6GSWA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLVHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 74
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gswA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gswA01
5DJLA 2IFQA 4TRXA 1VF4A 2IL3A 1HNBA 5FHIA 2R5GA 2VM1A 4BPYA 3QPMA 1NW2A 3LG6A 1BAYA 5CRGA 4WBJA 3UIWA 3L0HA 2XC2A 3G9BA 5KEJA 3WYWA 4HZ4A 3U5RE 5E4WA 1M9BA 3KH9A 3C1RA 2VM2A 1HD2A 2TIRA 5J4UA 2OBKA 5IOXA 5ECSA 3APSA 1J9BA 3GHAA 3ZFLA 1GTBA 5KN2A 3HYPA 4FYUA 1GNWA 2YOIA 5A5KA 2H6YA 4F82A 3TKRA 4EDZA 2HQTA 1GSSA 4ZB8A 3UVTA 3A5WA 2V41A 1XFLA 2HSMB 1F37A 2E2GA 5L71A 4YQMA 4ZL8A 4MH3A 4XS1A 4HDEA 1F3BA 4HQSA 4JEDA 18GSA 3O76A 2GTUA 2MZCA 2HSMA 4WR4A 4GQCA 1XW5A 4KF9A 2H1AA 3ME7A 1NHYA 3TDGA 2FUG2 3VWVA 3M0FA 3F4RA 4EF0A 1Q4JA 1DE1A 3NZNA 1U3AA 2RIIA 1Z5YE 1XVQA 1MD3A 4XHMA 2L5LA 2H0HA 4GXZA 2H0IA 4IP6A 5INYA 2NBSA 1QK8A 3M9JA 2V1MA 2DJ3A 2HE3A 1E2YA 1MTCA 2GT6A 5F05A 4BWSA 1G7EA 1M7TA 2JADA 1FHEA 1A0RP 4I2TA 1Z6MA 2YN1A 3UAPA 1GUHA 2DLXA 1ILOA 11GSA 2K8SA 4EUYA 5C04A 4HU9A 2HNLA 4JRRA 3IRAA 4ZBBA 4J57E 2B5EA 4HUAA 4TN8A 4K9ZA 2H75A 2DJJA 2CX4A 3GRXA 4G2EA 1GUMA 1HNCA 2YCDA 5IO2A 1WE0A 3H79A 2C3QA 1U88A 3GMFA 2QC7A 5AISA 1T7PB 1V2AA 4TOPA 4CDOA 1AQVA 2AHEA 1JFUA 1GSYA 4MPFA 2PWJA 1KTEA 3DMLA 3R2QA 3C73A 4Q5RA 3KXOA 3DKSA 3EMPA 2GZPA 3TCOA 1X5CA 1O81A 2GQLA 1TK0B 3DVXA 1IYHA 2VL2C 1K0OA 1VF2A 2G2QA 2TRXA 5IMVA 2O8VB 2NTOA 2OE1A 2IMEA 4K7NA 2ON7A 2X8HA 4MJBA 4EO3A 5KN0A 2FWFA 1TI3A 3I9V2 1U3IA 1ERVA 1Y6EA 4X0XA 4GSTA 2DJ2A 2CZ3A 1FG4A 3LFLA 4ULXA 1F9MA 1GSDA 2KP2A 4XTSA 1H75A 2WRTA 1OC9B 4RI6A 2OA7A 2LTKA 1UVZA 3DYRA 4FIWA 1FVKA 3IV4A 6GSSA 2RM5A 3MAKA 1PSQA 4MDCA 3W6GA 3QOUA 5HR0A 4GQFA 4KAEA 3UOMA 1XOAA 1OC9A 5JCGA 2L4QA 4F0CA 2GDRA 1GRXA 3QDNA 5IIZA 1X5DA 4L5OA 3ZITA 4OCFA 2ZUPA 3TB2A 3JCML 1AUCA 3F6FA 2DMLA 1HNAA 2I4AA 1GNEA 2WJUA 2NVLA 2R37A 1TRWA 4ZBAA 3D22A 4MP4A 2ALBA 2FY6A 3GKKA 1V57A 4K8MA 1QMVA 3H4KA 3QCPA 3F8UA 1C72A 4WKWA 1K0MA 2XPDA 3HVVA 3RPPA 1SKWB 1ABAA 4JU5A 1OKTA 1Z7PA 2HSNB 2AUVA 4DSRA 3KMOA 2L6CA 4MH2A 3UVHA 3FZ9A 2FNOA 2L5OA 3FR3A 4KH7A 3HVSA 4I8BA 1BYEA 3ISOA 1SU9A 3CRUA 4ILFA 1TRSA 1GTUA 3DEXA 3UL3A 1WRYA 2DJ1A 4DSSB 4MZBA 1UA5A 4O5RA 1SL1B 2B6MA 4PURA 3ERFA 3IE3A 1VGLA 5GSTA 4L5LA 1DUGA 2LRNA 3KD0A 4V2LA 4AF2A 3FY7A 2HSHA 2VD0A 3KP8A 5CYYA 3F3QA 4IW9A 4V1Ap 3ZVJA 2LRTA 3Q74A 3O6TA 3CSIA 1V9WA 3TRPA 2L4CA 5FT3A 4I5QA 2VCXA 3GA4A 2N5FA 1XVWA 4MPGA 2LUSA 4KE3A 2B7KA 1R4WA 1SKSB 2HRFA 4OWYA 4KDXA 1OAZA 4IBPA 2OADA 1XPVA 3FEUA 3M3MA 4N0ZA 3C1SA 3FHKA 4YQUA 2P0GA 3KEBA 1TDIA 3ZYWA 2X8CA 4TXVA 4PQHA 2H70A 5EVOA 2UZ8A 2ZCTA 4IN0A 1NSWA 2PU9C 3ED3A 4Q5NA 3LORA 1O6JA 5DQYA 2GSTA 4MZWA 2JU5A 4ID0A 2CV4A 3FYGA 2J9HA 1WIKA 2HXKA 2BJXA 3GNJA 2ZNMA 2K18A 4TR1B 3US3A 1K0NA 3KCMA 1I5GA 3ME8A 4LL1B 3RDWA 1TK5B 2B1LA 1AQWA 2X99A 2HRAA 1AQXA 1OVNA 5HR3A 2HLSA 2PVOC 2OE3A 3EE2A 1QUWA 1TRVA 2B5XA 5JCUA 2AYTA 3L9VA 1QQ2A 4BVYB 1A8LA 3WD6A 4OD7A 5J5NA 3TJFA 1R26A 3D4TA 3MWHA 3ZVJD 3HA9A 5G2ZA 4I6XA 4GSSA 4MABA 5H5QA 3I69A 1K3OA 2IMIA 2GQMA 3FZAA 3TKPA 1T4YA 2EC4A 2MMAA 4PUAA 1AC1A 3H1NA 5G5EA 1TRUA 1PX6A 5EPFA 1J08A 2MMNA 1TU7A 2WFCA 3GL3A 2CVKA 3VI7A 2EIQA 4KX4A 3LXTA 1YKCA 2XHFA 4N11A 2V32A 5IPGA 1ZGNA 5D8IA 3E0UA 3NIVA 2XPEA 1SD9A 1TI1A 3D0ZA 3N5OA 1GULA 3FZ5A 1XBSA 3GL5A 3P90A 3GX8A 4FQUA 2N5BA 1ZOFA 2LV3A 2MBTA 3ZIJA 5JWRB 1OC8A 1S3AA 3VFIA 3OR5A 3F0IA 5ECPB 2H6XA 1JLWA 4HJ2A 3DD3A 1PKZA 2CAQA 2PVQA 2GGTA 4ZXGA 3QAWA 3VI5A 2GVPA 3HZ8A 4TW5A 1VF1A 2QSIA 2CVBA 2CQ9A 2C1YA 6GSYA 5HR2A 1TU8A 5A4UA 1ERUA 3GN3A 1WMJA 4G10A 3LGCA 4J2FA 2H19A 3EURA 2FA4A 4MJEA 20GSA 2RM6A 3UMAA 4ZL7A 1N2AA 1WWJA 2EIOA 2OE0A 4F9ZA 4OFNA 4CHSA 1GSUA 1PKWA 3G7JA 5IMDA 2VCTA 4WF5A 2RUFA 2FD3A 3KTBA 1A23A 3BOAA 3UBLA 2KOKA 5IMFA 2FWGA 3F4TA 2X8GA 4YAVA 1OYJA 2AAWA 4X43A 4KSMA 3IAM2 1DBYA 1K0CA 2CT6A 1Z3EA 4DEJA 3GUSA 3HVXA 3GYKA 1B8XA 3TOTA 2K9FA 1SK1A 4G0LA 4PXOA 3CTFA 1X0RA 5ABRA 2R4VA 1YZXA 3FZ4A 1M9AA 2LQQA 5CNWA 2E2MA 3H8QA 3CXGA 3IXRA 3IC8A 3BBYA 2TRCP 4LMVA 3KIJA 2PGTA 2O87A 6GSWA 2H1DA 2H01A 1AIUA 1MDIA 3IHQA 2IN3A 1PN9A 3EINA 1XOBA 4L0WA 2HI7A 1RK4A 1BX9A 2WULA 3P2AA 4ZILA 1XWAA 2X64A 1E6BA 4AGSA 4XRAA 5A4VA 3ZL5A 4MMMA 3L4NA 1R5AA 3GTUA 1BQ7A 1TOFA 2WCIA 2CAIA 3HY2A 4IQ1A 5IM9A 5DDLA 1LBKA 2I3YA 4N0VA 4TR3A 4F2IA 1B48A 4F03A 2B7JA 4NAXA 4I97A 4X1UA 4O92A 5B7CA 4GSNA 4N30A 5IMZA 5JWQB 1T00A 3N9JA 22GSA 3DXBA 3PPUA 1SJIA 1EOHA 1V58A 4PQ1A 1PL2A 2YWMA 4HQZA 4K0NA 1WJKA 3GKNA 4FYBA 3HKRA 4WR5A 2WGRA 5J3RA 3IA1A 4PUFC 4F0BA 4WXTA 2A4VA 4JZQA 4RQRA 1ZL9A 5A4WA 3CBUA 4LMWA 1XXUA 3W8JA 2I1UA 2I9HA 5E59A 3TOUA 1ZZYA 1SK2A 4LL4B 4G19A 3A2WA 3FRCA 2M46A 1O8WA 2H66A 3LQ7A 3IR4A 19GSA 1ZMAA 4TXOB 3CSHA 5GZZB 2H74A 3R3EA 3CMIA 1EWXA 3GSSA 1EEMA 5ELGA 1LJRA 1PX7A 2XBIA 3BCIA 1THXA 5DCGA 3S9FA 2JZSA 2P5RA 1SKRB 2AJQB 3WT2A 1GSFA 4TXOA 5LCZA 2H76A 1XWBA 2LKUA 3D6IA 3J7Yk 3FW2A 2JZRA 3UEMA 5ECQB 3KMNA 3DVWA 1XZOA 5AIXA 3KP9A 3QAGA 3QMXA 4OFMA 4Z7XA 6GSTA 2VAFA 3U6VA 4AJ7A 5B6MA 5ECLB 3DGQA 4KA0A 2HFDA 3GKMA 4KSOA 4KW6A 1K0BA 2C0EA 3HHVA 1EEJA 3EYTA 3UARA 4JR4A 3VPTA 5ENUA 2V2GA 4KDYA 2NDOA 5J9BA 5ECMB 5HFIA 5BMUA 6GSVA 4PX1A 1M2BA 2IJYA 3HCZA 2L59A 4EKZA 1GP1A 4OFTA 2HZEA 2GSSA 2YWNA 2R6KA 3BD2A 2GS3A 2O7KA 1K0AA 5B8BA 2H8LA 2REMA 1YDKA 5CO3A 1G6WA 1MD4A 2LS5A 2J23A 5F8BA 4G0KA 1AXDA 5F06A 2CA8A 5IO0A 4HZ2A 5B8AA 4GCIA 3WGEA 3TGZA 4HI7A 4EDYA 5H5SA 5HQPA 4TVEA 4USSA 3KH7A 4NWYA 1PGTA 2H1BA 3GSTA 4OCEA 1O73A 2M72A 1GUKA 4BVXB 1GTIA 4KUNA 1CQGA 5C00A 4V2MA 4BL7B 1PD21 4Q5QA 4K7IA 2B3SA 3VLNA 1TTZA 3TKSE 2GZYA 5DJMA 4BVXA 2F8AA 4BL7A 3IPZA 5LNKe 1V98A 3M9KA 5IMCA 5EY6A 4FH8A 1TJDA 2VO4A 3VWXA 2DSAA 1KNGA 4J56E 3ZMLA 4G9HA 1U6TA 4LLRA 2C3NA 3RPNA 4TKYA 3CRTA 3D5JA 3EVIA 3ZREA 4IHUA 3F6DA 3VPQA 5GAPD 1FO5A 2DMMA 2O85A 3O3TA 4NXIA 2VIMA 4O7HA 1YEPA 4NHWA 3ZTLA 1X5EA 3DRNA 1I9DA 2B5YA 5HR1A 5DQSA 2H73A 4LA1A 2LJRA 4ZL9A 3ZMKA 4WETA 4GTUA 3G7IA 2YWOA 16GSA 2N5AA 4MF6A 3GH9A 2PUKC 5DBQA 5FWGA 2IMDA 2OBIA 1FAAA 5AN1A 4PNGA 2YNXA 4YQVA 1Z7RA 3TJGA 4K2DA 1EGOA 4AJ8A 13GSA 1V40A 4WEYA 1BEDA 1GL8A 2VCZA 3QFAC 4ML1A 1YEXA 3EC3A 2A2RA 2ON5A 5KN3A 2C4JA 4TR0A 2IWTA 2I81A 4O32A 5G30A 3KM6A 1RQMA 1FB6A 1TW9A 3GV1A 4OO4A 3HJPA 1YJ6A 4RI7A 1GSEA 4KNDA 4EE0A 1AAZA 1NM3A 4V2NA 1JZWA 2JSYA 2MMOA 2PN8A 4ZIJA 6GSXA 2HYXA 4IELA 3L9SA 2KHPA 10GSA 4K7OA 3Q6OA 3H93A 4RQXA 5DCHA 1UN2A 1ERTA 3QR6A 5COHA 1SD8A 3GX0A 5G5FA 1PRXA 3LYPA 1GLQA 3MSZA 3GKXA 5IMAA 2L6DA 1ACVA 1M2DA 1SYRA 5CRHA 5D93A 3WGXA 4NPBA 5GAND 3CYNA 3WGDA 1EZKA 2FGXA 2GT5A 4IQAA 3CSJA 1G0TA 1A2MA 2VCWA 3TJBA 3GFKA 4I2UA 3DWVA 1YF1A 2LSTA 5ECNB 3F63A 4KDUA 1USBA 2MBSA 1K3YA 4MCUA 3PR8A 5J41A 4GF0A 1OE8A 4MK3A 1PL1A 2CZ2A 3APOA 1ZYQB 3IK7A 3UBKA 1H4OA 1XIYA 12GSA 1A24A 2XBQA 1CQHA 1WOUA 1TXXA 5JWOB 1HQOA 3GIXA 8GSSA 1QXHA 1ZCPA 4POMA 4RUVA 3TJJA 3F3RA 2A2SA 5CP1A 3LSZA 5AGYA 1A2JA 4HOJA 3ZLPA 17GSA 2E7PA 3LWAA 2VCQA 2YANA 4DVCA 1HYUA 1TKDB 1XWKA 3D4MA 4WBRD 1N8JA 4JE1A 4EXJA 6GSUA 1X9WB 2JZTA 3KJYA 2E0QA 3NOFA 5CRDA 3KGKA 1ERWA 2VCVA 5CAXA 1URMA 4ECIA 3EMXA 1B4QA 1Q98A 1SL0B 2G0FA 5KN1A 4HS1A 1KBNA 2C80A 1MDJA 3TRXA 4XS6A 3E9JB 3QFBC 4AJ6A 3QAVA 4ECJA 4KCAA 5IOWA 1PA3A 2DC5A 3MDKA 3KTLA 2FWHA 4IJ3A 3AY8A 4NMUA 2DIYA 1W89A 1THOA 5D9WA 2C3TA 2PBJA 2FHEA 7GSSA 3GTUB 3IAS2 3EU3A 4XCSA 5G1KA 2VLVA 1GH2A 1MDKA 5ID2B 2K6VA 1T1VA 4ZB9A 2MYGA 3C7MA 4ZBDA 2M80A 3IDVA 5D9TA 4ECCA 2PPTA 3F4SA 4D73B 1A8YA 4QQ7A 1GSQA 5B6NA 4GRFA 4IJIA 2WDUA 3C71A 3E3EA 1B9YC 5ID2A 4IP1A 1KEBA 3PINA 2H30A 3TRQA 2BTOT 1XWCA 1G7OA 4D73A 2FLSA 3EWLA 1MEKA 1O85A 4L0UA 5D96A 1JZOA 2LQOA 2F3MA 2KUCA 1UC7A 3GH6A 2F8FA 2YP6A 4XS4B 1JHBA 4N10A 2HT9A 3UJ1A 1O7UA 2YV7A 1LU4A 1S3CA 3HJOA 3C8EA 4K1FA 2F51A 2C0GA 5ECKB 1OE7A 5EL8A 1O8XA 4OO5A 4XS4A 3HJMA 3J7Yb 5IQYA 2OJLA 3P8WA 1GWCA 1SL2B 2AB6A 2VLUA 2OKAA 3W8SA 1EP7A 3ZRDA 2FA8A 3RHBA 1EGRA 1Y25A 1T4ZA 2H72A 1W4VA 1Z6NA 2LJKA 3RHCA 4KCEA 3PGTA 1K3LA 2R2JA 2VOCA 4PQIA 4EVMA 1BJXA 2VUPA 2IIYA 1TP9A 3IK9A 2B1KA 3IBHA 2IMFA 5ELAA 2WZ9A 2IMKA 2KLXA 5GSSA 3LJRA 4IGJA 1X9MB 2LEGA 2LJAA 2JL4A 3HZ4A 2C0DA 4L8EA 2R3XA 1B4PA 4K6XA 1A0FA 2VD1A 2P5QA 1YY7A 4QL7A 3MNGA 1R5PA 3TJKA 4YH2A 1JLVA 5HFKA 5F07A 5LD0A 4NV2A 3P7XA 4ACSA 3FR9A 3HD5A 5ECIB 2IPAA 2F9SA 3IC4A 2HZFA 4KB3A 1XWGA 5ECOB 3BJ5A 1XW6A 2HZEB 4MZCA 9GSSA 2H71A 2LNSA 1AW9A 2JACA 1F6MC 5CREA 3Q19A 1B9XC 3VURA 3QD9A 1IYIA 4NHZA 4HU7A 3A2VA 4ML6A 4GWRA 1M2AA 1A2LA 3EU4A 2JSZA 1R7HA 4JBBA 4POBA 2GSRA 5G1LA 2PMTA 3L9UA 2YPMA 5D9XA 1DE2A 4EC0A 2PERA 4OMVA 3FK8A 4POLA 2GSQA 3TKSA 3PH9A 2BMXA 1XW9A 1SK0A 2FWEA 2H0GA 2HRNA 4CW9A 1EV4A 1BG5A 3SWLA 1GTAA 2YV9A 2H1GA 4ECBA 1EP8A 1ST9A 4E8HA 3LYKA 5J9CA 2C8UA 1NHOA 1SJZA 4IS0A 4E8EA 1ZYEA 3K8NA 4TR4A 3ERWA 1PQNA 3F9UA 4ZB6A 1JZDA 3I6AA 5DVBA 2QGVA 5JCWA 3D21A 4K0GA 3G7YA 3HDCA 1FB0A 5F0GA 2YJHA 4G0IA 1OKDA 3TKQA 4IKHA 1QFNA 1ON4A 3LXZA 3L78A 2WS2A 2L57A 3RBTA 4DSSA 1DSBA 1SENA 3VWUA 1G6YA 5D73A 2K8VA 2LRCA 1ML6A 1S3DA 1YKAA 4QL9A 2MMZA 1OC3A 3DIEA 5DALB 3LEFA 1VRSD 4XIHA 3M1GA 2VLTA 1T8EB 3Q18A 1U87A 3CTGA 4EL1A 2RLIA 3TUEA 2HSYA 1FOVA 1EV9A 4PTSA 3ZFBA 1TK8B 1J0FA 5DALA 1VF3A 4JR6A 4MF5A 2V6KA 2OACA 4WF4A 2HRKB 4MJAA 4H86A 2GZZA 5DAKB 5HFGA 4KGIA 2Z9SA 4FO5A 3SBCA 1YF0A 1JZRA 2DJKA 1Z9HA 3RAZA 2QKEA 1M0UA 5AIVA 2EIRA 1RW1A 2HRKA 1PMTA 4Q5FA 2NPBA 1QGVA 2DIZA 2CVDA 5DAKA 4FYCA 3A2XA 1SYXA 4MJCA 3BCKA 2VL3A 3HXSA 2LNTA 2CX3A 2D2ZA 3FKFA 3V1WA 4MLYA 2H6ZA 3VK9A 1YQ1A 1X9SB 1WP0A 2YZUA 3GURA 14GSA 2O89A 4TR1A 4POKA 1F3AA 3APQA 4XRDA 3ERGA 2YZHA 2P31A 4HJMA 3ZIVA 1XCCA 4YAPA 4BA7A 5ECHB 2GLRA 3FR6A 2V6OA 5D9VA 2ES7A 1GLPA 4NV5A 2YJ7A 4IVFA 4BVYA 3WT1A 1EOGA 1SJ6A 4ISDA 5ECRB 2YWIA 2RUEA 4MA9A 1F2EA 2DJ0A 5H5RA 2DBCA 4V1Ag 3KZQA 4BWQA 1K0DA 1M99A 2VL2A 2C0FA 5G31A 3TKSC 2GQKA 4P3YB 1T3BA 3M8NA 3IOSA 4MF7A 2WB9A 4PGTA 3I43A 4DSQA 3ZZXA 4PNFA 5IPHA 1FW1A 2VL9A 3A3TA 2FCHA 2IFQB 4GLTA 1WPIA 5CRWA 3VWWA 2KP1A 4HEA2 1FVJA 2AV4A
