6GSYA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGFWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsyA01
1XPVA 2HXKA 2O85A 3N5OA 2V6KA 3UARA 3WGEA 2HRFA 1SL1B 3ME8A 5ELGA 20GSA 3LSZA 4ZB9A 2MMAA 4Z7XA 2JZTA 2KP2A 2A2RA 4I6XA 2LRNA 1OAZA 4V1Ap 2GSTA 4RUVA 1OE7A 3PGTA 4JR4A 4MDCA 2EIRA 2FA4A 1V57A 4V2NA 3V1WA 4K2DA 3GTUB 5D93A 3A5WA 3DVWA 3O6TA 4RQXA 2DBCA 2YOIA 5KN1A 5F07A 1BX9A 3KZQA 2HZEB 5D9VA 1A8YA 5KN3A 2LRCA 3H1NA 6GSUA 3GURA 2DSAA 4IBPA 3L9SA 1JLVA 2EC4A 4OWYA 4EKZA 2CVDA 4WBJA 2GQLA 4KDUA 4IP1A 2H1GA 2GS3A 3EE2A 1BYEA 4O32A 4HEA2 4KF9A 3DRNA 4IVFA 1BEDA 5FHIA 2V6OA 4O92A 4BA7A 2VL2A 4J57E 3DVXA 6GSYA 1YF1A 1M9BA 2H6ZA 2ALBA 3PPUA 3H8QA 4K8MA 2IMKA 5J5NA 5ECIB 3M8NA 4TRXA 5ID2B 1EWXA 2WULA 1FB0A 1O81A 2KLXA 2X99A 4FYBA 3KMNA 3ZZXA 1ZCPA 5B8AA 1SJZA 2HRKA 3EINA 4ZXGA 4KE3A 4TOPA 3RDWA 3KEBA 1EV4A 5A5KA 2GGTA 2C0EA 2HSMB 1A2LA 1QMVA 5L71A 2I3YA 1TRVA 2VL2C 4P3YB 2HSYA 5J9BA 4L5OA 1Z6MA 1K0MA 1YJ6A 3IAS2 2FHEA 3NOFA 3KH9A 2YZUA 3BJ5A 4K0GA 4ECJA 1E2YA 4CW9A 4ZL7A 1QQ2A 2GSSA 1TRUA 5DDLA 1MDKA 3GX0A 5G1LA 3HJPA 2MMOA 4KX4A 5AN1A 2HLSA 3K8NA 3UMAA 3GHAA 4MABA 4HZ2A 3D5JA 4I97A 3F6FA 4Q5RA 4JRRA 3BOAA 1S3CA 1T4YA 1GTIA 1J0FA 5CRHA 5ECMB 1EP7A 2GZPA 1K0BA 3Q19A 1GSQA 2AHEA 1JHBA 3I9V2 3VI7A 2OACA 2IN3A 2XC2A 4E8EA 1MDIA 4HJ2A 1M9AA 3W8SA 3LFLA 2JADA 2GQKA 5CNWA 3HVVA 1EP8A 2IMFA 4TR1A 3GFKA 4IW9A 1BG5A 4DSRA 5F05A 2DMMA 4XRDA 4TKYA 1X0RA 5IMZA 1K3YA 4JEDA 2ES7A 2L5LA 1YDKA 2P5QA 5D9TA 2ZNMA 1F3AA 3FR9A 1SL2B 4IQAA 1OYJA 2MMNA 2B7JA 3DYRA 4K9ZA 3GL3A 1VF1A 4AGSA 3GX8A 3FRCA 1QFNA 4EXJA 5GSSA 4EO3A 1HNBA 2K6VA 2DJ3A 4GRFA 3FZ4A 4WR4A 3LJRA 5IMVA 5INYA 1V98A 1TJDA 3KP8A 3KP9A 1W89A 4ZB8A 5E59A 4KUNA 3ZITA 3IA1A 1LU4A 1JZDA 2YN1A 1TW9A 5HR0A 2A2SA 2F8FA 5DALA 2TIRA 5IO0A 2XHFA 3KH7A 4IJ3A 3O3TA 1A0RP 5DQYA 2YNXA 3ZLPA 1ST9A 4DEJA 1SYXA 2DIZA 3OR5A 1C72A 3GKMA 1U6TA 3IK9A 4EE0A 5D73A 2R37A 5AIXA 5ECQB 1B8XA 2LUSA 5ECRB 4AF2A 4D73B 4PXOA 5IMCA 5J41A 1J9BA 1IYHA 3GH9A 2L57A 3D0ZA 1SYRA 1WPIA 3A2WA 2C3QA 1WOUA 1A2JA 4DSQA 1S3AA 2GLRA 2C0GA 2YJHA 1IYIA 2LQOA 1XW6A 3WT1A 4ZBAA 3FR3A 2O89A 2J9HA 2NPBA 1SJ6A 4X43A 3LYKA 5ECKB 2C0FA 4LL1B 1HNAA 4L0WA 2D2ZA 4Q5FA 1DSBA 4TR0A 1TK8B 4LLRA 3IK7A 5ELAA 3ZFBA 2OBIA 2FD3A 4FYCA 1QK8A 1GSSA 2WFCA 4AJ7A 4HUAA 1VF2A 4EC0A 2IMDA 1USBA 5F06A 1K0OA 4MPFA 2P5RA 1U87A 3EU3A 2C1YA 2XPDA 2NDOA 2M46A 1OC9A 1TU7A 2XPEA 2YZHA 1TTZA 2YV7A 1ABAA 3QFAC 4HS1A 4PNFA 2VO4A 1AQWA 2JZRA 3H93A 5A4VA 1YKCA 4XTSA 2M72A 1TK0B 5DQSA 2V1MA 3GL5A 4OFNA 1Z7PA 3QAGA 4IHUA 3FK8A 2PWJA 2EIOA 2GZYA 2OJLA 3UEMA 4BVYA 1SK0A 3TCOA 4MA9A 2H1AA 1G6WA 1JLWA 3ZIVA 2P31A 3CSIA 5D8IA 2HI7A 2VCQA 1OVNA 3CXGA 3FZ9A 2I9HA 4HQSA 3UVTA 3QD9A 4RI7A 1EV9A 3U6VA 2GSRA 3TKQA 1AW9A 2KOKA 2IWTA 1GTBA 5DJMA 3IE3A 2I1UA 1YQ1A 1HNCA 13GSA 4RI6A 2BMXA 4FH8A 2JACA 3EWLA 1WIKA 1NHYA 2DJ1A 4TW5A 3UIWA 2MBSA 1JZOA 2FUG2 2LNSA 1XCCA 2CX4A 5KEJA 2V32A 2LEGA 2RUEA 5IOWA 4KH7A 3QAWA 4WXTA 2F51A 2CT6A 2AB6A 2R4VA 4HJMA 2CV4A 4X0XA 1HQOA 2FY6A 4NV2A 3H4KA 3A2XA 3QOUA 1DE1A 2ON7A 1GSDA 3FYGA 2J23A 2I81A 1JFUA 1ZGNA 1TRWA 1GTAA 1XOAA 1VRSD 4KNDA 4AJ6A 4K1FA 5IM9A 5D9XA 4ECIA 1XWKA 4USSA 1A8LA 1O73A 5ECOB 3PINA 2X8HA 5EL8A 4TXOB 1WWJA 3D4TA 2PMTA 1R5AA 3UBKA 2DJJA 2R2JA 2ON5A 3DKSA 1XW5A 1FHEA 1AIUA 4HOJA 1EOGA 3GRXA 2JZSA 2P0GA 2REMA 4I2TA 3LQ7A 2K8SA 3FR6A 3CSJA 1NM3A 5B6NA 1QXHA 3HVSA 2PUKC 3L4NA 1QUWA 7GSSA 1K0AA 3DMLA 4CDOA 4OFMA 2CZ2A 4PQIA 3HJOA 1PSQA 4GLTA 3WGXA 2RM6A 1XWGA 3F3QA 4KB3A 1Y25A 3EYTA 3CBUA 4HU9A 2VCZA 1X5CA 4EDZA 3NZNA 2H66A 1B48A 1BQ7A 1XOBA 3P2AA 2ZUPA 3FW2A 3FEUA 3PR8A 3G7JA 1DBYA 2E2GA 4BL7B 5ECNB 5J4UA 4ML6A 2PVQA 1Q4JA 2OKAA 2H74A 2YJ7A 4YH2A 2AUVA 1UVZA 5HR3A 4FO5A 1WE0A 3ISOA 4MJCA 4F82A 2DJ2A 2JSZA 3UJ1A 3GSTA 4ZL8A 4BPYA 2OE0A 4YQUA 1KEBA 2HQTA 4ID0A 4I8BA 3JCML 4WF5A 2X8GA 4XS4A 1SJIA 1EEMA 1Y6EA 1TP9A 3IDVA 1PL2A 3VWVA 5B7CA 4ZILA 2TRXA 3I69A 1PRXA 2FWGA 3GSSA 4WEYA 3FKFA 1RK4A 4WR5A 5IPHA 5B6MA 4XIHA 3F0IA 1J08A 4PQHA 4J2FA 4KSMA 1MD3A 4MH2A 1T3BA 3ZVJA 2ZCTA 4RQRA 4EF0A 4PUFC 1URMA 1NHOA 3UOMA 1A23A 4ZB6A 2DMLA 2IPAA 2PGTA 3APOA 2V41A 3HVXA 5HR1A 3TKSA 2K9FA 2YV9A 3PH9A 1ILOA 3VPTA 5EPFA 3ZRDA 1FAAA 1I5GA 4IS0A 4YAPA 2VCWA 2CZ3A 1RQMA 1XWBA 5HQPA 1GSYA 2C80A 1YZXA 3HA9A 3FZ5A 1OC8A 4EUYA 5B8BA 2HRAA 2YP6A 3S9FA 3GIXA 3ED3A 3LWAA 3HKRA 2VCVA 4PUAA 3CMIA 4GWRA 3UBLA 1EGRA 