A 4OMVA 4JEDA 1Q4JA 4XRDA 4MLYA 3SWLA 5ID2A 3DMLA 2YV9A 1LU4A 4MZWA 4IJ3A 1ERUA 4TRXA 3KZQA 4K7IA 2JL4A 4V2NA 1X5DA 2C3QA 2GQLA 4ECCA 3F6DA 2B1KA 1GUHA 3FEUA 1N2AA 2YWNA 3IAM2 3IBHA 2REMA 2M72A 1FO5A 1TTZA 4KDXA 2LJRA 3PGTA 5HR0A 4TW5A 4HOJA 1XFLA 3D4MA 3KMNA 2FCHA 1AQWA 1AC1A 3GNJA 4X1UA 1TRWA 2KHPA 4XS6A 5J3RA 2C1YA 2N5BA 5JWOB 3E9JB 4HEA2 4YH2A 4MF7A 5ECNB 6GSSA 4LMVA 2QGVA 2F9SA 2H19A 2EC4A 5IM9A 3L78A 1KBNA 4OFTA 4KW6A 4NPBA 1TK0B 5COHA 4FYCA 3DD3A 3FR3A 5HR3A 4FYUA 3ZIVA 3F0IA 1GTUA 5B8BA 3QAGA 1GNWA 2I3YA 3L0HA 3G7IA 2QC7A 4IP6A 2WFCA 4WKWA 2B7KA 1ERVA 1X5CA 2OE1A 3QOUA 2FY6A 2O87A 1MD4A 1ZYEA 4ULXA 4XHMA 2CZ2A 4NHZA 2VCWA 4OD7A 1TP9A 2VM2A 3EC3A 5KEJA 2PWJA 1O8XA 2H1BA 2AJQB 2E0QA 3ZFLA 5DVBA 5AIXA 3HZ8A 1EEJA 2NBSA 2GT6A 4KSOA 3RHCA 1WE0A 3EVIA 3G7JA 2CVBA 3U5RE 4LL1B 4X0XA 4HQSA 4TR1A 4PXOA 1AW9A 3FK8A 4RQXA 4J56E 3TUEA 5IPHA 3LFLA 5HFKA 3ME7A 1IYIA 4NAXA 5DJMA 1XWAA 1X9WB 4PUAA 5ECLB 2C3TA 5LD0A 1JLVA 3ZTLA 1R4WA 3HY2A 2RIIA 2NVLA 5B6MA 3O76A 1ZMAA 1ML6A 2GLRA 2GSSA 3UEMA 4MK3A 4F2IA 2V1MA 1DBYA 2NDOA 1YY7A 2HI7A 4D73B 5D93A 2B5EA 3LYPA 1Z6MA 4V2MA 4AJ8A 1JZDA 4Q5FA 3ZITA 3W6GA 2C0DA 3HJMA 2OE3A 2HSNB 2DSAA 2KLXA 1J0FA 8GSSA 2B3SA 5ECOB 1XWKA 3CRTA 1R26A 3FZAA 3HYPA 5ABRA 3MDKA 4GF0A 4PTSA 4FQUA 3TGZA 1CQHA 3EMPA 2L5LA 1SJ6A 2JZRA 2HZEA 4KX4A 4O5RA 3HKRA 1FW1A 5J41A 3UAPA 1ZYQB 1GTAA 1GUMA 2VL9A 3UIWA 4I6XA 1PL2A 2HRKA 1GP1A 1K0CA 1H4OA 1W89A 3IA1A 3MWHA 3IHQA 5IOXA 5DAKA 1YJ6A 2PERA 5AIVA 4GWRA 4ZBDA 4JRRA 1OVNA 1ACVA 2E2GA 4XS4B 3N9JA 2HRAA 2FGXA 1M9AA 1GLQA 3GA4A 1B9XC 3HVXA 3MNGA 1X0RA 1ST9A 1Z3EA 4K6XA 2J9HA 3JCML 3IE3A 4I2UA 5B7CA 2YJ7A 1A8YA 3DXBA 4IW9A 3NOFA 5AISA 4J2FA 1A0RP 1DE1A 1V2AA 4ZL9A 4OO4A 2TRXA 5HR2A 4EE0A 2GS3A 4D73A 5GAPD 5G31A 1XOAA 2CX3A 1K0BA 2CX4A 3TKPA 5D8IA 3KGKA 1TKDB 4LLRA 4F0CA 1R5PA 4HS1A 4KF9A 2I1UA 5J5NA 3WGEA 1RW1A 2LS5A 2JADA 1KTEA 3IAS2 4GQFA 3Q6OA 3GFKA 3FHKA 4MCUA 2H6ZA 2OADA 1GSQA 5D73A 1XW5A 1S3CA 4N11A 1PN9A 1X5EA 5B8AA 2HT9A 1FHEA 1R5AA 5IMZA 5JWQB 4L8EA 1XWBA 5IMFA 3QDNA 4ZILA 1TK8B 3UARA 4WBJA 5B6NA 3UJ1A 5JCWA 3GTUA 2BTOT 2R6KA 3M8NA 3MAKA 4E8HA 4CW9A 5D9TA 1XBSA 2H0GA 1XWCA 4RQRA 4HZ4A 3FR9A 4X43A 5IMCA 4JE1A 12GSA 2FWEA 2LJAA 3H1NA 1ZOFA 4IKHA 2R3XA 3IXRA 2C3NA 3OR5A 5JWRB 4G0IA 4N30A 3HDCA 2PBJA 4NMUA 4JR6A 2KUCA 6GSVA 5JCUA 3EE2A 5G30A 1OYJA 2XPDA 1ILOA 3P8WA 1XOBA 4GRFA 4NXIA 2PVQA 1MD3A 3DEXA 2DLXA 2P0GA 1MTCA 3F4SA 2L6CA 1UA5A 4IELA 2PVOC 4K0NA 1PX7A 1FG4A 4JBBA 4BVXA 2RLIA 4TKYA 3FZ9A 3LEFA 1SK2A 4WEYA 2MMOA 3GH9A 1C72A 1MDIA 2NPBA 19GSA 2MMNA 3APQA 4NV5A 4ZB9A 3A2XA 4MDCA 1A24A 5GSTA 2DJJA 3C1SA 4LMWA 3F9UA 1OC9B 2IL3A 3VWUA 1SYXA 2QSIA 3H79A 1SKSB 3BCIA 5IIZA 1V40A 5ECRB 2EIQA 1THXA 4POMA 1SYRA 4V2LA 4MPGA 5A4WA 4V1Ag 2H76A 4ZXGA 2RM6A 3EURA 5KN3A 5J9CA 2MBTA 1V58A 1TRUA 3Q18A 6GSYA 4OCFA 4TXVA 4K7NA 4WETA 4POLA 2H1DA 1LBKA 1T00A 1MDKA 3PPUA 2V6OA 2VLUA 5G5EA 4XS1A 1BYEA 2TRCP 4RI6A 2G2QA 1TRSA 4IQAA 3IC4A 4MJAA 1FB0A 22GSA 4GSNA 1T8EB 1GLPA 1B8XA 3GN3A 2LQOA 3W8JA 3GKKA 2H1GA 1PKWA 2C4JA 3CXGA
chains in the Genus database with same CATH superfamily
5F8BA 1ZZYA 4TXOB 4PNFA 1AQVA 5INYA 1WIKA 4GDFA 3D22A 4OWYA 1QGVA 2ZCTA 4BWSA 5CYYA 2P31A 3P7XA 5BRTA 1OAZA 1GSSA 3RPNA 2H0HA 1TK5B 4IBPA 5JCGA 3L9UA 2WW2A 4E8EA 3KXOA 1HYUA 2IMIA 3M0FA 3IK7A 1QQ2A 4MF5A 4MJBA 1SL2B 6GSUA 1M7TA 1PA3A 4MJEA 2V41A 1BF5A 3TKSE 2J23A 3ZRDA 2B5XA 3ED3A 1YF0A 3LGCA 1K0MA 1S3DA 3HVVA 5G1LA 2MZCA 4PURA 1G7OA 2HXKA 4PQIA 3F4TA 1YDKA 2IFQB 3EU3A 2GZYA 1PL1A 1VF1A 2C80A 1OKDA 3UL3A 3PINA 1ERWA 1KEBA 1U87A 2WZ9A 4PQ1A 3F6FA 3SBCA 4TR3A 3TOUA 2HRFA 3LXTA 2IMFA 5DBQA 1ZL9A 2HSMB 3VFIA 2RUEA 3KP9A 3TKQA 4TR4A 3C73A 2YN1A 4WBRD 2E7PA 1GWCA 5KN0A 3TKRA 3ZLPA 2AYTA 2WW1A 1PQNA 1M2AA 2H8LA 1AQXA 2JZSA 1QMVA 1A2MA 2LTKA 4I2TA 2VD1A 2B1LA 2CQ9A 1VF2A 5C00A 2HYXA 2EFHA 3E3EA 3M1GA 3GKMA 2CA8A 1OC3A 4Q5QA 1FB6A 2CV4A 2R4VA 3BBYA 2WB9A 4L5LA 3KH7A 2XC2A 4K7OA 4MA9A 5ECKB 4O32A 2PN8A 1EP8A 2DJ2A 1YKAA 3LORA 4GLTA 2WGRA 1FVKA 5IPGA 5ECMB 2FD3A 3W8SA 2A2PA 7GSSA 3O3TA 2C0EA 5ECHB 3VPTA 4ECBA 4TXOA 5A5HB 4YQVA 4TR0A 1U6TA 1YEXA 3DVXA 2BMXA 1GSEA 4HQZA 1EOGA 5DALB 2CAQA 4BWQA 4G9HA 4ML6A 3LQ7A 3CWGA 2MMAA 3F8UA 5IMAA 2X8HA 4QL7A 2VLTA 3EU4A 3ISOA 5CO3A 2FA8A 3C7MA 1O8WA 3APSA 4Z2UA 4ILFA 2B7JA 2DMMA 1M2DA 3GIXA 3H8QA 2I4AA 4L0UA 3IDVA 1BX9A 2WULA 2DBCA 1EZKA 2H6XA 2XHFA 1AAZA 2IFQA 3ERGA 4GSSA 3IPZA 2AHEA 3CQFA 4IHUA 3TDGA 20GSA 2OE0A 2X8CA 3F4RA 2GZZA 9GSSA 1HNAA 3GKXA 4Z7XA 1UVZA 3A5WA 2HSHA 4ZB7A 1J9BA 2KOKA 2VCQA 1Y6EA 3TCOA 3WGXA 4CHSA 2JZTA 2DJ1A 4O7HA 1GSUA 5A4UA 1V9WA 3BCKA 2WDUA 2VL2C 2QKEA 1SD8A 4J57E 1B4PA 5GZZB 2OACA 4I8BA 1F3BA 2H74A 4LL4B 1E2YA 1JZWA 2V2GA 2VCZA 1K0NA 4K5RA 3PH9A 3GL5A 1BG1A 4ID0A 4IJIA 3FZ5A 1Y1UA 5C04A 5ELAA 3ZVJA 1PD21 5DDLA 2GVPA 2L6DA 2VIMA 3UOMA 2YPMA 1XCCA 5E4WA 4P3YB 3VI7A 5CAXA 2DIZA 4ZBAA 2CZ3A 3CRUA 3HD5A 3CBUA 4CDOA 1Z9HA 3GYKA 2TIRA 2FWFA 4V1Ap 1XW9A 3L9SA 2O85A 2AUVA 2KP2A 1X9MB 4NHWA 2MMZA 3GSSA 3ME8A 1K3OA 5A5HA 3QPMA 2K18A 2OJLA 5KOXA 1SK1A 4BVYB 1XVQA 5DALA 4H86A 3RAZA 5CRDA 4Q5NA 3O6TA 5EVOA 2KP1A 2AB6A 2H30A 1J08A 5LNKe 2VM1A 1EOHA 3LG6A 1M99A 1B9YC 1HD2A 5D96A 1A8LA 3ZMKA 4PUFC 1GL8A 5A1NB 3VURA 3TKSC 5F07A 4MABA 4POKA 5CP1A 1U88A 3RDWA 3IOSA 4ZB6A 17GSA 3VK9A 3N5OA 4EDYA 2CAIA 4DSSB 2IN3A 4GTUA 3IV4A 3ZMLA 5BMUB 2YCDA 3TOTA 4CY6A 4X4JA 6GSXA 1XPVA 1EGRA 3A2VA 2GZPA 1EGOA 2OBIA 1U3AA 4IS0A 4HUAA 3L9VA 2O5VA 2GSRA 4K1FA 1TJDA 3D4TA 2X99A 2X4AA 1OE8A 4MMMA 4KSMA 14GSA 5F0GA 3IK9A 1I9DA 1PFOA 2PGTA 1KNGA 2X8GA 4IP1A 4RUVA 5L71A 3FKFA 5IMVA 4OFNA 3TJFA 2FNOA 5LCZA 2UZ8A 4ISDA 2JACA 5IOWA 4HJ2A 4K2XA 4MNNA 1THOA 3KM6A 1GSFA 2DJKA 3LXZA 2LRCA 2ON5A 1TXXA 4G0LA 2LV3A 2X64A 4XIHA 2EIRA 4MH3A 2WVXB 2O36A 2H0IA 5DQSA 5KN1A 2EFCA 4XS4A 3TB2A 3H93A 1PKZA 1NM3A 2ES7A 2VKZG 1QK8A 4BVYA 1QFNA 2G0FA 2RM5A 5ID2B 2VL2A 3Q74A 2LRTA 1XWGA 4WF5A 2I81A 3GMFA 1VRSD 3L4NA 4TVEA 2LKUA 3CSIA 5FWGA 4HJMA 4ACSA 3GH6A 3HHVA 1K3YA 2F8FA 4ECJA 2LJKA 4XRAA 2IMKA 10GSA 2N5FA 4GCIA 1F37A 1S3RA 1GULA 2LSTA 3VLNA 2DJ3A 4GSTA 3Q19A 3TJKA 1OKTA 2N5AA 3IRAA 2EFDA 3P2AA 3FRCA 2L4CA 4FIWA 5IMDA 1V98A 2WRTA 3GURA 2C8UA 4HZ2A 4N10A 3TRPA 5D9XA 1OC8A 1XIYA 3GUSA 4WR4A 1SENA 3P90A 1N25A 4BA7A 4KDUA 1TOFA 3R3EA 4EXJA 6GSWA 3MSZA 2YNXA 4F0BA 1F3AA 1SVMA 3TRXA 4YAVA 4IGJA 3HJOA 4KAEA 1USBA 2JSZA 3FR6A 2H6YA 2VCVA 4ZBBA 4MPFA 5D9VA 1NW2A 1PMTA 1JFUA 1TRVA 3QAWA 3VPQA 1TU7A 3HA9A 1YF1A 3D21A 5HR1A 2HQTA 2FHEA 4DSRA 5J9BA 3TKSA 3HCZA 3TJGA 3QMXA 4TOPA 4ZIJA 2OA7A 3GX0A 2LRNA 3DWVA 5A4VA 1MEKA 1MDJA 2B5YA 3UVTA 2CVDA 3G7YA 1Q98A 4IN0A 3U6VA 2VL3A 2C0GA 3ZREA 3G9BA 1T4ZA 4N3ZA 1SU9A 2H1LA 4WF4A 5HFIA 2AV4A 2H73A 3E0UA 1HNCA 2P5QA 1U3IA 2DIYA 2EIOA 1RK4A 3BOAA 1XVWA 1I5GA 2H72A 3DKSA 3H4KA 1VF3A 2IMDA 2K9FA 2DMLA 4EC0A 3ZZXA 2WVZA 3WD6A 1TI1A 4PGTA 4RI7A 4TR1B 5IQYA 5ENUA 1O6JA 4AF2A 3APOA 5A34B 2VUPA 4F9ZA 2CVKA 3KMOA 5CRWA 16GSA 4QMKA 2L57A 2A2SA 3A5IA 2R5GA 1TI3A 4G10A 1XW6A 1YQ1A 1SJIA 2ZNMA 1XZOA 4DSQA 1Y25A 4KCEA 2H1AA 2BJXA 2H71A 4FYBA 11GSA 1OC9A 1EV4A 2IPAA 5J4YA 3EYTA 2YV7A 3KTLA 4KGIA 3VI5A 4KE3A 1RQMA 2GQMA 5KOWA 3VWVA 1W4VA 1BEDA 3FZ4A 1GTBA 4PI0C 1O7UA 2JU5A 2H01A 3CMIA 1G6YA 2H75A 4BPYA 1XXUA 2GSTA 3FW2A 2HNLA 3KCMA 3ZIJA 2GTUA 4AKIA 2A4HA 2PU9C 1F9MA 1Z6NA 4N0VA 1FAAA 2VO4A 4OCEA 2VCXA 3I9V2 4MH2A 3CSHA 2FLSA 1A0FA 3WYWA 1URMA 2HZEB 3GSTA 2WJUA 1BJXA 1A2JA 3NIVA 4EUYA 3DYRA 2HLSA 4ZL7A 3D5JA 1HQOA 1K0DA 3RBTA 1M2BA 2LUSA 1O81A 5DCGA 3CTFA 3KEBA 4LA1A 3VWXA 18GSA 2HRKB 3I69A 3CYNA 1HNBA 1WJKA 3FYGA 1S4BP 5E59A 2P5RA 1NHOA 5DAKB 3WGDA 1SL0B 3KD0A 3MIXA 4EO3A 3WT1A 3M9KA 1SD9A 3F63A 4TN8A 4KNDA 2GGTA 2CT6A 3ERFA 1AIUA 1N8JA 1K3LA 5A34A 2O89A 3C1RA 3IHGA 4NWYA 1DSBA 3PR8A 4JU5A 2YZUA 4OO5A 2XBQA 1JZRA 2IJYA 3A2WA 4G2EA 4F03A 1T4YA 1GSYA 2HFDA 2I9HA 2WW0A 4DEJA 2LEGA 1ON4A 3QFAC 4YQMA 2IIYA 5CRGA 2GDRA 4AKGA 1ZGNA 5KN2A 3GHAA 1GRXA 5J40A 3GKNA 3K8NA 2HSMA 4PX1A 2XBIA 2AAWA 3AY8A 2FWGA 4DVCA 4QL9A 4L0WA 2YANA 4Q5RA 1Z7PA 3LWAA 3ERWA 5FT3A 4QQ7A 1DE2A 1PGTA 2PUKC 4HI7A 4K9ZA 5AN1A 4NV2A 1F2EA 3ZYWA 5A5KA 3FY7A 2DKIA 4GQCA 2GSQA 1K0AA 3R2QA 4KDYA 4O92A 4GXZA 3TJBA 1VF4A 3FMWA 1B4QA 4JR4A 4HDEA 2NTOA 1T7PB 4WR5A 4ML1A 2XPEA 2GT5A 2HSYA 4I5QA 2VOCA 4EL1A 2YZHA 4AKXB 3KH9A 3GTUB 5ECQB 1LJRA 2IMEA 2F8AA 4EKZA 2IWTA 2FWHA 1Z7RA 1IYHA 5H5QA 4YKFA 1SJZA 2V6KA 1SKWB 4OFMA 1B48A 4EVMA 1WP0A 4YAPA 4I97A 1K0OA 2L4QA 5GAND 3UBKA 5DQYA 1YZXA 1VGLA 3M3MA 1G6WA 1O73A 4G01A 3LJRA 3QAVA 3EWLA 4L5OA 5CRHA 4ZL8A 3J7Yb 4AGSA 1AUCA 3D6IA 4KH7A 1SVLA 2R0CA 5EPFA 5D9WA 4MJCA 1G7EA 1M9BA 4MP4A 2F3MA 4EF0A 1JLWA 4IQ1A 1QUWA 1FVJA 6GSTA 2FA4A 1XG8A 1S3AA 2YJHA 4CY8A 3GV1A 2HRNA 2VD0A 3CTGA 1E6BA 