chains in the Genus database with same CATH superfamily
5DJLA 2DKHA 2IFQA 4TRXA 1VF4A 2IL3A 1HNBA 5FHIA 2R5GA 2EFHA 2VM1A 4BPYA 3QPMA 1NW2A 3LG6A 1BAYA 5CRGA 4WBJA 3UIWA 3L0HA 2XC2A 3G9BA 5KEJA 3WYWA 4HZ4A 3U5RE 5E4WA 1M9BA 4YKFA 3KH9A 3C1RA 2VM2A 1HD2A 2TIRA 5J4UA 2OBKA 5IOXA 5ECSA 3APSA 1J9BA 3GHAA 3ZFLA 1GTBA 2X49A 5KN2A 3HYPA 4FYUA 1GNWA 2YOIA 5KOXA 5A5KA 2H6YA 4F82A 3TKRA 2A4HA 4EDZA 2HQTA 1GSSA 4ZB8A 3UVTA 3A5WA 2V41A 1XFLA 2HSMB 1F37A 2E2GA 5L71A 4YQMA 4ZL8A 4MH3A 4XS1A 4HDEA 1F3BA 4HQSA 4JEDA 18GSA 3O76A 2GTUA 2MZCA 2HSMA 4WR4A 4GQCA 1XW5A 4KF9A 2H1AA 3ME7A 1NHYA 3TDGA 2FUG2 3VWVA 3M0FA 3F4RA 4EF0A 1Q4JA 1DE1A 3NZNA 1U3AA 2RIIA 1Z5YE 1XVQA 1MD3A 4XHMA 2L5LA 2H0HA 4GXZA 2H0IA 4IP6A 5INYA 2NBSA 1QK8A 3M9JA 2V1MA 2DJ3A 2HE3A 1E2YA 1MTCA 2GT6A 5F05A 4O5UA 4BWSA 1G7EA 1M7TA 2JADA 1FHEA 1A0RP 4I2TA 1Z6MA 2O3EA 2YN1A 3UAPA 1XG8A 1GUHA 2DLXA 1ILOA 11GSA 2K8SA 4EUYA 1M3IA 5C04A 4HU9A 2HNLA 4JRRA 3IRAA 4ZBBA 4J57E 2B5EA 4HUAA 4TN8A 4K9ZA 2H75A 2DJJA 2CX4A 3GRXA 4G2EA 1GUMA 1HNCA 2YCDA 5IO2A 1WE0A 3H79A 2C3QA 1U88A 3GMFA 2QC7A 5AISA 1T7PB 1V2AA 4TOPA 4CDOA 1AQVA 2AHEA 1JFUA 1GSYA 4MPFA 2PWJA 1KTEA 3DMLA 3R2QA 3C73A 4Q5RA 3KXOA 4QMKA 3DKSA 3EMPA 2GZPA 3TCOA 1X5CA 1O81A 2GQLA 1TK0B 3DVXA 1IYHA 2VL2C 1K0OA 1VF2A 2G2QA 2TRXA 5IMVA 2O8VB 2NTOA 2OE1A 2IMEA 4K7NA 2ON7A 2X8HA 4MJBA 4EO3A 5KN0A 2FWFA 1TI3A 3I9V2 1U3IA 4Z2TA 1ERVA 1Y6EA 4X0XA 4GSTA 2DJ2A 4AKHA 2CZ3A 1FG4A 3LFLA 4ULXA 1F9MA 1GSDA 2KP2A 4XTSA 1H75A 2WRTA 1OC9B 4AI6A 4RI6A 3TU3B 2OA7A 2LTKA 2R0GA 1UVZA 3DYRA 4FIWA 1FVKA 3IV4A 6GSSA 2RM5A 3MAKA 1PSQA 4MDCA 3W6GA 3QOUA 5HR0A 4GQFA 4KAEA 3UOMA 1XOAA 1OC9A 5JCGA 2L4QA 4F0CA 2GDRA 1GRXA 3QDNA 5IIZA 1X5DA 4L5OA 3ZITA 4OCFA 1PFOA 2ZUPA 3TB2A 3JCML 1AUCA 3F6FA 2DMLA 1HNAA 2I4AA 1GNEA 2WJUA 2NVLA 2R37A 1TRWA 4ZBAA 3D22A 4MP4A 2ALBA 4CY8A 2WW0A 2FY6A 3GKKA 1V57A 4K8MA 1QMVA 3H4KA 3QCPA 3F8UA 1C72A 4WKWA 1K0MA 2XPDA 3HVVA 3RPPA 1SKWB 1ABAA 4JU5A 1OKTA 1Z7PA 2HSNB 2AUVA 4DSRA 3KMOA 2L6CA 4MH2A 3UVHA 3FZ9A 2FNOA 2L5OA 3FR3A 4KH7A 3HVSA 4I8BA 1BYEA 3ISOA 1SU9A 2O5VA 3CRUA 5J47A 4ILFA 1TRSA 1GTUA 3DEXA 2HSNA 3UL3A 1WRYA 2DJ1A 4DSSB 4MZBA 1UA5A 4O5RA 1SL1B 2B6MA 2WVXB 4PURA 3ERFA 3IE3A 1VGLA 5GSTA 5J40A 4L5LA 1DUGA 2O36A 2LRNA 3KD0A 4V2LA 4AF2A 3FY7A 2HSHA 2VD0A 3KP8A 5CYYA 3F3QA 4IW9A 4V1Ap 3ZVJA 2LRTA 3Q74A 3O6TA 3CSIA 1V9WA 3TRPA 2L4CA 5FT3A 4I5QA 2EFDA 2VCXA 3GA4A 1I1IP 2N5FA 1XVWA 4MPGA 2LUSA 4KE3A 2B7KA 1R4WA 1SKSB 2HRFA 4OWYA 4KDXA 1OAZA 4IBPA 2OADA 4K2XA 1XPVA 3FEUA 3M3MA 4N0ZA 3C1SA 3FHKA 4YQUA 2P0GA 3KEBA 1TDIA 3ZYWA 2X8CA 4TXVA 4PQHA 2H70A 5EVOA 2UZ8A 2ZCTA 4IN0A 1NSWA 2PU9C 3ED3A 4Q5NA 3LORA 1O6JA 5DQYA 1S4BP 2GSTA 4MZWA 2WW3A 2JU5A 4ID0A 2CV4A 3FYGA 2J9HA 1WIKA 2HXKA 2BJXA 3GNJA 2ZNMA 2K18A 4TR1B 3US3A 1K0NA 3KCMA 1I5GA 3ME8A 2WW1A 4LL1B 3RDWA 1TK5B 2B1LA 1AQWA 2X99A 2HRAA 1AQXA 1OVNA 5HR3A 2HLSA 2PVOC 2OE3A 3EE2A 1QUWA 1TRVA 2B5XA 5JCUA 2AYTA 3L9VA 1QQ2A 4BVYB 1A8LA 4O5QA 3WD6A 4OD7A 5J5NA 3TJFA 1R26A 3D4TA 3MWHA 3ZVJD 3HA9A 5G2ZA 4I6XA 4GSSA 4MABA 5H5QA 3I69A 1K3OA 2IMIA 2GQMA 3FZAA 1Y1UA 3TKPA 1T4YA 2EC4A 2MMAA 4EIPA 4PUAA 1AC1A 3H1NA 5G5EA 1TRUA 1PX6A 5EPFA 1J08A 2MMNA 3IHGA 1TU7A 2WFCA 3GL3A 1YEWC 2CVKA 3VI7A 2EIQA 4KX4A 3LXTA 1YKCA 2XHFA 4N11A 2V32A 5IPGA 1ZGNA 5D8IA 3E0UA 3NIVA 2XPEA 1SD9A 1TI1A 3D0ZA 3N5OA 1GULA 3FZ5A 1XBSA 3GL5A 3P90A 3GX8A 4FQUA 2N5BA 1ZOFA 2LV3A 2MBTA 3ZIJA 5JWRB 1OC8A 1S3AA 3VFIA 3OR5A 1YVLA 3F0IA 5ECPB 2H6XA 1JLWA 4HJ2A 3DD3A 1PKZA 2CAQA 2PVQA 2GGTA 4ZXGA 3QAWA 3VI5A 2GVPA 3HZ8A 4TW5A 1VF1A 2QSIA 3RFRC 2CVBA 2CQ9A 2C1YA 3MYDA 6GSYA 5HR2A 1TU8A 5A4UA 1ERUA 3GN3A 1WMJA 4G10A 3LGCA 4J2FA 2H19A 3EURA 2FA4A 4MJEA 20GSA 2RM6A 3CQFA 3UMAA 4ZL7A 1N2AA 1WWJA 2EIOA 2OE0A 4F9ZA 4OFNA 4CHSA 1GSUA 1PKWA 3G7JA 5IMDA 2VCTA 4WF5A 2RUFA 2FD3A 3KTBA 1A23A 3BOAA 3UBLA 2KOKA 5IMFA 2FWGA 3F4TA 2X8GA 4YAVA 1OYJA 2AAWA 4X43A 4KSMA 3IAM2 1DBYA 1K0CA 2CT6A 1Z3EA 4DEJA 3GUSA 3HVXA 3GYKA 1B8XA 3TOTA 2K9FA 3FMWA 1SK1A 4G0LA 4PXOA 3CTFA 1X0RA 5ABRA 2R4VA 1YZXA 3FZ4A 4Z2RA 1M9AA 1ZYNA 4AKIA 2LQQA 5CNWA 2E2MA 3H8QA 4AKGA 3CXGA 3IXRA 3IC8A 3BBYA 2TRCP 4LMVA 3KIJA 2PGTA 2O87A 6GSWA 2H1DA 2H01A 1AIUA 1MDIA 3IHQA 1BF5A 2IN3A 1PN9A 3EINA 2X4AA 1XOBA 4L0WA 2HI7A 1RK4A 1BX9A 2WULA 3P2AA 4ZILA 1XWAA 2X64A 1E6BA 4AGSA 4XRAA 5A4VA 3ZL5A 4MMMA 3L4NA 1R5AA 3GTUA 1BQ7A 1TOFA 2WCIA 2CAIA 3HY2A 4IQ1A 5IM9A 5DDLA 1LBKA 2I3YA 4N0VA 4TR3A 4F2IA 1B48A 4F03A 2B7JA 4NAXA 4I97A 4X1UA 1S3RA 4O92A 5B7CA 4GSNA 4N30A 5IMZA 5JWQB 1T00A 3N9JA 22GSA 3DXBA 3PPUA 1SJIA 4ZB7A 1EOHA 1V58A 4PQ1A 1PL2A 2YWMA 4HQZA 4K0NA 1WJKA 3GKNA 4FYBA 3HKRA 4WR5A 2WGRA 5J3RA 3IA1A 4PUFC 3MIXA 4F0BA 4WXTA 2A4VA 4JZQA 4RQRA 1ZL9A 5A4WA 3CBUA 4LMWA 4A5PA 1XXUA 3W8JA 2I1UA 2I9HA 5E59A 3TOUA 1ZZYA 1SK2A 4LL4B 4G19A 3A2WA 3FRCA 2M46A 1O8WA 4E68A 2H66A 3LQ7A 3IR4A 2A2PA 19GSA 1ZMAA 4TXOB 3CSHA 5GZZB 2H74A 4YKGA 3R3EA 3CMIA 1EWXA 3GSSA 1EEMA 5ELGA 1LJRA 1PX7A 2XBIA 3BCIA 1THXA 5DCGA 3S9FA 2JZSA 2P5RA 1SKRB 2AJQB 3WT2A 1GSFA 4TXOA 5LCZA 2H76A 1XWBA 2LKUA 4PHZC 3D6IA 3J7Yk 3FW2A 2JZRA 5J4VA 3UEMA 5ECQB 3KMNA 3DVWA 1XZOA 5AIXA 3KP9A 3QAGA 3QMXA 4OFMA 4Z7XA 6GSTA 2VAFA 3U6VA 4AJ7A 5B6MA 5ECLB 3DGQA 4KA0A 2HFDA 3GKMA 4KSOA 4KW6A 1K0BA 1ZYPA 2C0EA 3HHVA 4MNNA 5BMUB 1EEJA 3EYTA 3UARA 4JR4A 3VPTA 5ENUA 2V2GA 4KDYA 2NDOA 5J9BA 5ECMB 5HFIA 5BMUA 6GSVA 4PX1A 1M2BA 2IJYA 3HCZA 2L59A 4EKZA 1GP1A 4OFTA 2HZEA 2GSSA 2YWNA 2R6KA 3BD2A 2GS3A 2O7KA 1K0AA 5B8BA 2H8LA 2REMA 1YDKA 4PI2C 5CO3A 1G6WA 1MD4A 2LS5A 3HVNA 2J23A 5F8BA 4G0KA 4FXYP 1AXDA 5F06A 2CA8A 5IO0A 4HZ2A 5B8AA 4GCIA 3WGEA 3TGZA 4HI7A 4EDYA 5H5SA 5HQPA 4TVEA 4USSA 3KH7A 4NWYA 1PGTA 2H1BA 3GSTA 4OCEA 1O73A 4K5SA 2M72A 1GUKA 4BVXB 1GTIA 4KUNA 1CQGA 5C00A 4V2MA 4BL7B 1PD21 4Q5QA 4K7IA 2B3SA 3VLNA 1TTZA 3TKSE 2GZYA 5DJMA 4BVXA 2F8AA 1BG1A 4BL7A 3IPZA 5LNKe 1V98A 3M9KA 5IMCA 5EY6A 4FH8A 1TJDA 2VO4A 3VWXA 2DSAA 1KNGA 4K5RA 4J56E 3ZMLA 4G9HA 1U6TA 4LLRA 2C3NA 2EFCA 3RPNA 4TKYA 3CRTA 3D5JA 4GDFA 2H1LA 4HSCX 3EVIA 3ZREA 4IHUA 3F6DA 3VPQA 5GAPD 3A5IA 1FO5A 2DMMA 2O85A 3O3TA 4NXIA 2VIMA 4O7HA 1YEPA 4NHWA 3ZTLA 1X5EA 3DRNA 1I9DA 2B5YA 5HR1A 5DQSA 2H73A 2OT3A 4LA1A 2LJRA 4ZL9A 3ZMKA 4WETA 4GTUA 3G7IA 2YWOA 16GSA 2N5AA 4MF6A 3GH9A 2PUKC 5J4YA 5DBQA 5FWGA 2IMDA 2OBIA 1FAAA 5AN1A 4PNGA 2YNXA 4YQVA 1Z7RA 3TJGA 4K2DA 1EGOA 4AJ8A 13GSA 1V40A 4WEYA 1BEDA 1GL8A 2VCZA 3QFAC 4ML1A 1YEXA 3EC3A 2A2RA 5BRTA 2ON5A 5KN3A 2C4JA 4TR0A 2IWTA 2I81A 4O32A 5G30A 3KM6A 1FOHA 1RQMA 1FB6A 1TW9A 3GV1A 4OO4A 5KOWA 3HJPA 1YJ6A 4RI7A 1GSEA 4BIKA 4KNDA 4EE0A 1AAZA 1NM3A 4V2NA 1JZWA 2JSYA 2MMOA 2PN8A 4ZIJA 6GSXA 2HYXA 4IELA 3L9SA 2KHPA 1SVLA 10GSA 4K7OA 3Q6OA 3H93A 2WVYA 4RQXA 5DCHA 1UN2A 1ERTA 3QR6A 5COHA 1SD8A 3GX0A 5G5FA 1PRXA 3LYPA 1GLQA 3MSZA 3LW9A 3GKXA 5IMAA 2L6DA 1ACVA 1M2DA 1SYRA 5CRHA 5D93A 3WGXA 4NPBA 2R0PA 5GAND 3CYNA 3WGDA 1EZKA 2FGXA 2GT5A 4IQAA 3CSJA 1G0TA 1A2MA 2VCWA 3TJBA 3GFKA 4I2UA 3DWVA 1YF1A 2LSTA 5ECNB 3F63A 4KDUA 1USBA 2MBSA 1K3YA 1SVMA 4MCUA 3PR8A 5J41A 4GF0A 1OE8A 4MK3A 1PL1A 4CY6A 2CZ2A 3APOA 1ZYQB 3IK7A 3UBKA 1H4OA 1XIYA 12GSA 1A24A 2XBQA 1CQHA 1N25A 1WOUA 1TXXA 5JWOB 1HQOA 2QA2A 3GIXA 8GSSA 1QXHA 4N3ZA 3CHXC 1ZCPA 4POMA 4RUVA 3TJJA 3F3RA 2A2SA 5CP1A 3LSZA 5AGYA 1A2JA 4HOJA 3ZLPA 17GSA 1PN0A 2E7PA 3LWAA 2VCQA 2YANA 4DVCA 1HYUA 1TKDB 1XWKA 3D4MA 4WBRD 1N8JA 4JE1A 4EXJA 6GSUA 1X9WB 2JZTA 3KJYA 2E0QA 3NOFA 5CRDA 3KGKA 1ERWA 2VCVA 5CAXA 1URMA 4ECIA 3EMXA 1B4QA 1Q98A 1SL0B 2G0FA 5KN1A 4HS1A 1KBNA 2C80A 1MDJA 5A34B 3TRXA 4XS6A 3E9JB 3QFBC 4AJ6A 3QAVA 4ECJA 4KCAA 5IOWA 1PA3A 2DC5A 3MDKA 3KTLA 2FWHA 4IJ3A 3AY8A 4NMUA 2DIYA 1W89A 2VKZG 1THOA 5D9WA 2C3TA 2PBJA 2FHEA 7GSSA 3GTUB 5A34A 3IAS2 3EU3A 4XCSA 5G1KA 2VLVA 1GH2A 1MDKA 5ID2B 2K6VA 1T1VA 4ZB9A 2MYGA 3C7MA 4ZBDA 2M80A 3IDVA 5D9TA 4ECCA 2PPTA 3F4SA 4D73B 1A8YA 4QQ7A 1GSQA 5B6NA 4GRFA 4IJIA 2WDUA 3C71A 2WZSA 3E3EA 1B9YC 5ID2A 4IP1A 1KEBA 3PINA 2H30A 3TRQA 2BTOT 1XWCA 1G7OA 4D73A 2FLSA 3EWLA 1MEKA 1O85A 4AKXB 4L0UA 5D96A 1JZOA 2LQOA 2F3MA 2KUCA 1UC7A 3GH6A 2F8FA 2YP6A 4XS4B 1JHBA 3EPTA 4N10A 2HT9A 3UJ1A 1O7UA 2YV7A 1LU4A 1S3CA 3HJOA 3C8EA 4K1FA 2F51A 2C0GA 5ECKB 1OE7A 5EL8A 1O8XA 4OO5A 4XS4A 3HJMA 3J7Yb 5IQYA 2OJLA 3P8WA 1GWCA 1SL2B 2AB6A 2VLUA 2OKAA 3W8SA 1EP7A 3ZRDA 2FA8A 3RHBA 1EGRA 1Y25A 1T4ZA 2H72A 1W4VA 1Z6NA 2LJKA 3RHCA 4KCEA 3PGTA 1K3LA 2R2JA 2VOCA 4PQIA 4EVMA 2WW2A 1BJXA 2VUPA 4EIQA 2IIYA 1TP9A 3IK9A 2B1KA 3IBHA 2IMFA 5ELAA 2WZ9A 2IMKA 2KLXA 5GSSA 3LJRA 4IGJA 1X9MB 2LEGA 2LJAA 2JL4A 3HZ4A 2C0DA 4L8EA 2R3XA 1B4PA 4K6XA 1A0FA 2VD1A 2P5QA 1YY7A 4QL7A 1M3JA 3MNGA 1R5PA 3TJKA 4YH2A 1JLVA 5HFKA 2WVZA 5F07A 5LD0A 4NV2A 3P7XA 4ACSA 3FR9A 3HD5A 2UV8G 5ECIB 2IPAA 2F9SA 3IC4A 2HZFA 4KB3A 1XWGA 5ECOB 3BJ5A 1XW6A 2HZEB 4MZCA 9GSSA 2H71A 2LNSA 1AW9A 2JACA 1F6MC 5CREA 3Q19A 1B9XC 3VURA 3QD9A 1IYIA 4NHZA 4HU7A 3A2VA 4ML6A 4GWRA 1M2AA 1A2LA 3EU4A 2JSZA 1R7HA 4JBBA 4POBA 2GSRA 5G1LA 2PMTA 3L9UA 2YPMA 5D9XA 1DE2A 4EC0A 2PERA 4OMVA 2EFEA 3FK8A 4POLA 2GSQA 3TKSA 3PH9A 2BMXA 1XW9A 1SK0A 2FWEA 2H0GA 2HRNA 4CW9A 1EV4A 1BG5A 3SWLA 1GTAA 2YV9A 2H1GA 4ECBA 1EP8A 1ST9A 4E8HA 4Z2UA 3LYKA 5J9CA 2C8UA 1NHOA 1SJZA 4IS0A 4E8EA 1ZYEA 3K8NA 4TR4A 3ERWA 1PQNA 3F9UA 4ZB6A 1JZDA 3I6AA 5DVBA 2QGVA 5JCWA 3D21A 4K0GA 1TXUA 3G7YA 3HDCA 1FB0A 5F0GA 2YJHA 4G0IA 1OKDA 3TKQA 4IKHA 1QFNA 1ON4A 3LXZA 3L78A 5A1NB 2WS2A 2L57A 3RBTA 4DSSA 1DSBA 1SENA 3VWUA 2WVXA 1G6YA 5D73A 2K8VA 2LRCA 1ML6A 1S3DA 1YKAA 4QL9A 4ICYA 2MMZA 5A1NA 1OC3A 3RGBC 3DIEA 5DALB 1VRSD 3LEFA 4XIHA 3M1GA 2VLTA 1T8EB 2R0CA 3Q18A 1U87A 3CTGA 4EL1A 2RLIA 3TUEA 2HSYA 1FOVA 1EV9A 4PTSA 3ZFBA 1TK8B 1J0FA 5DALA 1SVOA 1VF3A 3CWGA 4JR6A 4MF5A 2V6KA 2OACA 4WF4A 2HRKB 4MJAA 4H86A 2GZZA 5DAKB 2QA1A 5HFGA 4KGIA 2Z9SA 4FO5A 3SBCA 1YF0A 1JZRA 2DJKA 1Z9HA 3RAZA 2QKEA 1M0UA 5AIVA 2DKIA 2EIRA 1RW1A 2HRKA 1PMTA 4Q5FA 2NPBA 1QGVA 2DIZA 2CVDA 5DAKA 4FYCA 3A2XA 1SYXA 4MJCA 3BCKA 2VL3A 3HXSA 2LNTA 3HMJG 2CX3A 2D2ZA 3FKFA 3V1WA 4MLYA 2H6ZA 3VK9A 1YQ1A 1X9SB 1WP0A 2YZUA 3GURA 14GSA 2O89A 4TR1A 4POKA 1F3AA 3APQA 4XRDA 3ERGA 2YZHA 2P31A 4HJMA 3ZIVA 4G01A 1XCCA 4YAPA 4BA7A 4W66A 5ECHB 2GLRA 3FR6A 2V6OA 5D9VA 2ES7A 1GLPA 4NV5A 2YJ7A 4IVFA 4BVYA 3WT1A 1EOGA 1SJ6A 4ISDA 5ECRB 2YWIA 2RUEA 4MA9A 1F2EA 2DJ0A 5H5RA 2DBCA 4V1Ag 3KZQA 4BWQA 1K0DA 1M99A 2VL2A 2C0FA 5G31A 3TKSC 2GQKA 4P3YB 1T3BA 5A5HB 3M8NA 3IOSA 4MF7A 2WB9A 4PGTA 3I43A 4DSQA 3ZZXA 4PNFA 5IPHA 1FW1A 2VL9A 3A3TA 2FCHA 2IFQB 4GLTA 1WPIA 4X4JA 5A5HA 5CRWA 4PI0C 3VWWA 2KP1A 4HEA2 1FVJA 2AV4A