19GSA 1JZRA 2VOCA 5DAKA 1KTEA 4OMVA 2DJ0A 5CP1A 3GTUA 3L9UA 3O76A 2N5BA 3VWWA 3DD3A 1VF3A 5J9CA 3DGQA 3W8JA 2N5FA 3QCPA 4MF6A 3C71A 1SU9A 2RIIA 1XFLA 5G5EA 1ZMAA 5H5SA 2UZ8A 4IGJA 3GYKA 4GTUA 4FIWA 2H6YA 3DIEA 1T4ZA 4IJIA 2L6CA 3SBCA 3IBHA 4ISDA 2PN8A 3VPQA 5D9WA 2BJXA 4KCEA 1M99A 1N8JA 3ME7A 2IFQB 3MWHA 2H75A 1FG4A 1ZYQB 4E8HA 4EVMA 1AXDA 4QL7A 1PQNA 4XS1A 2WRTA 4K6XA 1GUHA 1TRSA 1FO5A 22GSA 1PGTA 2F3MA 4LA1A 4GSNA 4FQUA 3R2QA 5JCUA 2X64A 1T8EB 3ZIJA 5ECHB 2QSIA 3ZMKA 1SK1A 1FVJA 4JE1A 5CRWA 5GZZB 1W4VA 2VM2A 5JWRB 5ID2A 2NVLA 2E2MA 2L59A 3D6IA 4JZQA 2NTOA 2KP1A 2AAWA 5IMFA 3P8WA 2GT6A 1XBSA 1M2DA 1F37A 1LJRA 3LEFA 1B4QA 4KGIA 2QC7A 4ZL9A 2HZFA 3I43A 2PPTA 5JCWA 3F6DA 1AAZA 4WF4A 4JR6A 4G0LA 2A4VA 2L4CA 1CQGA 6GSSA 3H79A 5DBQA 4NHZA 5JWQB 4MJEA 4AJ8A 5KN0A 4BVXA 1XZOA 1GUKA 3LYPA 4ECBA 2RM5A 4MCUA 1KBNA 4TN8A 4CHSA 1YY7A 2VCTA 1XVQA 1GNEA 1GLQA 5FT3A 2LV3A 3RBTA 5A4WA 4K7OA 5GAPD 1K0CA 1OC3A 9GSSA 5DCHA 16GSA 3LXZA 3CYNA 1TK5B 1T7PB 1WJKA 1ML6A 8GSSA 4IQ1A 1Z3EA 4TR4A 3MNGA 2XBIA 4I2UA 5CREA 3WD6A 2FWHA 1NSWA 1GH2A 1SENA 2CAIA 2CA8A 2HYXA 3M0FA 3VLNA 1M2AA 1BJXA 1VF4A 3BCIA 1MD4A 1S3DA 1ERWA 2PVOC 3MAKA 1KNGA 1YKAA 2O8VB 3IR4A 2WZ9A 3QAVA 3TJGA 1YEXA 1PKWA 1Z6NA 10GSA 2MMZA 3GN3A 3GV1A 3DWVA 2JSYA 5EY6A 3QMXA 3QPMA 3TRXA 3BCKA 1PMTA 3P7XA 2LNTA 3IAM2 1Z7RA 4G10A 3C73A 1GLPA 4ZBDA 4XHMA 3MDKA 1THOA 4WETA 3FY7A 4J56E 1M0UA 2K18A 1THXA 4K0NA 3IRAA 1FVKA 5C00A 2L5OA 3ZYWA 3E0UA 4EDYA 4F2IA 4DSSA 4ACSA 3IPZA 3EMXA 2B7KA 4ILFA 1F6MC 4GQCA 1ERTA 3NIVA 1T00A 3KCMA 1SKRB 3D21A 3M1GA 1SKWB 4XRAA 1ERVA 4GQFA 4XS4B 4HZ4A 2OE1A 2QGVA 3KTLA 3IV4A 3UAPA 5IMDA 3L9VA 3P90A 1AQXA 1FOVA 4POBA 12GSA 4N0VA 1T1VA 2R3XA 2C8UA 1TU8A 5AISA 5IIZA 3G9BA 5E4WA 4I5QA 2HRKB 3KTBA 3TOTA 2IIYA 4HI7A 2LJAA 1H4OA 3VFIA 2JL4A 4D73A 3Q18A 3LG6A 1F3BA 4N10A 1SD9A 4IP6A 1XW9A 3TRQA 1E6BA 2H76A 2WDUA 4WBRD 5F8BA 3D22A 3LXTA 2AV4A 4NXIA 11GSA 1TI1A 4KW6A 3GKKA 1EEJA 3HYPA 3D4MA 4DVCA 4G0KA 3U5RE 1X5DA 1O7UA 6GSVA 1PL1A 18GSA 4POMA 2WS2A 2WB9A 2QKEA 5IMAA 1OKDA 4MLYA 1PX6A 3M3MA 5H5RA 1FB6A 3C1SA 2H0HA 3F4RA 1TKDB 5H5QA 4MJAA 4NAXA 1O85A 2Z9SA 3WGDA 1R7HA 1LBKA 4PTSA 2G0FA 2VAFA 5DAKB 1PA3A 1HYUA 4PX1A 3GH6A 4GF0A 2PBJA 4MH3A 3CTGA 1Z5YE 2B6MA 1R4WA 1GSEA 1MEKA 2C3TA 4BWQA 2C3NA 2IL3A 4TR1B 4YAVA 3R3EA 3DEXA 4NPBA 1ZYEA 2OA7A 2HT9A 2GQMA 2YPMA 1R26A 1I9DA 1GWCA 2YANA 5IPGA 4OCEA 1V9WA 1VGLA 2HFDA 5G31A 2B5EA 4MZBA 2H19A 2OADA 3KJYA 4F9ZA 1AUCA 5CAXA 4QL9A 5ECPB 1F2EA 1H75A 3J7Yk 3ERFA 3C8EA 2KUCA 3F4SA 3ZMLA 2LJKA 6GSXA 1K3OA 2VL9A 1M7TA 1V58A 1K0DA 2CVBA 4POLA 4ML1A 3SWLA 2WGRA 2N5AA 4OO5A 3ZVJD 3A3TA 3GKXA 1TDIA 2H8LA 5GSTA 2WCIA 2FA8A 3F3RA 1SD8A 1M2BA 1EGOA 3ERWA 4X1UA 5DCGA 1OE8A 2GVPA 3GNJA 3HHVA 3KIJA 2GDRA 3TB2A 1G7OA 4KDXA 4KA0A 5DALB 1YF0A 5CO3A 4O5RA 4TR3A 2CVKA 2YCDA 1A0FA 2K8VA 4KSOA 3DXBA 4MK3A 3RHBA 5AGYA 2WJUA 5ECSA 5G2ZA 5HFKA 3TJFA 4MZCA 4MJBA 5HR2A 1R5PA 2B5YA 3W6GA 1F9MA 2V2GA 4PQ1A 3Q74A 1G6YA 2LJRA 1O8XA 4LMWA 2H01A 4WKWA 3ERGA 1ZOFA 3GA4A 14GSA 5IO2A 1QGVA 1RW1A 2YWIA 2E7PA 4TXOA 2TRCP 2I4AA 3GKNA 1TXXA 4BVXB 3LORA 4NWYA 2L6DA 4IKHA 4FYUA 4ZIJA 3TKSE 2CQ9A 2FWFA 2OBKA 4L5LA 1Q98A 3QR6A 1G7EA 2IMEA 2GSQA 4MF5A 2AYTA 2VD1A 2KHPA 4LL4B 4NMUA 4F0CA 2F9SA 1G0TA 5CRDA 2R5GA 3E3EA 1K3LA 3ZREA 4POKA 1UN2A 3HCZA 5FWGA 1SKSB 4GSSA 3IXRA 2C4JA 2H71A 3QDNA 4GXZA 3TKSC 1N2AA 5G30A 3RPPA 1TOFA 4HQZA 3L78A 3HY2A 2HZEA 2MYGA 3TKRA 2E0QA 4EL1A 5AIVA 4GSTA 2YWOA 3C1RA 3ZTLA 1TI3A 1X9SB 1GULA 2H30A 5CRGA 5COHA 1V2AA 4PGTA 4PNGA 3VWUA 2HSHA 2L4QA 1OC9B 4KAEA 3FZAA 1WRYA 3BBYA 3QFBC 2H73A 4MP4A 4N11A 1PD21 2H0IA 4ULXA 3M9KA 3I6AA 4GCIA 2MBTA 2C0DA 4BL7A 3TJBA 3HXSA 4XCSA 1GSUA 2HRNA 2OE3A 4NV5A 3J7Yb 3HD5A 5DVBA 4BVYB 2FWEA 5IOXA 2DLXA 4G9HA 1OKTA 3E9JB 3ZL5A 5A4UA 5LD0A 4BWSA 4H86A 1FW1A 5HFIA 2VLTA 2DIYA 2X8CA 1ERUA 3TRPA 1X9MB 4HU7A 2FLSA 1V40A 1DUGA 3BD2A 2DC5A 1U3AA 3ZFLA 4K7IA 3A2VA 3TKPA 4F03A 17GSA 4DSSB 4ECCA 3EC3A 3TJKA 3EVIA 3APSA 4JBBA 2GT5A 4MF7A 1WP0A 4HDEA 1WMJA 3LGCA 2O87A 4V2MA 4YQVA 2M80A 3TUEA 3VWXA 5ENUA 2O7KA 5JCGA 1CQHA 5HFGA 4LMVA 3MSZA 1HD2A 3AY8A 2HSMA 1ZZYA 1EOHA 1YEPA 4KCAA 5LNKe 1A24A 3IHQA 4MZWA 4Q5NA 1NW2A 1GRXA 2HNLA 4L0UA 2VCXA 5KN2A 3VK9A 4L8EA 1PX7A 2RUFA 3KM6A 2B3SA 5CYYA 3TGZA 3TDGA 4IELA 2R6KA 1GUMA 4G19A 2CX3A 5J3RA 3WT2A 2NBSA 1JZWA 1B4PA 3F8UA 1GP1A 2YWMA 6GSTA 1MTCA 3HDCA 3Q6OA 5JWOB 