3J7Yk 1M3JA 5H5RA 1X9SB 2DJ0A 5F06A 2VCTA 1R7HA 3F3QA 3DRNA 1GSDA 2ALBA 2YOIA 3EMXA 4BL7B 3HJPA 5G1KA 4BVXB 2O8VB 2WS2A 1GH2A 3US3A 3TRQA 5CNWA 5J4UA 4KA0A 1ABAA 5FHIA 2YWIA 1YKCA 1F6MC 1EEMA 1NSWA 1UN2A 3WT2A 1GTIA 2WZSA 2OKAA 4ZB8A 1TW9A 2WCIA 2JSYA 3BJ5A 5ECPB 4KCAA 1FOVA 4PQHA 13GSA 1ZYPA 3I6AA 2ZUPA 1TDIA 3C8EA 3KIJA 2OBKA 3LYKA 2YWOA 1PX6A 2X49A 4XTSA 5CREA 1YEPA 2O7KA 1QXHA 3ZL5A 4AI6A 5IO0A 3DVWA 2A2RA 5ECSA 2DC5A 4E68A 1WMJA 4USSA 1WRYA 3HXSA 3IC8A 1BQ7A 3DIEA 2HZFA 4AKHA 1A2LA 3QFBC 3VWWA 3LW9A 5EY6A 2ON7A 3LSZA 1EP7A 3S9FA 1UC7A 2FUG2 2H66A 2L5OA 2Z9SA 4G0KA 4JZQA 1SK0A 2MYGA 3QCPA 4AJ7A 5GSSA 1PSQA 2VAFA 1ERTA 3GRXA 1Z5YE 2RUFA 3HVSA 2D2ZA 5IO2A 2PPTA 4HU7A 1NHYA 3A3TA 3I43A 5ECIB 2DKHA 5H5SA 2R37A 3F3RA 3CHXC 1T1VA 2VLVA 2K8VA 2L59A 1JHBA 3EINA 2M80A 2LNTA 1PRXA 2LQQA 5G5FA 2K8SA 3C71A 3RPPA 1JZOA 4K2DA 4KUNA 5A1NA 4POBA 1SKRB 3UBLA 3QR6A 2QA2A 3V1WA 3M9JA 1O85A 2H70A 5G2ZA 1AXDA 4ECIA 1G0TA 4DSSA 2YP6A 3GX8A 5BMUA 4BL7A 2K6VA 1WWJA 4MF6A 3TJJA 1GUKA 1BAYA 1A23A 5HFGA 1GNEA 1EWXA 5F05A 5HQPA 3IR4A 2M46A 4K0GA 4MZCA 2MBSA 4N0ZA 3UVHA 4K8MA 5DJLA 2HE3A 4XCSA 3UMAA 4WXTA 4FO5A 3RHBA 2B6MA 3KP8A 1H75A 4YQUA 3ZVJD 4AJ6A 3DGQA 4HU9A 4KB3A 1EV9A 4FH8A 1V57A 3KJYA 4G19A 1FOHA 5EL8A 3GL3A 1OE7A 3KTBA 1WOUA 3CSJA 1ZCPA 3BD2A 3D0ZA 4PHZC 3NZNA 5ELGA 1DUGA 2F51A 3HZ4A 2LNSA 5DCHA 4F82A 2A4VA 2EFEA 2YWMA 3ZFBA 3QD9A 2PMTA 2C0FA 2WVXA 1CQGA 2QA1A 4PNGA 1M0UA 1WPIA 2E2MA 4IVFA 4EDZA 2R2JA 5AGYA 1SL1B 4MZBA 1BG5A 2V32A 1T3BA 2GQKA 1TU8A 4OMVA 4JEDA 1Q4JA 4XRDA 4MLYA 3SWLA 5ID2A 3DMLA 2YV9A 1LU4A 4MZWA 4IJ3A 1ERUA 4TRXA 3MYDA 3KZQA 4K7IA 2JL4A 4V2NA 1X5DA 2C3QA 2GQLA 4ECCA 3F6DA 2B1KA 1GUHA 3FEUA 1N2AA 2YWNA 3IAM2 3IBHA 2REMA 2M72A 1FO5A 1TTZA 4KDXA 1YVLA 2LJRA 3PGTA 5HR0A 4TW5A 4HOJA 1XFLA 3D4MA 2O3EA 3KMNA 1PN0A 1AQWA 2FCHA 4HSCX 1AC1A 3GNJA 4X1UA 1TRWA 2KHPA 4XS6A 5J3RA 2C1YA 2N5BA 5JWOB 3E9JB 4HEA2 4YH2A 4MF7A 5ECNB 6GSSA 4LMVA 4O5QA 2QGVA 2F9SA 2H19A 2EC4A 5IM9A 3L78A 1KBNA 1SVOA 4OFTA 4KW6A 4NPBA 4EIQA 5J47A 3TU3B 1TK0B 5COHA 4FYCA 3DD3A 3FR3A 5HR3A 4FYUA 3ZIVA 3F0IA 1GTUA 5B8BA 3RGBC 3QAGA 1GNWA 2I3YA 4EIPA 3L0HA 3G7IA 2QC7A 4IP6A 2WFCA 5J4VA 4WKWA 2B7KA 1ERVA 1TXUA 1X5CA 2OE1A 3QOUA 2FY6A 2O87A 1MD4A 1ZYEA 4ULXA 4XHMA 2CZ2A 4NHZA 2VCWA 4OD7A 1TP9A 2VM2A 3EC3A 5KEJA 2PWJA 1O8XA 2H1BA 2AJQB 2E0QA 3ZFLA 5DVBA 5AIXA 3HZ8A 1EEJA 2R0GA 2NBSA 2GT6A 4KSOA 3RHCA 1WE0A 3EVIA 3G7JA 2CVBA 3U5RE 2OT3A 4LL1B 4X0XA 4HQSA 4TR1A 4PXOA 1AW9A 3FK8A 4RQXA 4J56E 3TUEA 5IPHA 3LFLA 5HFKA 3ME7A 1IYIA 4NAXA 5DJMA 1XWAA 1X9WB 4PUAA 5ECLB 2C3TA 5LD0A 1JLVA 3ZTLA 1R4WA 3HY2A 2RIIA 2NVLA 5B6MA 3O76A 1ZMAA 1ML6A 2GLRA 2GSSA 3UEMA 4MK3A 4F2IA 2V1MA 1DBYA 2NDOA 1YY7A 2HI7A 4D73B 5D93A 2B5EA 3LYPA 1Z6MA 4V2MA 4AJ8A 1JZDA 4Q5FA 3ZITA 3W6GA 2C0DA 3HJMA 2OE3A 2HSNB 2DSAA 2KLXA 1J0FA 1M3IA 8GSSA 2B3SA 3HVNA 5ECOB 1XWKA 3CRTA 1R26A 3FZAA 3HYPA 5ABRA 3MDKA 4GF0A 4PTSA 4FQUA 3TGZA 4Z2RA 1CQHA 3EMPA 2L5LA 1SJ6A 2JZRA 2HZEA 4KX4A 4O5RA 3HKRA 1FW1A 5J41A 3UAPA 1ZYQB 1GTAA 1GUMA 2VL9A 3UIWA 4I6XA 1PL2A 2HRKA 1GP1A 1K0CA 3EPTA 1H4OA 1W89A 3IA1A 3MWHA 3IHQA 4ICYA 5DAKA 5IOXA 4O5UA 1YJ6A 2PERA 5AIVA 2UV8G 4GWRA 4ZBDA 4JRRA 1OVNA 1ACVA 2E2GA 4XS4B 3N9JA 2HRAA 2FGXA 1M9AA 1GLQA 3GA4A 1B9XC 3HVXA 3MNGA 1X0RA 1ST9A 1Z3EA 4K6XA 2J9HA 3JCML 3IE3A 4I2UA 5B7CA 2YJ7A 1A8YA 3DXBA 4IW9A 3NOFA 5AISA 4J2FA 1A0RP 1DE1A 2WW3A 2R0PA 1V2AA 4ZL9A 4OO4A 2TRXA 4BIKA 5HR2A 4EE0A 2GS3A 4D73A 5GAPD 5G31A 1XOAA 2CX3A 1K0BA 2CX4A 3TKPA 5D8IA 3KGKA 1TKDB 4LLRA 2HSNA 4F0CA 4PI2C 1R5PA 4HS1A 2WVYA 4KF9A 2I1UA 5J5NA 3WGEA 1RW1A 2LS5A 2JADA 1KTEA 3IAS2 4GQFA 1ZYNA 3RFRC 3Q6OA 1YEWC 3GFKA 3FHKA 4MCUA 2H6ZA 2OADA 1GSQA 5D73A 1XW5A 1S3CA 4N11A 1PN9A 1X5EA 5B8AA 4Z2TA 2HT9A 1FHEA 1R5AA 5IMZA 5JWQB 4L8EA 1XWBA 5IMFA 3QDNA 4ZILA 1TK8B 4A5PA 3UARA 4WBJA 4FXYP 5B6NA 3UJ1A 5JCWA 3GTUA 4YKGA 2BTOT 2R6KA 3M8NA 3MAKA 4E8HA 4CW9A 5D9TA 3HMJG 1XBSA 2H0GA 1XWCA 4RQRA 4HZ4A 3FR9A 4X43A 5IMCA 4JE1A 12GSA 2FWEA 2LJAA 3H1NA 1ZOFA 4IKHA 2R3XA 3IXRA 2C3NA 3OR5A 5JWRB 4G0IA 4N30A 3HDCA 2PBJA 4NMUA 4JR6A 2KUCA 6GSVA 5JCUA 3EE2A 5G30A 1OYJA 2XPDA 1ILOA 3P8WA 4W66A 1XOBA 4GRFA 4NXIA 2PVQA 1MD3A 3DEXA 2DLXA 2P0GA 1MTCA 3F4SA 2L6CA 1UA5A 4IELA 2PVOC 4K0NA 1PX7A 1FG4A 4JBBA 4BVXA 2RLIA 4TKYA 3FZ9A 3LEFA 1SK2A 4WEYA 2MMOA 3GH9A 1C72A 1MDIA 2NPBA 19GSA 2MMNA 3APQA 4NV5A 4ZB9A 3A2XA 4MDCA 1A24A 5GSTA 2DJJA 3C1SA 4LMWA 3F9UA 1OC9B 2IL3A 3VWUA 1SYXA 2QSIA 1I1IP 3H79A 1SKSB 3BCIA 5IIZA 1V40A 5ECRB 2EIQA 1THXA 4POMA 1SYRA 4V2LA 4MPGA 5A4WA 4V1Ag 4K5SA 2H76A 4ZXGA 2RM6A 3EURA 5KN3A 5J9CA 2MBTA 1V58A 1TRUA 3Q18A 6GSYA 4OCFA 4TXVA 4K7NA 4WETA 4POLA 2H1DA 1LBKA 1T00A 1MDKA 3PPUA 2V6OA 2VLUA 5G5EA 4XS1A 1BYEA 2TRCP 4RI6A 2G2QA 1TRSA 4IQAA 3IC4A 4MJAA 1FB0A 22GSA 4GSNA 1T8EB 1GLPA 1B8XA 3GN3A 2LQOA 3W8JA 3GKKA 2H1GA 1PKWA 2C4JA 3CXGA
chains in the Genus database with same CATH topology
5F8BA 1ZZYA 4TXOB 4PNFA 1AQVA 5INYA 1WIKA 4GDFA 3D22A 4OWYA 1QGVA 2ZCTA 4BWSA 5CYYA 2P31A 3P7XA 5BRTA 1OAZA 1GSSA 3RPNA 2H0HA 1TK5B 4IBPA 5JCGA 3L9UA 4E8EA 3KXOA 1HYUA 2IMIA 3M0FA 3IK7A 1QQ2A 4MF5A 4MJBA 1SL2B 6GSUA 1M7TA 1PA3A 4MJEA 2V41A 1BF5A 3TKSE 2J23A 3ZRDA 2B5XA 3ED3A 1YF0A 3LGCA 1K0MA 1S3DA 3HVVA 5G1LA 2MZCA 4PURA 1G7OA 2HXKA 4PQIA 3F4TA 1YDKA 2IFQB 3EU3A 2GZYA 1PL1A 1VF1A 2C80A 1OKDA 3UL3A 3PINA 1ERWA 1KEBA 1U87A 2WZ9A 4PQ1A 3F6FA 3SBCA 4TR3A 3TOUA 2HRFA 3LXTA 2IMFA 5DBQA 1ZL9A 2HSMB 3VFIA 2RUEA 3KP9A 3TKQA 4TR4A 3C73A 2YN1A 4WBRD 2E7PA 1GWCA 5KN0A 3TKRA 3ZLPA 2AYTA 1PQNA 1M2AA 2H8LA 1AQXA 2JZSA 1QMVA 1A2MA 2LTKA 4I2TA 2VD1A 2B1LA 2CQ9A 1VF2A 5C00A 2HYXA 2EFHA 3E3EA 3M1GA 3GKMA 2CA8A 1OC3A 4Q5QA 1FB6A 2CV4A 2R4VA 3BBYA 2WB9A 4L5LA 3KH7A 2XC2A 4K7OA 4MA9A 5ECKB 4O32A 2PN8A 1EP8A 2DJ2A 1YKAA 3LORA 4GLTA 2WGRA 1FVKA 5IPGA 5ECMB 2FD3A 3W8SA 2A2PA 7GSSA 3O3TA 2C0EA 5ECHB 3VPTA 4ECBA 4TXOA 5A5HB 4YQVA 4TR0A 1U6TA 1YEXA 3DVXA 2BMXA 1GSEA 4HQZA 1EOGA 5DALB 2CAQA 4BWQA 4G9HA 4ML6A 3LQ7A 3CWGA 2MMAA 3F8UA 5IMAA 2X8HA 4QL7A 2VLTA 3EU4A 3ISOA 5CO3A 2FA8A 3C7MA 1O8WA 3APSA 4Z2UA 4ILFA 2B7JA 2DMMA 1M2DA 3GIXA 3H8QA 2I4AA 4L0UA 3IDVA 1BX9A 2WULA 2DBCA 1EZKA 2H6XA 2XHFA 1AAZA 2IFQA 3ERGA 4GSSA 3IPZA 2AHEA 4IHUA 3TDGA 20GSA 2OE0A 2X8CA 3F4RA 2GZZA 9GSSA 1HNAA 3GKXA 4Z7XA 1UVZA 3A5WA 2HSHA 4ZB7A 1J9BA 2KOKA 2VCQA 1Y6EA 3TCOA 3WGXA 4CHSA 2JZTA 2DJ1A 4O7HA 1GSUA 5A4UA 1V9WA 3BCKA 2WDUA 2VL2C 2QKEA 1SD8A 4J57E 1B4PA 5GZZB 2OACA 4I8BA 1F3BA 2H74A 4LL4B 1E2YA 1JZWA 2V2GA 2VCZA 1K0NA 4K5RA 3PH9A 3GL5A 1BG1A 4ID0A 4IJIA 3FZ5A 1Y1UA 5C04A 5ELAA 3ZVJA 1PD21 5DDLA 2GVPA 2L6DA 2VIMA 3UOMA 2YPMA 1XCCA 5E4WA 4P3YB 3VI7A 5CAXA 2DIZA 4ZBAA 2CZ3A 3CRUA 3HD5A 3CBUA 4CDOA 1Z9HA 3GYKA 2TIRA 2FWFA 4V1Ap 1XW9A 3L9SA 2O85A 2AUVA 2KP2A 1X9MB 4NHWA 2MMZA 3GSSA 3ME8A 1K3OA 5A5HA 3QPMA 2K18A 2OJLA 5KOXA 1SK1A 4BVYB 1XVQA 5DALA 4H86A 3RAZA 5CRDA 4Q5NA 3O6TA 5EVOA 2KP1A 2AB6A 2H30A 1J08A 5LNKe 2VM1A 1EOHA 3LG6A 1M99A 1B9YC 1HD2A 5D96A 1A8LA 3ZMKA 4PUFC 1GL8A 5A1NB 3VURA 3TKSC 5F07A 4MABA 4POKA 5CP1A 1U88A 3RDWA 3IOSA 4ZB6A 17GSA 3VK9A 3N5OA 4EDYA 2CAIA 4DSSB 2IN3A 4GTUA 3IV4A 3ZMLA 5BMUB 2YCDA 3TOTA 4CY6A 4X4JA 6GSXA 1XPVA 1EGRA 3A2VA 2GZPA 1EGOA 2OBIA 1U3AA 4IS0A 4HUAA 3L9VA 2O5VA 2GSRA 4K1FA 1TJDA 3D4TA 2X99A 2X4AA 1OE8A 4MMMA 4KSMA 14GSA 5F0GA 3IK9A 1I9DA 2PGTA 1KNGA 2X8GA 4IP1A 4RUVA 5L71A 3FKFA 5IMVA 4OFNA 3TJFA 2FNOA 5LCZA 2UZ8A 4ISDA 2JACA 5IOWA 4HJ2A 4K2XA 4MNNA 1THOA 3KM6A 1GSFA 2DJKA 3LXZA 2LRCA 2ON5A 1TXXA 4G0LA 2LV3A 2X64A 4XIHA 2EIRA 4MH3A 2H0IA 5DQSA 5KN1A 2EFCA 4XS4A 3TB2A 3H93A 1PKZA 1NM3A 2ES7A 2VKZG 1QK8A 4BVYA 1QFNA 2G0FA 2RM5A 5ID2B 2VL2A 3Q74A 2LRTA 1XWGA 4WF5A 2I81A 3GMFA 1VRSD 3L4NA 4TVEA 2LKUA 3CSIA 5FWGA 4HJMA 4ACSA 3GH6A 3HHVA 1K3YA 2F8FA 4ECJA 2LJKA 4XRAA 2IMKA 10GSA 2N5FA 4GCIA 1F37A 1GULA 2LSTA 3VLNA 2DJ3A 4GSTA 3Q19A 3TJKA 1OKTA 2N5AA 3IRAA 2EFDA 3P2AA 3FRCA 2L4CA 4FIWA 5IMDA 1V98A 2WRTA 3GURA 2C8UA 4HZ2A 4N10A 3TRPA 5D9XA 1OC8A 1XIYA 3GUSA 4WR4A 1SENA 3P90A 1N25A 4BA7A 4KDUA 1TOFA 3R3EA 4EXJA 6GSWA 3MSZA 2YNXA 4F0BA 1F3AA 1SVMA 3TRXA 4YAVA 4IGJA 3HJOA 4KAEA 1USBA 2JSZA 3FR6A 2H6YA 2VCVA 4ZBBA 4MPFA 5D9VA 1NW2A 1PMTA 1JFUA 1TRVA 3QAWA 3VPQA 1TU7A 3HA9A 1YF1A 3D21A 5HR1A 2HQTA 2FHEA 4DSRA 5J9BA 3TKSA 3HCZA 3TJGA 3QMXA 4TOPA 4ZIJA 2OA7A 3GX0A 2LRNA 3DWVA 5A4VA 1MEKA 1MDJA 2B5YA 3UVTA 2CVDA 3G7YA 1Q98A 4IN0A 3U6VA 2VL3A 2C0GA 3ZREA 3G9BA 1T4ZA 4N3ZA 1SU9A 2H1LA 4WF4A 5HFIA 2AV4A 2H73A 3E0UA 1HNCA 2P5QA 1U3IA 2DIYA 2EIOA 1RK4A 3BOAA 1XVWA 1I5GA 2H72A 3DKSA 3H4KA 1VF3A 2IMDA 2K9FA 2DMLA 4EC0A 3ZZXA 3WD6A 1TI1A 4PGTA 4RI7A 4TR1B 5IQYA 5ENUA 1O6JA 4AF2A 3APOA 5A34B 2VUPA 4F9ZA 2CVKA 3KMOA 5CRWA 16GSA 4QMKA 2L57A 2A2SA 3A5IA 2R5GA 1TI3A 