chains in the Genus database with same CATH topology
5DJLA 2DKHA 2IFQA 4TRXA 1VF4A 2IL3A 1HNBA 5FHIA 2R5GA 2EFHA 2VM1A 4BPYA 3QPMA 1NW2A 3LG6A 1BAYA 5CRGA 4WBJA 3UIWA 3L0HA 2XC2A 3G9BA 5KEJA 3WYWA 4HZ4A 3U5RE 5E4WA 1M9BA 4YKFA 3KH9A 3C1RA 2VM2A 1HD2A 2TIRA 5J4UA 2OBKA 5IOXA 5ECSA 3APSA 1J9BA 3GHAA 3ZFLA 1GTBA 2X49A 5KN2A 3HYPA 4FYUA 1GNWA 2YOIA 5KOXA 5A5KA 2H6YA 4F82A 3TKRA 2A4HA 4EDZA 2HQTA 1GSSA 4ZB8A 3UVTA 3A5WA 2V41A 1XFLA 2HSMB 1F37A 2E2GA 5L71A 4YQMA 4ZL8A 4MH3A 4XS1A 4HDEA 1F3BA 4HQSA 4JEDA 18GSA 3O76A 2GTUA 2MZCA 2HSMA 4WR4A 4GQCA 1XW5A 4KF9A 2H1AA 3ME7A 1NHYA 3TDGA 2FUG2 3VWVA 3M0FA 3F4RA 4EF0A 1Q4JA 1DE1A 3NZNA 1U3AA 2RIIA 1Z5YE 1XVQA 1MD3A 4XHMA 2L5LA 2H0HA 4GXZA 2H0IA 4IP6A 5INYA 2NBSA 1QK8A 3M9JA 2V1MA 2DJ3A 2HE3A 1E2YA 1MTCA 2GT6A 5F05A 4O5UA 4BWSA 1G7EA 1M7TA 2JADA 1FHEA 1A0RP 4I2TA 1Z6MA 2YN1A 3UAPA 1GUHA 2DLXA 1ILOA 11GSA 2K8SA 4EUYA 5C04A 4HU9A 2HNLA 4JRRA 3IRAA 4ZBBA 4J57E 2B5EA 4HUAA 4TN8A 4K9ZA 2H75A 2DJJA 2CX4A 3GRXA 4G2EA 1GUMA 1HNCA 2YCDA 5IO2A 1WE0A 3H79A 2C3QA 1U88A 3GMFA 2QC7A 5AISA 1T7PB 1V2AA 4TOPA 4CDOA 1AQVA 2AHEA 1JFUA 1GSYA 4MPFA 2PWJA 1KTEA 3DMLA 3R2QA 3C73A 4Q5RA 3KXOA 4QMKA 3DKSA 3EMPA 2GZPA 3TCOA 1X5CA 1O81A 2GQLA 1TK0B 3DVXA 1IYHA 2VL2C 1K0OA 1VF2A 2G2QA 2TRXA 5IMVA 2O8VB 2NTOA 2OE1A 2IMEA 4K7NA 2ON7A 2X8HA 4MJBA 4EO3A 5KN0A 2FWFA 1TI3A 3I9V2 1U3IA 4Z2TA 1ERVA 1Y6EA 4X0XA 4GSTA 2DJ2A 4AKHA 2CZ3A 1FG4A 3LFLA 4ULXA 1F9MA 1GSDA 2KP2A 4XTSA 1H75A 2WRTA 1OC9B 4AI6A 4RI6A 3TU3B 2OA7A 2LTKA 2R0GA 1UVZA 3DYRA 4FIWA 1FVKA 3IV4A 6GSSA 2RM5A 3MAKA 1PSQA 4MDCA 3W6GA 3QOUA 5HR0A 4GQFA 4KAEA 3UOMA 1XOAA 1OC9A 5JCGA 2L4QA 4F0CA 2GDRA 1GRXA 3QDNA 5IIZA 1X5DA 4L5OA 3ZITA 4OCFA 2ZUPA 3TB2A 3JCML 1AUCA 3F6FA 2DMLA 1HNAA 2I4AA 1GNEA 2WJUA 2NVLA 2R37A 1TRWA 4ZBAA 3D22A 4MP4A 2ALBA 4CY8A 2FY6A 3GKKA 1V57A 4K8MA 1QMVA 3H4KA 3QCPA 3F8UA 1C72A 4WKWA 1K0MA 2XPDA 3HVVA 3RPPA 1SKWB 1ABAA 4JU5A 1OKTA 1Z7PA 2HSNB 2AUVA 4DSRA 3KMOA 2L6CA 4MH2A 3UVHA 3FZ9A 2FNOA 2L5OA 3FR3A 4KH7A 3HVSA 4I8BA 1BYEA 3ISOA 1SU9A 2O5VA 3CRUA 5J47A 4ILFA 1TRSA 1GTUA 3DEXA 2HSNA 3UL3A 1WRYA 2DJ1A 4DSSB 4MZBA 1UA5A 4O5RA 1SL1B 2B6MA 4PURA 3ERFA 3IE3A 1VGLA 5GSTA 5J40A 4L5LA 1DUGA 2LRNA 3KD0A 4V2LA 4AF2A 3FY7A 2HSHA 2VD0A 3KP8A 5CYYA 3F3QA 4IW9A 4V1Ap 3ZVJA 2LRTA 3Q74A 3O6TA 3CSIA 1V9WA 3TRPA 2L4CA 5FT3A 4I5QA 2EFDA 2VCXA 3GA4A 2N5FA 1XVWA 4MPGA 2LUSA 4KE3A 2B7KA 1R4WA 1SKSB 2HRFA 4OWYA 4KDXA 1OAZA 4IBPA 2OADA 4K2XA 1XPVA 3FEUA 3M3MA 4N0ZA 3C1SA 3FHKA 4YQUA 2P0GA 3KEBA 1TDIA 3ZYWA 2X8CA 4TXVA 4PQHA 2H70A 5EVOA 2UZ8A 2ZCTA 4IN0A 1NSWA 2PU9C 3ED3A 4Q5NA 3LORA 1O6JA 5DQYA 2GSTA 4MZWA 2JU5A 4ID0A 2CV4A 3FYGA 2J9HA 1WIKA 2HXKA 2BJXA 3GNJA 2ZNMA 2K18A 4TR1B 3US3A 1K0NA 3KCMA 1I5GA 3ME8A 4LL1B 3RDWA 1TK5B 2B1LA 1AQWA 2X99A 2HRAA 1AQXA 1OVNA 5HR3A 2HLSA 2PVOC 2OE3A 3EE2A 1QUWA 1TRVA 2B5XA 5JCUA 2AYTA 3L9VA 1QQ2A 4BVYB 1A8LA 4O5QA 3WD6A 4OD7A 5J5NA 3TJFA 1R26A 3D4TA 3MWHA 3ZVJD 3HA9A 5G2ZA 4I6XA 4GSSA 4MABA 5H5QA 3I69A 1K3OA 2IMIA 2GQMA 3FZAA 1Y1UA 3TKPA 1T4YA 2EC4A 2MMAA 4EIPA 4PUAA 1AC1A 3H1NA 5G5EA 1TRUA 1PX6A 5EPFA 1J08A 2MMNA 3IHGA 1TU7A 2WFCA 3GL3A 2CVKA 3VI7A 2EIQA 4KX4A 3LXTA 1YKCA 2XHFA 4N11A 2V32A 5IPGA 1ZGNA 5D8IA 3E0UA 3NIVA 2XPEA 1SD9A 1TI1A 3D0ZA 3N5OA 1GULA 3FZ5A 1XBSA 3GL5A 3P90A 3GX8A 4FQUA 2N5BA 1ZOFA 2LV3A 2MBTA 3ZIJA 5JWRB 1OC8A 1S3AA 3VFIA 3OR5A 1YVLA 3F0IA 5ECPB 2H6XA 1JLWA 4HJ2A 3DD3A 1PKZA 2CAQA 2PVQA 2GGTA 4ZXGA 3QAWA 3VI5A 2GVPA 3HZ8A 4TW5A 1VF1A 2QSIA 2CVBA 2CQ9A 2C1YA 3MYDA 6GSYA 5HR2A 1TU8A 5A4UA 1ERUA 3GN3A 1WMJA 4G10A 3LGCA 4J2FA 2H19A 3EURA 2FA4A 4MJEA 20GSA 2RM6A 3UMAA 4ZL7A 1N2AA 1WWJA 2EIOA 2OE0A 4F9ZA 4OFNA 4CHSA 1GSUA 1PKWA 3G7JA 5IMDA 2VCTA 4WF5A 2RUFA 2FD3A 3KTBA 1A23A 3BOAA 3UBLA 2KOKA 5IMFA 2FWGA 3F4TA 2X8GA 4YAVA 1OYJA 2AAWA 4X43A 4KSMA 3IAM2 1DBYA 1K0CA 2CT6A 1Z3EA 4DEJA 3GUSA 3HVXA 3GYKA 1B8XA 3TOTA 2K9FA 3FMWA 1SK1A 4G0LA 4PXOA 3CTFA 1X0RA 5ABRA 2R4VA 1YZXA 3FZ4A 4Z2RA 1M9AA 1ZYNA 4AKIA 2LQQA 5CNWA 2E2MA 3H8QA 4AKGA 3CXGA 3IXRA 3IC8A 3BBYA 2TRCP 4LMVA 3KIJA 2PGTA 2O87A 6GSWA 2H1DA 2H01A 1AIUA 1MDIA 3IHQA 1BF5A 2IN3A 1PN9A 3EINA 2X4AA 1XOBA 4L0WA 2HI7A 1RK4A 1BX9A 2WULA 3P2AA 4ZILA 1XWAA 2X64A 1E6BA 4AGSA 4XRAA 5A4VA 3ZL5A 4MMMA 3L4NA 1R5AA 3GTUA 1BQ7A 1TOFA 2WCIA 2CAIA 3HY2A 4IQ1A 5IM9A 5DDLA 1LBKA 2I3YA 4N0VA 4TR3A 4F2IA 1B48A 4F03A 2B7JA 4NAXA 4I97A 4X1UA 4O92A 5B7CA 4GSNA 4N30A 5IMZA 5JWQB 1T00A 3N9JA 22GSA 3DXBA 3PPUA 1SJIA 4ZB7A 1EOHA 1V58A 4PQ1A 1PL2A 2YWMA 4HQZA 4K0NA 1WJKA 3GKNA 4FYBA 3HKRA 4WR5A 2WGRA 5J3RA 3IA1A 4PUFC 3MIXA 4F0BA 4WXTA 2A4VA 4JZQA 4RQRA 1ZL9A 5A4WA 3CBUA 4LMWA 4A5PA 1XXUA 3W8JA 2I1UA 2I9HA 5E59A 3TOUA 1ZZYA 1SK2A 4LL4B 4G19A 3A2WA 3FRCA 2M46A 1O8WA 4E68A 2H66A 3LQ7A 3IR4A 2A2PA 19GSA 1ZMAA 4TXOB 3CSHA 5GZZB 2H74A 4YKGA 3R3EA 3CMIA 1EWXA 3GSSA 1EEMA 5ELGA 1LJRA 1PX7A 2XBIA 3BCIA 1THXA 5DCGA 3S9FA 2JZSA 2P5RA 1SKRB 2AJQB 3WT2A 1GSFA 4TXOA 5LCZA 2H76A 1XWBA 2LKUA 3D6IA 3J7Yk 3FW2A 2JZRA 5J4VA 3UEMA 5ECQB 3KMNA 3DVWA 1XZOA 5AIXA 3KP9A 3QAGA 3QMXA 4OFMA 4Z7XA 6GSTA 2VAFA 3U6VA 4AJ7A 5B6MA 5ECLB 3DGQA 4KA0A 2HFDA 3GKMA 4KSOA 4KW6A 1K0BA 1ZYPA 2C0EA 3HHVA 4MNNA 5BMUB 1EEJA 3EYTA 3UARA 4JR4A 3VPTA 5ENUA 2V2GA 4KDYA 2NDOA 5J9BA 5ECMB 5HFIA 5BMUA 6GSVA 4PX1A 1M2BA 2IJYA 3HCZA 2L59A 4EKZA 1GP1A 4OFTA 2HZEA 2GSSA 2YWNA 2R6KA 3BD2A 2GS3A 2O7KA 1K0AA 5B8BA 2H8LA 2REMA 1YDKA 5CO3A 1G6WA 1MD4A 2LS5A 2J23A 5F8BA 4G0KA 1AXDA 5F06A 2CA8A 5IO0A 4HZ2A 5B8AA 4GCIA 3WGEA 3TGZA 4HI7A 4EDYA 5H5SA 5HQPA 4TVEA 4USSA 3KH7A 4NWYA 1PGTA 2H1BA 3GSTA 4OCEA 1O73A 4K5SA 2M72A 1GUKA 4BVXB 1GTIA 4KUNA 1CQGA 5C00A 4V2MA 4BL7B 1PD21 4Q5QA 4K7IA 2B3SA 3VLNA 1TTZA 3TKSE 2GZYA 5DJMA 4BVXA 2F8AA 1BG1A 4BL7A 3IPZA 5LNKe 1V98A 3M9KA 5IMCA 5EY6A 4FH8A 1TJDA 2VO4A 3VWXA 2DSAA 1KNGA 4K5RA 4J56E 3ZMLA 4G9HA 1U6TA 4LLRA 2C3NA 2EFCA 3RPNA 4TKYA 3CRTA 3D5JA 4GDFA 2H1LA 3EVIA 3ZREA 4IHUA 3F6DA 3VPQA 5GAPD 3A5IA 1FO5A 2DMMA 2O85A 3O3TA 4NXIA 2VIMA 4O7HA 1YEPA 4NHWA 3ZTLA 1X5EA 3DRNA 1I9DA 2B5YA 5HR1A 5DQSA 2H73A 2OT3A 4LA1A 2LJRA 4ZL9A 3ZMKA 4WETA 4GTUA 3G7IA 2YWOA 16GSA 2N5AA 4MF6A 3GH9A 2PUKC 5J4YA 5DBQA 5FWGA 2IMDA 2OBIA 1FAAA 5AN1A 4PNGA 2YNXA 4YQVA 1Z7RA 3TJGA 4K2DA 1EGOA 4AJ8A 13GSA 1V40A 4WEYA 1BEDA 1GL8A 2VCZA 3QFAC 4ML1A 1YEXA 3EC3A 2A2RA 5BRTA 2ON5A 5KN3A 2C4JA 4TR0A 2IWTA 2I81A 4O32A 5G30A 3KM6A 1FOHA 1RQMA 1FB6A 1TW9A 3GV1A 4OO4A 5KOWA 3HJPA 1YJ6A 4RI7A 1GSEA 4KNDA 4EE0A 1AAZA 1NM3A 4V2NA 1JZWA 2JSYA 2MMOA 2PN8A 4ZIJA 6GSXA 2HYXA 4IELA 3L9SA 2KHPA 1SVLA 10GSA 4K7OA 3Q6OA 3H93A 4RQXA 5DCHA 1UN2A 1ERTA 3QR6A 5COHA 1SD8A 3GX0A 5G5FA 1PRXA 3LYPA 1GLQA 3MSZA 3LW9A 3GKXA 5IMAA 2L6DA 1ACVA 1M2DA 1SYRA 5CRHA 5D93A 3WGXA 4NPBA 2R0PA 5GAND 3CYNA 3WGDA 1EZKA 2FGXA 2GT5A 4IQAA 3CSJA 1G0TA 1A2MA 2VCWA 3TJBA 3GFKA 4I2UA 3DWVA 1YF1A 2LSTA 5ECNB 3F63A 4KDUA 1USBA 2MBSA 1K3YA 1SVMA 4MCUA 3PR8A 5J41A 4GF0A 1OE8A 4MK3A 1PL1A 4CY6A 2CZ2A 3APOA 1ZYQB 3IK7A 3UBKA 1H4OA 1XIYA 12GSA 1A24A 2XBQA 1CQHA 1N25A 1WOUA 1TXXA 5JWOB 1HQOA 2QA2A 3GIXA 8GSSA 1QXHA 4N3ZA 1ZCPA 4POMA 4RUVA 3TJJA 3F3RA 2A2SA 5CP1A 3LSZA 5AGYA 1A2JA 4HOJA 3ZLPA 17GSA 1PN0A 2E7PA 3LWAA 2VCQA 2YANA 4DVCA 1HYUA 1TKDB 1XWKA 3D4MA 4WBRD 1N8JA 4JE1A 4EXJA 6GSUA 1X9WB 2JZTA 3KJYA 2E0QA 3NOFA 5CRDA 3KGKA 1ERWA 2VCVA 5CAXA 1URMA 4ECIA 3EMXA 1B4QA 1Q98A 1SL0B 2G0FA 5KN1A 4HS1A 1KBNA 2C80A 1MDJA 5A34B 3TRXA 4XS6A 3E9JB 3QFBC 4AJ6A 3QAVA 4ECJA 4KCAA 5IOWA 1PA3A 2DC5A 3MDKA 3KTLA 2FWHA 4IJ3A 3AY8A 4NMUA 2DIYA 1W89A 2VKZG 1THOA 5D9WA 2C3TA 2PBJA 2FHEA 7GSSA 3GTUB 5A34A 3IAS2 3EU3A 4XCSA 5G1KA 2VLVA 1GH2A 1MDKA 5ID2B 2K6VA 1T1VA 4ZB9A 2MYGA 3C7MA 4ZBDA 2M80A 3IDVA 5D9TA 4ECCA 2PPTA 3F4SA 4D73B 1A8YA 4QQ7A 1GSQA 5B6NA 4GRFA 4IJIA 2WDUA 3C71A 3E3EA 1B9YC 5ID2A 4IP1A 1KEBA 3PINA 2H30A 3TRQA 2BTOT 1XWCA 1G7OA 4D73A 2FLSA 3EWLA 1MEKA 1O85A 4AKXB 4L0UA 5D96A 1JZOA 2LQOA 2F3MA 2KUCA 1UC7A 3GH6A 2F8FA 2YP6A 4XS4B 1JHBA 3EPTA 4N10A 2HT9A 3UJ1A 1O7UA 2YV7A 1LU4A 1S3CA 3HJOA 3C8EA 4K1FA 2F51A 2C0GA 5ECKB 1OE7A 5EL8A 1O8XA 4OO5A 4XS4A 3HJMA 3J7Yb 5IQYA 2OJLA 3P8WA 1GWCA 1SL2B 2AB6A 2VLUA 2OKAA 3W8SA 1EP7A 3ZRDA 2FA8A 3RHBA 1EGRA 1Y25A 1T4ZA 2H72A 1W4VA 1Z6NA 2LJKA 3RHCA 4KCEA 3PGTA 1K3LA 2R2JA 2VOCA 4PQIA 4EVMA 1BJXA 2VUPA 4EIQA 2IIYA 1TP9A 3IK9A 2B1KA 