2FNOA 2LQQA 4N30A 1PN9A 3F9UA 2G2QA 1XVWA 3EURA 2BTOT 1DE2A 4XS6A 4OD7A 4Q5QA 4MPGA 3F4TA 1PKZA 4PURA 4F0BA 4YQMA 3C7MA 2VLUA 2AJQB 3M9JA 2YWNA 4G0IA 1SL0B 1GSFA 3US3A 4G2EA 3RHCA 2LRTA 2CAQA 2LTKA 3G7YA 2H1DA 1UC7A 2B5XA 3CRTA 1A2MA 4MMMA 1ZL9A 2HE3A 2GZZA 5F0GA 3HZ4A 3N9JA 5ECLB 2B1KA 3FHKA 3KMOA 2PU9C 3VI5A 5G1KA 4OFTA 1B9YC 3GUSA 3CRUA 4TXVA 1AC1A 1XWCA 2H6XA 3TOUA 1GTUA 2IFQA 2RLIA 3CSHA 1B9XC 3KXOA 4IN0A 2GTUA 3VURA 1K0NA 3IC8A 2H0GA 2VUPA 4V1Ag 2H70A 2VM1A 5GAND 2PERA 2FCHA 1U3IA 4V2LA 4O7HA 2XBQA 2IMIA 2LSTA 1SK2A 3L0HA 1MDJA 2HSNB 2VD0A 3KGKA 4ZBBA 5C04A 2DJKA 2FGXA 4N0ZA 3UVHA 2MZCA 4OO4A 1U88A 2VIMA 3APQA 4NHWA 1GNWA 5D96A 3EU4A 5LCZA 3GMFA 2H1BA 2VLVA 1O6JA 3TJJA 1AQVA 2IJYA 5DJLA 3IC4A 1ON4A 1UA5A 2LKUA 3HZ8A 3G7IA 4TVEA 1O8WA 1Z9HA 1ACVA 1EZKA 3IOSA 1GL8A 2JU5A 4OCFA 3UL3A 4K7NA 1X5EA 1XXUA 3RPNA 5G5FA 2F8AA 3CTFA 5EVOA 2LS5A 2H72A 2VL3A 5ABRA 4KDYA 4JU5A 5BMUA 3F63A 4QQ7A 1XWAA 3KD0A 5IQYA 1XIYA 3RAZA 2B1LA 3EMPA 1X9WB 3WYWA 1BAYA 2EIQA 3HJMA 6GSWA
chains in the Genus database with same CATH superfamily
1XPVA 2HXKA 5A1NA 2O85A 3N5OA 2V6KA 3UARA 3WGEA 2HRFA 1SL1B 3ME8A 5ELGA 20GSA 2WVXB 3LSZA 4ZB9A 2MMAA 4Z7XA 2JZTA 2KP2A 2A2RA 4I6XA 2LRNA 1OAZA 4V1Ap 2GSTA 4RUVA 1OE7A 3PGTA 4JR4A 4MDCA 2EIRA 2FA4A 1V57A 2EFEA 4V2NA 3V1WA 4K2DA 3GTUB 5D93A 3A5WA 3DVWA 3O6TA 4RQXA 2DBCA 2YOIA 5KN1A 5F07A 1BX9A 4K5SA 3KZQA 2HZEB 5D9VA 1A8YA 5KN3A 2LRCA 3H1NA 6GSUA 3GURA 2DSAA 4IBPA 3L9SA 1JLVA 2EC4A 4OWYA 4EKZA 2CVDA 4WBJA 2GQLA 4KDUA 4IP1A 2H1GA 2GS3A 3EE2A 1BYEA 4O32A 4HEA2 4KF9A 3DRNA 4IVFA 1BEDA 5FHIA 2V6OA 4O92A 4BA7A 2VL2A 4J57E 3DVXA 6GSYA 1YF1A 1M9BA 2H6ZA 2ALBA 3PPUA 2DKHA 3H8QA 5A34B 4K8MA 2IMKA 5J5NA 5ECIB 3M8NA 4E68A 4TRXA 5ID2B 1ZYNA 1EWXA 2WULA 1FB0A 1O81A 2KLXA 2X99A 4FYBA 3KMNA 3ZZXA 1ZCPA 5B8AA 1SJZA 2HRKA 3EINA 4ZXGA 4KE3A 4TOPA 3RDWA 3KEBA 1EV4A 5A5KA 2GGTA 2C0EA 2HSMB 1A2LA 1QMVA 5L71A 2I3YA 1TRVA 2VL2C 4P3YB 2HSYA 5J9BA 4L5OA 1Z6MA 4YKFA 1K0MA 1YJ6A 3IAS2 2WW2A 2FHEA 3NOFA 3KH9A 2YZUA 3BJ5A 4K0GA 4ECJA 1E2YA 4CW9A 4ZL7A 1QQ2A 2GSSA 1TRUA 5DDLA 1MDKA 3GX0A 5G1LA 3HJPA 2MMOA 4KX4A 5AN1A 2HLSA 3K8NA 3UMAA 1I1IP 3GHAA 4MABA 4HZ2A 3D5JA 4I97A 3F6FA 4Q5RA 4JRRA 3BOAA 1S3CA 1T4YA 1Y1UA 1GTIA 1J0FA 5CRHA 5ECMB 1EP7A 2GZPA 1K0BA 3Q19A 1GSQA 2AHEA 1JHBA 3I9V2 3VI7A 2OACA 2IN3A 2XC2A 4E8EA 1MDIA 4HJ2A 1M9AA 3W8SA 3LFLA 2JADA 2GQKA 5CNWA 3HVVA 1EP8A 4ICYA 2IMFA 4TR1A 3GFKA 4IW9A 1BG5A 4DSRA 5F05A 2DMMA 4XRDA 4TKYA 1X0RA 5IMZA 1K3YA 4JEDA 2ES7A 2L5LA 2WW0A 1YVLA 1YDKA 2P5QA 5D9TA 2ZNMA 1F3AA 3FR9A 1SL2B 2OT3A 4IQAA 4Z2TA 1OYJA 2MMNA 2B7JA 3DYRA 3GL3A 4K9ZA 1VF1A 4AGSA 3GX8A 3FRCA 1QFNA 4EXJA 5GSSA 4EO3A 1HNBA 2K6VA 2DJ3A 4GRFA 3FZ4A 4WR4A 3LJRA 5IMVA 5INYA 1V98A 1TJDA 3KP8A 3KP9A 1W89A 4ZB8A 5E59A 4KUNA 3ZITA 3IA1A 1LU4A 1JZDA 2YN1A 1TW9A 5HR0A 2A2SA 2F8FA 5DALA 2TIRA 5IO0A 2XHFA 3KH7A 4HSCX 4IJ3A 3O3TA 1A0RP 5DQYA 2YNXA 3ZLPA 1ST9A 4DEJA 4K2XA 1SYXA 2DIZA 3OR5A 1C72A 3GKMA 1U6TA 3IK9A 4EE0A 5D73A 2R37A 5AIXA 5ECQB 1B8XA 2LUSA 5ECRB 4AF2A 4D73B 4PXOA 5IMCA 3HMJG 5J41A 1J9BA 1IYHA 3GH9A 2L57A 3D0ZA 1SYRA 1WPIA 3A2WA 2C3QA 1WOUA 1A2JA 1SVLA 4DSQA 1S3AA 2GLRA 2C0GA 2YJHA 1IYIA 2LQOA 1XW6A 3WT1A 5A1NB 4ZBAA 3FR3A 2O89A 2J9HA 2NPBA 1SJ6A 4X43A 3LYKA 5ECKB 2C0FA 4LL1B 1HNAA 4L0WA 4X4JA 2D2ZA 4Q5FA 1DSBA 4TR0A 1TK8B 4LLRA 3IK7A 5ELAA 3ZFBA 2OBIA 2FD3A 4FYCA 1QK8A 1GSSA 2WFCA 4AJ7A 4HUAA 1VF2A 4EC0A 2IMDA 1USBA 5F06A 1K0OA 4MPFA 2P5RA 1U87A 3EU3A 2C1YA 2XPDA 2NDOA 2M46A 1OC9A 1TU7A 2XPEA 2YZHA 1TTZA 2O5VA 2YV7A 1ABAA 4BIKA 3QFAC 4HS1A 4PNFA 2VO4A 1AQWA 2JZRA 3H93A 5A4VA 1XG8A 1YKCA 4XTSA 2M72A 1TK0B 5DQSA 2V1MA 4ZB7A 3GL5A 4OFNA 1Z7PA 3QAGA 4IHUA 3FK8A 2PWJA 2EIOA 2GZYA 2OJLA 3UEMA 4BVYA 1SK0A 3TCOA 4MA9A 2H1AA 1G6WA 1JLWA 3ZIVA 2P31A 3CSIA 5D8IA 2HI7A 2VCQA 1OVNA 3CXGA 3FZ9A 2I9HA 4HQSA 3UVTA 3QD9A 4RI7A 5KOWA 1EV9A 3U6VA 2GSRA 3TKQA 1AW9A 2KOKA 2IWTA 1GTBA 5DJMA 3IE3A 2I1UA 1YQ1A 3FMWA 1HNCA 13GSA 4RI6A 2BMXA 4FH8A 2JACA 3EWLA 1WIKA 1NHYA 2DJ1A 4TW5A 2QA1A 3UIWA 2MBSA 1JZOA 2FUG2 2LNSA 1XCCA 2CX4A 5KEJA 2V32A 2LEGA 2RUEA 5IOWA 4KH7A 3QAWA 4WXTA 2F51A 2CT6A 2AB6A 2R4VA 4HJMA 2CV4A 4X0XA 1S4BP 1HQOA 2FY6A 4NV2A 3H4KA 3A2XA 3QOUA 1DE1A 2ON7A 1GSDA 3FYGA 2J23A 2I81A 1JFUA 1ZGNA 1TRWA 1GTAA 1XOAA 1VRSD 4KNDA 4AJ6A 4K1FA 5IM9A 5D9XA 4ECIA 1XWKA 4USSA 1A8LA 2VKZG 1O73A 5ECOB 3PINA 2X8HA 5EL8A 