4G10A 1XW6A 1YQ1A 1SJIA 2ZNMA 1XZOA 4DSQA 1Y25A 4KCEA 2H1AA 2BJXA 2H71A 4FYBA 11GSA 1OC9A 1EV4A 2IPAA 5J4YA 3EYTA 2YV7A 3KTLA 4KGIA 3VI5A 4KE3A 1RQMA 2GQMA 5KOWA 3VWVA 1W4VA 1BEDA 3FZ4A 1GTBA 1O7UA 2JU5A 2H01A 3CMIA 1G6YA 2H75A 4BPYA 1XXUA 2GSTA 3FW2A 2HNLA 3KCMA 3ZIJA 2GTUA 4AKIA 2A4HA 2PU9C 1F9MA 1Z6NA 4N0VA 1FAAA 2VO4A 4OCEA 2VCXA 3I9V2 4MH2A 3CSHA 2FLSA 1A0FA 3WYWA 1URMA 2HZEB 3GSTA 2WJUA 1BJXA 1A2JA 3NIVA 4EUYA 3DYRA 2HLSA 4ZL7A 3D5JA 1HQOA 1K0DA 3RBTA 1M2BA 2LUSA 1O81A 5DCGA 3CTFA 3KEBA 4LA1A 3VWXA 18GSA 2HRKB 3I69A 3CYNA 1HNBA 1WJKA 3FYGA 5E59A 2P5RA 1NHOA 5DAKB 3WGDA 1SL0B 3KD0A 3MIXA 4EO3A 3WT1A 3M9KA 1SD9A 3F63A 4TN8A 4KNDA 2GGTA 2CT6A 3ERFA 1AIUA 1N8JA 1K3LA 5A34A 2O89A 3C1RA 3IHGA 4NWYA 1DSBA 3PR8A 4JU5A 2YZUA 4OO5A 2XBQA 1JZRA 2IJYA 3A2WA 4G2EA 4F03A 1T4YA 1GSYA 2HFDA 2I9HA 4DEJA 2LEGA 1ON4A 3QFAC 4YQMA 2IIYA 5CRGA 2GDRA 4AKGA 1ZGNA 5KN2A 3GHAA 1GRXA 5J40A 3GKNA 3K8NA 2HSMA 4PX1A 2XBIA 2AAWA 3AY8A 2FWGA 4DVCA 4QL9A 4L0WA 2YANA 4Q5RA 1Z7PA 3LWAA 3ERWA 5FT3A 4QQ7A 1DE2A 1PGTA 2PUKC 4HI7A 4K9ZA 5AN1A 4NV2A 1F2EA 3ZYWA 5A5KA 3FY7A 2DKIA 4GQCA 2GSQA 1K0AA 3R2QA 4KDYA 4O92A 4GXZA 3TJBA 1VF4A 3FMWA 1B4QA 4JR4A 4HDEA 2NTOA 1T7PB 4WR5A 4ML1A 2XPEA 2GT5A 2HSYA 4I5QA 2VOCA 4EL1A 2YZHA 4AKXB 3KH9A 3GTUB 5ECQB 1LJRA 2IMEA 2F8AA 4EKZA 2IWTA 2FWHA 1Z7RA 1IYHA 5H5QA 4YKFA 1SJZA 2V6KA 1SKWB 4OFMA 1B48A 4EVMA 1WP0A 4YAPA 4I97A 1K0OA 2L4QA 5GAND 3UBKA 5DQYA 1YZXA 1VGLA 3M3MA 1G6WA 1O73A 4G01A 3LJRA 3QAVA 3EWLA 4L5OA 5CRHA 4ZL8A 3J7Yb 4AGSA 1AUCA 3D6IA 4KH7A 1SVLA 2R0CA 5EPFA 5D9WA 4MJCA 1G7EA 1M9BA 4MP4A 2F3MA 4EF0A 1JLWA 4IQ1A 1QUWA 1FVJA 6GSTA 2FA4A 1S3AA 2YJHA 4CY8A 3GV1A 2HRNA 2VD0A 3CTGA 1E6BA 3J7Yk 5H5RA 1X9SB 2DJ0A 5F06A 2VCTA 1R7HA 3F3QA 3DRNA 1GSDA 2ALBA 2YOIA 3EMXA 4BL7B 3HJPA 5G1KA 4BVXB 2O8VB 2WS2A 1GH2A 3US3A 3TRQA 5CNWA 5J4UA 4KA0A 1ABAA 5FHIA 2YWIA 1YKCA 1F6MC 1EEMA 1NSWA 1UN2A 3WT2A 1GTIA 2OKAA 4ZB8A 1TW9A 2WCIA 2JSYA 3BJ5A 5ECPB 4KCAA 1FOVA 4PQHA 13GSA 1ZYPA 3I6AA 2ZUPA 1TDIA 3C8EA 3KIJA 2OBKA 3LYKA 2YWOA 1PX6A 2X49A 4XTSA 5CREA 1YEPA 2O7KA 1QXHA 3ZL5A 4AI6A 5IO0A 3DVWA 2A2RA 5ECSA 2DC5A 4E68A 1WMJA 4USSA 1WRYA 3HXSA 3IC8A 1BQ7A 3DIEA 2HZFA 4AKHA 1A2LA 3QFBC 3VWWA 3LW9A 5EY6A 2ON7A 3LSZA 1EP7A 3S9FA 1UC7A 2FUG2 2H66A 2L5OA 2Z9SA 4G0KA 4JZQA 1SK0A 2MYGA 3QCPA 4AJ7A 5GSSA 1PSQA 2VAFA 1ERTA 3GRXA 1Z5YE 2RUFA 3HVSA 2D2ZA 5IO2A 2PPTA 4HU7A 1NHYA 3A3TA 3I43A 5ECIB 2DKHA 5H5SA 2R37A 3F3RA 1T1VA 2VLVA 2K8VA 2L59A 1JHBA 3EINA 2M80A 2LNTA 1PRXA 2LQQA 5G5FA 2K8SA 3C71A 3RPPA 1JZOA 4K2DA 4KUNA 5A1NA 4POBA 1SKRB 3UBLA 3QR6A 2QA2A 3V1WA 3M9JA 1O85A 2H70A 5G2ZA 1AXDA 4ECIA 1G0TA 4DSSA 2YP6A 3GX8A 5BMUA 4BL7A 2K6VA 1WWJA 4MF6A 3TJJA 1GUKA 1BAYA 1A23A 5HFGA 1GNEA 1EWXA 5F05A 5HQPA 3IR4A 2M46A 4K0GA 4MZCA 2MBSA 4N0ZA 3UVHA 4K8MA 5DJLA 2HE3A 4XCSA 3UMAA 4WXTA 4FO5A 3RHBA 2B6MA 3KP8A 1H75A 4YQUA 3ZVJD 4AJ6A 3DGQA 4HU9A 4KB3A 1EV9A 4FH8A 1V57A 3KJYA 4G19A 1FOHA 5EL8A 3GL3A 1OE7A 3KTBA 1WOUA 3CSJA 1ZCPA 3BD2A 3D0ZA 3NZNA 5ELGA 1DUGA 2F51A 3HZ4A 2LNSA 5DCHA 4F82A 2A4VA 2EFEA 2YWMA 3ZFBA 3QD9A 2PMTA 2C0FA 1CQGA 2QA1A 4PNGA 1M0UA 1WPIA 2E2MA 4IVFA 4EDZA 2R2JA 5AGYA 1SL1B 4MZBA 1BG5A 2V32A 1T3BA 2GQKA 1TU8A 4OMVA 4JEDA 1Q4JA 4XRDA 4MLYA 3SWLA 5ID2A 3DMLA 2YV9A 1LU4A 4MZWA 4IJ3A 1ERUA 4TRXA 3MYDA 3KZQA 4K7IA 2JL4A 4V2NA 1X5DA 2C3QA 2GQLA 4ECCA 3F6DA 2B1KA 1GUHA 3FEUA 1N2AA 2YWNA 3IAM2 3IBHA 2REMA 2M72A 1FO5A 1TTZA 4KDXA 1YVLA 2LJRA 3PGTA 5HR0A 4TW5A 4HOJA 1XFLA 3D4MA 3KMNA 1PN0A 1AQWA 2FCHA 1AC1A 3GNJA 4X1UA 1TRWA 2KHPA 4XS6A 5J3RA 2C1YA 2N5BA 5JWOB 3E9JB 4HEA2 4YH2A 4MF7A 5ECNB 6GSSA 4LMVA 4O5QA 2QGVA 2F9SA 2H19A 2EC4A 5IM9A 3L78A 1KBNA 1SVOA 4OFTA 4KW6A 4NPBA 4EIQA 5J47A 3TU3B 1TK0B 5COHA 4FYCA 3DD3A 3FR3A 5HR3A 4FYUA 3ZIVA 3F0IA 1GTUA 5B8BA 3QAGA 1GNWA 2I3YA 4EIPA 3L0HA 3G7IA 2QC7A 4IP6A 2WFCA 5J4VA 4WKWA 2B7KA 1ERVA 1TXUA 1X5CA 2OE1A 3QOUA 2FY6A 2O87A 1MD4A 1ZYEA 4ULXA 4XHMA 2CZ2A 4NHZA 2VCWA 4OD7A 1TP9A 2VM2A 3EC3A 5KEJA 2PWJA 1O8XA 2H1BA 2AJQB 2E0QA 3ZFLA 5DVBA 5AIXA 3HZ8A 1EEJA 2R0GA 2NBSA 2GT6A 4KSOA 3RHCA 1WE0A 3EVIA 3G7JA 2CVBA 3U5RE 2OT3A 4LL1B 4X0XA 4HQSA 4TR1A 4PXOA 1AW9A 3FK8A 4RQXA 4J56E 3TUEA 5IPHA 3LFLA 5HFKA 3ME7A 1IYIA 4NAXA 5DJMA 1XWAA 1X9WB 4PUAA 5ECLB 2C3TA 5LD0A 1JLVA 3ZTLA 1R4WA 3HY2A 2RIIA 2NVLA 5B6MA 3O76A 1ZMAA 1ML6A 2GLRA 2GSSA 3UEMA 4MK3A 4F2IA 2V1MA 1DBYA 2NDOA 1YY7A 2HI7A 4D73B 5D93A 2B5EA 3LYPA 1Z6MA 4V2MA 4AJ8A 1JZDA 4Q5FA 3ZITA 3W6GA 2C0DA 3HJMA 2OE3A 2HSNB 2DSAA 2KLXA 1J0FA 8GSSA 2B3SA 5ECOB 1XWKA 3CRTA 1R26A 3FZAA 3HYPA 5ABRA 3MDKA 4GF0A 4PTSA 4FQUA 3TGZA 4Z2RA 1CQHA 3EMPA 2L5LA 1SJ6A 2JZRA 2HZEA 4KX4A 4O5RA 3HKRA 1FW1A 5J41A 3UAPA 1ZYQB 1GTAA 1GUMA 2VL9A 3UIWA 4I6XA 1PL2A 2HRKA 1GP1A 1K0CA 3EPTA 1H4OA 1W89A 3IA1A 3MWHA 3IHQA 4ICYA 5DAKA 5IOXA 4O5UA 1YJ6A 2PERA 5AIVA 2UV8G 4GWRA 4ZBDA 4JRRA 1OVNA 1ACVA 2E2GA 4XS4B 3N9JA 2HRAA 2FGXA 1M9AA 1GLQA 3GA4A 1B9XC 3HVXA 3MNGA 1X0RA 1ST9A 1Z3EA 4K6XA 2J9HA 3JCML 3IE3A 4I2UA 5B7CA 2YJ7A 1A8YA 3DXBA 4IW9A 3NOFA 5AISA 4J2FA 1A0RP 1DE1A 2R0PA 1V2AA 4ZL9A 4OO4A 2TRXA 5HR2A 4EE0A 2GS3A 4D73A 5GAPD 5G31A 1XOAA 2CX3A 1K0BA 2CX4A 3TKPA 5D8IA 3KGKA 1TKDB 4LLRA 2HSNA 4F0CA 1R5PA 4HS1A 4KF9A 2I1UA 5J5NA 3WGEA 1RW1A 2LS5A 2JADA 1KTEA 3IAS2 4GQFA 1ZYNA 3Q6OA 3GFKA 3FHKA 4MCUA 2H6ZA 2OADA 1GSQA 5D73A 1XW5A 1S3CA 4N11A 1PN9A 1X5EA 5B8AA 4Z2TA 2HT9A 1FHEA 1R5AA 5IMZA 5JWQB 4L8EA 1XWBA 5IMFA 3QDNA 4ZILA 1TK8B 4A5PA 3UARA 4WBJA 5B6NA 3UJ1A 5JCWA 3GTUA 4YKGA 2BTOT 2R6KA 3M8NA 3MAKA 4E8HA 4CW9A 5D9TA 3HMJG 1XBSA 2H0GA 1XWCA 4RQRA 4HZ4A 3FR9A 4X43A 5IMCA 4JE1A 12GSA 2FWEA 2LJAA 3H1NA 1ZOFA 4IKHA 2R3XA 3IXRA 2C3NA 3OR5A 5JWRB 4G0IA 4N30A 3HDCA 2PBJA 4NMUA 4JR6A 2KUCA 6GSVA 5JCUA 3EE2A 5G30A 1OYJA 2XPDA 1ILOA 3P8WA 4W66A 1XOBA 4GRFA 4NXIA 2PVQA 1MD3A 3DEXA 2DLXA 2P0GA 1MTCA 3F4SA 2L6CA 1UA5A 4IELA 2PVOC 4K0NA 1PX7A 1FG4A 4JBBA 4BVXA 2RLIA 4TKYA 3FZ9A 3LEFA 1SK2A 4WEYA 2MMOA 3GH9A 1C72A 1MDIA 2NPBA 19GSA 2MMNA 3APQA 4NV5A 4ZB9A 3A2XA 4MDCA 1A24A 5GSTA 2DJJA 3C1SA 4LMWA 3F9UA 1OC9B 2IL3A 3VWUA 1SYXA 2QSIA 3H79A 1SKSB 3BCIA 5IIZA 1V40A 5ECRB 2EIQA 1THXA 4POMA 1SYRA 4V2LA 4MPGA 5A4WA 4V1Ag 4K5SA 2H76A 4ZXGA 2RM6A 3EURA 5KN3A 5J9CA 2MBTA 1V58A 1TRUA 3Q18A 6GSYA 4OCFA 4TXVA 4K7NA 4WETA 4POLA 2H1DA 1LBKA 1T00A 1MDKA 3PPUA 2V6OA 2VLUA 5G5EA 4XS1A 1BYEA 2TRCP 4RI6A 2G2QA 1TRSA 4IQAA 3IC4A 4MJAA 1FB0A 22GSA 4GSNA 1T8EB 1GLPA 1B8XA 3GN3A 2LQOA 3W8JA 3GKKA 2H1GA 1PKWA 2C4JA 3CXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F8B A;  1ZZY A;  4TXO B;  4PNF A;  1AQV A;  5INY A;  1WIK A;  3D22 A;  4OWY A;  1QGV A;  2ZCT A;  4BWS A;  5CYY A;  2P31 A;  3P7X A;  1OAZ A;  1GSS A;  3RPN A;  2H0H A;  1TK5 B;  4IBP A;  5JCG A;  3L9U A;  4E8E A;  3KXO A;  1HYU A;  2IMI A;  3M0F A;  3IK7 A;  1QQ2 A;  4MF5 A;  4MJB A;  1SL2 B;  6GSU A;  1M7T A;  1PA3 A;  4MJE A;  2V41 A;  3TKS E;  2J23 A;  3ZRD A;  2B5X A;  3ED3 A;  1YF0 A;  3LGC A;  1K0M A;  1S3D A;  3HVV A;  5G1L A;  2MZC A;  4PUR A;  1G7O A;  2HXK A;  4PQI A;  3F4T A;  1YDK A;  2IFQ B;  3EU3 A;  2GZY A;  1PL1 A;  1VF1 A;  2C80 A;  1OKD A;  3UL3 A;  3PIN A;  1ERW A;  1KEB A;  1U87 A;  2WZ9 A;  4PQ1 A;  3F6F A;  3SBC A;  4TR3 A;  3TOU A;  2HRF A;  3LXT A;  2IMF A;  5DBQ A;  1ZL9 A;  2HSM B;  3VFI A;  2RUE A;  3KP9 A;  3TKQ A;  4TR4 A;  3C73 A;  2YN1 A;  4WBR D;  2E7P A;  1GWC A;  5KN0 A;  3TKR A;  3ZLP A;  2AYT A;  1PQN A;  1M2A A;  2H8L A;  1AQX A;  2JZS A;  1QMV A;  1A2M A;  2LTK A;  4I2T A;  2VD1 A;  2B1L A;  2CQ9 A;  1VF2 A;  5C00 A;  2HYX A;  3E3E A;  3M1G A;  3GKM A;  2CA8 A;  1OC3 A;  4Q5Q A;  1FB6 A;  2CV4 A;  2R4V A;  3BBY A;  2WB9 A;  4L5L A;  3KH7 A;  2XC2 A;  4K7O A;  4MA9 A;  5ECK B;  4O32 A;  2PN8 A;  1EP8 A;  2DJ2 A;  1YKA A;  3LOR A;  4GLT A;  2WGR A;  1FVK A;  5IPG A;  5ECM B;  2FD3 A;  3W8S A;  7GSS A;  3O3T A;  2C0E A;  5ECH B;  3VPT A;  4ECB A;  4TXO A;  4YQV A;  4TR0 A;  1U6T A;  1YEX A;  3DVX A;  2BMX A;  1GSE A;  4HQZ A;  1EOG A;  5DAL B;  2CAQ A;  4BWQ A;  4G9H A;  4ML6 A;  3LQ7 A;  2MMA A;  3F8U A;  5IMA A;  2X8H A;  4QL7 A;  2VLT A;  3EU4 A;  3ISO A;  5CO3 A;  2FA8 A;  3C7M A;  1O8W A;  3APS A;  4ILF A;  2B7J A;  2DMM A;  1M2D A;  3GIX A;  3H8Q A;  2I4A A;  4L0U A;  3IDV A;  1BX9 A;  2WUL A;  2DBC A;  1EZK A;  2H6X A;  2XHF A;  1AAZ A;  2IFQ A;  3ERG A;  4GSS A;  3IPZ A;  2AHE A;  4IHU A;  3TDG A;  20GS A;  2OE0 A;  2X8C A;  3F4R A;  2GZZ A;  9GSS A;  1HNA A;  3GKX A;  4Z7X A;  1UVZ A;  3A5W A;  2HSH A;  1J9B A;  2KOK A;  2VCQ A;  1Y6E A;  3TCO A;  3WGX A;  4CHS A;  2JZT A;  2DJ1 A;  4O7H A;  1GSU A;  5A4U A;  1V9W A;  3BCK A;  2WDU A;  2VL2 C;  2QKE A;  1SD8 A;  4J57 E;  1B4P A;  5GZZ B;  2OAC A;  