3IBHA 2IMFA 5ELAA 2WZ9A 2IMKA 2KLXA 5GSSA 3LJRA 4IGJA 1X9MB 2LEGA 2LJAA 2JL4A 3HZ4A 2C0DA 4L8EA 2R3XA 1B4PA 4K6XA 1A0FA 2VD1A 2P5QA 1YY7A 4QL7A 3MNGA 1R5PA 3TJKA 4YH2A 1JLVA 5HFKA 5F07A 5LD0A 4NV2A 3P7XA 4ACSA 3FR9A 3HD5A 2UV8G 5ECIB 2IPAA 2F9SA 3IC4A 2HZFA 4KB3A 1XWGA 5ECOB 3BJ5A 1XW6A 2HZEB 4MZCA 9GSSA 2H71A 2LNSA 1AW9A 2JACA 1F6MC 5CREA 3Q19A 1B9XC 3VURA 3QD9A 1IYIA 4NHZA 4HU7A 3A2VA 4ML6A 4GWRA 1M2AA 1A2LA 3EU4A 2JSZA 1R7HA 4JBBA 4POBA 2GSRA 5G1LA 2PMTA 3L9UA 2YPMA 5D9XA 1DE2A 4EC0A 2PERA 4OMVA 2EFEA 3FK8A 4POLA 2GSQA 3TKSA 3PH9A 2BMXA 1XW9A 1SK0A 2FWEA 2H0GA 2HRNA 4CW9A 1EV4A 1BG5A 3SWLA 1GTAA 2YV9A 2H1GA 4ECBA 1EP8A 1ST9A 4E8HA 4Z2UA 3LYKA 5J9CA 2C8UA 1NHOA 1SJZA 4IS0A 4E8EA 1ZYEA 3K8NA 4TR4A 3ERWA 1PQNA 3F9UA 4ZB6A 1JZDA 3I6AA 5DVBA 2QGVA 5JCWA 3D21A 4K0GA 1TXUA 3G7YA 3HDCA 1FB0A 5F0GA 2YJHA 4G0IA 1OKDA 3TKQA 4IKHA 1QFNA 1ON4A 3LXZA 3L78A 5A1NB 2WS2A 2L57A 3RBTA 4DSSA 1DSBA 1SENA 3VWUA 1G6YA 5D73A 2K8VA 2LRCA 1ML6A 1S3DA 1YKAA 4QL9A 4ICYA 2MMZA 5A1NA 1OC3A 3DIEA 5DALB 3LEFA 1VRSD 4XIHA 3M1GA 2VLTA 1T8EB 2R0CA 3Q18A 1U87A 3CTGA 4EL1A 2RLIA 3TUEA 2HSYA 1FOVA 1EV9A 4PTSA 3ZFBA 1TK8B 1J0FA 5DALA 1SVOA 1VF3A 3CWGA 4JR6A 4MF5A 2V6KA 2OACA 4WF4A 2HRKB 4MJAA 4H86A 2GZZA 5DAKB 2QA1A 5HFGA 4KGIA 2Z9SA 4FO5A 3SBCA 1YF0A 1JZRA 2DJKA 1Z9HA 3RAZA 2QKEA 1M0UA 5AIVA 2DKIA 2EIRA 1RW1A 2HRKA 1PMTA 4Q5FA 2NPBA 1QGVA 2DIZA 2CVDA 5DAKA 4FYCA 3A2XA 1SYXA 4MJCA 3BCKA 2VL3A 3HXSA 2LNTA 3HMJG 2CX3A 2D2ZA 3FKFA 3V1WA 4MLYA 2H6ZA 3VK9A 1YQ1A 1X9SB 1WP0A 2YZUA 3GURA 14GSA 2O89A 4TR1A 4POKA 1F3AA 3APQA 4XRDA 3ERGA 2YZHA 2P31A 4HJMA 3ZIVA 4G01A 1XCCA 4YAPA 4BA7A 4W66A 5ECHB 2GLRA 3FR6A 2V6OA 5D9VA 2ES7A 1GLPA 4NV5A 2YJ7A 4IVFA 4BVYA 3WT1A 1EOGA 1SJ6A 4ISDA 5ECRB 2YWIA 2RUEA 4MA9A 1F2EA 2DJ0A 5H5RA 2DBCA 4V1Ag 3KZQA 4BWQA 1K0DA 1M99A 2VL2A 2C0FA 5G31A 3TKSC 2GQKA 4P3YB 1T3BA 5A5HB 3M8NA 3IOSA 4MF7A 2WB9A 4PGTA 3I43A 4DSQA 3ZZXA 4PNFA 5IPHA 1FW1A 2VL9A 3A3TA 2FCHA 2IFQB 4GLTA 1WPIA 4X4JA 5A5HA 5CRWA 3VWWA 2KP1A 4HEA2 1FVJA 2AV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJL A;  2IFQ A;  4TRX A;  1VF4 A;  2IL3 A;  1HNB A;  5FHI A;  2R5G A;  2VM1 A;  4BPY A;  3QPM A;  1NW2 A;  3LG6 A;  1BAY A;  5CRG A;  4WBJ A;  3UIW A;  3L0H A;  2XC2 A;  3G9B A;  5KEJ A;  3WYW A;  4HZ4 A;  3U5R E;  5E4W A;  1M9B A;  3KH9 A;  3C1R A;  2VM2 A;  1HD2 A;  2TIR A;  5J4U A;  2OBK A;  5IOX A;  5ECS A;  3APS A;  1J9B A;  3GHA A;  3ZFL A;  1GTB A;  5KN2 A;  3HYP A;  4FYU A;  1GNW A;  2YOI A;  5A5K A;  2H6Y A;  4F82 A;  3TKR A;  4EDZ A;  2HQT A;  1GSS A;  4ZB8 A;  3UVT A;  3A5W A;  2V41 A;  1XFL A;  2HSM B;  1F37 A;  2E2G A;  5L71 A;  4YQM A;  4ZL8 A;  4MH3 A;  4XS1 A;  4HDE A;  1F3B A;  4HQS A;  4JED A;  18GS A;  3O76 A;  2GTU A;  2MZC A;  2HSM A;  4WR4 A;  4GQC A;  1XW5 A;  4KF9 A;  2H1A A;  3ME7 A;  1NHY A;  3TDG A;  2FUG 2;  3VWV A;  3M0F A;  3F4R A;  4EF0 A;  1Q4J A;  1DE1 A;  3NZN A;  1U3A A;  2RII A;  1Z5Y E;  1XVQ A;  1MD3 A;  4XHM A;  2L5L A;  2H0H A;  4GXZ A;  2H0I A;  4IP6 A;  5INY A;  2NBS A;  1QK8 A;  3M9J A;  2V1M A;  2DJ3 A;  2HE3 A;  1E2Y A;  1MTC A;  2GT6 A;  5F05 A;  4BWS A;  1G7E A;  1M7T A;  2JAD A;  1FHE A;  1A0R P;  4I2T A;  1Z6M A;  2YN1 A;  3UAP A;  1GUH A;  2DLX A;  1ILO A;  11GS A;  2K8S A;  4EUY A;  5C04 A;  4HU9 A;  2HNL A;  4JRR A;  3IRA A;  4ZBB A;  4J57 E;  2B5E A;  4HUA A;  4TN8 A;  4K9Z A;  2H75 A;  2DJJ A;  2CX4 A;  3GRX A;  4G2E A;  1GUM A;  1HNC A;  2YCD A;  5IO2 A;  1WE0 A;  3H79 A;  2C3Q A;  1U88 A;  3GMF A;  2QC7 A;  5AIS A;  1T7P B;  1V2A A;  4TOP A;  4CDO A;  1AQV A;  2AHE A;  1JFU A;  1GSY A;  4MPF A;  2PWJ A;  1KTE A;  3DML A;  3R2Q A;  3C73 A;  4Q5R A;  3KXO A;  3DKS A;  3EMP A;  2GZP A;  3TCO A;  1X5C A;  1O81 A;  2GQL A;  1TK0 B;  3DVX A;  1IYH A;  2VL2 C;  1K0O A;  1VF2 A;  2G2Q A;  2TRX A;  5IMV A;  2O8V B;  2NTO A;  2OE1 A;  2IME A;  4K7N A;  2ON7 A;  2X8H A;  4MJB A;  4EO3 A;  5KN0 A;  2FWF A;  1TI3 A;  3I9V 2;  1U3I A;  1ERV A;  1Y6E A;  4X0X A;  4GST A;  2DJ2 A;  2CZ3 A;  1FG4 A;  3LFL A;  4ULX A;  1F9M A;  1GSD A;  2KP2 A;  4XTS A;  1H75 A;  2WRT A;  1OC9 B;  4RI6 A;  2OA7 A;  2LTK A;  1UVZ A;  3DYR A;  4FIW A;  1FVK A;  3IV4 A;  6GSS A;  2RM5 A;  3MAK A;  1PSQ A;  4MDC A;  3W6G A;  3QOU A;  5HR0 A;  4GQF A;  4KAE A;  3UOM A;  1XOA A;  1OC9 A;  5JCG A;  2L4Q A;  4F0C A;  2GDR A;  1GRX A;  3QDN A;  5IIZ A;  1X5D A;  4L5O A;  3ZIT A;  4OCF A;  2ZUP A;  3TB2 A;  3JCM L;  1AUC A;  3F6F A;  2DML A;  1HNA A;  2I4A A;  1GNE A;  2WJU A;  2NVL A;  2R37 A;  1TRW A;  4ZBA A;  3D22 A;  4MP4 A;  2ALB A;  2FY6 A;  3GKK A;  1V57 A;  4K8M A;  1QMV A;  3H4K A;  3QCP A;  3F8U A;  1C72 A;  4WKW A;  1K0M A;  2XPD A;  3HVV A;  3RPP A;  1SKW B;  1ABA A;  4JU5 A;  1OKT A;  1Z7P A;  2HSN B;  2AUV A;  4DSR A;  3KMO A;  2L6C A;  4MH2 A;  3UVH A;  3FZ9 A;  2FNO A;  2L5O A;  3FR3 A;  4KH7 A;  3HVS A;  4I8B A;  1BYE A;  3ISO A;  1SU9 A;  3CRU A;  4ILF A;  1TRS A;  1GTU A;  3DEX A;  3UL3 A;  1WRY A;  2DJ1 A;  4DSS B;  4MZB A;  1UA5 A;  4O5R A;  1SL1 B;  2B6M A;  4PUR A;  3ERF A;  3IE3 A;  1VGL A;  5GST A;  4L5L A;  1DUG A;  2LRN A;  3KD0 A;  4V2L A;  4AF2 A;  3FY7 A;  2HSH A;  2VD0 A;  3KP8 A;  5CYY A;  3F3Q A;  4IW9 A;  4V1A p;  3ZVJ A;  2LRT A;  3Q74 A;  3O6T A;  3CSI A;  1V9W A;  3TRP A;  2L4C A;  5FT3 A;  4I5Q A;  2VCX A;  3GA4 A;  2N5F A;  1XVW A;  4MPG A;  2LUS A;  4KE3 A;  2B7K A;  1R4W A;  1SKS B;  2HRF A;  4OWY A;  4KDX A;  1OAZ A;  4IBP A;  2OAD A;  1XPV A;  3FEU A;  3M3M A;  4N0Z A;  3C1S A;  3FHK A;  4YQU A;  2P0G A;  3KEB A;  1TDI A;  3ZYW A;  2X8C A;  4TXV A;  4PQH A;  2H70 A;  5EVO A;  2UZ8 A;  2ZCT A;  4IN0 A;  1NSW A;  2PU9 C;  3ED3 A;  4Q5N A;  3LOR A;  1O6J A;  5DQY A;  2GST A;  4MZW A;  2JU5 A;  4ID0 A;  2CV4 A;  3FYG A;  2J9H A;  1WIK A;  2HXK A;  2BJX A;  3GNJ A;  2ZNM A;  2K18 A;  4TR1 B;  3US3 A;  1K0N A;  3KCM A;  1I5G A;  3ME8 A;  4LL1 B;  3RDW A;  1TK5 B;  2B1L A;  1AQW A;  2X99 A;  2HRA A;  1AQX A;  1OVN A;  5HR3 A;  2HLS A;  2PVO C;  2OE3 A;  3EE2 A;  1QUW A;  1TRV A;  2B5X A;  5JCU A;  2AYT A;  3L9V A;  1QQ2 A;  4BVY B;  1A8L A;  3WD6 A;  4OD7 A;  5J5N A;  3TJF A;  1R26 A;  3D4T A;  3MWH A;  3ZVJ D;  3HA9 A;  5G2Z A;  4I6X A;  4GSS A;  4MAB A;  5H5Q A;  3I69 A;  1K3O A;  2IMI A;  2GQM A;  3FZA A;  3TKP A;  1T4Y A;  2EC4 A;  2MMA A;  4PUA A;  1AC1 A;  3H1N A;  5G5E A;  1TRU A;  1PX6 A;  5EPF A;  1J08 A;  2MMN A;  1TU7 A;  2WFC A;  3GL3 A;  2CVK A;  3VI7 A;  2EIQ A;  4KX4 A;  3LXT A;  1YKC A;  2XHF A;  4N11 A;  2V32 A;  5IPG A;  1ZGN A;  5D8I A;  3E0U A;  3NIV A;  2XPE A;  1SD9 A;  1TI1 A;  3D0Z A;  3N5O A;  1GUL A;  3FZ5 A;  1XBS A;  3GL5 A;  3P90 A;  3GX8 A;  4FQU A;  2N5B A;  1ZOF A;  2LV3 A;  2MBT A;  3ZIJ A;  5JWR B;  1OC8 A;  1S3A A;  3VFI A;  3OR5 A;  3F0I A;  5ECP B;  2H6X A;  1JLW A;  4HJ2 A;  3DD3 A;  1PKZ A;  2CAQ A;  2PVQ A;  2GGT A;  4ZXG A;  3QAW A;  3VI5 A;  2GVP A;  3HZ8 A;  4TW5 A;  1VF1 A;  2QSI A;  2CVB A;  2CQ9 A;  2C1Y A;  6GSY A;  5HR2 A;  1TU8 A;  5A4U A;  1ERU A;  3GN3 A;  1WMJ A;  4G10 A;  3LGC A;  4J2F A;  2H19 A;  3EUR A;  2FA4 A;  4MJE A;  20GS A;  2RM6 A;  3UMA A;  4ZL7 A;  1N2A A;  1WWJ A;  2EIO A;  2OE0 A;  4F9Z A;  4OFN A;  4CHS A;  1GSU A;  1PKW A;  3G7J A;  5IMD A;  2VCT A;  4WF5 A;  2RUF A;  2FD3 A;  3KTB A;  1A23 A;  3BOA A;  3UBL A;  2KOK A;  5IMF A;  2FWG A;  3F4T A;  2X8G A;  4YAV A;  1OYJ A;  2AAW A;  4X43 A;  4KSM A;  3IAM 2;  1DBY A;  1K0C A;  2CT6 A;  1Z3E A;  4DEJ A;  3GUS A;  3HVX A;  3GYK A;  1B8X A;  3TOT A;  2K9F A;  1SK1 A;  4G0L A;  4PXO A;  3CTF A;  1X0R A;  5ABR A;  2R4V A;  1YZX A;  3FZ4 A;  1M9A A;  2LQQ A;  5CNW A;  2E2M A;  3H8Q A;  3CXG A;  3IXR A;  3IC8 A;  3BBY A;  2TRC P;  4LMV A;  3KIJ A;  2PGT A;  2O87 A;  6GSW A;  2H1D A;  2H01 A;  1AIU A;  1MDI A;  3IHQ A;  2IN3 A;  1PN9 A;  3EIN A;  1XOB A;  4L0W A;  2HI7 A;  1RK4 A;  1BX9 A;  2WUL A;  3P2A A;  4ZIL A;  1XWA A;  2X64 A;  1E6B A;  4AGS A;  4XRA A;  5A4V A;  3ZL5 A;  4MMM A;  3L4N A;  1R5A A;  3GTU A;  1BQ7 A;  1TOF A;  2WCI A;  2CAI A;  3HY2 A;  4IQ1 A;  5IM9 A;  5DDL A;  1LBK A;  2I3Y A;  4N0V A;  4TR3 A;  4F2I A;  1B48 A;  4F03 A;  2B7J A;  4NAX A;  4I97 A;  4X1U A;  4O92 A;  5B7C A;  4GSN A;  4N30 A;  5IMZ A;  5JWQ B;  1T00 A;  3N9J A;  22GS A;  3DXB A;  3PPU A;  1SJI A;  1EOH A;  1V58 A;  4PQ1 A;  1PL2 A;  2YWM A;  4HQZ A;  4K0N A;  1WJK A;  3GKN A;  4FYB A;  3HKR A;  4WR5 A;  2WGR A;  5J3R A;  3IA1 A;  4PUF C;  4F0B A;  4WXT A;  2A4V A;  4JZQ A;  4RQR A;  1ZL9 A;  5A4W A;  3CBU A;  4LMW A;  1XXU A;  3W8J A;  2I1U A;  2I9H A;  5E59 A;  3TOU A;  1ZZY A;  1SK2 A;  4LL4 B;  4G19 A;  3A2W A;  3FRC A;  2M46 A;  1O8W A;  2H66 A;  3LQ7 A;  3IR4 A;  19GS A;  1ZMA A;  4TXO B;  3CSH A;  5GZZ B;  2H74 A;  3R3E A;  3CMI A;  1EWX A;  3GSS A;  1EEM A;  5ELG A;  1LJR A;  1PX7 A;  2XBI A;  3BCI A;  1THX A;  5DCG A;  3S9F A;  2JZS A;  2P5R A;  1SKR B;  2AJQ B;  3WT2 A;  1GSF A;  4TXO A;  5LCZ A;  2H76 A;  1XWB A;  2LKU A;  3D6I A;  3J7Y k;  3FW2 A;  2JZR A;  3UEM A;  5ECQ B;  3KMN A;  3DVW A;  1XZO A;  5AIX A;  3KP9 A;  3QAG A;  3QMX A;  4OFM A;  4Z7X A;  6GST A;  2VAF A;  3U6V A;  4AJ7 A;  5B6M A;  5ECL B;  3DGQ A;  4KA0 A;  2HFD A;  3GKM A;  4KSO A;  4KW6 A;  1K0B A;  2C0E A;  3HHV A;  1EEJ A;  3EYT A;  3UAR A;  4JR4 A;  3VPT A;  5ENU A;  2V2G A;  4KDY A;  2NDO A;  5J9B A;  5ECM B;  5HFI A;  5BMU A;  6GSV A;  4PX1 A;  1M2B A;  2IJY A;  3HCZ A;  2L59 A;  4EKZ A;  1GP1 A;  4OFT A;  2HZE