4TXOB 1WWJA 3D4TA 2PMTA 1R5AA 3UBKA 2DJJA 2R2JA 3MYDA 2ON5A 3DKSA 1XW5A 1FHEA 1AIUA 4HOJA 1EOGA 3GRXA 2JZSA 1PN0A 2P0GA 2REMA 4I2TA 3LQ7A 1S3RA 2K8SA 4AKGA 3FR6A 3CSJA 4CY8A 1NM3A 5B6NA 1QXHA 3HVSA 2PUKC 3L4NA 1QUWA 7GSSA 1K0AA 3DMLA 4CDOA 4OFMA 2CZ2A 4PQIA 3HJOA 1PSQA 4GLTA 3WGXA 2RM6A 1XWGA 2A2PA 3F3QA 4KB3A 1Y25A 3EYTA 3CBUA 4HU9A 2VCZA 1X5CA 4EDZA 3NZNA 2H66A 1B48A 1BQ7A 1XOBA 3P2AA 2ZUPA 3FW2A 3FEUA 3PR8A 3G7JA 1DBYA 2E2GA 4BL7B 5ECNB 5J4UA 4ML6A 2PVQA 1Q4JA 2OKAA 2H74A 2YJ7A 4YH2A 2AUVA 1UVZA 5HR3A 2HSNA 4FO5A 1WE0A 3ISOA 4MJCA 4F82A 2DJ2A 2JSZA 3UJ1A 3GSTA 4ZL8A 4BPYA 2UV8G 2OE0A 4YQUA 1M3JA 1KEBA 2HQTA 4ID0A 3IHGA 4I8BA 3JCML 4WF5A 2X8GA 4XS4A 1SJIA 1EEMA 1Y6EA 1TP9A 3IDVA 1PL2A 3VWVA 5B7CA 4ZILA 2TRXA 3I69A 1PRXA 2H1LA 3GSSA 2FWGA 4WEYA 3FKFA 1RK4A 4WR5A 5IPHA 4G01A 5B6MA 4XIHA 3F0IA 1J08A 4PQHA 4J2FA 4KSMA 1MD3A 4MH2A 1T3BA 3ZVJA 2ZCTA 4RQRA 4EF0A 5J40A 4PUFC 1URMA 3CWGA 1NHOA 3UOMA 1A23A 4ZB6A 2DMLA 2IPAA 2PGTA 3APOA 2V41A 3HVXA 5HR1A 3TKSA 2K9FA 2YV9A 3PH9A 1ILOA 3VPTA 5EPFA 3ZRDA 1FAAA 1I5GA 4IS0A 4YAPA 2VCWA 2CZ3A 1RQMA 1XWBA 5HQPA 1GSYA 2C80A 1YZXA 3HA9A 3FZ5A 1OC8A 4EUYA 5B8BA 2HRAA 2YP6A 3S9FA 3GIXA 2WVXA 3ED3A 3LWAA 3HKRA 2VCVA 4PUAA 3CMIA 4GWRA 3UBLA 1EGRA 19GSA 1JZRA 2VOCA 5DAKA 1KTEA 4OMVA 2DJ0A 5CP1A 3GTUA 3RFRC 3L9UA 3O76A 2N5BA 3VWWA 3DD3A 1VF3A 5J9CA 3DGQA 3W8JA 2N5FA 3QCPA 4MF6A 3C71A 1SU9A 2RIIA 1XFLA 5G5EA 1ZMAA 5H5SA 2UZ8A 4IGJA 3GYKA 3A5IA 4GTUA 4FIWA 2H6YA 3DIEA 1T4ZA 4IJIA 2L6CA 3SBCA 3IBHA 4ISDA 2PN8A 3VPQA 5D9WA 2BJXA 4KCEA 1M99A 1N8JA 3ME7A 2IFQB 5A5HA 3MWHA 2H75A 1FG4A 1ZYQB 4E8HA 4EVMA 5BRTA 1AXDA 4QL7A 1PQNA 4XS1A 2WRTA 4K6XA 1GUHA 1TRSA 1FO5A 22GSA 1PGTA 2F3MA 4LA1A 4GSNA 4FQUA 3R2QA 5JCUA 2X64A 1T8EB 3ZIJA 5ECHB 5J4VA 2QSIA 2X4AA 3ZMKA 1SK1A 1FVJA 4JE1A 5CRWA 5GZZB 1W4VA 2VM2A 5JWRB 5ID2A 2NVLA 2E2MA 2L59A 3D6IA 4JZQA 2NTOA 2KP1A 2AAWA 5IMFA 3P8WA 2GT6A 1XBSA 1M2DA 1F37A 1LJRA 3LEFA 1B4QA 4KGIA 2QC7A 4ZL9A 2HZFA 4YKGA 3I43A 4Z2UA 2PPTA 5JCWA 3F6DA 1AAZA 4WF4A 4JR6A 4G0LA 2A4VA 2L4CA 1CQGA 6GSSA 3H79A 5DBQA 4NHZA 5JWQB 4MJEA 4AJ8A 5KN0A 5KOXA 4BVXA 5BMUB 1XZOA 1GUKA 3LYPA 4ECBA 2RM5A 4MCUA 1KBNA 4TN8A 4CHSA 1YY7A 2VCTA 1XVQA 1GNEA 1GLQA 5FT3A 2LV3A 3RBTA 5A4WA 4K7OA 5GAPD 1K0CA 1OC3A 9GSSA 5DCHA 16GSA 3LXZA 3CYNA 1TK5B 1T7PB 1WJKA 1ML6A 8GSSA 4IQ1A 1Z3EA 4TR4A 3MNGA 2XBIA 4I2UA 5CREA 3WD6A 2FWHA 1NSWA 1GH2A 1SENA 2CAIA 2CA8A 2HYXA 3M0FA 3VLNA 1M2AA 1BJXA 1VF4A 3BCIA 4Z2RA 1MD4A 1S3DA 2EFHA 1ERWA 2PVOC 3MAKA 1KNGA 1YKAA 2O8VB 4FXYP 3IR4A 2WZ9A 3QAVA 3TJGA 1YEXA 1PKWA 1Z6NA 2EFDA 10GSA 2MMZA 3GN3A 3GV1A 3DWVA 2JSYA 5EY6A 3QMXA 3QPMA 3TRXA 3BCKA 1PMTA 3P7XA 2WZSA 2LNTA 3IAM2 1Z7RA 4G10A 3C73A 1GLPA 4ZBDA 4XHMA 3MDKA 1THOA 4WETA 3FY7A 4QMKA 4J56E 1M0UA 4EIPA 5J47A 2K18A 1THXA 4K0NA 3IRAA 1FVKA 5C00A 2L5OA 3ZYWA 3E0UA 4EDYA 4F2IA 4DSSA 4ACSA 3IPZA 3EMXA 2B7KA 4ILFA 1F6MC 4GQCA 2WVZA 1ERTA 3NIVA 1T00A 3KCMA 1SKRB 3D21A 3M1GA 1SKWB 4XRAA 4GDFA 1ERVA 4GQFA 4XS4B 4HZ4A 2OE1A 2QGVA 3KTLA 3IV4A 3UAPA 5IMDA 3L9VA 3P90A 1AQXA 4O5QA 4POBA 1FOVA 12GSA 4N0VA 1T1VA 2R3XA 4W66A 2C8UA 4AKXB 1TU8A 5AISA 5IIZA 3G9BA 5E4WA 4I5QA 2HRKB 3KTBA 3TOTA 2IIYA 2A4HA 4HI7A 2LJAA 1H4OA 3VFIA 2JL4A 4D73A 3Q18A 3LG6A 1F3BA 4A5PA 4N10A 1SD9A 4IP6A 1XW9A 1BG1A 3TRQA 4O5UA 1E6BA 2H76A 2DKIA 2WDUA 4WBRD 5F8BA 3D22A 2WW3A 3LXTA 2AV4A 2EFCA 1BF5A 4NXIA 11GSA 1TI1A 4KW6A 3GKKA 1EEJA 3HYPA 3D4MA 4DVCA 4G0KA 3U5RE 1X5DA 1O7UA 6GSVA 1PL1A 18GSA 4POMA 2WS2A 2WB9A 2QKEA 5IMAA 1OKDA 4MLYA 1PX6A 3M3MA 5H5RA 1FB6A 3C1SA 2H0HA 3F4RA 1TKDB 5H5QA 4PHZC 4NAXA 4MJAA 1O85A 2Z9SA 3WGDA 1R7HA 1LBKA 4PTSA 2G0FA 2VAFA 5DAKB 1PA3A 1HYUA 4PX1A 3GH6A 4GF0A 2PBJA 4MH3A 3CTGA 1Z5YE 2B6MA 1R4WA 1GSEA 1MEKA 2C3TA 4BWQA 2C3NA 2IL3A 4TR1B 4YAVA 3R3EA 3DEXA 4NPBA 1ZYEA 2OA7A 2HT9A 2GQMA 2O3EA 2YPMA 1R26A 1I9DA 1GWCA 2YANA 5IPGA 4OCEA 1V9WA 1VGLA 2HFDA 5G31A 2B5EA 4MZBA 2H19A 2OADA 3KJYA 4F9ZA 1AUCA 5CAXA 4QL9A 5ECPB 1F2EA 5A5HB 1H75A 3J7Yk 3ERFA 3C8EA 2KUCA 3F4SA 3ZMLA 2LJKA 6GSXA 1K3OA 2VL9A 1M7TA 1V58A 1K0DA 2CVBA 4POLA 4ML1A 3SWLA 3CQFA 2WGRA 3EPTA 2N5AA 4OO5A 3ZVJD 3A3TA 3GKXA 1TDIA 2H8LA 5GSTA 2WCIA 2FA8A 3F3RA 1SD8A 1M2BA 1EGOA 3ERWA 4X1UA 5DCGA 1OE8A 2GVPA 3GNJA 3HHVA 3KIJA 2GDRA 3TB2A 3HVNA 1ZYPA 1G7OA 4KDXA 4KA0A 5DALB 1YF0A 5CO3A 4O5RA 4CY6A 4TR3A 2CVKA 2YCDA 1A0FA 2K8VA 4AKHA 4AKIA 4KSOA 3DXBA 4MK3A 