4I8B A;  1F3B A;  2H74 A;  4LL4 B;  1E2Y A;  1JZW A;  2V2G A;  2VCZ A;  1K0N A;  3PH9 A;  3GL5 A;  4ID0 A;  4IJI A;  3FZ5 A;  5C04 A;  5ELA A;  3ZVJ A;  1PD2 1;  5DDL A;  2GVP A;  2L6D A;  2VIM A;  3UOM A;  2YPM A;  1XCC A;  5E4W A;  4P3Y B;  3VI7 A;  5CAX A;  2DIZ A;  4ZBA A;  2CZ3 A;  3CRU A;  3HD5 A;  3CBU A;  4CDO A;  1Z9H A;  3GYK A;  2TIR A;  2FWF A;  4V1A p;  1XW9 A;  3L9S A;  2O85 A;  2AUV A;  2KP2 A;  1X9M B;  4NHW A;  2MMZ A;  3GSS A;  3ME8 A;  1K3O A;  3QPM A;  2K18 A;  2OJL A;  1SK1 A;  4BVY B;  1XVQ A;  5DAL A;  4H86 A;  3RAZ A;  5CRD A;  4Q5N A;  3O6T A;  5EVO A;  2KP1 A;  2AB6 A;  2H30 A;  1J08 A;  5LNK e;  2VM1 A;  1EOH A;  3LG6 A;  1M99 A;  1B9Y C;  1HD2 A;  5D96 A;  1A8L A;  3ZMK A;  4PUF C;  1GL8 A;  3VUR A;  3TKS C;  5F07 A;  4MAB A;  4POK A;  5CP1 A;  1U88 A;  3RDW A;  3IOS A;  4ZB6 A;  17GS A;  3VK9 A;  3N5O A;  4EDY A;  2CAI A;  4DSS B;  2IN3 A;  4GTU A;  3IV4 A;  3ZML A;  2YCD A;  3TOT A;  6GSX A;  1XPV A;  1EGR A;  3A2V A;  2GZP A;  1EGO A;  2OBI A;  1U3A A;  4IS0 A;  4HUA A;  3L9V A;  2GSR A;  4K1F A;  1TJD A;  3D4T A;  2X99 A;  1OE8 A;  4MMM A;  4KSM A;  14GS A;  5F0G A;  3IK9 A;  1I9D A;  2PGT A;  1KNG A;  2X8G A;  4IP1 A;  4RUV A;  5L71 A;  3FKF A;  5IMV A;  4OFN A;  3TJF A;  2FNO A;  5LCZ A;  2UZ8 A;  4ISD A;  2JAC A;  5IOW A;  4HJ2 A;  1THO A;  3KM6 A;  1GSF A;  2DJK A;  3LXZ A;  2LRC A;  2ON5 A;  1TXX A;  4G0L A;  2LV3 A;  2X64 A;  4XIH A;  2EIR A;  4MH3 A;  2H0I A;  5DQS A;  5KN1 A;  4XS4 A;  3TB2 A;  3H93 A;  1PKZ A;  1NM3 A;  2ES7 A;  1QK8 A;  4BVY A;  1QFN A;  2G0F A;  2RM5 A;  5ID2 B;  2VL2 A;  3Q74 A;  2LRT A;  1XWG A;  4WF5 A;  2I81 A;  3GMF A;  1VRS D;  3L4N A;  4TVE A;  2LKU A;  3CSI A;  5FWG A;  4HJM A;  4ACS A;  3GH6 A;  3HHV A;  1K3Y A;  2F8F A;  4ECJ A;  2LJK A;  4XRA A;  2IMK A;  10GS A;  2N5F A;  4GCI A;  1F37 A;  1GUL A;  2LST A;  3VLN A;  2DJ3 A;  4GST A;  3Q19 A;  3TJK A;  1OKT A;  2N5A A;  3IRA A;  3P2A A;  3FRC A;  2L4C A;  4FIW A;  5IMD A;  1V98 A;  2WRT A;  3GUR A;  2C8U A;  4HZ2 A;  4N10 A;  3TRP A;  5D9X A;  1OC8 A;  1XIY A;  3GUS A;  4WR4 A;  1SEN A;  3P90 A;  4BA7 A;  4KDU A;  1TOF A;  3R3E A;  4EXJ A;  6GSW A;  3MSZ A;  2YNX A;  4F0B A;  1F3A A;  3TRX A;  4YAV A;  4IGJ A;  3HJO A;  4KAE A;  1USB A;  2JSZ A;  3FR6 A;  2H6Y A;  2VCV A;  4ZBB A;  4MPF A;  5D9V A;  1NW2 A;  1PMT A;  1JFU A;  1TRV A;  3QAW A;  3VPQ A;  1TU7 A;  3HA9 A;  1YF1 A;  3D21 A;  5HR1 A;  2HQT A;  2FHE A;  4DSR A;  5J9B A;  3TKS A;  3HCZ A;  3TJG A;  3QMX A;  4TOP A;  4ZIJ A;  2OA7 A;  3GX0 A;  2LRN A;  3DWV A;  5A4V A;  1MEK A;  1MDJ A;  2B5Y A;  3UVT A;  2CVD A;  3G7Y A;  1Q98 A;  4IN0 A;  3U6V A;  2VL3 A;  2C0G A;  3ZRE A;  3G9B A;  1T4Z A;  1SU9 A;  4WF4 A;  5HFI A;  2AV4 A;  2H73 A;  3E0U A;  1HNC A;  2P5Q A;  1U3I A;  2DIY A;  2EIO A;  1RK4 A;  3BOA A;  1XVW A;  1I5G A;  2H72 A;  3DKS A;  3H4K A;  1VF3 A;  2IMD A;  2K9F A;  2DML A;  4EC0 A;  3ZZX A;  3WD6 A;  1TI1 A;  4PGT A;  4RI7 A;  4TR1 B;  5IQY A;  5ENU A;  1O6J A;  4AF2 A;  3APO A;  2VUP A;  4F9Z A;  2CVK A;  3KMO A;  5CRW A;  16GS A;  2L57 A;  2A2S A;  2R5G A;  1TI3 A;  4G10 A;  1XW6 A;  1YQ1 A;  1SJI A;  2ZNM A;  1XZO A;  4DSQ A;  1Y25 A;  4KCE A;  2H1A A;  2BJX A;  2H71 A;  4FYB A;  11GS A;  1OC9 A;  1EV4 A;  2IPA A;  3EYT A;  2YV7 A;  3KTL A;  4KGI A;  3VI5 A;  4KE3 A;  1RQM A;  2GQM A;  3VWV A;  1W4V A;  1BED A;  3FZ4 A;  1GTB A;  1O7U A;  2JU5 A;  2H01 A;  3CMI A;  1G6Y A;  2H75 A;  4BPY A;  1XXU A;  2GST A;  3FW2 A;  2HNL A;  3KCM A;  3ZIJ A;  2GTU A;  2PU9 C;  1F9M A;  1Z6N A;  4N0V A;  1FAA A;  2VO4 A;  4OCE A;  2VCX A;  3I9V 2;  4MH2 A;  3CSH A;  2FLS A;  1A0F A;  3WYW A;  1URM A;  2HZE B;  3GST A;  2WJU A;  1BJX A;  1A2J A;  3NIV A;  4EUY A;  3DYR A;  2HLS A;  4ZL7 A;  3D5J A;  1HQO A;  1K0D A;  3RBT A;  1M2B A;  2LUS A;  1O81 A;  5DCG A;  3CTF A;  3KEB A;  4LA1 A;  3VWX A;  18GS A;  2HRK B;  3I69 A;  3CYN A;  1HNB A;  1WJK A;  3FYG A;  5E59 A;  2P5R A;  1NHO A;  5DAK B;  3WGD A;  1SL0 B;  3KD0 A;  4EO3 A;  3WT1 A;  3M9K A;  1SD9 A;  3F63 A;  4TN8 A;  4KND A;  2GGT A;  2CT6 A;  3ERF A;  1AIU A;  1N8J A;  1K3L A;  2O89 A;  3C1R A;  4NWY A;  1DSB A;  3PR8 A;  4JU5 A;  2YZU A;  4OO5 A;  2XBQ A;  1JZR A;  2IJY A;  3A2W A;  4G2E A;  4F03 A;  1T4Y A;  1GSY A;  2HFD A;  2I9H A;  4DEJ A;  2LEG A;  1ON4 A;  3QFA C;  4YQM A;  2IIY A;  5CRG A;  2GDR A;  1ZGN A;  5KN2 A;  3GHA A;  1GRX A;  3GKN A;  3K8N A;  2HSM A;  4PX1 A;  2XBI A;  2AAW A;  3AY8 A;  2FWG A;  4DVC A;  4QL9 A;  4L0W A;  2YAN A;  4Q5R A;  1Z7P A;  3LWA A;  3ERW A;  5FT3 A;  4QQ7 A;  1DE2 A;  1PGT A;  2PUK C;  4HI7 A;  4K9Z A;  5AN1 A;  4NV2 A;  1F2E A;  3ZYW A;  5A5K A;  3FY7 A;  4GQC A;  2GSQ A;  1K0A A;  3R2Q A;  4KDY A;  4O92 A;  4GXZ A;  3TJB A;  1VF4 A;  1B4Q A;  4JR4 A;  4HDE A;  2NTO A;  1T7P B;  4WR5 A;  4ML1 A;  2XPE A;  2GT5 A;  2HSY A;  4I5Q A;  2VOC A;  4EL1 A;  2YZH A;  3KH9 A;  3GTU B;  5ECQ B;  1LJR A;  2IME A;  2F8A A;  4EKZ A;  2IWT A;  2FWH A;  1Z7R A;  1IYH A;  5H5Q A;  1SJZ A;  2V6K A;  1SKW B;  4OFM A;  1B48 A;  4EVM A;  1WP0 A;  4YAP A;  4I97 A;  1K0O A;  2L4Q A;  5GAN D;  3UBK A;  5DQY A;  1YZX A;  1VGL A;  3M3M A;  1G6W A;  1O73 A;  3LJR A;  3QAV A;  3EWL A;  4L5O A;  5CRH A;  4ZL8 A;  3J7Y b;  4AGS A;  1AUC A;  3D6I A;  4KH7 A;  5EPF A;  5D9W A;  4MJC A;  1G7E A;  1M9B A;  4MP4 A;  2F3M A;  4EF0 A;  1JLW A;  4IQ1 A;  1QUW A;  1FVJ A;  6GST A;  2FA4 A;  1S3A A;  2YJH A;  3GV1 A;  2HRN A;  2VD0 A;  3CTG A;  1E6B A;  3J7Y k;  5H5R A;  1X9S B;  2DJ0 A;  5F06 A;  2VCT A;  1R7H A;  3F3Q A;  3DRN A;  1GSD A;  2ALB A;  2YOI A;  3EMX A;  4BL7 B;  3HJP A;  5G1K A;  4BVX B;  2O8V B;  2WS2 A;  1GH2 A;  3US3 A;  3TRQ A;  5CNW A;  5J4U A;  4KA0 A;  1ABA A;  5FHI A;  2YWI A;  1YKC A;  1F6M C;  1EEM A;  1NSW A;  1UN2 A;  3WT2 A;  1GTI A;  2OKA A;  4ZB8 A;  1TW9 A;  2WCI A;  2JSY A;  3BJ5 A;  5ECP B;  4KCA A;  1FOV A;  4PQH A;  13GS A;  3I6A A;  2ZUP A;  1TDI A;  3C8E A;  3KIJ A;  2OBK A;  3LYK A;  2YWO A;  1PX6 A;  4XTS A;  5CRE A;  1YEP A;  2O7K A;  1QXH A;  3ZL5 A;  5IO0 A;  3DVW A;  2A2R A;  5ECS A;  2DC5 A;  1WMJ A;  4USS A;  1WRY A;  3HXS A;  3IC8 A;  1BQ7 A;  3DIE A;  2HZF A;  1A2L A;  3QFB C;  3VWW A;  5EY6 A;  2ON7 A;  3LSZ A;  1EP7 A;  3S9F A;  1UC7 A;  2FUG 2;  2H66 A;  2L5O A;  2Z9S A;  4G0K A;  4JZQ A;  1SK0 A;  2MYG A;  3QCP A;  4AJ7 A;  5GSS A;  1PSQ A;  2VAF A;  1ERT A;  3GRX A;  1Z5Y E;  2RUF A;  3HVS A;  2D2Z A;  5IO2 A;  2PPT A;  4HU7 A;  1NHY A;  3A3T A;  3I43 A;  5ECI B;  5H5S A;  2R37 A;  3F3R A;  1T1V A;  2VLV A;  2K8V A;  2L59 A;  1JHB A;  3EIN A;  2M80 A;  2LNT A;  1PRX A;  2LQQ A;  5G5F A;  2K8S A;  3C71 A;  3RPP A;  1JZO A;  4K2D A;  4KUN A;  4POB A;  1SKR B;  3UBL A;  3QR6 A;  3V1W A;  3M9J A;  1O85 A;  2H70 A;  5G2Z A;  1AXD A;  4ECI A;  1G0T A;  4DSS A;  2YP6 A;  3GX8 A;  5BMU A;  4BL7 A;  2K6V A;  1WWJ A;  4MF6 A;  3TJJ A;  1GUK A;  1BAY A;  1A23 A;  5HFG A;  1GNE A;  1EWX A;  5F05 A;  5HQP A;  3IR4 A;  2M46 A;  4K0G A;  4MZC A;  2MBS A;  4N0Z A;  3UVH A;  4K8M A;  5DJL A;  2HE3 A;  4XCS A;  3UMA A;  4WXT A;  4FO5 A;  3RHB A;  2B6M A;  3KP8 A;  1H75 A;  4YQU A;  3ZVJ D;  4AJ6 A;  3DGQ A;  4HU9 A;  4KB3 A;  1EV9 A;  4FH8 A;  1V57 A;  3KJY A;  4G19 A;  5EL8 A;  3GL3 A;  1OE7 A;  3KTB A;  1WOU A;  3CSJ A;  1ZCP A;  3BD2 A;  3D0Z A;  3NZN A;  5ELG A;  1DUG A;  2F51 A;  3HZ4 A;  2LNS A;  5DCH A;  4F82 A;  2A4V A;  2YWM A;  3ZFB A;  3QD9 A;  2PMT A;  2C0F A;  1CQG A;  4PNG A;  1M0U A;  1WPI A;  2E2M A;  4IVF A;  4EDZ A;  2R2J A;  5AGY A;  1SL1 B;  4MZB A;  1BG5 A;  2V32 A;  1T3B A;  2GQK A;  1TU8 A;  4OMV A;  4JED A;  1Q4J A;  4XRD A;  4MLY A;  3SWL A;  5ID2 A;  3DML A;  2YV9 A;  1LU4 A;  4MZW A;  4IJ3 A;  1ERU A;  4TRX A;  3KZQ A;  4K7I A;  2JL4 A;  4V2N A;  1X5D A;  2C3Q A;  2GQL A;  4ECC A;  3F6D A;  2B1K A;  1GUH A;  3FEU A;  1N2A A;  2YWN A;  3IAM 2;  3IBH A;  2REM A;  2M72 A;  1FO5 A;  1TTZ A;  4KDX A;  2LJR A;  3PGT A;  5HR0 A;  4TW5 A;  4HOJ A;  1XFL A;  3D4M A;  3KMN A;  2FCH A;  1AQW A;  1AC1 A;  3GNJ A;  4X1U A;  1TRW A;  2KHP A;  4XS6 A;  5J3R A;  2C1Y A;  2N5B A;  5JWO B;  3E9J B;  4HEA 2;  4YH2 A;  4MF7 A;  5ECN B;  6GSS A;  4LMV A;  2QGV A;  2F9S A;  2H19 A;  2EC4 A;  5IM9 A;  3L78 A;  1KBN A;  4OFT A;  4KW6 A;  4NPB A;  1TK0 B;  5COH A;  4FYC A;  3DD3 A;  3FR3 A;  5HR3 A;  4FYU A;  3ZIV A;  3F0I A;  1GTU A;  5B8B A;  3QAG A;  1GNW A;  2I3Y A;  3L0H A;  3G7I A;  2QC7 A;  4IP6 A;  2WFC A;  4WKW A;  2B7K A;  1ERV A;  1X5C A;  2OE1 A;  3QOU A;  2FY6 A;  2O87 A;  1MD4 A;  1ZYE A;  4ULX A;  4XHM