A;  2GSS A;  2YWN A;  2R6K A;  3BD2 A;  2GS3 A;  2O7K A;  1K0A A;  5B8B A;  2H8L A;  2REM A;  1YDK A;  5CO3 A;  1G6W A;  1MD4 A;  2LS5 A;  2J23 A;  5F8B A;  4G0K A;  1AXD A;  5F06 A;  2CA8 A;  5IO0 A;  4HZ2 A;  5B8A A;  4GCI A;  3WGE A;  3TGZ A;  4HI7 A;  4EDY A;  5H5S A;  5HQP A;  4TVE A;  4USS A;  3KH7 A;  4NWY A;  1PGT A;  2H1B A;  3GST A;  4OCE A;  1O73 A;  2M72 A;  1GUK A;  4BVX B;  1GTI A;  4KUN A;  1CQG A;  5C00 A;  4V2M A;  4BL7 B;  1PD2 1;  4Q5Q A;  4K7I A;  2B3S A;  3VLN A;  1TTZ A;  3TKS E;  2GZY A;  5DJM A;  4BVX A;  2F8A A;  4BL7 A;  3IPZ A;  5LNK e;  1V98 A;  3M9K A;  5IMC A;  5EY6 A;  4FH8 A;  1TJD A;  2VO4 A;  3VWX A;  2DSA A;  1KNG A;  4J56 E;  3ZML A;  4G9H A;  1U6T A;  4LLR A;  2C3N A;  3RPN A;  4TKY A;  3CRT A;  3D5J A;  3EVI A;  3ZRE A;  4IHU A;  3F6D A;  3VPQ A;  5GAP D;  1FO5 A;  2DMM A;  2O85 A;  3O3T A;  4NXI A;  2VIM A;  4O7H A;  1YEP A;  4NHW A;  3ZTL A;  1X5E A;  3DRN A;  1I9D A;  2B5Y A;  5HR1 A;  5DQS A;  2H73 A;  4LA1 A;  2LJR A;  4ZL9 A;  3ZMK A;  4WET A;  4GTU A;  3G7I A;  2YWO A;  16GS A;  2N5A A;  4MF6 A;  3GH9 A;  2PUK C;  5DBQ A;  5FWG A;  2IMD A;  2OBI A;  1FAA A;  5AN1 A;  4PNG A;  2YNX A;  4YQV A;  1Z7R A;  3TJG A;  4K2D A;  1EGO A;  4AJ8 A;  13GS A;  1V40 A;  4WEY A;  1BED A;  1GL8 A;  2VCZ A;  3QFA C;  4ML1 A;  1YEX A;  3EC3 A;  2A2R A;  2ON5 A;  5KN3 A;  2C4J A;  4TR0 A;  2IWT A;  2I81 A;  4O32 A;  5G30 A;  3KM6 A;  1RQM A;  1FB6 A;  1TW9 A;  3GV1 A;  4OO4 A;  3HJP A;  1YJ6 A;  4RI7 A;  1GSE A;  4KND A;  4EE0 A;  1AAZ A;  1NM3 A;  4V2N A;  1JZW A;  2JSY A;  2MMO A;  2PN8 A;  4ZIJ A;  6GSX A;  2HYX A;  4IEL A;  3L9S A;  2KHP A;  10GS A;  4K7O A;  3Q6O A;  3H93 A;  4RQX A;  5DCH A;  1UN2 A;  1ERT A;  3QR6 A;  5COH A;  1SD8 A;  3GX0 A;  5G5F A;  1PRX A;  3LYP A;  1GLQ A;  3MSZ A;  3GKX A;  5IMA A;  2L6D A;  1ACV A;  1M2D A;  1SYR A;  5CRH A;  5D93 A;  3WGX A;  4NPB A;  5GAN D;  3CYN A;  3WGD A;  1EZK A;  2FGX A;  2GT5 A;  4IQA A;  3CSJ A;  1G0T A;  1A2M A;  2VCW A;  3TJB A;  3GFK A;  4I2U A;  3DWV A;  1YF1 A;  2LST A;  5ECN B;  3F63 A;  4KDU A;  1USB A;  2MBS A;  1K3Y A;  4MCU A;  3PR8 A;  5J41 A;  4GF0 A;  1OE8 A;  4MK3 A;  1PL1 A;  2CZ2 A;  3APO A;  1ZYQ B;  3IK7 A;  3UBK A;  1H4O A;  1XIY A;  12GS A;  1A24 A;  2XBQ A;  1CQH A;  1WOU A;  1TXX A;  5JWO B;  1HQO A;  3GIX A;  8GSS A;  1QXH A;  1ZCP A;  4POM A;  4RUV A;  3TJJ A;  3F3R A;  2A2S A;  5CP1 A;  3LSZ A;  5AGY A;  1A2J A;  4HOJ A;  3ZLP A;  17GS A;  2E7P A;  3LWA A;  2VCQ A;  2YAN A;  4DVC A;  1HYU A;  1TKD B;  1XWK A;  3D4M A;  4WBR D;  1N8J A;  4JE1 A;  4EXJ A;  6GSU A;  1X9W B;  2JZT A;  3KJY A;  2E0Q A;  3NOF A;  5CRD A;  3KGK A;  1ERW A;  2VCV A;  5CAX A;  1URM A;  4ECI A;  3EMX A;  1B4Q A;  1Q98 A;  1SL0 B;  2G0F A;  5KN1 A;  4HS1 A;  1KBN A;  2C80 A;  1MDJ A;  3TRX A;  4XS6 A;  3E9J B;  3QFB C;  4AJ6 A;  3QAV A;  4ECJ A;  4KCA A;  5IOW A;  1PA3 A;  2DC5 A;  3MDK A;  3KTL A;  2FWH A;  4IJ3 A;  3AY8 A;  4NMU A;  2DIY A;  1W89 A;  1THO A;  5D9W A;  2C3T A;  2PBJ A;  2FHE A;  7GSS A;  3GTU B;  3IAS 2;  3EU3 A;  4XCS A;  5G1K A;  2VLV A;  1GH2 A;  1MDK A;  5ID2 B;  2K6V A;  1T1V A;  4ZB9 A;  2MYG A;  3C7M A;  4ZBD A;  2M80 A;  3IDV A;  5D9T A;  4ECC A;  2PPT A;  3F4S A;  4D73 B;  1A8Y A;  4QQ7 A;  1GSQ A;  5B6N A;  4GRF A;  4IJI A;  2WDU A;  3C71 A;  3E3E A;  1B9Y C;  5ID2 A;  4IP1 A;  1KEB A;  3PIN A;  2H30 A;  3TRQ A;  2BTO T;  1XWC A;  1G7O A;  4D73 A;  2FLS A;  3EWL A;  1MEK A;  1O85 A;  4L0U A;  5D96 A;  1JZO A;  2LQO A;  2F3M A;  2KUC A;  1UC7 A;  3GH6 A;  2F8F A;  2YP6 A;  4XS4 B;  1JHB A;  4N10 A;  2HT9 A;  3UJ1 A;  1O7U A;  2YV7 A;  1LU4 A;  1S3C A;  3HJO A;  3C8E A;  4K1F A;  2F51 A;  2C0G A;  5ECK B;  1OE7 A;  5EL8 A;  1O8X A;  4OO5 A;  4XS4 A;  3HJM A;  3J7Y b;  5IQY A;  2OJL A;  3P8W A;  1GWC A;  1SL2 B;  2AB6 A;  2VLU A;  2OKA A;  3W8S A;  1EP7 A;  3ZRD A;  2FA8 A;  3RHB A;  1EGR A;  1Y25 A;  1T4Z A;  2H72 A;  1W4V A;  1Z6N A;  2LJK A;  3RHC A;  4KCE A;  3PGT A;  1K3L A;  2R2J A;  2VOC A;  4PQI A;  4EVM A;  1BJX A;  2VUP A;  2IIY A;  1TP9 A;  3IK9 A;  2B1K A;  3IBH A;  2IMF A;  5ELA A;  2WZ9 A;  2IMK A;  2KLX A;  5GSS A;  3LJR A;  4IGJ A;  1X9M B;  2LEG A;  2LJA A;  2JL4 A;  3HZ4 A;  2C0D A;  4L8E A;  2R3X A;  1B4P A;  4K6X A;  1A0F A;  2VD1 A;  2P5Q A;  1YY7 A;  4QL7 A;  3MNG A;  1R5P A;  3TJK A;  4YH2 A;  1JLV A;  5HFK A;  5F07 A;  5LD0 A;  4NV2 A;  3P7X A;  4ACS A;  3FR9 A;  3HD5 A;  5ECI B;  2IPA A;  2F9S A;  3IC4 A;  2HZF A;  4KB3 A;  1XWG A;  5ECO B;  3BJ5 A;  1XW6 A;  2HZE B;  4MZC A;  9GSS A;  2H71 A;  2LNS A;  1AW9 A;  2JAC A;  1F6M C;  5CRE A;  3Q19 A;  1B9X C;  3VUR A;  3QD9 A;  1IYI A;  4NHZ A;  4HU7 A;  3A2V A;  4ML6 A;  4GWR A;  1M2A A;  1A2L A;  3EU4 A;  2JSZ A;  1R7H A;  4JBB A;  4POB A;  2GSR A;  5G1L A;  2PMT A;  3L9U A;  2YPM A;  5D9X A;  1DE2 A;  4EC0 A;  2PER A;  4OMV A;  3FK8 A;  4POL A;  2GSQ A;  3TKS A;  3PH9 A;  2BMX A;  1XW9 A;  1SK0 A;  2FWE A;  2H0G A;  2HRN A;  4CW9 A;  1EV4 A;  1BG5 A;  3SWL A;  1GTA A;  2YV9 A;  2H1G A;  4ECB A;  1EP8 A;  1ST9 A;  4E8H A;  3LYK A;  5J9C A;  2C8U A;  1NHO A;  1SJZ A;  4IS0 A;  4E8E A;  1ZYE A;  3K8N A;  4TR4 A;  3ERW A;  1PQN A;  3F9U A;  4ZB6 A;  1JZD A;  3I6A A;  5DVB A;  2QGV A;  5JCW A;  3D21 A;  4K0G A;  3G7Y A;  3HDC A;  1FB0 A;  5F0G A;  2YJH A;  4G0I A;  1OKD A;  3TKQ A;  4IKH A;  1QFN A;  1ON4 A;  3LXZ A;  3L78 A;  2WS2 A;  2L57 A;  3RBT A;  4DSS A;  1DSB A;  1SEN A;  3VWU A;  1G6Y A;  5D73 A;  2K8V A;  2LRC A;  1ML6 A;  1S3D A;  1YKA A;  4QL9 A;  2MMZ A;  1OC3 A;  3DIE A;  5DAL B;  3LEF A;  1VRS D;  4XIH A;  3M1G A;  2VLT A;  1T8E B;  3Q18 A;  1U87 A;  3CTG A;  4EL1 A;  2RLI A;  3TUE A;  2HSY A;  1FOV A;  1EV9 A;  4PTS A;  3ZFB A;  1TK8 B;  1J0F A;  5DAL A;  1VF3 A;  4JR6 A;  4MF5 A;  2V6K A;  2OAC A;  4WF4 A;  2HRK B;  4MJA A;  4H86 A;  2GZZ A;  5DAK B;  5HFG A;  4KGI A;  2Z9S A;  4FO5 A;  3SBC A;  1YF0 A;  1JZR A;  2DJK A;  1Z9H A;  3RAZ A;  2QKE A;  1M0U A;  5AIV A;  2EIR A;  1RW1 A;  2HRK A;  1PMT A;  4Q5F A;  2NPB A;  1QGV A;  2DIZ A;  2CVD A;  5DAK A;  4FYC A;  3A2X A;  1SYX A;  4MJC A;  3BCK A;  2VL3 A;  3HXS A;  2LNT A;  2CX3 A;  2D2Z A;  3FKF A;  3V1W A;  4MLY A;  2H6Z A;  3VK9 A;  1YQ1 A;  1X9S B;  1WP0 A;  2YZU A;  3GUR A;  14GS A;  2O89 A;  4TR1 A;  4POK A;  1F3A A;  3APQ A;  4XRD A;  3ERG A;  2YZH A;  2P31 A;  4HJM A;  3ZIV A;  1XCC A;  4YAP A;  4BA7 A;  5ECH B;  2GLR A;  3FR6 A;  2V6O A;  5D9V A;  2ES7 A;  1GLP A;  4NV5 A;  2YJ7 A;  4IVF A;  4BVY A;  3WT1 A;  1EOG A;  1SJ6 A;  4ISD A;  5ECR B;  2YWI A;  2RUE A;  4MA9 A;  1F2E A;  2DJ0 A;  5H5R A;  2DBC A;  4V1A g;  3KZQ A;  4BWQ A;  1K0D A;  1M99 A;  2VL2 A;  2C0F A;  5G31 A;  3TKS C;  2GQK A;  4P3Y B;  1T3B A;  3M8N A;  3IOS A;  4MF7 A;  2WB9 A;  4PGT A;  3I43 A;  4DSQ A;  3ZZX A;  4PNF A;  5IPH A;  1FW1 A;  2VL9 A;  3A3T A;  2FCH A;  2IFQ B;  4GLT A;  1WPI A;  5CRW A;  3VWW A;  2KP1 A;  4HEA 2;  1FVJ A;  2AV4 A; 
#chains in the Genus database with same CATH topology
 5DJL A;  2DKH A;  2IFQ A;  4TRX A;  1VF4 A;  2IL3 A;  1HNB A;  5FHI A;  2R5G A;  2EFH A;  2VM1 A;  4BPY A;  3QPM A;  1NW2 A;  3LG6 A;  1BAY A;  5CRG A;  4WBJ A;  3UIW A;  3L0H A;  2XC2 A;  3G9B A;  5KEJ A;  3WYW A;  4HZ4 A;  3U5R E;  5E4W A;  1M9B A;  4YKF A;  3KH9 A;  3C1R A;  2VM2 A;  1HD2 A;  2TIR A;  5J4U A;  2OBK A;  5IOX A;  5ECS A;  3APS A;  1J9B A;  3GHA A;  3ZFL A;  1GTB A;  2X49 A;  5KN2 A;  3HYP A;  4FYU A;  1GNW A;  2YOI A;  5KOX A;  5A5K A;  2H6Y A;  4F82 A;  3TKR A;  2A4H A;  4EDZ A;  2HQT A;  1GSS A;  4ZB8 A;  3UVT A;  3A5W A;  2V41 A;  1XFL A;  2HSM B;  1F37 A;  2E2G A;  5L71 A;  4YQM A;  4ZL8 A;  4MH3 A;  4XS1 A;  4HDE A;  1F3B A;  4HQS A;  4JED A;  18GS A;  3O76 A;  2GTU A;  2MZC A;  2HSM A;  4WR4 A;  4GQC A;  1XW5 A;  4KF9 A;  2H1A A;  3ME7 A;  1NHY A;  3TDG A;  2FUG 2;  3VWV A;  3M0F A;  3F4R A;  4EF0 A;  1Q4J A;  1DE1 A;  3NZN A;  1U3A A;  2RII A;  1Z5Y E;  1XVQ A;  1MD3 A;  4XHM A;  2L5L A;  2H0H A;  4GXZ A;  2H0I A;  4IP6 A;  5INY A;  2NBS A;  1QK8 A;  3M9J A;  2V1M A;  2DJ3 A;  2HE3 A;  1E2Y A;  1MTC A;  2GT6 A;  5F05 A;  4O5U A;  4BWS A;  1G7E A;  1M7T A;  2JAD A;  1FHE A;  1A0R P;  4I2T A;  1Z6M A;  2O3E A;  2YN1 A;  3UAP A;  1XG8 A;  1GUH A;  2DLX A;  1ILO A;  11GS A;  2K8S A;  4EUY A;  1M3I A;  5C04 A;  4HU9 A;  2HNL A;  4JRR A;  3IRA A;  4ZBB A;  4J57 E;  2B5E A;  4HUA A;  4TN8 A;  4K9Z A;  2H75 A;  2DJJ A;  2CX4 A;  3GRX A;  4G2E A;  1GUM A;  1HNC A;  2YCD A;  5IO2 A;  1WE0 A;  3H79 A;  2C3Q A;  1U88 A;  3GMF A;  2QC7 A;  5AIS A;  1T7P B;  1V2A A;  4TOP A;  4CDO A;  1AQV A;  2AHE A;  1JFU A;  1GSY A;  4MPF A;  2PWJ A;  1KTE A;  3DML A;  3R2Q A;  3C73 A;  4Q5R A;  3KXO A;  4QMK A;  3DKS A;  3EMP A;  2GZP A;  3TCO A;  1X5C A;  1O81 A;  2GQL A;  1TK0 B;  3DVX A;  1IYH A;  2VL2 C;  1K0O A;  1VF2 A;  2G2Q A;  2TRX A;  5IMV A;  2O8V B;  2NTO A;  2OE1 A;  2IME A;  4K7N A;  2ON7 A;  2X8H A;  4MJB A;  4EO3 A;  5KN0 A;  2FWF A;  1TI3 A;  3I9V 2;  1U3I A;  4Z2T A;  1ERV A;  1Y6E A;  4X0X A;  4GST A;  2DJ2 A;  4AKH A;  2CZ3 A;  1FG4 A;  3LFL A;  4ULX A;  1F9M A;  1GSD A;  2KP2 A;  4XTS A;  1H75 A;  2WRT A;  1OC9 B;  4AI6 A;  4RI6 A;  3TU3 B;  2OA7 A;  2LTK A;  2R0G A;  1UVZ A;  3DYR A;  4FIW A;  1FVK A;  3IV4 A;  6GSS A;  2RM5 A;  3MAK A;  1PSQ A;  4MDC A;  3W6G A;  3QOU A;  5HR0 A;  4GQF A;  4KAE A;  3UOM A;  1XOA A;  1OC9 A;  5JCG A;  2L4Q A;  4F0C A;  