3RHBA 5AGYA 2WJUA 5ECSA 5G2ZA 5HFKA 3TJFA 4MZCA 4MJBA 5HR2A 1SVOA 1R5PA 2B5YA 3W6GA 1F9MA 2V2GA 4PQ1A 3Q74A 1G6YA 3CHXC 2LJRA 1O8XA 4LMWA 2H01A 4WKWA 3ERGA 1ZOFA 3GA4A 14GSA 2WW1A 5IO2A 1QGVA 1RW1A 2YWIA 2E7PA 4TXOA 2TRCP 2I4AA 3GKNA 1TXXA 4BVXB 3LORA 4NWYA 2L6DA 4IKHA 4FYUA 4ZIJA 3TKSE 2CQ9A 2FWFA 2OBKA 4L5LA 1Q98A 3QR6A 1G7EA 2IMEA 2GSQA 4MF5A 2AYTA 2VD1A 2KHPA 4LL4B 4NMUA 4F0CA 2F9SA 1G0TA 5CRDA 2R5GA 3E3EA 1K3LA 3ZREA 4POKA 1UN2A 3HCZA 5FWGA 1SKSB 4GSSA 3IXRA 2C4JA 2H71A 3QDNA 4GXZA 3TKSC 1N2AA 4PI2C 5G30A 3RPPA 1TOFA 4HQZA 2WVYA 2R0PA 3L78A 3HY2A 2HZEA 2MYGA 3TKRA 2E0QA 4EL1A 5AIVA 4GSTA 2YWOA 3C1RA 3ZTLA 1TI3A 1X9SB 1GULA 2H30A 5CRGA 5COHA 1V2AA 4PGTA 4PNGA 3VWUA 2HSHA 2L4QA 1OC9B 4KAEA 3FZAA 1WRYA 3BBYA 3QFBC 2H73A 4MP4A 4N11A 1PD21 2H0IA 4ULXA 3M9KA 3I6AA 4GCIA 2MBTA 1SVMA 2C0DA 4BL7A 3TJBA 3HXSA 4XCSA 3LW9A 1GSUA 2HRNA 2OE3A 4NV5A 3J7Yb 3HD5A 5DVBA 4BVYB 2FWEA 5IOXA 2DLXA 4G9HA 1OKTA 3E9JB 3ZL5A 2R0CA 5A4UA 5LD0A 4BWSA 4H86A 1YEWC 1FW1A 5HFIA 2VLTA 2DIYA 2X8CA 5A34A 1ERUA 3TRPA 4HU7A 2FLSA 1X9MB 1V40A 2O36A 1DUGA 3BD2A 2DC5A 3MIXA 1U3AA 3ZFLA 4K7IA 3A2VA 3TKPA 4F03A 3RGBC 17GSA 4DSSB 4ECCA 3EC3A 3TJKA 3EVIA 3APSA 4JBBA 2GT5A 4MF7A 1WP0A 4HDEA 1WMJA 3LGCA 2O87A 4V2MA 4YQVA 2M80A 3TUEA 3VWXA 5ENUA 2O7KA 5JCGA 1CQHA 5HFGA 4LMVA 3MSZA 1HD2A 3AY8A 2HSMA 1ZZYA 1EOHA 1YEPA 4KCAA 5LNKe 1A24A 3IHQA 4MZWA 4Q5NA 1NW2A 1GRXA 2HNLA 4L0UA 2VCXA 5KN2A 3VK9A 4L8EA 1PX7A 2RUFA 3KM6A 2B3SA 5CYYA 3TGZA 3TDGA 4IELA 2R6KA 1GUMA 4G19A 2CX3A 5J3RA 3WT2A 2NBSA 1JZWA 1B4PA 3F8UA 1GP1A 2YWMA 6GSTA 1MTCA 3HDCA 3Q6OA 5JWOB 2FNOA 2LQQA 1PFOA 4N30A 1PN9A 3F9UA 2G2QA 1XVWA 3EURA 4K5RA 2BTOT 1DE2A 4XS6A 4OD7A 4Q5QA 4MPGA 3F4TA 1PKZA 4PURA 4F0BA 3TU3B 2R0GA 4YQMA 3C7MA 2VLUA 2AJQB 3M9JA 2YWNA 4G0IA 1SL0B 1GSFA 4PI0C 3US3A 4G2EA 3RHCA 2LRTA 2CAQA 2LTKA 3G7YA 2H1DA 1UC7A 2B5XA 3CRTA 1A2MA 4MMMA 1ZL9A 2HE3A 2GZZA 5F0GA 3HZ4A 3N9JA 5ECLB 2B1KA 3FHKA 3KMOA 2PU9C 3VI5A 5G1KA 4OFTA 1B9YC 3GUSA 3CRUA 2QA2A 4TXVA 1AC1A 1XWCA 1N25A 2H6XA 3TOUA 1GTUA 2IFQA 2RLIA 3CSHA 1B9XC 3KXOA 4IN0A 2GTUA 3VURA 1K0NA 3IC8A 2H0GA 2VUPA 4V1Ag 2H70A 2VM1A 5GAND 2PERA 2FCHA 1U3IA 4V2LA 4O7HA 2XBQA 2IMIA 1TXUA 2LSTA 5J4YA 1SK2A 3L0HA 1MDJA 2HSNB 2VD0A 3KGKA 4ZBBA 5C04A 2DJKA 2FGXA 4N0ZA 3UVHA 2MZCA 4OO4A 1U88A 2VIMA 1M3IA 3APQA 4NHWA 1GNWA 5D96A 3EU4A 5LCZA 3GMFA 2H1BA 2VLVA 1O6JA 3TJJA 1AQVA 1FOHA 2IJYA 5DJLA 4N3ZA 3IC4A 1ON4A 1UA5A 2LKUA 3HZ8A 3G7IA 4TVEA 1O8WA 1Z9HA 1ACVA 1EZKA 3IOSA 2X49A 1GL8A 2JU5A 4OCFA 3UL3A 4K7NA 1X5EA 1XXUA 3RPNA 4MNNA 5G5FA 2F8AA 3CTFA 5EVOA 4AI6A 2LS5A 2H72A 2VL3A 5ABRA 4KDYA 4JU5A 5BMUA 3F63A 4QQ7A 1XWAA 3KD0A 5IQYA 4EIQA 1XIYA 3RAZA 2B1LA 3EMPA 1X9WB 3WYWA 1BAYA 2EIQA 3HJMA 6GSWA
chains in the Genus database with same CATH topology
1XPVA 2HXKA 5A1NA 2O85A 3N5OA 2V6KA 3UARA 3WGEA 2HRFA 1SL1B 3ME8A 5ELGA 20GSA 3LSZA 4ZB9A 2MMAA 4Z7XA 2JZTA 2KP2A 2A2RA 4I6XA 2LRNA 1OAZA 4V1Ap 2GSTA 4RUVA 1OE7A 3PGTA 4JR4A 4MDCA 2EIRA 2FA4A 1V57A 2EFEA 4V2NA 3V1WA 4K2DA 3GTUB 5D93A 3A5WA 3DVWA 3O6TA 4RQXA 2DBCA 2YOIA 5KN1A 5F07A 1BX9A 4K5SA 3KZQA 2HZEB 5D9VA 1A8YA 5KN3A 2LRCA 3H1NA 6GSUA 3GURA 2DSAA 4IBPA 3L9SA 1JLVA 2EC4A 4OWYA 4EKZA 2CVDA 4WBJA 2GQLA 4KDUA 4IP1A 2H1GA 2GS3A 3EE2A 1BYEA 4O32A 4HEA2 4KF9A 3DRNA 4IVFA 1BEDA 5FHIA 2V6OA 4O92A 4BA7A 2VL2A 4J57E 3DVXA 6GSYA 1YF1A 1M9BA 2H6ZA 2ALBA 3PPUA 2DKHA 3H8QA 5A34B 4K8MA 2IMKA 5J5NA 5ECIB 3M8NA 4E68A 4TRXA 5ID2B 1ZYNA 1EWXA 2WULA 1FB0A 1O81A 2KLXA 2X99A 4FYBA 3KMNA 3ZZXA 1ZCPA 5B8AA 1SJZA 2HRKA 3EINA 4ZXGA 4KE3A 4TOPA 3RDWA 3KEBA 1EV4A 5A5KA 2GGTA 2C0EA 2HSMB 1A2LA 1QMVA 5L71A 2I3YA 1TRVA 2VL2C 4P3YB 2HSYA 5J9BA 4L5OA 1Z6MA 4YKFA 1K0MA 1YJ6A 3IAS2 2FHEA 3NOFA 3KH9A 2YZUA 3BJ5A 4K0GA 4ECJA 1E2YA 4CW9A 4ZL7A 1QQ2A 2GSSA 1TRUA 5DDLA 1MDKA 3GX0A 5G1LA 3HJPA 2MMOA 4KX4A 5AN1A 2HLSA 3K8NA 3UMAA 3GHAA 4MABA 4HZ2A 3D5JA 4I97A 3F6FA 4Q5RA 4JRRA 3BOAA 1S3CA 1T4YA 1Y1UA 1GTIA 1J0FA 5CRHA 5ECMB 1EP7A 2GZPA 1K0BA 3Q19A 1GSQA 2AHEA 1JHBA 3I9V2 3VI7A 2OACA 2IN3A 2XC2A 4E8EA 1MDIA 4HJ2A 1M9AA 3W8SA 3LFLA 2JADA 2GQKA 5CNWA 3HVVA 1EP8A 4ICYA 2IMFA 4TR1A 3GFKA 4IW9A 1BG5A 4DSRA 5F05A 2DMMA 4XRDA 4TKYA 1X0RA 5IMZA 1K3YA 4JEDA 2ES7A 2L5LA 1YVLA 1YDKA 2P5QA 5D9TA 2ZNMA 1F3AA 3FR9A 1SL2B 2OT3A 4IQAA 4Z2TA 1OYJA 2MMNA 2B7JA 3DYRA 3GL3A 4K9ZA 1VF1A 4AGSA 3GX8A 3FRCA 1QFNA 4EXJA 5GSSA 4EO3A 1HNBA 2K6VA 