A;  2CZ2 A;  4NHZ A;  2VCW A;  4OD7 A;  1TP9 A;  2VM2 A;  3EC3 A;  5KEJ A;  2PWJ A;  1O8X A;  2H1B A;  2AJQ B;  2E0Q A;  3ZFL A;  5DVB A;  5AIX A;  3HZ8 A;  1EEJ A;  2NBS A;  2GT6 A;  4KSO A;  3RHC A;  1WE0 A;  3EVI A;  3G7J A;  2CVB A;  3U5R E;  4LL1 B;  4X0X A;  4HQS A;  4TR1 A;  4PXO A;  1AW9 A;  3FK8 A;  4RQX A;  4J56 E;  3TUE A;  5IPH A;  3LFL A;  5HFK A;  3ME7 A;  1IYI A;  4NAX A;  5DJM A;  1XWA A;  1X9W B;  4PUA A;  5ECL B;  2C3T A;  5LD0 A;  1JLV A;  3ZTL A;  1R4W A;  3HY2 A;  2RII A;  2NVL A;  5B6M A;  3O76 A;  1ZMA A;  1ML6 A;  2GLR A;  2GSS A;  3UEM A;  4MK3 A;  4F2I A;  2V1M A;  1DBY A;  2NDO A;  1YY7 A;  2HI7 A;  4D73 B;  5D93 A;  2B5E A;  3LYP A;  1Z6M A;  4V2M A;  4AJ8 A;  1JZD A;  4Q5F A;  3ZIT A;  3W6G A;  2C0D A;  3HJM A;  2OE3 A;  2HSN B;  2DSA A;  2KLX A;  1J0F A;  8GSS A;  2B3S A;  5ECO B;  1XWK A;  3CRT A;  1R26 A;  3FZA A;  3HYP A;  5ABR A;  3MDK A;  4GF0 A;  4PTS A;  4FQU A;  3TGZ A;  1CQH A;  3EMP A;  2L5L A;  1SJ6 A;  2JZR A;  2HZE A;  4KX4 A;  4O5R A;  3HKR A;  1FW1 A;  5J41 A;  3UAP A;  1ZYQ B;  1GTA A;  1GUM A;  2VL9 A;  3UIW A;  4I6X A;  1PL2 A;  2HRK A;  1GP1 A;  1K0C A;  1H4O A;  1W89 A;  3IA1 A;  3MWH A;  3IHQ A;  5IOX A;  5DAK A;  1YJ6 A;  2PER A;  5AIV A;  4GWR A;  4ZBD A;  4JRR A;  1OVN A;  1ACV A;  2E2G A;  4XS4 B;  3N9J A;  2HRA A;  2FGX A;  1M9A A;  1GLQ A;  3GA4 A;  1B9X C;  3HVX A;  3MNG A;  1X0R A;  1ST9 A;  1Z3E A;  4K6X A;  2J9H A;  3JCM L;  3IE3 A;  4I2U A;  5B7C A;  2YJ7 A;  1A8Y A;  3DXB A;  4IW9 A;  3NOF A;  5AIS A;  4J2F A;  1A0R P;  1DE1 A;  1V2A A;  4ZL9 A;  4OO4 A;  2TRX A;  5HR2 A;  4EE0 A;  2GS3 A;  4D73 A;  5GAP D;  5G31 A;  1XOA A;  2CX3 A;  1K0B A;  2CX4 A;  3TKP A;  5D8I A;  3KGK A;  1TKD B;  4LLR A;  4F0C A;  1R5P A;  4HS1 A;  4KF9 A;  2I1U A;  5J5N A;  3WGE A;  1RW1 A;  2LS5 A;  2JAD A;  1KTE A;  3IAS 2;  4GQF A;  3Q6O A;  3GFK A;  3FHK A;  4MCU A;  2H6Z A;  2OAD A;  1GSQ A;  5D73 A;  1XW5 A;  1S3C A;  4N11 A;  1PN9 A;  1X5E A;  5B8A A;  2HT9 A;  1FHE A;  1R5A A;  5IMZ A;  5JWQ B;  4L8E A;  1XWB A;  5IMF A;  3QDN A;  4ZIL A;  1TK8 B;  3UAR A;  4WBJ A;  5B6N A;  3UJ1 A;  5JCW A;  3GTU A;  2BTO T;  2R6K A;  3M8N A;  3MAK A;  4E8H A;  4CW9 A;  5D9T A;  1XBS A;  2H0G A;  1XWC A;  4RQR A;  4HZ4 A;  3FR9 A;  4X43 A;  5IMC A;  4JE1 A;  12GS A;  2FWE A;  2LJA A;  3H1N A;  1ZOF A;  4IKH A;  2R3X A;  3IXR A;  2C3N A;  3OR5 A;  5JWR B;  4G0I A;  4N30 A;  3HDC A;  2PBJ A;  4NMU A;  4JR6 A;  2KUC A;  6GSV A;  5JCU A;  3EE2 A;  5G30 A;  1OYJ A;  2XPD A;  1ILO A;  3P8W A;  1XOB A;  4GRF A;  4NXI A;  2PVQ A;  1MD3 A;  3DEX A;  2DLX A;  2P0G A;  1MTC A;  3F4S A;  2L6C A;  1UA5 A;  4IEL A;  2PVO C;  4K0N A;  1PX7 A;  1FG4 A;  4JBB A;  4BVX A;  2RLI A;  4TKY A;  3FZ9 A;  3LEF A;  1SK2 A;  4WEY A;  2MMO A;  3GH9 A;  1C72 A;  1MDI A;  2NPB A;  19GS A;  2MMN A;  3APQ A;  4NV5 A;  4ZB9 A;  3A2X A;  4MDC A;  1A24 A;  5GST A;  2DJJ A;  3C1S A;  4LMW A;  3F9U A;  1OC9 B;  2IL3 A;  3VWU A;  1SYX A;  2QSI A;  3H79 A;  1SKS B;  3BCI A;  5IIZ A;  1V40 A;  5ECR B;  2EIQ A;  1THX A;  4POM A;  1SYR A;  4V2L A;  4MPG A;  5A4W A;  4V1A g;  2H76 A;  4ZXG A;  2RM6 A;  3EUR A;  5KN3 A;  5J9C A;  2MBT A;  1V58 A;  1TRU A;  3Q18 A;  6GSY A;  4OCF A;  4TXV A;  4K7N A;  4WET A;  4POL A;  2H1D A;  1LBK A;  1T00 A;  1MDK A;  3PPU A;  2V6O A;  2VLU A;  5G5E A;  4XS1 A;  1BYE A;  2TRC P;  4RI6 A;  2G2Q A;  1TRS A;  4IQA A;  3IC4 A;  4MJA A;  1FB0 A;  22GS A;  4GSN A;  1T8E B;  1GLP A;  1B8X A;  3GN3 A;  2LQO A;  3W8J A;  3GKK A;  2H1G A;  1PKW A;  2C4J A;  3CXG A; 
#chains in the Genus database with same CATH topology
 5F8B A;  1ZZY A;  4TXO B;  4PNF A;  1AQV A;  5INY A;  1WIK A;  4GDF A;  3D22 A;  4OWY A;  1QGV A;  2ZCT A;  4BWS A;  5CYY A;  2P31 A;  3P7X A;  5BRT A;  1OAZ A;  1GSS A;  3RPN A;  2H0H A;  1TK5 B;  4IBP A;  5JCG A;  3L9U A;  2WW2 A;  4E8E A;  3KXO A;  1HYU A;  2IMI A;  3M0F A;  3IK7 A;  1QQ2 A;  4MF5 A;  4MJB A;  1SL2 B;  6GSU A;  1M7T A;  1PA3 A;  4MJE A;  2V41 A;  1BF5 A;  3TKS E;  2J23 A;  3ZRD A;  2B5X A;  3ED3 A;  1YF0 A;  3LGC A;  1K0M A;  1S3D A;  3HVV A;  5G1L A;  2MZC A;  4PUR A;  1G7O A;  2HXK A;  4PQI A;  3F4T A;  1YDK A;  2IFQ B;  3EU3 A;  2GZY A;  1PL1 A;  1VF1 A;  2C80 A;  1OKD A;  3UL3 A;  3PIN A;  1ERW A;  1KEB A;  1U87 A;  2WZ9 A;  4PQ1 A;  3F6F A;  3SBC A;  4TR3 A;  3TOU A;  2HRF A;  3LXT A;  2IMF A;  5DBQ A;  1ZL9 A;  2HSM B;  3VFI A;  2RUE A;  3KP9 A;  3TKQ A;  4TR4 A;  3C73 A;  2YN1 A;  4WBR D;  2E7P A;  1GWC A;  5KN0 A;  3TKR A;  3ZLP A;  2AYT A;  2WW1 A;  1PQN A;  1M2A A;  2H8L A;  1AQX A;  2JZS A;  1QMV A;  1A2M A;  2LTK A;  4I2T A;  2VD1 A;  2B1L A;  2CQ9 A;  1VF2 A;  5C00 A;  2HYX A;  2EFH A;  3E3E A;  3M1G A;  3GKM A;  2CA8 A;  1OC3 A;  4Q5Q A;  1FB6 A;  2CV4 A;  2R4V A;  3BBY A;  2WB9 A;  4L5L A;  3KH7 A;  2XC2 A;  4K7O A;  4MA9 A;  5ECK B;  4O32 A;  2PN8 A;  1EP8 A;  2DJ2 A;  1YKA A;  3LOR A;  4GLT A;  2WGR A;  1FVK A;  5IPG A;  5ECM B;  2FD3 A;  3W8S A;  2A2P A;  7GSS A;  3O3T A;  2C0E A;  5ECH B;  3VPT A;  4ECB A;  4TXO A;  5A5H B;  4YQV A;  4TR0 A;  1U6T A;  1YEX A;  3DVX A;  2BMX A;  1GSE A;  4HQZ A;  1EOG A;  5DAL B;  2CAQ A;  4BWQ A;  4G9H A;  4ML6 A;  3LQ7 A;  3CWG A;  2MMA A;  3F8U A;  5IMA A;  2X8H A;  4QL7 A;  2VLT A;  3EU4 A;  3ISO A;  5CO3 A;  2FA8 A;  3C7M A;  1O8W A;  3APS A;  4Z2U A;  4ILF A;  2B7J A;  2DMM A;  1M2D A;  3GIX A;  3H8Q A;  2I4A A;  4L0U A;  3IDV A;  1BX9 A;  2WUL A;  2DBC A;  1EZK A;  2H6X A;  2XHF A;  1AAZ A;  2IFQ A;  3ERG A;  4GSS A;  3IPZ A;  2AHE A;  3CQF A;  4IHU A;  3TDG A;  20GS A;  2OE0 A;  2X8C A;  3F4R A;  2GZZ A;  9GSS A;  1HNA A;  3GKX A;  4Z7X A;  1UVZ A;  3A5W A;  2HSH A;  4ZB7 A;  1J9B A;  2KOK A;  2VCQ A;  1Y6E A;  3TCO A;  3WGX A;  4CHS A;  2JZT A;  2DJ1 A;  4O7H A;  1GSU A;  5A4U A;  1V9W A;  3BCK A;  2WDU A;  2VL2 C;  2QKE A;  1SD8 A;  4J57 E;  1B4P A;  5GZZ B;  2OAC A;  4I8B A;  1F3B A;  2H74 A;  4LL4 B;  1E2Y A;  1JZW A;  2V2G A;  2VCZ A;  1K0N A;  4K5R A;  3PH9 A;  3GL5 A;  1BG1 A;  4ID0 A;  4IJI A;  3FZ5 A;  1Y1U A;  5C04 A;  5ELA A;  3ZVJ A;  1PD2 1;  5DDL A;  2GVP A;  2L6D A;  2VIM A;  3UOM A;  2YPM A;  1XCC A;  5E4W A;  4P3Y B;  3VI7 A;  5CAX A;  2DIZ A;  4ZBA A;  2CZ3 A;  3CRU A;  3HD5 A;  3CBU A;  4CDO A;  1Z9H A;  3GYK A;  2TIR A;  2FWF A;  4V1A p;  1XW9 A;  3L9S A;  2O85 A;  2AUV A;  2KP2 A;  1X9M B;  4NHW A;  2MMZ A;  3GSS A;  3ME8 A;  1K3O A;  5A5H A;  3QPM A;  2K18 A;  2OJL A;  5KOX A;  1SK1 A;  4BVY B;  1XVQ A;  5DAL A;  4H86 A;  3RAZ A;  5CRD A;  4Q5N A;  3O6T A;  5EVO A;  2KP1 A;  2AB6 A;  2H30 A;  1J08 A;  5LNK e;  2VM1 A;  1EOH A;  3LG6 A;  1M99 A;  1B9Y C;  1HD2 A;  5D96 A;  1A8L A;  3ZMK A;  4PUF C;  1GL8 A;  5A1N B;  3VUR A;  3TKS C;  5F07 A;  4MAB A;  4POK A;  5CP1 A;  1U88 A;  3RDW A;  3IOS A;  4ZB6 A;  17GS A;  3VK9 A;  3N5O A;  4EDY A;  2CAI A;  4DSS B;  2IN3 A;  4GTU A;  3IV4 A;  3ZML A;  5BMU B;  2YCD A;  3TOT A;  4CY6 A;  4X4J A;  6GSX A;  1XPV A;  1EGR A;  3A2V A;  2GZP A;  1EGO A;  2OBI A;  1U3A A;  4IS0 A;  4HUA A;  3L9V A;  2O5V A;  2GSR A;  4K1F A;  1TJD A;  3D4T A;  2X99 A;  2X4A A;  1OE8 A;  4MMM A;  4KSM A;  14GS A;  5F0G A;  3IK9 A;  1I9D A;  1PFO A;  2PGT A;  1KNG A;  2X8G A;  4IP1 A;  4RUV A;  5L71 A;  3FKF A;  5IMV A;  4OFN A;  3TJF A;  2FNO A;  5LCZ A;  2UZ8 A;  4ISD A;  2JAC A;  5IOW A;  4HJ2 A;  4K2X A;  4MNN A;  1THO A;  3KM6 A;  1GSF A;  2DJK A;  3LXZ A;  2LRC A;  2ON5 A;  1TXX A;  4G0L A;  2LV3 A;  2X64 A;  4XIH A;  2EIR A;  4MH3 A;  2WVX B;  2O36 A;  2H0I A;  5DQS A;  5KN1 A;  2EFC A;  4XS4 A;  3TB2 A;  3H93 A;  1PKZ A;  1NM3 A;  2ES7 A;  2VKZ G;  1QK8 A;  4BVY A;  1QFN A;  2G0F A;  2RM5 A;  5ID2 B;  2VL2 A;  3Q74 A;  2LRT A;  1XWG A;  4WF5 A;  2I81 A;  3GMF A;  1VRS D;  3L4N A;  4TVE A;  2LKU A;  3CSI A;  5FWG A;  4HJM A;  4ACS A;  3GH6 A;  3HHV A;  1K3Y A;  2F8F A;  4ECJ A;  2LJK A;  4XRA A;  2IMK A;  10GS A;  2N5F A;  4GCI A;  1F37 A;  1S3R A;  1GUL A;  2LST A;  3VLN A;  2DJ3 A;  4GST A;  3Q19 A;  3TJK A;  1OKT A;  2N5A A;  3IRA A;  2EFD A;  3P2A A;  3FRC A;  2L4C A;  4FIW A;  5IMD A;  1V98 A;  2WRT A;  3GUR A;  2C8U A;  4HZ2 A;  4N10 A;  3TRP A;  5D9X A;  1OC8 A;  1XIY A;  3GUS A;  4WR4 A;  1SEN A;  3P90 A;  1N25 A;  4BA7 A;  4KDU A;  1TOF A;  3R3E A;  4EXJ A;  6GSW A;  3MSZ A;  2YNX A;  4F0B A;  1F3A A;  1SVM A;  3TRX A;  4YAV A;  4IGJ A;  3HJO A;  4KAE A;  1USB A;  2JSZ A;  3FR6 A;  2H6Y A;  2VCV A;  4ZBB A;  4MPF A;  5D9V A;  1NW2 A;  1PMT A;  1JFU A;  1TRV A;  3QAW A;  3VPQ A;  1TU7 A;  3HA9 A;  1YF1 A;  3D21 A;  5HR1 A;  2HQT A;  