2GDR A;  1GRX A;  3QDN A;  5IIZ A;  1X5D A;  4L5O A;  3ZIT A;  4OCF A;  1PFO A;  2ZUP A;  3TB2 A;  3JCM L;  1AUC A;  3F6F A;  2DML A;  1HNA A;  2I4A A;  1GNE A;  2WJU A;  2NVL A;  2R37 A;  1TRW A;  4ZBA A;  3D22 A;  4MP4 A;  2ALB A;  4CY8 A;  2WW0 A;  2FY6 A;  3GKK A;  1V57 A;  4K8M A;  1QMV A;  3H4K A;  3QCP A;  3F8U A;  1C72 A;  4WKW A;  1K0M A;  2XPD A;  3HVV A;  3RPP A;  1SKW B;  1ABA A;  4JU5 A;  1OKT A;  1Z7P A;  2HSN B;  2AUV A;  4DSR A;  3KMO A;  2L6C A;  4MH2 A;  3UVH A;  3FZ9 A;  2FNO A;  2L5O A;  3FR3 A;  4KH7 A;  3HVS A;  4I8B A;  1BYE A;  3ISO A;  1SU9 A;  2O5V A;  3CRU A;  5J47 A;  4ILF A;  1TRS A;  1GTU A;  3DEX A;  2HSN A;  3UL3 A;  1WRY A;  2DJ1 A;  4DSS B;  4MZB A;  1UA5 A;  4O5R A;  1SL1 B;  2B6M A;  2WVX B;  4PUR A;  3ERF A;  3IE3 A;  1VGL A;  5GST A;  5J40 A;  4L5L A;  1DUG A;  2O36 A;  2LRN A;  3KD0 A;  4V2L A;  4AF2 A;  3FY7 A;  2HSH A;  2VD0 A;  3KP8 A;  5CYY A;  3F3Q A;  4IW9 A;  4V1A p;  3ZVJ A;  2LRT A;  3Q74 A;  3O6T A;  3CSI A;  1V9W A;  3TRP A;  2L4C A;  5FT3 A;  4I5Q A;  2EFD A;  2VCX A;  3GA4 A;  1I1I P;  2N5F A;  1XVW A;  4MPG A;  2LUS A;  4KE3 A;  2B7K A;  1R4W A;  1SKS B;  2HRF A;  4OWY A;  4KDX A;  1OAZ A;  4IBP A;  2OAD A;  4K2X A;  1XPV A;  3FEU A;  3M3M A;  4N0Z A;  3C1S A;  3FHK A;  4YQU A;  2P0G A;  3KEB A;  1TDI A;  3ZYW A;  2X8C A;  4TXV A;  4PQH A;  2H70 A;  5EVO A;  2UZ8 A;  2ZCT A;  4IN0 A;  1NSW A;  2PU9 C;  3ED3 A;  4Q5N A;  3LOR A;  1O6J A;  5DQY A;  1S4B P;  2GST A;  4MZW A;  2WW3 A;  2JU5 A;  4ID0 A;  2CV4 A;  3FYG A;  2J9H A;  1WIK A;  2HXK A;  2BJX A;  3GNJ A;  2ZNM A;  2K18 A;  4TR1 B;  3US3 A;  1K0N A;  3KCM A;  1I5G A;  3ME8 A;  2WW1 A;  4LL1 B;  3RDW A;  1TK5 B;  2B1L A;  1AQW A;  2X99 A;  2HRA A;  1AQX A;  1OVN A;  5HR3 A;  2HLS A;  2PVO C;  2OE3 A;  3EE2 A;  1QUW A;  1TRV A;  2B5X A;  5JCU A;  2AYT A;  3L9V A;  1QQ2 A;  4BVY B;  1A8L A;  4O5Q A;  3WD6 A;  4OD7 A;  5J5N A;  3TJF A;  1R26 A;  3D4T A;  3MWH A;  3ZVJ D;  3HA9 A;  5G2Z A;  4I6X A;  4GSS A;  4MAB A;  5H5Q A;  3I69 A;  1K3O A;  2IMI A;  2GQM A;  3FZA A;  1Y1U A;  3TKP A;  1T4Y A;  2EC4 A;  2MMA A;  4EIP A;  4PUA A;  1AC1 A;  3H1N A;  5G5E A;  1TRU A;  1PX6 A;  5EPF A;  1J08 A;  2MMN A;  3IHG A;  1TU7 A;  2WFC A;  3GL3 A;  1YEW C;  2CVK A;  3VI7 A;  2EIQ A;  4KX4 A;  3LXT A;  1YKC A;  2XHF A;  4N11 A;  2V32 A;  5IPG A;  1ZGN A;  5D8I A;  3E0U A;  3NIV A;  2XPE A;  1SD9 A;  1TI1 A;  3D0Z A;  3N5O A;  1GUL A;  3FZ5 A;  1XBS A;  3GL5 A;  3P90 A;  3GX8 A;  4FQU A;  2N5B A;  1ZOF A;  2LV3 A;  2MBT A;  3ZIJ A;  5JWR B;  1OC8 A;  1S3A A;  3VFI A;  3OR5 A;  1YVL A;  3F0I A;  5ECP B;  2H6X A;  1JLW A;  4HJ2 A;  3DD3 A;  1PKZ A;  2CAQ A;  2PVQ A;  2GGT A;  4ZXG A;  3QAW A;  3VI5 A;  2GVP A;  3HZ8 A;  4TW5 A;  1VF1 A;  2QSI A;  3RFR C;  2CVB A;  2CQ9 A;  2C1Y A;  3MYD A;  6GSY A;  5HR2 A;  1TU8 A;  5A4U A;  1ERU A;  3GN3 A;  1WMJ A;  4G10 A;  3LGC A;  4J2F A;  2H19 A;  3EUR A;  2FA4 A;  4MJE A;  20GS A;  2RM6 A;  3CQF A;  3UMA A;  4ZL7 A;  1N2A A;  1WWJ A;  2EIO A;  2OE0 A;  4F9Z A;  4OFN A;  4CHS A;  1GSU A;  1PKW A;  3G7J A;  5IMD A;  2VCT A;  4WF5 A;  2RUF A;  2FD3 A;  3KTB A;  1A23 A;  3BOA A;  3UBL A;  2KOK A;  5IMF A;  2FWG A;  3F4T A;  2X8G A;  4YAV A;  1OYJ A;  2AAW A;  4X43 A;  4KSM A;  3IAM 2;  1DBY A;  1K0C A;  2CT6 A;  1Z3E A;  4DEJ A;  3GUS A;  3HVX A;  3GYK A;  1B8X A;  3TOT A;  2K9F A;  3FMW A;  1SK1 A;  4G0L A;  4PXO A;  3CTF A;  1X0R A;  5ABR A;  2R4V A;  1YZX A;  3FZ4 A;  4Z2R A;  1M9A A;  1ZYN A;  4AKI A;  2LQQ A;  5CNW A;  2E2M A;  3H8Q A;  4AKG A;  3CXG A;  3IXR A;  3IC8 A;  3BBY A;  2TRC P;  4LMV A;  3KIJ A;  2PGT A;  2O87 A;  6GSW A;  2H1D A;  2H01 A;  1AIU A;  1MDI A;  3IHQ A;  1BF5 A;  2IN3 A;  1PN9 A;  3EIN A;  2X4A A;  1XOB A;  4L0W A;  2HI7 A;  1RK4 A;  1BX9 A;  2WUL A;  3P2A A;  4ZIL A;  1XWA A;  2X64 A;  1E6B A;  4AGS A;  4XRA A;  5A4V A;  3ZL5 A;  4MMM A;  3L4N A;  1R5A A;  3GTU A;  1BQ7 A;  1TOF A;  2WCI A;  2CAI A;  3HY2 A;  4IQ1 A;  5IM9 A;  5DDL A;  1LBK A;  2I3Y A;  4N0V A;  4TR3 A;  4F2I A;  1B48 A;  4F03 A;  2B7J A;  4NAX A;  4I97 A;  4X1U A;  1S3R A;  4O92 A;  5B7C A;  4GSN A;  4N30 A;  5IMZ A;  5JWQ B;  1T00 A;  3N9J A;  22GS A;  3DXB A;  3PPU A;  1SJI A;  4ZB7 A;  1EOH A;  1V58 A;  4PQ1 A;  1PL2 A;  2YWM A;  4HQZ A;  4K0N A;  1WJK A;  3GKN A;  4FYB A;  3HKR A;  4WR5 A;  2WGR A;  5J3R A;  3IA1 A;  4PUF C;  3MIX A;  4F0B A;  4WXT A;  2A4V A;  4JZQ A;  4RQR A;  1ZL9 A;  5A4W A;  3CBU A;  4LMW A;  4A5P A;  1XXU A;  3W8J A;  2I1U A;  2I9H A;  5E59 A;  3TOU A;  1ZZY A;  1SK2 A;  4LL4 B;  4G19 A;  3A2W A;  3FRC A;  2M46 A;  1O8W A;  4E68 A;  2H66 A;  3LQ7 A;  3IR4 A;  2A2P A;  19GS A;  1ZMA A;  4TXO B;  3CSH A;  5GZZ B;  2H74 A;  4YKG A;  3R3E A;  3CMI A;  1EWX A;  3GSS A;  1EEM A;  5ELG A;  1LJR A;  1PX7 A;  2XBI A;  3BCI A;  1THX A;  5DCG A;  3S9F A;  2JZS A;  2P5R A;  1SKR B;  2AJQ B;  3WT2 A;  1GSF A;  4TXO A;  5LCZ A;  2H76 A;  1XWB A;  2LKU A;  4PHZ C;  3D6I A;  3J7Y k;  3FW2 A;  2JZR A;  5J4V A;  3UEM A;  5ECQ B;  3KMN A;  3DVW A;  1XZO A;  5AIX A;  3KP9 A;  3QAG A;  3QMX A;  4OFM A;  4Z7X A;  6GST A;  2VAF A;  3U6V A;  4AJ7 A;  5B6M A;  5ECL B;  3DGQ A;  4KA0 A;  2HFD A;  3GKM A;  4KSO A;  4KW6 A;  1K0B A;  1ZYP A;  2C0E A;  3HHV A;  4MNN A;  5BMU B;  1EEJ A;  3EYT A;  3UAR A;  4JR4 A;  3VPT A;  5ENU A;  2V2G A;  4KDY A;  2NDO A;  5J9B A;  5ECM B;  5HFI A;  5BMU A;  6GSV A;  4PX1 A;  1M2B A;  2IJY A;  3HCZ A;  2L59 A;  4EKZ A;  1GP1 A;  4OFT A;  2HZE A;  2GSS A;  2YWN A;  2R6K A;  3BD2 A;  2GS3 A;  2O7K A;  1K0A A;  5B8B A;  2H8L A;  2REM A;  1YDK A;  4PI2 C;  5CO3 A;  1G6W A;  1MD4 A;  2LS5 A;  3HVN A;  2J23 A;  5F8B A;  4G0K A;  4FXY P;  1AXD A;  5F06 A;  2CA8 A;  5IO0 A;  4HZ2 A;  5B8A A;  4GCI A;  3WGE A;  3TGZ A;  4HI7 A;  4EDY A;  5H5S A;  5HQP A;  4TVE A;  4USS A;  3KH7 A;  4NWY A;  1PGT A;  2H1B A;  3GST A;  4OCE A;  1O73 A;  4K5S A;  2M72 A;  1GUK A;  4BVX B;  1GTI A;  4KUN A;  1CQG A;  5C00 A;  4V2M A;  4BL7 B;  1PD2 1;  4Q5Q A;  4K7I A;  2B3S A;  3VLN A;  1TTZ A;  3TKS E;  2GZY A;  5DJM A;  4BVX A;  2F8A A;  1BG1 A;  4BL7 A;  3IPZ A;  5LNK e;  1V98 A;  3M9K A;  5IMC A;  5EY6 A;  4FH8 A;  1TJD A;  2VO4 A;  3VWX A;  2DSA A;  1KNG A;  4K5R A;  4J56 E;  3ZML A;  4G9H A;  1U6T A;  4LLR A;  2C3N A;  2EFC A;  3RPN A;  4TKY A;  3CRT A;  3D5J A;  4GDF A;  2H1L A;  4HSC X;  3EVI A;  3ZRE A;  4IHU A;  3F6D A;  3VPQ A;  5GAP D;  3A5I A;  1FO5 A;  2DMM A;  2O85 A;  3O3T A;  4NXI A;  2VIM A;  4O7H A;  1YEP A;  4NHW A;  3ZTL A;  1X5E A;  3DRN A;  1I9D A;  2B5Y A;  5HR1 A;  5DQS A;  2H73 A;  2OT3 A;  4LA1 A;  2LJR A;  4ZL9 A;  3ZMK A;  4WET A;  4GTU A;  3G7I A;  2YWO A;  16GS A;  2N5A A;  4MF6 A;  3GH9 A;  2PUK C;  5J4Y A;  5DBQ A;  5FWG A;  2IMD A;  2OBI A;  1FAA A;  5AN1 A;  4PNG A;  2YNX A;  4YQV A;  1Z7R A;  3TJG A;  4K2D A;  1EGO A;  4AJ8 A;  13GS A;  1V40 A;  4WEY A;  1BED A;  1GL8 A;  2VCZ A;  3QFA C;  4ML1 A;  1YEX A;  3EC3 A;  2A2R A;  5BRT A;  2ON5 A;  5KN3 A;  2C4J A;  4TR0 A;  2IWT A;  2I81 A;  4O32 A;  5G30 A;  3KM6 A;  1FOH A;  1RQM A;  1FB6 A;  1TW9 A;  3GV1 A;  4OO4 A;  5KOW A;  3HJP A;  1YJ6 A;  4RI7 A;  1GSE A;  4BIK A;  4KND A;  4EE0 A;  1AAZ A;  1NM3 A;  4V2N A;  1JZW A;  2JSY A;  2MMO A;  2PN8 A;  4ZIJ A;  6GSX A;  2HYX A;  4IEL A;  3L9S A;  2KHP A;  1SVL A;  10GS A;  4K7O A;  3Q6O A;  3H93 A;  2WVY A;  4RQX A;  5DCH A;  1UN2 A;  1ERT A;  3QR6 A;  5COH A;  1SD8 A;  3GX0 A;  5G5F A;  1PRX A;  3LYP A;  1GLQ A;  3MSZ A;  3LW9 A;  3GKX A;  5IMA A;  2L6D A;  1ACV A;  1M2D A;  1SYR A;  5CRH A;  5D93 A;  3WGX A;  4NPB A;  2R0P A;  5GAN D;  3CYN A;  3WGD A;  1EZK A;  2FGX A;  2GT5 A;  4IQA A;  3CSJ A;  1G0T A;  1A2M A;  2VCW A;  3TJB A;  3GFK A;  4I2U A;  3DWV A;  1YF1 A;  2LST A;  5ECN B;  3F63 A;  4KDU A;  1USB A;  2MBS A;  1K3Y A;  1SVM A;  4MCU A;  3PR8 A;  5J41 A;  4GF0 A;  1OE8 A;  4MK3 A;  1PL1 A;  4CY6 A;  2CZ2 A;  3APO A;  1ZYQ B;  3IK7 A;  3UBK A;  1H4O A;  1XIY A;  12GS A;  1A24 A;  2XBQ A;  1CQH A;  1N25 A;  1WOU A;  1TXX A;  5JWO B;  1HQO A;  2QA2 A;  3GIX A;  8GSS A;  1QXH A;  4N3Z A;  3CHX C;  1ZCP A;  4POM A;  4RUV A;  3TJJ A;  3F3R A;  2A2S A;  5CP1 A;  3LSZ A;  5AGY A;  1A2J A;  4HOJ A;  3ZLP A;  17GS A;  1PN0 A;  2E7P A;  3LWA A;  2VCQ A;  2YAN A;  4DVC A;  1HYU A;  1TKD B;  1XWK A;  3D4M A;  4WBR D;  1N8J A;  4JE1 A;  4EXJ A;  6GSU A;  1X9W B;  2JZT A;  3KJY A;  2E0Q A;  3NOF A;  5CRD A;  3KGK A;  1ERW A;  2VCV A;  5CAX A;  1URM A;  4ECI A;  3EMX A;  1B4Q A;  1Q98 A;  1SL0 B;  2G0F A;  5KN1 A;  4HS1 A;  1KBN A;  2C80 A;  1MDJ A;  5A34 B;  3TRX A;  4XS6 A;  3E9J B;  3QFB C;  4AJ6 A;  3QAV A;  4ECJ A;  4KCA A;  5IOW A;  1PA3 A;  2DC5 A;  3MDK A;  3KTL A;  2FWH A;  4IJ3 A;  3AY8 A;  4NMU A;  2DIY A;  1W89 A;  2VKZ G;  1THO A;  5D9W A;  2C3T A;  2PBJ A;  2FHE A;  7GSS A;  3GTU B;  5A34 A;  3IAS 2;  3EU3 A;  4XCS A;  5G1K A;  2VLV A;  1GH2 A;  1MDK A;  5ID2 B;  2K6V A;  1T1V A;  4ZB9 A;  2MYG A;  3C7M A;  4ZBD A;  2M80 A;  3IDV A;  5D9T A;  4ECC A;  2PPT A;  3F4S A;  4D73 B;  1A8Y A;  4QQ7 A;  1GSQ A;  5B6N A;  4GRF A;  4IJI A;  2WDU A;  3C71 A;  2WZS A;  3E3E A;  1B9Y C;  5ID2 A;  4IP1 A;  1KEB A;  3PIN A;  2H30 A;  3TRQ A;  2BTO T;  1XWC A;  1G7O A;  4D73 A;  2FLS A;  3EWL A;  1MEK A;  1O85 A;  4AKX B;  4L0U A;  5D96 A;  1JZO A;  2LQO A;  2F3M A;  2KUC A;  1UC7 A;  3GH6 A;  2F8F A;  2YP6 A;  4XS4 B;  1JHB A;  3EPT A;  