2DJ3A 4GRFA 3FZ4A 4WR4A 3LJRA 5IMVA 5INYA 1V98A 1TJDA 3KP8A 3KP9A 1W89A 4ZB8A 5E59A 4KUNA 3ZITA 3IA1A 1LU4A 1JZDA 2YN1A 1TW9A 5HR0A 2A2SA 2F8FA 5DALA 2TIRA 5IO0A 2XHFA 3KH7A 4IJ3A 3O3TA 1A0RP 5DQYA 2YNXA 3ZLPA 1ST9A 4DEJA 4K2XA 1SYXA 2DIZA 3OR5A 1C72A 3GKMA 1U6TA 3IK9A 4EE0A 5D73A 2R37A 5AIXA 5ECQB 1B8XA 2LUSA 5ECRB 4AF2A 4D73B 4PXOA 5IMCA 3HMJG 5J41A 1J9BA 1IYHA 3GH9A 2L57A 3D0ZA 1SYRA 1WPIA 3A2WA 2C3QA 1WOUA 1A2JA 1SVLA 4DSQA 1S3AA 2GLRA 2C0GA 2YJHA 1IYIA 2LQOA 1XW6A 3WT1A 5A1NB 4ZBAA 3FR3A 2O89A 2J9HA 2NPBA 1SJ6A 4X43A 3LYKA 5ECKB 2C0FA 4LL1B 1HNAA 4L0WA 4X4JA 2D2ZA 4Q5FA 1DSBA 4TR0A 1TK8B 4LLRA 3IK7A 5ELAA 3ZFBA 2OBIA 2FD3A 4FYCA 1QK8A 1GSSA 2WFCA 4AJ7A 4HUAA 1VF2A 4EC0A 2IMDA 1USBA 5F06A 1K0OA 4MPFA 2P5RA 1U87A 3EU3A 2C1YA 2XPDA 2NDOA 2M46A 1OC9A 1TU7A 2XPEA 2YZHA 1TTZA 2O5VA 2YV7A 1ABAA 3QFAC 4HS1A 4PNFA 2VO4A 1AQWA 2JZRA 3H93A 5A4VA 1YKCA 4XTSA 2M72A 1TK0B 5DQSA 2V1MA 4ZB7A 3GL5A 4OFNA 1Z7PA 3QAGA 4IHUA 3FK8A 2PWJA 2EIOA 2GZYA 2OJLA 3UEMA 4BVYA 1SK0A 3TCOA 4MA9A 2H1AA 1G6WA 1JLWA 3ZIVA 2P31A 3CSIA 5D8IA 2HI7A 2VCQA 1OVNA 3CXGA 3FZ9A 2I9HA 4HQSA 3UVTA 3QD9A 4RI7A 5KOWA 1EV9A 3U6VA 2GSRA 3TKQA 1AW9A 2KOKA 2IWTA 1GTBA 5DJMA 3IE3A 2I1UA 1YQ1A 3FMWA 1HNCA 13GSA 4RI6A 2BMXA 4FH8A 2JACA 3EWLA 1WIKA 1NHYA 2DJ1A 4TW5A 2QA1A 3UIWA 2MBSA 1JZOA 2FUG2 2LNSA 1XCCA 2CX4A 5KEJA 2V32A 2LEGA 2RUEA 5IOWA 4KH7A 3QAWA 4WXTA 2F51A 2CT6A 2AB6A 2R4VA 4HJMA 2CV4A 4X0XA 1HQOA 2FY6A 4NV2A 3H4KA 3A2XA 3QOUA 1DE1A 2ON7A 1GSDA 3FYGA 2J23A 2I81A 1JFUA 1ZGNA 1TRWA 1GTAA 1XOAA 1VRSD 4KNDA 4AJ6A 4K1FA 5IM9A 5D9XA 4ECIA 1XWKA 4USSA 1A8LA 2VKZG 1O73A 5ECOB 3PINA 2X8HA 5EL8A 4TXOB 1WWJA 3D4TA 2PMTA 1R5AA 3UBKA 2DJJA 2R2JA 3MYDA 2ON5A 3DKSA 1XW5A 1FHEA 1AIUA 4HOJA 1EOGA 3GRXA 2JZSA 1PN0A 2P0GA 2REMA 4I2TA 3LQ7A 2K8SA 4AKGA 3FR6A 3CSJA 4CY8A 1NM3A 5B6NA 1QXHA 3HVSA 2PUKC 3L4NA 1QUWA 7GSSA 1K0AA 3DMLA 4CDOA 4OFMA 2CZ2A 4PQIA 3HJOA 1PSQA 4GLTA 3WGXA 2RM6A 1XWGA 2A2PA 3F3QA 4KB3A 1Y25A 3EYTA 3CBUA 4HU9A 2VCZA 1X5CA 4EDZA 3NZNA 2H66A 1B48A 1BQ7A 1XOBA 3P2AA 2ZUPA 3FW2A 3FEUA 3PR8A 3G7JA 1DBYA 2E2GA 4BL7B 5ECNB 5J4UA 4ML6A 2PVQA 1Q4JA 2OKAA 2H74A 2YJ7A 4YH2A 2AUVA 1UVZA 5HR3A 2HSNA 4FO5A 1WE0A 3ISOA 4MJCA 4F82A 2DJ2A 2JSZA 3UJ1A 3GSTA 4ZL8A 4BPYA 2UV8G 2OE0A 4YQUA 1KEBA 2HQTA 4ID0A 3IHGA 4I8BA 3JCML 4WF5A 2X8GA 4XS4A 1SJIA 1EEMA 1Y6EA 1TP9A 3IDVA 1PL2A 3VWVA 5B7CA 4ZILA 2TRXA 3I69A 1PRXA 2H1LA 3GSSA 2FWGA 4WEYA 3FKFA 1RK4A 4WR5A 5IPHA 4G01A 5B6MA 4XIHA 3F0IA 1J08A 4PQHA 4J2FA 4KSMA 1MD3A 4MH2A 1T3BA 3ZVJA 2ZCTA 4RQRA 4EF0A 5J40A 4PUFC 1URMA 3CWGA 1NHOA 3UOMA 1A23A 4ZB6A 2DMLA 2IPAA 2PGTA 3APOA 2V41A 3HVXA 5HR1A 3TKSA 2K9FA 2YV9A 3PH9A 1ILOA 3VPTA 5EPFA 3ZRDA 1FAAA 1I5GA 4IS0A 4YAPA 2VCWA 2CZ3A 1RQMA 1XWBA 5HQPA 1GSYA 2C80A 1YZXA 3HA9A 3FZ5A 1OC8A 4EUYA 5B8BA 2HRAA 2YP6A 3S9FA 3GIXA 3ED3A 3LWAA 3HKRA 2VCVA 4PUAA 3CMIA 4GWRA 3UBLA 1EGRA 19GSA 1JZRA 2VOCA 5DAKA 1KTEA 4OMVA 2DJ0A 5CP1A 3GTUA 3L9UA 3O76A 2N5BA 3VWWA 3DD3A 1VF3A 5J9CA 3DGQA 3W8JA 2N5FA 3QCPA 4MF6A 3C71A 1SU9A 2RIIA 1XFLA 5G5EA 1ZMAA 5H5SA 2UZ8A 4IGJA 3GYKA 3A5IA 4GTUA 4FIWA 2H6YA 3DIEA 1T4ZA 4IJIA 2L6CA 3SBCA 3IBHA 4ISDA 2PN8A 3VPQA 5D9WA 2BJXA 4KCEA 1M99A 1N8JA 3ME7A 2IFQB 5A5HA 3MWHA 2H75A 1FG4A 1ZYQB 4E8HA 4EVMA 5BRTA 1AXDA 4QL7A 1PQNA 4XS1A 2WRTA 4K6XA 1GUHA 1TRSA 1FO5A 22GSA 1PGTA 2F3MA 4LA1A 4GSNA 4FQUA 3R2QA 5JCUA 2X64A 1T8EB 3ZIJA 5ECHB 5J4VA 2QSIA 2X4AA 3ZMKA 1SK1A 1FVJA 4JE1A 5CRWA 5GZZB 1W4VA 2VM2A 5JWRB 5ID2A 2NVLA 2E2MA 2L59A 3D6IA 4JZQA 2NTOA 2KP1A 2AAWA 5IMFA 3P8WA 2GT6A 1XBSA 1M2DA 1F37A 1LJRA 3LEFA 1B4QA 4KGIA 2QC7A 4ZL9A 2HZFA 4YKGA 3I43A 4Z2UA 2PPTA 5JCWA 3F6DA 1AAZA 4WF4A 4JR6A 4G0LA 2A4VA 2L4CA 1CQGA 6GSSA 3H79A 5DBQA 4NHZA 5JWQB 4MJEA 4AJ8A 5KN0A 5KOXA 4BVXA 5BMUB 1XZOA 1GUKA 3LYPA 4ECBA 2RM5A 4MCUA 1KBNA 4TN8A 4CHSA 1YY7A 2VCTA 1XVQA 1GNEA 1GLQA 5FT3A 2LV3A 3RBTA 5A4WA 4K7OA 5GAPD 1K0CA 1OC3A 9GSSA 5DCHA 16GSA 3LXZA 3CYNA 1TK5B 1T7PB 1WJKA 1ML6A 8GSSA 4IQ1A 1Z3EA 4TR4A 3MNGA 2XBIA 4I2UA 5CREA 3WD6A 2FWHA 1NSWA 1GH2A 1SENA 2CAIA 2CA8A 2HYXA 3M0FA 3VLNA 1M2AA 1BJXA 1VF4A 3BCIA 4Z2RA 1MD4A 1S3DA 2EFHA 1ERWA 2PVOC 3MAKA 1KNGA 1YKAA 2O8VB 3IR4A 2WZ9A 3QAVA 3TJGA 1YEXA 1PKWA 1Z6NA 2EFDA 10GSA 2MMZA 3GN3A 3GV1A 3DWVA 2JSYA 5EY6A 3QMXA 3QPMA 3TRXA 3BCKA 1PMTA 3P7XA 2LNTA 3IAM2 1Z7RA 4G10A 3C73A 1GLPA 4ZBDA 4XHMA 3MDKA 1THOA 4WETA 3FY7A 4QMKA 