2FHE A;  4DSR A;  5J9B A;  3TKS A;  3HCZ A;  3TJG A;  3QMX A;  4TOP A;  4ZIJ A;  2OA7 A;  3GX0 A;  2LRN A;  3DWV A;  5A4V A;  1MEK A;  1MDJ A;  2B5Y A;  3UVT A;  2CVD A;  3G7Y A;  1Q98 A;  4IN0 A;  3U6V A;  2VL3 A;  2C0G A;  3ZRE A;  3G9B A;  1T4Z A;  4N3Z A;  1SU9 A;  2H1L A;  4WF4 A;  5HFI A;  2AV4 A;  2H73 A;  3E0U A;  1HNC A;  2P5Q A;  1U3I A;  2DIY A;  2EIO A;  1RK4 A;  3BOA A;  1XVW A;  1I5G A;  2H72 A;  3DKS A;  3H4K A;  1VF3 A;  2IMD A;  2K9F A;  2DML A;  4EC0 A;  3ZZX A;  2WVZ A;  3WD6 A;  1TI1 A;  4PGT A;  4RI7 A;  4TR1 B;  5IQY A;  5ENU A;  1O6J A;  4AF2 A;  3APO A;  5A34 B;  2VUP A;  4F9Z A;  2CVK A;  3KMO A;  5CRW A;  16GS A;  4QMK A;  2L57 A;  2A2S A;  3A5I A;  2R5G A;  1TI3 A;  4G10 A;  1XW6 A;  1YQ1 A;  1SJI A;  2ZNM A;  1XZO A;  4DSQ A;  1Y25 A;  4KCE A;  2H1A A;  2BJX A;  2H71 A;  4FYB A;  11GS A;  1OC9 A;  1EV4 A;  2IPA A;  5J4Y A;  3EYT A;  2YV7 A;  3KTL A;  4KGI A;  3VI5 A;  4KE3 A;  1RQM A;  2GQM A;  5KOW A;  3VWV A;  1W4V A;  1BED A;  3FZ4 A;  1GTB A;  4PI0 C;  1O7U A;  2JU5 A;  2H01 A;  3CMI A;  1G6Y A;  2H75 A;  4BPY A;  1XXU A;  2GST A;  3FW2 A;  2HNL A;  3KCM A;  3ZIJ A;  2GTU A;  4AKI A;  2A4H A;  2PU9 C;  1F9M A;  1Z6N A;  4N0V A;  1FAA A;  2VO4 A;  4OCE A;  2VCX A;  3I9V 2;  4MH2 A;  3CSH A;  2FLS A;  1A0F A;  3WYW A;  1URM A;  2HZE B;  3GST A;  2WJU A;  1BJX A;  1A2J A;  3NIV A;  4EUY A;  3DYR A;  2HLS A;  4ZL7 A;  3D5J A;  1HQO A;  1K0D A;  3RBT A;  1M2B A;  2LUS A;  1O81 A;  5DCG A;  3CTF A;  3KEB A;  4LA1 A;  3VWX A;  18GS A;  2HRK B;  3I69 A;  3CYN A;  1HNB A;  1WJK A;  3FYG A;  1S4B P;  5E59 A;  2P5R A;  1NHO A;  5DAK B;  3WGD A;  1SL0 B;  3KD0 A;  3MIX A;  4EO3 A;  3WT1 A;  3M9K A;  1SD9 A;  3F63 A;  4TN8 A;  4KND A;  2GGT A;  2CT6 A;  3ERF A;  1AIU A;  1N8J A;  1K3L A;  5A34 A;  2O89 A;  3C1R A;  3IHG A;  4NWY A;  1DSB A;  3PR8 A;  4JU5 A;  2YZU A;  4OO5 A;  2XBQ A;  1JZR A;  2IJY A;  3A2W A;  4G2E A;  4F03 A;  1T4Y A;  1GSY A;  2HFD A;  2I9H A;  2WW0 A;  4DEJ A;  2LEG A;  1ON4 A;  3QFA C;  4YQM A;  2IIY A;  5CRG A;  2GDR A;  4AKG A;  1ZGN A;  5KN2 A;  3GHA A;  1GRX A;  5J40 A;  3GKN A;  3K8N A;  2HSM A;  4PX1 A;  2XBI A;  2AAW A;  3AY8 A;  2FWG A;  4DVC A;  4QL9 A;  4L0W A;  2YAN A;  4Q5R A;  1Z7P A;  3LWA A;  3ERW A;  5FT3 A;  4QQ7 A;  1DE2 A;  1PGT A;  2PUK C;  4HI7 A;  4K9Z A;  5AN1 A;  4NV2 A;  1F2E A;  3ZYW A;  5A5K A;  3FY7 A;  2DKI A;  4GQC A;  2GSQ A;  1K0A A;  3R2Q A;  4KDY A;  4O92 A;  4GXZ A;  3TJB A;  1VF4 A;  3FMW A;  1B4Q A;  4JR4 A;  4HDE A;  2NTO A;  1T7P B;  4WR5 A;  4ML1 A;  2XPE A;  2GT5 A;  2HSY A;  4I5Q A;  2VOC A;  4EL1 A;  2YZH A;  4AKX B;  3KH9 A;  3GTU B;  5ECQ B;  1LJR A;  2IME A;  2F8A A;  4EKZ A;  2IWT A;  2FWH A;  1Z7R A;  1IYH A;  5H5Q A;  4YKF A;  1SJZ A;  2V6K A;  1SKW B;  4OFM A;  1B48 A;  4EVM A;  1WP0 A;  4YAP A;  4I97 A;  1K0O A;  2L4Q A;  5GAN D;  3UBK A;  5DQY A;  1YZX A;  1VGL A;  3M3M A;  1G6W A;  1O73 A;  4G01 A;  3LJR A;  3QAV A;  3EWL A;  4L5O A;  5CRH A;  4ZL8 A;  3J7Y b;  4AGS A;  1AUC A;  3D6I A;  4KH7 A;  1SVL A;  2R0C A;  5EPF A;  5D9W A;  4MJC A;  1G7E A;  1M9B A;  4MP4 A;  2F3M A;  4EF0 A;  1JLW A;  4IQ1 A;  1QUW A;  1FVJ A;  6GST A;  2FA4 A;  1XG8 A;  1S3A A;  2YJH A;  4CY8 A;  3GV1 A;  2HRN A;  2VD0 A;  3CTG A;  1E6B A;  3J7Y k;  1M3J A;  5H5R A;  1X9S B;  2DJ0 A;  5F06 A;  2VCT A;  1R7H A;  3F3Q A;  3DRN A;  1GSD A;  2ALB A;  2YOI A;  3EMX A;  4BL7 B;  3HJP A;  5G1K A;  4BVX B;  2O8V B;  2WS2 A;  1GH2 A;  3US3 A;  3TRQ A;  5CNW A;  5J4U A;  4KA0 A;  1ABA A;  5FHI A;  2YWI A;  1YKC A;  1F6M C;  1EEM A;  1NSW A;  1UN2 A;  3WT2 A;  1GTI A;  2WZS A;  2OKA A;  4ZB8 A;  1TW9 A;  2WCI A;  2JSY A;  3BJ5 A;  5ECP B;  4KCA A;  1FOV A;  4PQH A;  13GS A;  1ZYP A;  3I6A A;  2ZUP A;  1TDI A;  3C8E A;  3KIJ A;  2OBK A;  3LYK A;  2YWO A;  1PX6 A;  2X49 A;  4XTS A;  5CRE A;  1YEP A;  2O7K A;  1QXH A;  3ZL5 A;  4AI6 A;  5IO0 A;  3DVW A;  2A2R A;  5ECS A;  2DC5 A;  4E68 A;  1WMJ A;  4USS A;  1WRY A;  3HXS A;  3IC8 A;  1BQ7 A;  3DIE A;  2HZF A;  4AKH A;  1A2L A;  3QFB C;  3VWW A;  3LW9 A;  5EY6 A;  2ON7 A;  3LSZ A;  1EP7 A;  3S9F A;  1UC7 A;  2FUG 2;  2H66 A;  2L5O A;  2Z9S A;  4G0K A;  4JZQ A;  1SK0 A;  2MYG A;  3QCP A;  4AJ7 A;  5GSS A;  1PSQ A;  2VAF A;  1ERT A;  3GRX A;  1Z5Y E;  2RUF A;  3HVS A;  2D2Z A;  5IO2 A;  2PPT A;  4HU7 A;  1NHY A;  3A3T A;  3I43 A;  5ECI B;  2DKH A;  5H5S A;  2R37 A;  3F3R A;  3CHX C;  1T1V A;  2VLV A;  2K8V A;  2L59 A;  1JHB A;  3EIN A;  2M80 A;  2LNT A;  1PRX A;  2LQQ A;  5G5F A;  2K8S A;  3C71 A;  3RPP A;  1JZO A;  4K2D A;  4KUN A;  5A1N A;  4POB A;  1SKR B;  3UBL A;  3QR6 A;  2QA2 A;  3V1W A;  3M9J A;  1O85 A;  2H70 A;  5G2Z A;  1AXD A;  4ECI A;  1G0T A;  4DSS A;  2YP6 A;  3GX8 A;  5BMU A;  4BL7 A;  2K6V A;  1WWJ A;  4MF6 A;  3TJJ A;  1GUK A;  1BAY A;  1A23 A;  5HFG A;  1GNE A;  1EWX A;  5F05 A;  5HQP A;  3IR4 A;  2M46 A;  4K0G A;  4MZC A;  2MBS A;  4N0Z A;  3UVH A;  4K8M A;  5DJL A;  2HE3 A;  4XCS A;  3UMA A;  4WXT A;  4FO5 A;  3RHB A;  2B6M A;  3KP8 A;  1H75 A;  4YQU A;  3ZVJ D;  4AJ6 A;  3DGQ A;  4HU9 A;  4KB3 A;  1EV9 A;  4FH8 A;  1V57 A;  3KJY A;  4G19 A;  1FOH A;  5EL8 A;  3GL3 A;  1OE7 A;  3KTB A;  1WOU A;  3CSJ A;  1ZCP A;  3BD2 A;  3D0Z A;  4PHZ C;  3NZN A;  5ELG A;  1DUG A;  2F51 A;  3HZ4 A;  2LNS A;  5DCH A;  4F82 A;  2A4V A;  2EFE A;  2YWM A;  3ZFB A;  3QD9 A;  2PMT A;  2C0F A;  2WVX A;  1CQG A;  2QA1 A;  4PNG A;  1M0U A;  1WPI A;  2E2M A;  4IVF A;  4EDZ A;  2R2J A;  5AGY A;  1SL1 B;  4MZB A;  1BG5 A;  2V32 A;  1T3B A;  2GQK A;  1TU8 A;  4OMV A;  4JED A;  1Q4J A;  4XRD A;  4MLY A;  3SWL A;  5ID2 A;  3DML A;  2YV9 A;  1LU4 A;  4MZW A;  4IJ3 A;  1ERU A;  4TRX A;  3MYD A;  3KZQ A;  4K7I A;  2JL4 A;  4V2N A;  1X5D A;  2C3Q A;  2GQL A;  4ECC A;  3F6D A;  2B1K A;  1GUH A;  3FEU A;  1N2A A;  2YWN A;  3IAM 2;  3IBH A;  2REM A;  2M72 A;  1FO5 A;  1TTZ A;  4KDX A;  1YVL A;  2LJR A;  3PGT A;  5HR0 A;  4TW5 A;  4HOJ A;  1XFL A;  3D4M A;  2O3E A;  3KMN A;  1PN0 A;  1AQW A;  2FCH A;  4HSC X;  1AC1 A;  3GNJ A;  4X1U A;  1TRW A;  2KHP A;  4XS6 A;  5J3R A;  2C1Y A;  2N5B A;  5JWO B;  3E9J B;  4HEA 2;  4YH2 A;  4MF7 A;  5ECN B;  6GSS A;  4LMV A;  4O5Q A;  2QGV A;  2F9S A;  2H19 A;  2EC4 A;  5IM9 A;  3L78 A;  1KBN A;  1SVO A;  4OFT A;  4KW6 A;  4NPB A;  4EIQ A;  5J47 A;  3TU3 B;  1TK0 B;  5COH A;  4FYC A;  3DD3 A;  3FR3 A;  5HR3 A;  4FYU A;  3ZIV A;  3F0I A;  1GTU A;  5B8B A;  3RGB C;  3QAG A;  1GNW A;  2I3Y A;  4EIP A;  3L0H A;  3G7I A;  2QC7 A;  4IP6 A;  2WFC A;  5J4V A;  4WKW A;  2B7K A;  1ERV A;  1TXU A;  1X5C A;  2OE1 A;  3QOU A;  2FY6 A;  2O87 A;  1MD4 A;  1ZYE A;  4ULX A;  4XHM A;  2CZ2 A;  4NHZ A;  2VCW A;  4OD7 A;  1TP9 A;  2VM2 A;  3EC3 A;  5KEJ A;  2PWJ A;  1O8X A;  2H1B A;  2AJQ B;  2E0Q A;  3ZFL A;  5DVB A;  5AIX A;  3HZ8 A;  1EEJ A;  2R0G A;  2NBS A;  2GT6 A;  4KSO A;  3RHC A;  1WE0 A;  3EVI A;  3G7J A;  2CVB A;  3U5R E;  2OT3 A;  4LL1 B;  4X0X A;  4HQS A;  4TR1 A;  4PXO A;  1AW9 A;  3FK8 A;  4RQX A;  4J56 E;  3TUE A;  5IPH A;  3LFL A;  5HFK A;  3ME7 A;  1IYI A;  4NAX A;  5DJM A;  1XWA A;  1X9W B;  4PUA A;  5ECL B;  2C3T A;  5LD0 A;  1JLV A;  3ZTL A;  1R4W A;  3HY2 A;  2RII A;  2NVL A;  5B6M A;  3O76 A;  1ZMA A;  1ML6 A;  2GLR A;  2GSS A;  3UEM A;  4MK3 A;  4F2I A;  2V1M A;  1DBY A;  2NDO A;  1YY7 A;  2HI7 A;  4D73 B;  5D93 A;  2B5E A;  3LYP A;  1Z6M A;  4V2M A;  4AJ8 A;  1JZD A;  4Q5F A;  3ZIT A;  3W6G A;  2C0D A;  3HJM A;  2OE3 A;  2HSN B;  2DSA A;  2KLX A;  1J0F A;  1M3I A;  8GSS A;  2B3S A;  3HVN A;  5ECO B;  1XWK A;  3CRT A;  1R26 A;  3FZA A;  3HYP A;  5ABR A;  3MDK A;  4GF0 A;  4PTS A;  4FQU A;  3TGZ A;  4Z2R A;  1CQH A;  3EMP A;  2L5L A;  1SJ6 A;  2JZR A;  2HZE A;  4KX4 A;  4O5R A;  3HKR A;  1FW1 A;  5J41 A;  3UAP A;  1ZYQ B;  1GTA A;  1GUM A;  2VL9 A;  3UIW A;  4I6X A;  1PL2 A;  2HRK A;  1GP1 A;  1K0C A;  3EPT A;  1H4O A;  1W89 A;  3IA1 A;  3MWH A;  3IHQ A;  4ICY A;  5DAK A;  5IOX A;  4O5U A;  1YJ6 A;  2PER A;  5AIV A;  2UV8 G;  4GWR A;  4ZBD A;  4JRR A;  1OVN A;  1ACV A;  2E2G A;  4XS4 B;  3N9J A;  2HRA A;  2FGX A;  1M9A A;  1GLQ A;  3GA4 A;  1B9X C;  3HVX A;  3MNG A;  1X0R A;  1ST9 A;  1Z3E A;  4K6X A;  2J9H A;  3JCM L;  3IE3 A;  4I2U A;  5B7C A;  2YJ7 A;  1A8Y A;  3DXB A;  4IW9 A;  3NOF A;  5AIS A;  4J2F A;  1A0R P;  1DE1 A;  2WW3 A;  2R0P A;  1V2A A;  4ZL9 A;  4OO4 A;  2TRX A;  4BIK A;  5HR2 A;  4EE0 A;  2GS3 A;  4D73 A;  5GAP D;  5G31 A;  1XOA A;  2CX3 A;  1K0B A;  2CX4 A;  3TKP A;  5D8I A;  3KGK A;  1TKD B;  4LLR A;  2HSN A;  4F0C A;  4PI2 C;  1R5P A;  4HS1 A;  2WVY