4N10 A;  2HT9 A;  3UJ1 A;  1O7U A;  2YV7 A;  1LU4 A;  1S3C A;  3HJO A;  3C8E A;  4K1F A;  2F51 A;  2C0G A;  5ECK B;  1OE7 A;  5EL8 A;  1O8X A;  4OO5 A;  4XS4 A;  3HJM A;  3J7Y b;  5IQY A;  2OJL A;  3P8W A;  1GWC A;  1SL2 B;  2AB6 A;  2VLU A;  2OKA A;  3W8S A;  1EP7 A;  3ZRD A;  2FA8 A;  3RHB A;  1EGR A;  1Y25 A;  1T4Z A;  2H72 A;  1W4V A;  1Z6N A;  2LJK A;  3RHC A;  4KCE A;  3PGT A;  1K3L A;  2R2J A;  2VOC A;  4PQI A;  4EVM A;  2WW2 A;  1BJX A;  2VUP A;  4EIQ A;  2IIY A;  1TP9 A;  3IK9 A;  2B1K A;  3IBH A;  2IMF A;  5ELA A;  2WZ9 A;  2IMK A;  2KLX A;  5GSS A;  3LJR A;  4IGJ A;  1X9M B;  2LEG A;  2LJA A;  2JL4 A;  3HZ4 A;  2C0D A;  4L8E A;  2R3X A;  1B4P A;  4K6X A;  1A0F A;  2VD1 A;  2P5Q A;  1YY7 A;  4QL7 A;  1M3J A;  3MNG A;  1R5P A;  3TJK A;  4YH2 A;  1JLV A;  5HFK A;  2WVZ A;  5F07 A;  5LD0 A;  4NV2 A;  3P7X A;  4ACS A;  3FR9 A;  3HD5 A;  2UV8 G;  5ECI B;  2IPA A;  2F9S A;  3IC4 A;  2HZF A;  4KB3 A;  1XWG A;  5ECO B;  3BJ5 A;  1XW6 A;  2HZE B;  4MZC A;  9GSS A;  2H71 A;  2LNS A;  1AW9 A;  2JAC A;  1F6M C;  5CRE A;  3Q19 A;  1B9X C;  3VUR A;  3QD9 A;  1IYI A;  4NHZ A;  4HU7 A;  3A2V A;  4ML6 A;  4GWR A;  1M2A A;  1A2L A;  3EU4 A;  2JSZ A;  1R7H A;  4JBB A;  4POB A;  2GSR A;  5G1L A;  2PMT A;  3L9U A;  2YPM A;  5D9X A;  1DE2 A;  4EC0 A;  2PER A;  4OMV A;  2EFE A;  3FK8 A;  4POL A;  2GSQ A;  3TKS A;  3PH9 A;  2BMX A;  1XW9 A;  1SK0 A;  2FWE A;  2H0G A;  2HRN A;  4CW9 A;  1EV4 A;  1BG5 A;  3SWL A;  1GTA A;  2YV9 A;  2H1G A;  4ECB A;  1EP8 A;  1ST9 A;  4E8H A;  4Z2U A;  3LYK A;  5J9C A;  2C8U A;  1NHO A;  1SJZ A;  4IS0 A;  4E8E A;  1ZYE A;  3K8N A;  4TR4 A;  3ERW A;  1PQN A;  3F9U A;  4ZB6 A;  1JZD A;  3I6A A;  5DVB A;  2QGV A;  5JCW A;  3D21 A;  4K0G A;  1TXU A;  3G7Y A;  3HDC A;  1FB0 A;  5F0G A;  2YJH A;  4G0I A;  1OKD A;  3TKQ A;  4IKH A;  1QFN A;  1ON4 A;  3LXZ A;  3L78 A;  5A1N B;  2WS2 A;  2L57 A;  3RBT A;  4DSS A;  1DSB A;  1SEN A;  3VWU A;  2WVX A;  1G6Y A;  5D73 A;  2K8V A;  2LRC A;  1ML6 A;  1S3D A;  1YKA A;  4QL9 A;  4ICY A;  2MMZ A;  5A1N A;  1OC3 A;  3RGB C;  3DIE A;  5DAL B;  1VRS D;  3LEF A;  4XIH A;  3M1G A;  2VLT A;  1T8E B;  2R0C A;  3Q18 A;  1U87 A;  3CTG A;  4EL1 A;  2RLI A;  3TUE A;  2HSY A;  1FOV A;  1EV9 A;  4PTS A;  3ZFB A;  1TK8 B;  1J0F A;  5DAL A;  1SVO A;  1VF3 A;  3CWG A;  4JR6 A;  4MF5 A;  2V6K A;  2OAC A;  4WF4 A;  2HRK B;  4MJA A;  4H86 A;  2GZZ A;  5DAK B;  2QA1 A;  5HFG A;  4KGI A;  2Z9S A;  4FO5 A;  3SBC A;  1YF0 A;  1JZR A;  2DJK A;  1Z9H A;  3RAZ A;  2QKE A;  1M0U A;  5AIV A;  2DKI A;  2EIR A;  1RW1 A;  2HRK A;  1PMT A;  4Q5F A;  2NPB A;  1QGV A;  2DIZ A;  2CVD A;  5DAK A;  4FYC A;  3A2X A;  1SYX A;  4MJC A;  3BCK A;  2VL3 A;  3HXS A;  2LNT A;  3HMJ G;  2CX3 A;  2D2Z A;  3FKF A;  3V1W A;  4MLY A;  2H6Z A;  3VK9 A;  1YQ1 A;  1X9S B;  1WP0 A;  2YZU A;  3GUR A;  14GS A;  2O89 A;  4TR1 A;  4POK A;  1F3A A;  3APQ A;  4XRD A;  3ERG A;  2YZH A;  2P31 A;  4HJM A;  3ZIV A;  4G01 A;  1XCC A;  4YAP A;  4BA7 A;  4W66 A;  5ECH B;  2GLR A;  3FR6 A;  2V6O A;  5D9V A;  2ES7 A;  1GLP A;  4NV5 A;  2YJ7 A;  4IVF A;  4BVY A;  3WT1 A;  1EOG A;  1SJ6 A;  4ISD A;  5ECR B;  2YWI A;  2RUE A;  4MA9 A;  1F2E A;  2DJ0 A;  5H5R A;  2DBC A;  4V1A g;  3KZQ A;  4BWQ A;  1K0D A;  1M99 A;  2VL2 A;  2C0F A;  5G31 A;  3TKS C;  2GQK A;  4P3Y B;  1T3B A;  5A5H B;  3M8N A;  3IOS A;  4MF7 A;  2WB9 A;  4PGT A;  3I43 A;  4DSQ A;  3ZZX A;  4PNF A;  5IPH A;  1FW1 A;  2VL9 A;  3A3T A;  2FCH A;  2IFQ B;  4GLT A;  1WPI A;  4X4J A;  5A5H A;  5CRW A;  4PI0 C;  3VWW A;  2KP1 A;  4HEA 2;  1FVJ A;  2AV4 A; 
#chains in the Genus database with same CATH homology
 5DJL A;  2DKH A;  2IFQ A;  4TRX A;  1VF4 A;  2IL3 A;  1HNB A;  5FHI A;  2R5G A;  2EFH A;  2VM1 A;  4BPY A;  3QPM A;  1NW2 A;  3LG6 A;  1BAY A;  5CRG A;  4WBJ A;  3UIW A;  3L0H A;  2XC2 A;  3G9B A;  5KEJ A;  3WYW A;  4HZ4 A;  3U5R E;  5E4W A;  1M9B A;  4YKF A;  3KH9 A;  3C1R A;  2VM2 A;  1HD2 A;  2TIR A;  5J4U A;  2OBK A;  5IOX A;  5ECS A;  3APS A;  1J9B A;  3GHA A;  3ZFL A;  1GTB A;  2X49 A;  5KN2 A;  3HYP A;  4FYU A;  1GNW A;  2YOI A;  5KOX A;  5A5K A;  2H6Y A;  4F82 A;  3TKR A;  2A4H A;  4EDZ A;  2HQT A;  1GSS A;  4ZB8 A;  3UVT A;  3A5W A;  2V41 A;  1XFL A;  2HSM B;  1F37 A;  2E2G A;  5L71 A;  4YQM A;  4ZL8 A;  4MH3 A;  4XS1 A;  4HDE A;  1F3B A;  4HQS A;  4JED A;  18GS A;  3O76 A;  2GTU A;  2MZC A;  2HSM A;  4WR4 A;  4GQC A;  1XW5 A;  4KF9 A;  2H1A A;  3ME7 A;  1NHY A;  3TDG A;  2FUG 2;  3VWV A;  3M0F A;  3F4R A;  4EF0 A;  1Q4J A;  1DE1 A;  3NZN A;  1U3A A;  2RII A;  1Z5Y E;  1XVQ A;  1MD3 A;  4XHM A;  2L5L A;  2H0H A;  4GXZ A;  2H0I A;  4IP6 A;  5INY A;  2NBS A;  1QK8 A;  3M9J A;  2V1M A;  2DJ3 A;  2HE3 A;  1E2Y A;  1MTC A;  2GT6 A;  5F05 A;  4O5U A;  4BWS A;  1G7E A;  1M7T A;  2JAD A;  1FHE A;  1A0R P;  4I2T A;  1Z6M A;  2YN1 A;  3UAP A;  1GUH A;  2DLX A;  1ILO A;  11GS A;  2K8S A;  4EUY A;  5C04 A;  4HU9 A;  2HNL A;  4JRR A;  3IRA A;  4ZBB A;  4J57 E;  2B5E A;  4HUA A;  4TN8 A;  4K9Z A;  2H75 A;  2DJJ A;  2CX4 A;  3GRX A;  4G2E A;  1GUM A;  1HNC A;  2YCD A;  5IO2 A;  1WE0 A;  3H79 A;  2C3Q A;  1U88 A;  3GMF A;  2QC7 A;  5AIS A;  1T7P B;  1V2A A;  4TOP A;  4CDO A;  1AQV A;  2AHE A;  1JFU A;  1GSY A;  4MPF A;  2PWJ A;  1KTE A;  3DML A;  3R2Q A;  3C73 A;  4Q5R A;  3KXO A;  4QMK A;  3DKS A;  3EMP A;  2GZP A;  3TCO A;  1X5C A;  1O81 A;  2GQL A;  1TK0 B;  3DVX A;  1IYH A;  2VL2 C;  1K0O A;  1VF2 A;  2G2Q A;  2TRX A;  5IMV A;  2O8V B;  2NTO A;  2OE1 A;  2IME A;  4K7N A;  2ON7 A;  2X8H A;  4MJB A;  4EO3 A;  5KN0 A;  2FWF A;  1TI3 A;  3I9V 2;  1U3I A;  4Z2T A;  1ERV A;  1Y6E A;  4X0X A;  4GST A;  2DJ2 A;  4AKH A;  2CZ3 A;  1FG4 A;  3LFL A;  4ULX A;  1F9M A;  1GSD A;  2KP2 A;  4XTS A;  1H75 A;  2WRT A;  1OC9 B;  4AI6 A;  4RI6 A;  3TU3 B;  2OA7 A;  2LTK A;  2R0G A;  1UVZ A;  3DYR A;  4FIW A;  1FVK A;  3IV4 A;  6GSS A;  2RM5 A;  3MAK A;  1PSQ A;  4MDC A;  3W6G A;  3QOU A;  5HR0 A;  4GQF A;  4KAE A;  3UOM A;  1XOA A;  1OC9 A;  5JCG A;  2L4Q A;  4F0C A;  2GDR A;  1GRX A;  3QDN A;  5IIZ A;  1X5D A;  4L5O A;  3ZIT A;  4OCF A;  2ZUP A;  3TB2 A;  3JCM L;  1AUC A;  3F6F A;  2DML A;  1HNA A;  2I4A A;  1GNE A;  2WJU A;  2NVL A;  2R37 A;  1TRW A;  4ZBA A;  3D22 A;  4MP4 A;  2ALB A;  4CY8 A;  2FY6 A;  3GKK A;  1V57 A;  4K8M A;  1QMV A;  3H4K A;  3QCP A;  3F8U A;  1C72 A;  4WKW A;  1K0M A;  2XPD A;  3HVV A;  3RPP A;  1SKW B;  1ABA A;  4JU5 A;  1OKT A;  1Z7P A;  2HSN B;  2AUV A;  4DSR A;  3KMO A;  2L6C A;  4MH2 A;  3UVH A;  3FZ9 A;  2FNO A;  2L5O A;  3FR3 A;  4KH7 A;  3HVS A;  4I8B A;  1BYE A;  3ISO A;  1SU9 A;  2O5V A;  3CRU A;  5J47 A;  4ILF A;  1TRS A;  1GTU A;  3DEX A;  2HSN A;  3UL3 A;  1WRY A;  2DJ1 A;  4DSS B;  4MZB A;  1UA5 A;  4O5R A;  1SL1 B;  2B6M A;  4PUR A;  3ERF A;  3IE3 A;  1VGL A;  5GST A;  5J40 A;  4L5L A;  1DUG A;  2LRN A;  3KD0 A;  4V2L A;  4AF2 A;  3FY7 A;  2HSH A;  2VD0 A;  3KP8 A;  5CYY A;  3F3Q A;  4IW9 A;  4V1A p;  3ZVJ A;  2LRT A;  3Q74 A;  3O6T A;  3CSI A;  1V9W A;  3TRP A;  2L4C A;  5FT3 A;  4I5Q A;  2EFD A;  2VCX A;  3GA4 A;  2N5F A;  1XVW A;  4MPG A;  2LUS A;  4KE3 A;  2B7K A;  1R4W A;  1SKS B;  2HRF A;  4OWY A;  4KDX A;  1OAZ A;  4IBP A;  2OAD A;  4K2X A;  1XPV A;  3FEU A;  3M3M A;  4N0Z A;  3C1S A;  3FHK A;  4YQU A;  2P0G A;  3KEB A;  1TDI A;  3ZYW A;  2X8C A;  4TXV A;  4PQH A;  2H70 A;  5EVO A;  2UZ8 A;  2ZCT A;  4IN0 A;  1NSW A;  2PU9 C;  3ED3 A;  4Q5N A;  3LOR A;  1O6J A;  5DQY A;  2GST A;  4MZW A;  2JU5 A;  4ID0 A;  2CV4 A;  3FYG A;  2J9H A;  1WIK A;  2HXK A;  2BJX A;  3GNJ A;  2ZNM A;  2K18 A;  4TR1 B;  3US3 A;  1K0N A;  3KCM A;  1I5G A;  3ME8 A;  4LL1 B;  3RDW A;  1TK5 B;  2B1L A;  1AQW A;  2X99 A;  2HRA A;  1AQX A;  1OVN A;  5HR3 A;  2HLS A;  2PVO C;  2OE3 A;  3EE2 A;  1QUW A;  1TRV A;  2B5X A;  5JCU A;  2AYT A;  3L9V A;  1QQ2 A;  4BVY B;  1A8L A;  4O5Q A;  3WD6 A;  4OD7 A;  5J5N A;  3TJF A;  1R26 A;  3D4T A;  3MWH A;  3ZVJ D;  3HA9 A;  5G2Z A;  4I6X A;  4GSS A;  4MAB A;  5H5Q A;  3I69 A;  1K3O A;  2IMI A;  2GQM A;  3FZA A;  1Y1U A;  3TKP A;  1T4Y A;  2EC4 A;  2MMA A;  4EIP A;  4PUA A;  1AC1 A;  3H1N A;  5G5E A;  1TRU A;  1PX6 A;  5EPF A;  1J08 A;  2MMN A;  3IHG A;  1TU7 A;  2WFC A;  3GL3 A;  2CVK A;  3VI7 A;  2EIQ A;  4KX4 A;  3LXT A;  1YKC A;  2XHF A;  4N11 A;  2V32 A;  5IPG A;  1ZGN A;  5D8I A;  3E0U A;  3NIV A;  2XPE A;  1SD9 A;  1TI1 A;  3D0Z A;  3N5O A;  1GUL A;  3FZ5 A;  1XBS A;  3GL5 A;  3P90 A;  3GX8 A;  4FQU A;  2N5B A;  1ZOF A;  2LV3 A;  2MBT A;  3ZIJ A;  5JWR B;  1OC8 A;  1S3A A;  3VFI A;  3OR5 A;  1YVL A;  3F0I A;  5ECP B;  2H6X A;  1JLW A;  4HJ2 A;  3DD3 A;  1PKZ A;  2CAQ A;  2PVQ A;  2GGT A;  4ZXG A;  3QAW A;  3VI5 A;  2GVP A;  3HZ8 A;  4TW5 A;  1VF1 A;  2QSI A;  2CVB A;  2CQ9 A;  2C1Y A;  3MYD A;  6GSY A;  5HR2 A;  1TU8 A;  5A4U A;  1ERU A;  3GN3 A;  1WMJ A;  4G10 A;  3LGC A;  4J2F A;  2H19 A;  3EUR A;  2FA4 A;  4MJE A;  20GS A;  2RM6 A;  3UMA A;  4ZL7 A;  1N2A A;  1WWJ A;  2EIO A;  2OE0 A;  4F9Z A;  4OFN A;  4CHS A;  1GSU A;  1PKW A;  3G7J A;  5IMD A;  2VCT A;  4WF5 A;  2RUF A;  2FD3 A;  3KTB A;  1A23 A;  3BOA A;  3UBL A;  2KOK A;  5IMF A;  2FWG A;  3F4T A;  2X8G A;  4YAV A;  1OYJ A;  2AAW A;  4X43 A;  4KSM A;  3IAM 2;  1DBY A;  1K0C A;  2CT6 A;  1Z3E A;  4DEJ A;  3GUS A;  3HVX A;  3GYK A;  1B8X A;  3TOT A;  2K9F A;  3FMW A;  1SK1 A;  4G0L A;  4PXO A;  3CTF A;  1X0R A;  5ABR A;  2R4V A;  1YZX A;  3FZ4 A;  4Z2R