4J56E 1M0UA 4EIPA 5J47A 2K18A 1THXA 4K0NA 3IRAA 1FVKA 5C00A 2L5OA 3ZYWA 3E0UA 4EDYA 4F2IA 4DSSA 4ACSA 3IPZA 3EMXA 2B7KA 4ILFA 1F6MC 4GQCA 1ERTA 3NIVA 1T00A 3KCMA 1SKRB 3D21A 3M1GA 1SKWB 4XRAA 4GDFA 1ERVA 4GQFA 4XS4B 4HZ4A 2OE1A 2QGVA 3KTLA 3IV4A 3UAPA 5IMDA 3L9VA 3P90A 1AQXA 4O5QA 4POBA 1FOVA 12GSA 4N0VA 1T1VA 2R3XA 4W66A 2C8UA 4AKXB 1TU8A 5AISA 5IIZA 3G9BA 5E4WA 4I5QA 2HRKB 3KTBA 3TOTA 2IIYA 2A4HA 4HI7A 2LJAA 1H4OA 3VFIA 2JL4A 4D73A 3Q18A 3LG6A 1F3BA 4A5PA 4N10A 1SD9A 4IP6A 1XW9A 1BG1A 3TRQA 4O5UA 1E6BA 2H76A 2DKIA 2WDUA 4WBRD 5F8BA 3D22A 3LXTA 2AV4A 2EFCA 1BF5A 4NXIA 11GSA 1TI1A 4KW6A 3GKKA 1EEJA 3HYPA 3D4MA 4DVCA 4G0KA 3U5RE 1X5DA 1O7UA 6GSVA 1PL1A 18GSA 4POMA 2WS2A 2WB9A 2QKEA 5IMAA 1OKDA 4MLYA 1PX6A 3M3MA 5H5RA 1FB6A 3C1SA 2H0HA 3F4RA 1TKDB 5H5QA 4MJAA 4NAXA 1O85A 2Z9SA 3WGDA 1R7HA 1LBKA 4PTSA 2G0FA 2VAFA 5DAKB 1PA3A 1HYUA 4PX1A 3GH6A 4GF0A 2PBJA 4MH3A 3CTGA 1Z5YE 2B6MA 1R4WA 1GSEA 1MEKA 2C3TA 4BWQA 2C3NA 2IL3A 4TR1B 4YAVA 3R3EA 3DEXA 4NPBA 1ZYEA 2OA7A 2HT9A 2GQMA 2YPMA 1R26A 1I9DA 1GWCA 2YANA 5IPGA 4OCEA 1V9WA 1VGLA 2HFDA 5G31A 2B5EA 4MZBA 2H19A 2OADA 3KJYA 4F9ZA 1AUCA 5CAXA 4QL9A 5ECPB 1F2EA 5A5HB 1H75A 3J7Yk 3ERFA 3C8EA 2KUCA 3F4SA 3ZMLA 2LJKA 6GSXA 1K3OA 2VL9A 1M7TA 1V58A 1K0DA 2CVBA 4POLA 4ML1A 3SWLA 2WGRA 3EPTA 2N5AA 4OO5A 3ZVJD 3A3TA 3GKXA 1TDIA 2H8LA 5GSTA 2WCIA 2FA8A 3F3RA 1SD8A 1M2BA 1EGOA 3ERWA 4X1UA 5DCGA 1OE8A 2GVPA 3GNJA 3HHVA 3KIJA 2GDRA 3TB2A 1ZYPA 1G7OA 4KDXA 4KA0A 5DALB 1YF0A 5CO3A 4O5RA 4CY6A 4TR3A 2CVKA 2YCDA 1A0FA 2K8VA 4AKHA 4AKIA 4KSOA 3DXBA 4MK3A 3RHBA 5AGYA 2WJUA 5ECSA 5G2ZA 5HFKA 3TJFA 4MZCA 4MJBA 5HR2A 1SVOA 1R5PA 2B5YA 3W6GA 1F9MA 2V2GA 4PQ1A 3Q74A 1G6YA 2LJRA 1O8XA 4LMWA 2H01A 4WKWA 3ERGA 1ZOFA 3GA4A 14GSA 5IO2A 1QGVA 1RW1A 2YWIA 2E7PA 4TXOA 2TRCP 2I4AA 3GKNA 1TXXA 4BVXB 3LORA 4NWYA 2L6DA 4IKHA 4FYUA 4ZIJA 3TKSE 2CQ9A 2FWFA 2OBKA 4L5LA 1Q98A 3QR6A 1G7EA 2IMEA 2GSQA 4MF5A 2AYTA 2VD1A 2KHPA 4LL4B 4NMUA 4F0CA 2F9SA 1G0TA 5CRDA 2R5GA 3E3EA 1K3LA 3ZREA 4POKA 1UN2A 3HCZA 5FWGA 1SKSB 4GSSA 3IXRA 2C4JA 2H71A 3QDNA 4GXZA 3TKSC 1N2AA 5G30A 3RPPA 1TOFA 4HQZA 2R0PA 3L78A 3HY2A 2HZEA 2MYGA 3TKRA 2E0QA 4EL1A 5AIVA 4GSTA 2YWOA 3C1RA 3ZTLA 1TI3A 1X9SB 1GULA 2H30A 5CRGA 5COHA 1V2AA 4PGTA 4PNGA 3VWUA 2HSHA 2L4QA 1OC9B 4KAEA 3FZAA 1WRYA 3BBYA 3QFBC 2H73A 4MP4A 4N11A 1PD21 2H0IA 4ULXA 3M9KA 3I6AA 4GCIA 2MBTA 1SVMA 2C0DA 4BL7A 3TJBA 3HXSA 4XCSA 3LW9A 1GSUA 2HRNA 2OE3A 4NV5A 3J7Yb 3HD5A 5DVBA 4BVYB 2FWEA 5IOXA 2DLXA 4G9HA 1OKTA 3E9JB 3ZL5A 2R0CA 5A4UA 5LD0A 4BWSA 4H86A 1FW1A 5HFIA 2VLTA 2DIYA 2X8CA 5A34A 1ERUA 3TRPA 4HU7A 2FLSA 1X9MB 1V40A 1DUGA 3BD2A 2DC5A 3MIXA 1U3AA 3ZFLA 4K7IA 3A2VA 3TKPA 4F03A 17GSA 4DSSB 4ECCA 3EC3A 3TJKA 3EVIA 3APSA 4JBBA 2GT5A 4MF7A 1WP0A 4HDEA 1WMJA 3LGCA 2O87A 4V2MA 4YQVA 2M80A 3TUEA 3VWXA 5ENUA 2O7KA 5JCGA 1CQHA 5HFGA 4LMVA 3MSZA 1HD2A 3AY8A 2HSMA 1ZZYA 1EOHA 1YEPA 4KCAA 5LNKe 1A24A 3IHQA 4MZWA 4Q5NA 1NW2A 1GRXA 2HNLA 4L0UA 2VCXA 5KN2A 3VK9A 4L8EA 1PX7A 2RUFA 3KM6A 2B3SA 5CYYA 3TGZA 3TDGA 4IELA 2R6KA 1GUMA 4G19A 2CX3A 5J3RA 3WT2A 2NBSA 1JZWA 1B4PA 3F8UA 1GP1A 2YWMA 6GSTA 1MTCA 3HDCA 3Q6OA 5JWOB 2FNOA 2LQQA 4N30A 1PN9A 3F9UA 2G2QA 1XVWA 3EURA 4K5RA 2BTOT 1DE2A 4XS6A 4OD7A 4Q5QA 4MPGA 3F4TA 1PKZA 4PURA 4F0BA 3TU3B 2R0GA 4YQMA 3C7MA 2VLUA 2AJQB 3M9JA 2YWNA 4G0IA 1SL0B 1GSFA 3US3A 4G2EA 3RHCA 2LRTA 2CAQA 2LTKA 3G7YA 2H1DA 1UC7A 2B5XA 3CRTA 1A2MA 4MMMA 1ZL9A 2HE3A 2GZZA 5F0GA 3HZ4A 3N9JA 5ECLB 2B1KA 3FHKA 3KMOA 2PU9C 3VI5A 5G1KA 4OFTA 1B9YC 3GUSA 3CRUA 2QA2A 4TXVA 1AC1A 1XWCA 1N25A 2H6XA 3TOUA 1GTUA 2IFQA 2RLIA 3CSHA 1B9XC 3KXOA 4IN0A 2GTUA 3VURA 1K0NA 3IC8A 2H0GA 2VUPA 4V1Ag 2H70A 2VM1A 5GAND 2PERA 2FCHA 1U3IA 4V2LA 4O7HA 2XBQA 2IMIA 1TXUA 2LSTA 5J4YA 1SK2A 3L0HA 1MDJA 2HSNB 2VD0A 3KGKA 4ZBBA 5C04A 2DJKA 2FGXA 4N0ZA 3UVHA 2MZCA 4OO4A 1U88A 2VIMA 3APQA 4NHWA 1GNWA 5D96A 3EU4A 5LCZA 3GMFA 2H1BA 2VLVA 1O6JA 3TJJA 1AQVA 1FOHA 2IJYA 5DJLA 4N3ZA 3IC4A 1ON4A 1UA5A 2LKUA 3HZ8A 3G7IA 4TVEA 1O8WA 1Z9HA 1ACVA 1EZKA 3IOSA 2X49A 1GL8A 2JU5A 4OCFA 3UL3A 4K7NA 1X5EA 1XXUA 3RPNA 4MNNA 5G5FA 2F8AA 3CTFA 5EVOA 4AI6A 2LS5A 2H72A 2VL3A 5ABRA 4KDYA 4JU5A 5BMUA 3F63A 4QQ7A 1XWAA 3KD0A 5IQYA 4EIQA 1XIYA 3RAZA 2B1LA 3EMPA 1X9WB 3WYWA 1BAYA 2EIQA 3HJMA 6GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPV A;  2HXK A;  2O85 A;  3N5O A;  2V6K A;  3UAR A;  3WGE A;  2HRF A;  