A;  4KF9 A;  2I1U A;  5J5N A;  3WGE A;  1RW1 A;  2LS5 A;  2JAD A;  1KTE A;  3IAS 2;  4GQF A;  1ZYN A;  3RFR C;  3Q6O A;  1YEW C;  3GFK A;  3FHK A;  4MCU A;  2H6Z A;  2OAD A;  1GSQ A;  5D73 A;  1XW5 A;  1S3C A;  4N11 A;  1PN9 A;  1X5E A;  5B8A A;  4Z2T A;  2HT9 A;  1FHE A;  1R5A A;  5IMZ A;  5JWQ B;  4L8E A;  1XWB A;  5IMF A;  3QDN A;  4ZIL A;  1TK8 B;  4A5P A;  3UAR A;  4WBJ A;  4FXY P;  5B6N A;  3UJ1 A;  5JCW A;  3GTU A;  4YKG A;  2BTO T;  2R6K A;  3M8N A;  3MAK A;  4E8H A;  4CW9 A;  5D9T A;  3HMJ G;  1XBS A;  2H0G A;  1XWC A;  4RQR A;  4HZ4 A;  3FR9 A;  4X43 A;  5IMC A;  4JE1 A;  12GS A;  2FWE A;  2LJA A;  3H1N A;  1ZOF A;  4IKH A;  2R3X A;  3IXR A;  2C3N A;  3OR5 A;  5JWR B;  4G0I A;  4N30 A;  3HDC A;  2PBJ A;  4NMU A;  4JR6 A;  2KUC A;  6GSV A;  5JCU A;  3EE2 A;  5G30 A;  1OYJ A;  2XPD A;  1ILO A;  3P8W A;  4W66 A;  1XOB A;  4GRF A;  4NXI A;  2PVQ A;  1MD3 A;  3DEX A;  2DLX A;  2P0G A;  1MTC A;  3F4S A;  2L6C A;  1UA5 A;  4IEL A;  2PVO C;  4K0N A;  1PX7 A;  1FG4 A;  4JBB A;  4BVX A;  2RLI A;  4TKY A;  3FZ9 A;  3LEF A;  1SK2 A;  4WEY A;  2MMO A;  3GH9 A;  1C72 A;  1MDI A;  2NPB A;  19GS A;  2MMN A;  3APQ A;  4NV5 A;  4ZB9 A;  3A2X A;  4MDC A;  1A24 A;  5GST A;  2DJJ A;  3C1S A;  4LMW A;  3F9U A;  1OC9 B;  2IL3 A;  3VWU A;  1SYX A;  2QSI A;  1I1I P;  3H79 A;  1SKS B;  3BCI A;  5IIZ A;  1V40 A;  5ECR B;  2EIQ A;  1THX A;  4POM A;  1SYR A;  4V2L A;  4MPG A;  5A4W A;  4V1A g;  4K5S A;  2H76 A;  4ZXG A;  2RM6 A;  3EUR A;  5KN3 A;  5J9C A;  2MBT A;  1V58 A;  1TRU A;  3Q18 A;  6GSY A;  4OCF A;  4TXV A;  4K7N A;  4WET A;  4POL A;  2H1D A;  1LBK A;  1T00 A;  1MDK A;  3PPU A;  2V6O A;  2VLU A;  5G5E A;  4XS1 A;  1BYE A;  2TRC P;  4RI6 A;  2G2Q A;  1TRS A;  4IQA A;  3IC4 A;  4MJA A;  1FB0 A;  22GS A;  4GSN A;  1T8E B;  1GLP A;  1B8X A;  3GN3 A;  2LQO A;  3W8J A;  3GKK A;  2H1G A;  1PKW A;  2C4J A;  3CXG A; 
#chains in the Genus database with same CATH homology
 5F8B A;  1ZZY A;  4TXO B;  4PNF A;  1AQV A;  5INY A;  1WIK A;  4GDF A;  3D22 A;  4OWY A;  1QGV A;  2ZCT A;  4BWS A;  5CYY A;  2P31 A;  3P7X A;  5BRT A;  1OAZ A;  1GSS A;  3RPN A;  2H0H A;  1TK5 B;  4IBP A;  5JCG A;  3L9U A;  4E8E A;  3KXO A;  1HYU A;  2IMI A;  3M0F A;  3IK7 A;  1QQ2 A;  4MF5 A;  4MJB A;  1SL2 B;  6GSU A;  1M7T A;  1PA3 A;  4MJE A;  2V41 A;  1BF5 A;  3TKS E;  2J23 A;  3ZRD A;  2B5X A;  3ED3 A;  1YF0 A;  3LGC A;  1K0M A;  1S3D A;  3HVV A;  5G1L A;  2MZC A;  4PUR A;  1G7O A;  2HXK A;  4PQI A;  3F4T A;  1YDK A;  2IFQ B;  3EU3 A;  2GZY A;  1PL1 A;  1VF1 A;  2C80 A;  1OKD A;  3UL3 A;  3PIN A;  1ERW A;  1KEB A;  1U87 A;  2WZ9 A;  4PQ1 A;  3F6F A;  3SBC A;  4TR3 A;  3TOU A;  2HRF A;  3LXT A;  2IMF A;  5DBQ A;  1ZL9 A;  2HSM B;  3VFI A;  2RUE A;  3KP9 A;  3TKQ A;  4TR4 A;  3C73 A;  2YN1 A;  4WBR D;  2E7P A;  1GWC A;  5KN0 A;  3TKR A;  3ZLP A;  2AYT A;  1PQN A;  1M2A A;  2H8L A;  1AQX A;  2JZS A;  1QMV A;  1A2M A;  2LTK A;  4I2T A;  2VD1 A;  2B1L A;  2CQ9 A;  1VF2 A;  5C00 A;  2HYX A;  2EFH A;  3E3E A;  3M1G A;  3GKM A;  2CA8 A;  1OC3 A;  4Q5Q A;  1FB6 A;  2CV4 A;  2R4V A;  3BBY A;  2WB9 A;  4L5L A;  3KH7 A;  2XC2 A;  4K7O A;  4MA9 A;  5ECK B;  4O32 A;  2PN8 A;  1EP8 A;  2DJ2 A;  1YKA A;  3LOR A;  4GLT A;  2WGR A;  1FVK A;  5IPG A;  5ECM B;  2FD3 A;  3W8S A;  2A2P A;  7GSS A;  3O3T A;  2C0E A;  5ECH B;  3VPT A;  4ECB A;  4TXO A;  5A5H B;  4YQV A;  4TR0 A;  1U6T A;  1YEX A;  3DVX A;  2BMX A;  1GSE A;  4HQZ A;  1EOG A;  5DAL B;  2CAQ A;  4BWQ A;  4G9H A;  4ML6 A;  3LQ7 A;  3CWG A;  2MMA A;  3F8U A;  5IMA A;  2X8H A;  4QL7 A;  2VLT A;  3EU4 A;  3ISO A;  5CO3 A;  2FA8 A;  3C7M A;  1O8W A;  3APS A;  4Z2U A;  4ILF A;  2B7J A;  2DMM A;  1M2D A;  3GIX A;  3H8Q A;  2I4A A;  4L0U A;  3IDV A;  1BX9 A;  2WUL A;  2DBC A;  1EZK A;  2H6X A;  2XHF A;  1AAZ A;  2IFQ A;  3ERG A;  4GSS A;  3IPZ A;  2AHE A;  4IHU A;  3TDG A;  20GS A;  2OE0 A;  2X8C A;  3F4R A;  2GZZ A;  9GSS A;  1HNA A;  3GKX A;  4Z7X A;  1UVZ A;  3A5W A;  2HSH A;  4ZB7 A;  1J9B A;  2KOK A;  2VCQ A;  1Y6E A;  3TCO A;  3WGX A;  4CHS A;  2JZT A;  2DJ1 A;  4O7H A;  1GSU A;  5A4U A;  1V9W A;  3BCK A;  2WDU A;  2VL2 C;  2QKE A;  1SD8 A;  4J57 E;  1B4P A;  5GZZ B;  2OAC A;  4I8B A;  1F3B A;  2H74 A;  4LL4 B;  1E2Y A;  1JZW A;  2V2G A;  2VCZ A;  1K0N A;  4K5R A;  3PH9 A;  3GL5 A;  1BG1 A;  4ID0 A;  4IJI A;  3FZ5 A;  1Y1U A;  5C04 A;  5ELA A;  3ZVJ A;  1PD2 1;  5DDL A;  2GVP A;  2L6D A;  2VIM A;  3UOM A;  2YPM A;  1XCC A;  5E4W A;  4P3Y B;  3VI7 A;  5CAX A;  2DIZ A;  4ZBA A;  2CZ3 A;  3CRU A;  3HD5 A;  3CBU A;  4CDO A;  1Z9H A;  3GYK A;  2TIR A;  2FWF A;  4V1A p;  1XW9 A;  3L9S A;  2O85 A;  2AUV A;  2KP2 A;  1X9M B;  4NHW A;  2MMZ A;  3GSS A;  3ME8 A;  1K3O A;  5A5H A;  3QPM A;  2K18 A;  2OJL A;  5KOX A;  1SK1 A;  4BVY B;  1XVQ A;  5DAL A;  4H86 A;  3RAZ A;  5CRD A;  4Q5N A;  3O6T A;  5EVO A;  2KP1 A;  2AB6 A;  2H30 A;  1J08 A;  5LNK e;  2VM1 A;  1EOH A;  3LG6 A;  1M99 A;  1B9Y C;  1HD2 A;  5D96 A;  1A8L A;  3ZMK A;  4PUF C;  1GL8 A;  5A1N B;  3VUR A;  3TKS C;  5F07 A;  4MAB A;  4POK A;  5CP1 A;  1U88 A;  3RDW A;  3IOS A;  4ZB6 A;  17GS A;  3VK9 A;  3N5O A;  4EDY A;  2CAI A;  4DSS B;  2IN3 A;  4GTU A;  3IV4 A;  3ZML A;  5BMU B;  2YCD A;  3TOT A;  4CY6 A;  4X4J A;  6GSX A;  1XPV A;  1EGR A;  3A2V A;  2GZP A;  1EGO A;  2OBI A;  1U3A A;  4IS0 A;  4HUA A;  3L9V A;  2O5V A;  2GSR A;  4K1F A;  1TJD A;  3D4T A;  2X99 A;  2X4A A;  1OE8 A;  4MMM A;  4KSM A;  14GS A;  5F0G A;  3IK9 A;  1I9D A;  2PGT A;  1KNG A;  2X8G A;  4IP1 A;  4RUV A;  5L71 A;  3FKF A;  5IMV A;  4OFN A;  3TJF A;  2FNO A;  5LCZ A;  2UZ8 A;  4ISD A;  2JAC A;  5IOW A;  4HJ2 A;  4K2X A;  4MNN A;  1THO A;  3KM6 A;  1GSF A;  2DJK A;  3LXZ A;  2LRC A;  2ON5 A;  1TXX A;  4G0L A;  2LV3 A;  2X64 A;  4XIH A;  2EIR A;  4MH3 A;  2H0I A;  5DQS A;  5KN1 A;  2EFC A;  4XS4 A;  3TB2 A;  3H93 A;  1PKZ A;  1NM3 A;  2ES7 A;  2VKZ G;  1QK8 A;  4BVY A;  1QFN A;  2G0F A;  2RM5 A;  5ID2 B;  2VL2 A;  3Q74 A;  2LRT A;  1XWG A;  4WF5 A;  2I81 A;  3GMF A;  1VRS D;  3L4N A;  4TVE A;  2LKU A;  3CSI A;  5FWG A;  4HJM A;  4ACS A;  3GH6 A;  3HHV A;  1K3Y A;  2F8F A;  4ECJ A;  2LJK A;  4XRA A;  2IMK A;  10GS A;  2N5F A;  4GCI A;  1F37 A;  1GUL A;  2LST A;  3VLN A;  2DJ3 A;  4GST A;  3Q19 A;  3TJK A;  1OKT A;  2N5A A;  3IRA A;  2EFD A;  3P2A A;  3FRC A;  2L4C A;  4FIW A;  5IMD A;  1V98 A;  2WRT A;  3GUR A;  2C8U A;  4HZ2 A;  4N10 A;  3TRP A;  5D9X A;  1OC8 A;  1XIY A;  3GUS A;  4WR4 A;  1SEN A;  3P90 A;  1N25 A;  4BA7 A;  4KDU A;  1TOF A;  3R3E A;  4EXJ A;  6GSW A;  3MSZ A;  2YNX A;  4F0B A;  1F3A A;  1SVM A;  3TRX A;  4YAV A;  4IGJ A;  3HJO A;  4KAE A;  1USB A;  2JSZ A;  3FR6 A;  2H6Y A;  2VCV A;  4ZBB A;  4MPF A;  5D9V A;  1NW2 A;  1PMT A;  1JFU A;  1TRV A;  3QAW A;  3VPQ A;  1TU7 A;  3HA9 A;  1YF1 A;  3D21 A;  5HR1 A;  2HQT A;  2FHE A;  4DSR A;  5J9B A;  3TKS A;  3HCZ A;  3TJG A;  3QMX A;  4TOP A;  4ZIJ A;  2OA7 A;  3GX0 A;  2LRN A;  3DWV A;  5A4V A;  1MEK A;  1MDJ A;  2B5Y A;  3UVT A;  2CVD A;  3G7Y A;  1Q98 A;  4IN0 A;  3U6V A;  2VL3 A;  2C0G A;  3ZRE A;  3G9B A;  1T4Z A;  4N3Z A;  1SU9 A;  2H1L A;  4WF4 A;  5HFI A;  2AV4 A;  2H73 A;  3E0U A;  1HNC A;  2P5Q A;  1U3I A;  2DIY A;  2EIO A;  1RK4 A;  3BOA A;  1XVW A;  1I5G A;  2H72 A;  3DKS A;  3H4K A;  1VF3 A;  2IMD A;  2K9F A;  2DML A;  4EC0 A;  3ZZX A;  3WD6 A;  1TI1 A;  4PGT A;  4RI7 A;  4TR1 B;  5IQY A;  5ENU A;  1O6J A;  4AF2 A;  3APO A;  5A34 B;  2VUP A;  4F9Z A;  2CVK A;  3KMO A;  5CRW A;  16GS A;  4QMK A;  2L57 A;  2A2S A;  3A5I A;  2R5G A;  1TI3 A;  4G10 A;  1XW6 A;  1YQ1 A;  1SJI A;  2ZNM A;  1XZO A;  4DSQ A;  1Y25 A;  4KCE A;  2H1A A;  2BJX A;  2H71 A;  4FYB A;  11GS A;  1OC9 A;  1EV4 A;  2IPA A;  5J4Y A;  3EYT A;  2YV7 A;  3KTL A;  4KGI A;  3VI5 A;  4KE3 A;  1RQM A;  2GQM A;  5KOW A;  3VWV A;  1W4V A;  1BED A;  3FZ4 A;  1GTB A;  1O7U A;  2JU5 A;  2H01 A;  3CMI A;  1G6Y A;  2H75 A;  4BPY A;  1XXU A;  2GST A;  3FW2 A;  2HNL A;  3KCM A;  3ZIJ A;  2GTU A;  4AKI A;  2A4H A;  2PU9 C;  1F9M A;  1Z6N A;  4N0V A;  1FAA A;  2VO4 A;  4OCE A;  2VCX A;  3I9V 2;  4MH2 A;  3CSH A;  2FLS A;  1A0F A;  3WYW A;  1URM A;  2HZE B;  3GST A;  2WJU A;  1BJX A;  1A2J A;  3NIV A;  4EUY A;  3DYR A;  2HLS A;  4ZL7 A;  3D5J A;  1HQO A;  1K0D A;  3RBT A;  1M2B A;  2LUS A;  1O81 A;  5DCG A;  3CTF A;  3KEB A;  4LA1 A;  3VWX A;  18GS A;  2HRK B;  3I69 A;  3CYN A;  1HNB A;  1WJK A;  3FYG A;  5E59 A;  2P5R A;  1NHO A;  5DAK B;  3WGD A;  1SL0 B;  3KD0 A;  3MIX A;  4EO3 A;  3WT1 A;  3M9K A;  1SD9 A;  3F63 A;  4TN8 A;  4KND A;  2GGT A;  2CT6 A;  