A;  1M9A A;  1ZYN A;  4AKI A;  2LQQ A;  5CNW A;  2E2M A;  3H8Q A;  4AKG A;  3CXG A;  3IXR A;  3IC8 A;  3BBY A;  2TRC P;  4LMV A;  3KIJ A;  2PGT A;  2O87 A;  6GSW A;  2H1D A;  2H01 A;  1AIU A;  1MDI A;  3IHQ A;  1BF5 A;  2IN3 A;  1PN9 A;  3EIN A;  2X4A A;  1XOB A;  4L0W A;  2HI7 A;  1RK4 A;  1BX9 A;  2WUL A;  3P2A A;  4ZIL A;  1XWA A;  2X64 A;  1E6B A;  4AGS A;  4XRA A;  5A4V A;  3ZL5 A;  4MMM A;  3L4N A;  1R5A A;  3GTU A;  1BQ7 A;  1TOF A;  2WCI A;  2CAI A;  3HY2 A;  4IQ1 A;  5IM9 A;  5DDL A;  1LBK A;  2I3Y A;  4N0V A;  4TR3 A;  4F2I A;  1B48 A;  4F03 A;  2B7J A;  4NAX A;  4I97 A;  4X1U A;  4O92 A;  5B7C A;  4GSN A;  4N30 A;  5IMZ A;  5JWQ B;  1T00 A;  3N9J A;  22GS A;  3DXB A;  3PPU A;  1SJI A;  4ZB7 A;  1EOH A;  1V58 A;  4PQ1 A;  1PL2 A;  2YWM A;  4HQZ A;  4K0N A;  1WJK A;  3GKN A;  4FYB A;  3HKR A;  4WR5 A;  2WGR A;  5J3R A;  3IA1 A;  4PUF C;  3MIX A;  4F0B A;  4WXT A;  2A4V A;  4JZQ A;  4RQR A;  1ZL9 A;  5A4W A;  3CBU A;  4LMW A;  4A5P A;  1XXU A;  3W8J A;  2I1U A;  2I9H A;  5E59 A;  3TOU A;  1ZZY A;  1SK2 A;  4LL4 B;  4G19 A;  3A2W A;  3FRC A;  2M46 A;  1O8W A;  4E68 A;  2H66 A;  3LQ7 A;  3IR4 A;  2A2P A;  19GS A;  1ZMA A;  4TXO B;  3CSH A;  5GZZ B;  2H74 A;  4YKG A;  3R3E A;  3CMI A;  1EWX A;  3GSS A;  1EEM A;  5ELG A;  1LJR A;  1PX7 A;  2XBI A;  3BCI A;  1THX A;  5DCG A;  3S9F A;  2JZS A;  2P5R A;  1SKR B;  2AJQ B;  3WT2 A;  1GSF A;  4TXO A;  5LCZ A;  2H76 A;  1XWB A;  2LKU A;  3D6I A;  3J7Y k;  3FW2 A;  2JZR A;  5J4V A;  3UEM A;  5ECQ B;  3KMN A;  3DVW A;  1XZO A;  5AIX A;  3KP9 A;  3QAG A;  3QMX A;  4OFM A;  4Z7X A;  6GST A;  2VAF A;  3U6V A;  4AJ7 A;  5B6M A;  5ECL B;  3DGQ A;  4KA0 A;  2HFD A;  3GKM A;  4KSO A;  4KW6 A;  1K0B A;  1ZYP A;  2C0E A;  3HHV A;  4MNN A;  5BMU B;  1EEJ A;  3EYT A;  3UAR A;  4JR4 A;  3VPT A;  5ENU A;  2V2G A;  4KDY A;  2NDO A;  5J9B A;  5ECM B;  5HFI A;  5BMU A;  6GSV A;  4PX1 A;  1M2B A;  2IJY A;  3HCZ A;  2L59 A;  4EKZ A;  1GP1 A;  4OFT A;  2HZE A;  2GSS A;  2YWN A;  2R6K A;  3BD2 A;  2GS3 A;  2O7K A;  1K0A A;  5B8B A;  2H8L A;  2REM A;  1YDK A;  5CO3 A;  1G6W A;  1MD4 A;  2LS5 A;  2J23 A;  5F8B A;  4G0K A;  1AXD A;  5F06 A;  2CA8 A;  5IO0 A;  4HZ2 A;  5B8A A;  4GCI A;  3WGE A;  3TGZ A;  4HI7 A;  4EDY A;  5H5S A;  5HQP A;  4TVE A;  4USS A;  3KH7 A;  4NWY A;  1PGT A;  2H1B A;  3GST A;  4OCE A;  1O73 A;  4K5S A;  2M72 A;  1GUK A;  4BVX B;  1GTI A;  4KUN A;  1CQG A;  5C00 A;  4V2M A;  4BL7 B;  1PD2 1;  4Q5Q A;  4K7I A;  2B3S A;  3VLN A;  1TTZ A;  3TKS E;  2GZY A;  5DJM A;  4BVX A;  2F8A A;  1BG1 A;  4BL7 A;  3IPZ A;  5LNK e;  1V98 A;  3M9K A;  5IMC A;  5EY6 A;  4FH8 A;  1TJD A;  2VO4 A;  3VWX A;  2DSA A;  1KNG A;  4K5R A;  4J56 E;  3ZML A;  4G9H A;  1U6T A;  4LLR A;  2C3N A;  2EFC A;  3RPN A;  4TKY A;  3CRT A;  3D5J A;  4GDF A;  2H1L A;  3EVI A;  3ZRE A;  4IHU A;  3F6D A;  3VPQ A;  5GAP D;  3A5I A;  1FO5 A;  2DMM A;  2O85 A;  3O3T A;  4NXI A;  2VIM A;  4O7H A;  1YEP A;  4NHW A;  3ZTL A;  1X5E A;  3DRN A;  1I9D A;  2B5Y A;  5HR1 A;  5DQS A;  2H73 A;  2OT3 A;  4LA1 A;  2LJR A;  4ZL9 A;  3ZMK A;  4WET A;  4GTU A;  3G7I A;  2YWO A;  16GS A;  2N5A A;  4MF6 A;  3GH9 A;  2PUK C;  5J4Y A;  5DBQ A;  5FWG A;  2IMD A;  2OBI A;  1FAA A;  5AN1 A;  4PNG A;  2YNX A;  4YQV A;  1Z7R A;  3TJG A;  4K2D A;  1EGO A;  4AJ8 A;  13GS A;  1V40 A;  4WEY A;  1BED A;  1GL8 A;  2VCZ A;  3QFA C;  4ML1 A;  1YEX A;  3EC3 A;  2A2R A;  5BRT A;  2ON5 A;  5KN3 A;  2C4J A;  4TR0 A;  2IWT A;  2I81 A;  4O32 A;  5G30 A;  3KM6 A;  1FOH A;  1RQM A;  1FB6 A;  1TW9 A;  3GV1 A;  4OO4 A;  5KOW A;  3HJP A;  1YJ6 A;  4RI7 A;  1GSE A;  4KND A;  4EE0 A;  1AAZ A;  1NM3 A;  4V2N A;  1JZW A;  2JSY A;  2MMO A;  2PN8 A;  4ZIJ A;  6GSX A;  2HYX A;  4IEL A;  3L9S A;  2KHP A;  1SVL A;  10GS A;  4K7O A;  3Q6O A;  3H93 A;  4RQX A;  5DCH A;  1UN2 A;  1ERT A;  3QR6 A;  5COH A;  1SD8 A;  3GX0 A;  5G5F A;  1PRX A;  3LYP A;  1GLQ A;  3MSZ A;  3LW9 A;  3GKX A;  5IMA A;  2L6D A;  1ACV A;  1M2D A;  1SYR A;  5CRH A;  5D93 A;  3WGX A;  4NPB A;  2R0P A;  5GAN D;  3CYN A;  3WGD A;  1EZK A;  2FGX A;  2GT5 A;  4IQA A;  3CSJ A;  1G0T A;  1A2M A;  2VCW A;  3TJB A;  3GFK A;  4I2U A;  3DWV A;  1YF1 A;  2LST A;  5ECN B;  3F63 A;  4KDU A;  1USB A;  2MBS A;  1K3Y A;  1SVM A;  4MCU A;  3PR8 A;  5J41 A;  4GF0 A;  1OE8 A;  4MK3 A;  1PL1 A;  4CY6 A;  2CZ2 A;  3APO A;  1ZYQ B;  3IK7 A;  3UBK A;  1H4O A;  1XIY A;  12GS A;  1A24 A;  2XBQ A;  1CQH A;  1N25 A;  1WOU A;  1TXX A;  5JWO B;  1HQO A;  2QA2 A;  3GIX A;  8GSS A;  1QXH A;  4N3Z A;  1ZCP A;  4POM A;  4RUV A;  3TJJ A;  3F3R A;  2A2S A;  5CP1 A;  3LSZ A;  5AGY A;  1A2J A;  4HOJ A;  3ZLP A;  17GS A;  1PN0 A;  2E7P A;  3LWA A;  2VCQ A;  2YAN A;  4DVC A;  1HYU A;  1TKD B;  1XWK A;  3D4M A;  4WBR D;  1N8J A;  4JE1 A;  4EXJ A;  6GSU A;  1X9W B;  2JZT A;  3KJY A;  2E0Q A;  3NOF A;  5CRD A;  3KGK A;  1ERW A;  2VCV A;  5CAX A;  1URM A;  4ECI A;  3EMX A;  1B4Q A;  1Q98 A;  1SL0 B;  2G0F A;  5KN1 A;  4HS1 A;  1KBN A;  2C80 A;  1MDJ A;  5A34 B;  3TRX A;  4XS6 A;  3E9J B;  3QFB C;  4AJ6 A;  3QAV A;  4ECJ A;  4KCA A;  5IOW A;  1PA3 A;  2DC5 A;  3MDK A;  3KTL A;  2FWH A;  4IJ3 A;  3AY8 A;  4NMU A;  2DIY A;  1W89 A;  2VKZ G;  1THO A;  5D9W A;  2C3T A;  2PBJ A;  2FHE A;  7GSS A;  3GTU B;  5A34 A;  3IAS 2;  3EU3 A;  4XCS A;  5G1K A;  2VLV A;  1GH2 A;  1MDK A;  5ID2 B;  2K6V A;  1T1V A;  4ZB9 A;  2MYG A;  3C7M A;  4ZBD A;  2M80 A;  3IDV A;  5D9T A;  4ECC A;  2PPT A;  3F4S A;  4D73 B;  1A8Y A;  4QQ7 A;  1GSQ A;  5B6N A;  4GRF A;  4IJI A;  2WDU A;  3C71 A;  3E3E A;  1B9Y C;  5ID2 A;  4IP1 A;  1KEB A;  3PIN A;  2H30 A;  3TRQ A;  2BTO T;  1XWC A;  1G7O A;  4D73 A;  2FLS A;  3EWL A;  1MEK A;  1O85 A;  4AKX B;  4L0U A;  5D96 A;  1JZO A;  2LQO A;  2F3M A;  2KUC A;  1UC7 A;  3GH6 A;  2F8F A;  2YP6 A;  4XS4 B;  1JHB A;  3EPT A;  4N10 A;  2HT9 A;  3UJ1 A;  1O7U A;  2YV7 A;  1LU4 A;  1S3C A;  3HJO A;  3C8E A;  4K1F A;  2F51 A;  2C0G A;  5ECK B;  1OE7 A;  5EL8 A;  1O8X A;  4OO5 A;  4XS4 A;  3HJM A;  3J7Y b;  5IQY A;  2OJL A;  3P8W A;  1GWC A;  1SL2 B;  2AB6 A;  2VLU A;  2OKA A;  3W8S A;  1EP7 A;  3ZRD A;  2FA8 A;  3RHB A;  1EGR A;  1Y25 A;  1T4Z A;  2H72 A;  1W4V A;  1Z6N A;  2LJK A;  3RHC A;  4KCE A;  3PGT A;  1K3L A;  2R2J A;  2VOC A;  4PQI A;  4EVM A;  1BJX A;  2VUP A;  4EIQ A;  2IIY A;  1TP9 A;  3IK9 A;  2B1K A;  3IBH A;  2IMF A;  5ELA A;  2WZ9 A;  2IMK A;  2KLX A;  5GSS A;  3LJR A;  4IGJ A;  1X9M B;  2LEG A;  2LJA A;  2JL4 A;  3HZ4 A;  2C0D A;  4L8E A;  2R3X A;  1B4P A;  4K6X A;  1A0F A;  2VD1 A;  2P5Q A;  1YY7 A;  4QL7 A;  3MNG A;  1R5P A;  3TJK A;  4YH2 A;  1JLV A;  5HFK A;  5F07 A;  5LD0 A;  4NV2 A;  3P7X A;  4ACS A;  3FR9 A;  3HD5 A;  2UV8 G;  5ECI B;  2IPA A;  2F9S A;  3IC4 A;  2HZF A;  4KB3 A;  1XWG A;  5ECO B;  3BJ5 A;  1XW6 A;  2HZE B;  4MZC A;  9GSS A;  2H71 A;  2LNS A;  1AW9 A;  2JAC A;  1F6M C;  5CRE A;  3Q19 A;  1B9X C;  3VUR A;  3QD9 A;  1IYI A;  4NHZ A;  4HU7 A;  3A2V A;  4ML6 A;  4GWR A;  1M2A A;  1A2L A;  3EU4 A;  2JSZ A;  1R7H A;  4JBB A;  4POB A;  2GSR A;  5G1L A;  2PMT A;  3L9U A;  2YPM A;  5D9X A;  1DE2 A;  4EC0 A;  2PER A;  4OMV A;  2EFE A;  3FK8 A;  4POL A;  2GSQ A;  3TKS A;  3PH9 A;  2BMX A;  1XW9 A;  1SK0 A;  2FWE A;  2H0G A;  2HRN A;  4CW9 A;  1EV4 A;  1BG5 A;  3SWL A;  1GTA A;  2YV9 A;  2H1G A;  4ECB A;  1EP8 A;  1ST9 A;  4E8H A;  4Z2U A;  3LYK A;  5J9C A;  2C8U A;  1NHO A;  1SJZ A;  4IS0 A;  4E8E A;  1ZYE A;  3K8N A;  4TR4 A;  3ERW A;  1PQN A;  3F9U A;  4ZB6 A;  1JZD A;  3I6A A;  5DVB A;  2QGV A;  5JCW A;  3D21 A;  4K0G A;  1TXU A;  3G7Y A;  3HDC A;  1FB0 A;  5F0G A;  2YJH A;  4G0I A;  1OKD A;  3TKQ A;  4IKH A;  1QFN A;  1ON4 A;  3LXZ A;  3L78 A;  5A1N B;  2WS2 A;  2L57 A;  3RBT A;  4DSS A;  1DSB A;  1SEN A;  3VWU A;  1G6Y A;  5D73 A;  2K8V A;  2LRC A;  1ML6 A;  1S3D A;  1YKA A;  4QL9 A;  4ICY A;  2MMZ A;  5A1N A;  1OC3 A;  3DIE A;  5DAL B;  3LEF A;  1VRS D;  4XIH A;  3M1G A;  2VLT A;  1T8E B;  2R0C A;  3Q18 A;  1U87 A;  3CTG A;  4EL1 A;  2RLI A;  3TUE A;  2HSY A;  1FOV A;  1EV9 A;  4PTS A;  3ZFB A;  1TK8 B;  1J0F A;  5DAL A;  1SVO A;  1VF3 A;  3CWG A;  4JR6 A;  4MF5 A;  2V6K A;  2OAC A;  4WF4 A;  2HRK B;  4MJA A;  4H86 A;  2GZZ A;  5DAK B;  2QA1 A;  5HFG A;  4KGI A;  2Z9S A;  4FO5 A;  3SBC A;  1YF0 A;  1JZR A;  2DJK A;  1Z9H A;  3RAZ A;  2QKE A;  1M0U A;  5AIV A;  2DKI A;  2EIR A;  1RW1 A;  2HRK A;  1PMT A;  4Q5F A;  2NPB A;  1QGV A;  2DIZ A;  2CVD A;  5DAK A;  4FYC A;  3A2X A;  1SYX A;  4MJC A;  3BCK A;  2VL3 A;  3HXS A;  2LNT A;  3HMJ G;  2CX3 A;  2D2Z A;  3FKF A;  3V1W A;  4MLY A;  2H6Z A;  3VK9 A;  1YQ1 A;  1X9S B;  1WP0 A;  2YZU A;  3GUR A;  14GS A;  2O89 A;  4TR1 A;  4POK A;  1F3A A;  3APQ A;  4XRD A;  3ERG A;  2YZH A;  2P31 A;  4HJM A;  3ZIV A;  4G01 A;  1XCC A;  4YAP A;  4BA7 A;  4W66 A;  5ECH B;  2GLR A;  3FR6 A;  2V6O A;  5D9V A;  2ES7 A;  1GLP A;  4NV5 A;  2YJ7 A;  4IVF A;  4BVY A;  3WT1 A;  1EOG A;  1SJ6 A;  4ISD A;  5ECR B;  2YWI A;  2RUE A;  4MA9 A;  1F2E A;  2DJ0 A;  5H5R A;  2DBC A;  4V1A g;  3KZQ A;  4BWQ A;  1K0D A;  1M99 A;  2VL2 A;  2C0F A;  5G31 A;  3TKS C;  2GQK A;  4P3Y B;  1T3B A;  5A5H B;  3M8N A;  3IOS A;  4MF7 A;  2WB9 A;  4PGT A;  3I43 A;  4DSQ A;  3ZZX A;  4PNF A;  5IPH A;  1FW1 A;  2VL9 A;  3A3T A;  2FCH A;  2IFQ B;  4GLT A;  1WPI A;  4X4J A;  5A5H A;  5CRW A;  3VWW A;  2KP1 A;  4HEA 2;  1FVJ A;  2AV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...