3ERF A;  1AIU A;  1N8J A;  1K3L A;  5A34 A;  2O89 A;  3C1R A;  3IHG A;  4NWY A;  1DSB A;  3PR8 A;  4JU5 A;  2YZU A;  4OO5 A;  2XBQ A;  1JZR A;  2IJY A;  3A2W A;  4G2E A;  4F03 A;  1T4Y A;  1GSY A;  2HFD A;  2I9H A;  4DEJ A;  2LEG A;  1ON4 A;  3QFA C;  4YQM A;  2IIY A;  5CRG A;  2GDR A;  4AKG A;  1ZGN A;  5KN2 A;  3GHA A;  1GRX A;  5J40 A;  3GKN A;  3K8N A;  2HSM A;  4PX1 A;  2XBI A;  2AAW A;  3AY8 A;  2FWG A;  4DVC A;  4QL9 A;  4L0W A;  2YAN A;  4Q5R A;  1Z7P A;  3LWA A;  3ERW A;  5FT3 A;  4QQ7 A;  1DE2 A;  1PGT A;  2PUK C;  4HI7 A;  4K9Z A;  5AN1 A;  4NV2 A;  1F2E A;  3ZYW A;  5A5K A;  3FY7 A;  2DKI A;  4GQC A;  2GSQ A;  1K0A A;  3R2Q A;  4KDY A;  4O92 A;  4GXZ A;  3TJB A;  1VF4 A;  3FMW A;  1B4Q A;  4JR4 A;  4HDE A;  2NTO A;  1T7P B;  4WR5 A;  4ML1 A;  2XPE A;  2GT5 A;  2HSY A;  4I5Q A;  2VOC A;  4EL1 A;  2YZH A;  4AKX B;  3KH9 A;  3GTU B;  5ECQ B;  1LJR A;  2IME A;  2F8A A;  4EKZ A;  2IWT A;  2FWH A;  1Z7R A;  1IYH A;  5H5Q A;  4YKF A;  1SJZ A;  2V6K A;  1SKW B;  4OFM A;  1B48 A;  4EVM A;  1WP0 A;  4YAP A;  4I97 A;  1K0O A;  2L4Q A;  5GAN D;  3UBK A;  5DQY A;  1YZX A;  1VGL A;  3M3M A;  1G6W A;  1O73 A;  4G01 A;  3LJR A;  3QAV A;  3EWL A;  4L5O A;  5CRH A;  4ZL8 A;  3J7Y b;  4AGS A;  1AUC A;  3D6I A;  4KH7 A;  1SVL A;  2R0C A;  5EPF A;  5D9W A;  4MJC A;  1G7E A;  1M9B A;  4MP4 A;  2F3M A;  4EF0 A;  1JLW A;  4IQ1 A;  1QUW A;  1FVJ A;  6GST A;  2FA4 A;  1S3A A;  2YJH A;  4CY8 A;  3GV1 A;  2HRN A;  2VD0 A;  3CTG A;  1E6B A;  3J7Y k;  5H5R A;  1X9S B;  2DJ0 A;  5F06 A;  2VCT A;  1R7H A;  3F3Q A;  3DRN A;  1GSD A;  2ALB A;  2YOI A;  3EMX A;  4BL7 B;  3HJP A;  5G1K A;  4BVX B;  2O8V B;  2WS2 A;  1GH2 A;  3US3 A;  3TRQ A;  5CNW A;  5J4U A;  4KA0 A;  1ABA A;  5FHI A;  2YWI A;  1YKC A;  1F6M C;  1EEM A;  1NSW A;  1UN2 A;  3WT2 A;  1GTI A;  2OKA A;  4ZB8 A;  1TW9 A;  2WCI A;  2JSY A;  3BJ5 A;  5ECP B;  4KCA A;  1FOV A;  4PQH A;  13GS A;  1ZYP A;  3I6A A;  2ZUP A;  1TDI A;  3C8E A;  3KIJ A;  2OBK A;  3LYK A;  2YWO A;  1PX6 A;  2X49 A;  4XTS A;  5CRE A;  1YEP A;  2O7K A;  1QXH A;  3ZL5 A;  4AI6 A;  5IO0 A;  3DVW A;  2A2R A;  5ECS A;  2DC5 A;  4E68 A;  1WMJ A;  4USS A;  1WRY A;  3HXS A;  3IC8 A;  1BQ7 A;  3DIE A;  2HZF A;  4AKH A;  1A2L A;  3QFB C;  3VWW A;  3LW9 A;  5EY6 A;  2ON7 A;  3LSZ A;  1EP7 A;  3S9F A;  1UC7 A;  2FUG 2;  2H66 A;  2L5O A;  2Z9S A;  4G0K A;  4JZQ A;  1SK0 A;  2MYG A;  3QCP A;  4AJ7 A;  5GSS A;  1PSQ A;  2VAF A;  1ERT A;  3GRX A;  1Z5Y E;  2RUF A;  3HVS A;  2D2Z A;  5IO2 A;  2PPT A;  4HU7 A;  1NHY A;  3A3T A;  3I43 A;  5ECI B;  2DKH A;  5H5S A;  2R37 A;  3F3R A;  1T1V A;  2VLV A;  2K8V A;  2L59 A;  1JHB A;  3EIN A;  2M80 A;  2LNT A;  1PRX A;  2LQQ A;  5G5F A;  2K8S A;  3C71 A;  3RPP A;  1JZO A;  4K2D A;  4KUN A;  5A1N A;  4POB A;  1SKR B;  3UBL A;  3QR6 A;  2QA2 A;  3V1W A;  3M9J A;  1O85 A;  2H70 A;  5G2Z A;  1AXD A;  4ECI A;  1G0T A;  4DSS A;  2YP6 A;  3GX8 A;  5BMU A;  4BL7 A;  2K6V A;  1WWJ A;  4MF6 A;  3TJJ A;  1GUK A;  1BAY A;  1A23 A;  5HFG A;  1GNE A;  1EWX A;  5F05 A;  5HQP A;  3IR4 A;  2M46 A;  4K0G A;  4MZC A;  2MBS A;  4N0Z A;  3UVH A;  4K8M A;  5DJL A;  2HE3 A;  4XCS A;  3UMA A;  4WXT A;  4FO5 A;  3RHB A;  2B6M A;  3KP8 A;  1H75 A;  4YQU A;  3ZVJ D;  4AJ6 A;  3DGQ A;  4HU9 A;  4KB3 A;  1EV9 A;  4FH8 A;  1V57 A;  3KJY A;  4G19 A;  1FOH A;  5EL8 A;  3GL3 A;  1OE7 A;  3KTB A;  1WOU A;  3CSJ A;  1ZCP A;  3BD2 A;  3D0Z A;  3NZN A;  5ELG A;  1DUG A;  2F51 A;  3HZ4 A;  2LNS A;  5DCH A;  4F82 A;  2A4V A;  2EFE A;  2YWM A;  3ZFB A;  3QD9 A;  2PMT A;  2C0F A;  1CQG A;  2QA1 A;  4PNG A;  1M0U A;  1WPI A;  2E2M A;  4IVF A;  4EDZ A;  2R2J A;  5AGY A;  1SL1 B;  4MZB A;  1BG5 A;  2V32 A;  1T3B A;  2GQK A;  1TU8 A;  4OMV A;  4JED A;  1Q4J A;  4XRD A;  4MLY A;  3SWL A;  5ID2 A;  3DML A;  2YV9 A;  1LU4 A;  4MZW A;  4IJ3 A;  1ERU A;  4TRX A;  3MYD A;  3KZQ A;  4K7I A;  2JL4 A;  4V2N A;  1X5D A;  2C3Q A;  2GQL A;  4ECC A;  3F6D A;  2B1K A;  1GUH A;  3FEU A;  1N2A A;  2YWN A;  3IAM 2;  3IBH A;  2REM A;  2M72 A;  1FO5 A;  1TTZ A;  4KDX A;  1YVL A;  2LJR A;  3PGT A;  5HR0 A;  4TW5 A;  4HOJ A;  1XFL A;  3D4M A;  3KMN A;  1PN0 A;  1AQW A;  2FCH A;  1AC1 A;  3GNJ A;  4X1U A;  1TRW A;  2KHP A;  4XS6 A;  5J3R A;  2C1Y A;  2N5B A;  5JWO B;  3E9J B;  4HEA 2;  4YH2 A;  4MF7 A;  5ECN B;  6GSS A;  4LMV A;  4O5Q A;  2QGV A;  2F9S A;  2H19 A;  2EC4 A;  5IM9 A;  3L78 A;  1KBN A;  1SVO A;  4OFT A;  4KW6 A;  4NPB A;  4EIQ A;  5J47 A;  3TU3 B;  1TK0 B;  5COH A;  4FYC A;  3DD3 A;  3FR3 A;  5HR3 A;  4FYU A;  3ZIV A;  3F0I A;  1GTU A;  5B8B A;  3QAG A;  1GNW A;  2I3Y A;  4EIP A;  3L0H A;  3G7I A;  2QC7 A;  4IP6 A;  2WFC A;  5J4V A;  4WKW A;  2B7K A;  1ERV A;  1TXU A;  1X5C A;  2OE1 A;  3QOU A;  2FY6 A;  2O87 A;  1MD4 A;  1ZYE A;  4ULX A;  4XHM A;  2CZ2 A;  4NHZ A;  2VCW A;  4OD7 A;  1TP9 A;  2VM2 A;  3EC3 A;  5KEJ A;  2PWJ A;  1O8X A;  2H1B A;  2AJQ B;  2E0Q A;  3ZFL A;  5DVB A;  5AIX A;  3HZ8 A;  1EEJ A;  2R0G A;  2NBS A;  2GT6 A;  4KSO A;  3RHC A;  1WE0 A;  3EVI A;  3G7J A;  2CVB A;  3U5R E;  2OT3 A;  4LL1 B;  4X0X A;  4HQS A;  4TR1 A;  4PXO A;  1AW9 A;  3FK8 A;  4RQX A;  4J56 E;  3TUE A;  5IPH A;  3LFL A;  5HFK A;  3ME7 A;  1IYI A;  4NAX A;  5DJM A;  1XWA A;  1X9W B;  4PUA A;  5ECL B;  2C3T A;  5LD0 A;  1JLV A;  3ZTL A;  1R4W A;  3HY2 A;  2RII A;  2NVL A;  5B6M A;  3O76 A;  1ZMA A;  1ML6 A;  2GLR A;  2GSS A;  3UEM A;  4MK3 A;  4F2I A;  2V1M A;  1DBY A;  2NDO A;  1YY7 A;  2HI7 A;  4D73 B;  5D93 A;  2B5E A;  3LYP A;  1Z6M A;  4V2M A;  4AJ8 A;  1JZD A;  4Q5F A;  3ZIT A;  3W6G A;  2C0D A;  3HJM A;  2OE3 A;  2HSN B;  2DSA A;  2KLX A;  1J0F A;  8GSS A;  2B3S A;  5ECO B;  1XWK A;  3CRT A;  1R26 A;  3FZA A;  3HYP A;  5ABR A;  3MDK A;  4GF0 A;  4PTS A;  4FQU A;  3TGZ A;  4Z2R A;  1CQH A;  3EMP A;  2L5L A;  1SJ6 A;  2JZR A;  2HZE A;  4KX4 A;  4O5R A;  3HKR A;  1FW1 A;  5J41 A;  3UAP A;  1ZYQ B;  1GTA A;  1GUM A;  2VL9 A;  3UIW A;  4I6X A;  1PL2 A;  2HRK A;  1GP1 A;  1K0C A;  3EPT A;  1H4O A;  1W89 A;  3IA1 A;  3MWH A;  3IHQ A;  4ICY A;  5DAK A;  5IOX A;  4O5U A;  1YJ6 A;  2PER A;  5AIV A;  2UV8 G;  4GWR A;  4ZBD A;  4JRR A;  1OVN A;  1ACV A;  2E2G A;  4XS4 B;  3N9J A;  2HRA A;  2FGX A;  1M9A A;  1GLQ A;  3GA4 A;  1B9X C;  3HVX A;  3MNG A;  1X0R A;  1ST9 A;  1Z3E A;  4K6X A;  2J9H A;  3JCM L;  3IE3 A;  4I2U A;  5B7C A;  2YJ7 A;  1A8Y A;  3DXB A;  4IW9 A;  3NOF A;  5AIS A;  4J2F A;  1A0R P;  1DE1 A;  2R0P A;  1V2A A;  4ZL9 A;  4OO4 A;  2TRX A;  5HR2 A;  4EE0 A;  2GS3 A;  4D73 A;  5GAP D;  5G31 A;  1XOA A;  2CX3 A;  1K0B A;  2CX4 A;  3TKP A;  5D8I A;  3KGK A;  1TKD B;  4LLR A;  2HSN A;  4F0C A;  1R5P A;  4HS1 A;  4KF9 A;  2I1U A;  5J5N A;  3WGE A;  1RW1 A;  2LS5 A;  2JAD A;  1KTE A;  3IAS 2;  4GQF A;  1ZYN A;  3Q6O A;  3GFK A;  3FHK A;  4MCU A;  2H6Z A;  2OAD A;  1GSQ A;  5D73 A;  1XW5 A;  1S3C A;  4N11 A;  1PN9 A;  1X5E A;  5B8A A;  4Z2T A;  2HT9 A;  1FHE A;  1R5A A;  5IMZ A;  5JWQ B;  4L8E A;  1XWB A;  5IMF A;  3QDN A;  4ZIL A;  1TK8 B;  4A5P A;  3UAR A;  4WBJ A;  5B6N A;  3UJ1 A;  5JCW A;  3GTU A;  4YKG A;  2BTO T;  2R6K A;  3M8N A;  3MAK A;  4E8H A;  4CW9 A;  5D9T A;  3HMJ G;  1XBS A;  2H0G A;  1XWC A;  4RQR A;  4HZ4 A;  3FR9 A;  4X43 A;  5IMC A;  4JE1 A;  12GS A;  2FWE A;  2LJA A;  3H1N A;  1ZOF A;  4IKH A;  2R3X A;  3IXR A;  2C3N A;  3OR5 A;  5JWR B;  4G0I A;  4N30 A;  3HDC A;  2PBJ A;  4NMU A;  4JR6 A;  2KUC A;  6GSV A;  5JCU A;  3EE2 A;  5G30 A;  1OYJ A;  2XPD A;  1ILO A;  3P8W A;  4W66 A;  1XOB A;  4GRF A;  4NXI A;  2PVQ A;  1MD3 A;  3DEX A;  2DLX A;  2P0G A;  1MTC A;  3F4S A;  2L6C A;  1UA5 A;  4IEL A;  2PVO C;  4K0N A;  1PX7 A;  1FG4 A;  4JBB A;  4BVX A;  2RLI A;  4TKY A;  3FZ9 A;  3LEF A;  1SK2 A;  4WEY A;  2MMO A;  3GH9 A;  1C72 A;  1MDI A;  2NPB A;  19GS A;  2MMN A;  3APQ A;  4NV5 A;  4ZB9 A;  3A2X A;  4MDC A;  1A24 A;  5GST A;  2DJJ A;  3C1S A;  4LMW A;  3F9U A;  1OC9 B;  2IL3 A;  3VWU A;  1SYX A;  2QSI A;  3H79 A;  1SKS B;  3BCI A;  5IIZ A;  1V40 A;  5ECR B;  2EIQ A;  1THX A;  4POM A;  1SYR A;  4V2L A;  4MPG A;  5A4W A;  4V1A g;  4K5S A;  2H76 A;  4ZXG A;  2RM6 A;  3EUR A;  5KN3 A;  5J9C A;  2MBT A;  1V58 A;  1TRU A;  3Q18 A;  6GSY A;  4OCF A;  4TXV A;  4K7N A;  4WET A;  4POL A;  2H1D A;  1LBK A;  1T00 A;  1MDK A;  3PPU A;  2V6O A;  2VLU A;  5G5E A;  4XS1 A;  1BYE A;  2TRC P;  4RI6 A;  2G2Q A;  1TRS A;  4IQA A;  3IC4 A;  4MJA A;  1FB0 A;  22GS A;  4GSN A;  1T8E B;  1GLP A;  1B8X A;  3GN3 A;  2LQO A;  3W8J A;  3GKK A;  2H1G A;  1PKW A;  2C4J A;  3CXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...