1SL1 B;  3ME8 A;  5ELG A;  20GS A;  3LSZ A;  4ZB9 A;  2MMA A;  4Z7X A;  2JZT A;  2KP2 A;  2A2R A;  4I6X A;  2LRN A;  1OAZ A;  4V1A p;  2GST A;  4RUV A;  1OE7 A;  3PGT A;  4JR4 A;  4MDC A;  2EIR A;  2FA4 A;  1V57 A;  4V2N A;  3V1W A;  4K2D A;  3GTU B;  5D93 A;  3A5W A;  3DVW A;  3O6T A;  4RQX A;  2DBC A;  2YOI A;  5KN1 A;  5F07 A;  1BX9 A;  3KZQ A;  2HZE B;  5D9V A;  1A8Y A;  5KN3 A;  2LRC A;  3H1N A;  6GSU A;  3GUR A;  2DSA A;  4IBP A;  3L9S A;  1JLV A;  2EC4 A;  4OWY A;  4EKZ A;  2CVD A;  4WBJ A;  2GQL A;  4KDU A;  4IP1 A;  2H1G A;  2GS3 A;  3EE2 A;  1BYE A;  4O32 A;  4HEA 2;  4KF9 A;  3DRN A;  4IVF A;  1BED A;  5FHI A;  2V6O A;  4O92 A;  4BA7 A;  2VL2 A;  4J57 E;  3DVX A;  6GSY A;  1YF1 A;  1M9B A;  2H6Z A;  2ALB A;  3PPU A;  3H8Q A;  4K8M A;  2IMK A;  5J5N A;  5ECI B;  3M8N A;  4TRX A;  5ID2 B;  1EWX A;  2WUL A;  1FB0 A;  1O81 A;  2KLX A;  2X99 A;  4FYB A;  3KMN A;  3ZZX A;  1ZCP A;  5B8A A;  1SJZ A;  2HRK A;  3EIN A;  4ZXG A;  4KE3 A;  4TOP A;  3RDW A;  3KEB A;  1EV4 A;  5A5K A;  2GGT A;  2C0E A;  2HSM B;  1A2L A;  1QMV A;  5L71 A;  2I3Y A;  1TRV A;  2VL2 C;  4P3Y B;  2HSY A;  5J9B A;  4L5O A;  1Z6M A;  1K0M A;  1YJ6 A;  3IAS 2;  2FHE A;  3NOF A;  3KH9 A;  2YZU A;  3BJ5 A;  4K0G A;  4ECJ A;  1E2Y A;  4CW9 A;  4ZL7 A;  1QQ2 A;  2GSS A;  1TRU A;  5DDL A;  1MDK A;  3GX0 A;  5G1L A;  3HJP A;  2MMO A;  4KX4 A;  5AN1 A;  2HLS A;  3K8N A;  3UMA A;  3GHA A;  4MAB A;  4HZ2 A;  3D5J A;  4I97 A;  3F6F A;  4Q5R A;  4JRR A;  3BOA A;  1S3C A;  1T4Y A;  1GTI A;  1J0F A;  5CRH A;  5ECM B;  1EP7 A;  2GZP A;  1K0B A;  3Q19 A;  1GSQ A;  2AHE A;  1JHB A;  3I9V 2;  3VI7 A;  2OAC A;  2IN3 A;  2XC2 A;  4E8E A;  1MDI A;  4HJ2 A;  1M9A A;  3W8S A;  3LFL A;  2JAD A;  2GQK A;  5CNW A;  3HVV A;  1EP8 A;  2IMF A;  4TR1 A;  3GFK A;  4IW9 A;  1BG5 A;  4DSR A;  5F05 A;  2DMM A;  4XRD A;  4TKY A;  1X0R A;  5IMZ A;  1K3Y A;  4JED A;  2ES7 A;  2L5L A;  1YDK A;  2P5Q A;  5D9T A;  2ZNM A;  1F3A A;  3FR9 A;  1SL2 B;  4IQA A;  1OYJ A;  2MMN A;  2B7J A;  3DYR A;  4K9Z A;  3GL3 A;  1VF1 A;  4AGS A;  3GX8 A;  3FRC A;  1QFN A;  4EXJ A;  5GSS A;  4EO3 A;  1HNB A;  2K6V A;  2DJ3 A;  4GRF A;  3FZ4 A;  4WR4 A;  3LJR A;  5IMV A;  5INY A;  1V98 A;  1TJD A;  3KP8 A;  3KP9 A;  1W89 A;  4ZB8 A;  5E59 A;  4KUN A;  3ZIT A;  3IA1 A;  1LU4 A;  1JZD A;  2YN1 A;  1TW9 A;  5HR0 A;  2A2S A;  2F8F A;  5DAL A;  2TIR A;  5IO0 A;  2XHF A;  3KH7 A;  4IJ3 A;  3O3T A;  1A0R P;  5DQY A;  2YNX A;  3ZLP A;  1ST9 A;  4DEJ A;  1SYX A;  2DIZ A;  3OR5 A;  1C72 A;  3GKM A;  1U6T A;  3IK9 A;  4EE0 A;  5D73 A;  2R37 A;  5AIX A;  5ECQ B;  1B8X A;  2LUS A;  5ECR B;  4AF2 A;  4D73 B;  4PXO A;  5IMC A;  5J41 A;  1J9B A;  1IYH A;  3GH9 A;  2L57 A;  3D0Z A;  1SYR A;  1WPI A;  3A2W A;  2C3Q A;  1WOU A;  1A2J A;  4DSQ A;  1S3A A;  2GLR A;  2C0G A;  2YJH A;  1IYI A;  2LQO A;  1XW6 A;  3WT1 A;  4ZBA A;  3FR3 A;  2O89 A;  2J9H A;  2NPB A;  1SJ6 A;  4X43 A;  3LYK A;  5ECK B;  2C0F A;  4LL1 B;  1HNA A;  4L0W A;  2D2Z A;  4Q5F A;  1DSB A;  4TR0 A;  1TK8 B;  4LLR A;  3IK7 A;  5ELA A;  3ZFB A;  2OBI A;  2FD3 A;  4FYC A;  1QK8 A;  1GSS A;  2WFC A;  4AJ7 A;  4HUA A;  1VF2 A;  4EC0 A;  2IMD A;  1USB A;  5F06 A;  1K0O A;  4MPF A;  2P5R A;  1U87 A;  3EU3 A;  2C1Y A;  2XPD A;  2NDO A;  2M46 A;  1OC9 A;  1TU7 A;  2XPE A;  2YZH A;  1TTZ A;  2YV7 A;  1ABA A;  3QFA C;  4HS1 A;  4PNF A;  2VO4 A;  1AQW A;  2JZR A;  3H93 A;  5A4V A;  1YKC A;  4XTS A;  2M72 A;  1TK0 B;  5DQS A;  2V1M A;  3GL5 A;  4OFN A;  1Z7P A;  3QAG A;  4IHU A;  3FK8 A;  2PWJ A;  2EIO A;  2GZY A;  2OJL A;  3UEM A;  4BVY A;  1SK0 A;  3TCO A;  4MA9 A;  2H1A A;  1G6W A;  1JLW A;  3ZIV A;  2P31 A;  3CSI A;  5D8I A;  2HI7 A;  2VCQ A;  1OVN A;  3CXG A;  3FZ9 A;  2I9H A;  4HQS A;  3UVT A;  3QD9 A;  4RI7 A;  1EV9 A;  3U6V A;  2GSR A;  3TKQ A;  1AW9 A;  2KOK A;  2IWT A;  1GTB A;  5DJM A;  3IE3 A;  2I1U A;  1YQ1 A;  1HNC A;  13GS A;  4RI6 A;  2BMX A;  4FH8 A;  2JAC A;  3EWL A;  1WIK A;  1NHY A;  2DJ1 A;  4TW5 A;  3UIW A;  2MBS A;  1JZO A;  2FUG 2;  2LNS A;  1XCC A;  2CX4 A;  5KEJ A;  2V32 A;  2LEG A;  2RUE A;  5IOW A;  4KH7 A;  3QAW A;  4WXT A;  2F51 A;  2CT6 A;  2AB6 A;  2R4V A;  4HJM A;  2CV4 A;  4X0X A;  1HQO A;  2FY6 A;  4NV2 A;  3H4K A;  3A2X A;  3QOU A;  1DE1 A;  2ON7 A;  1GSD A;  3FYG A;  2J23 A;  2I81 A;  1JFU A;  1ZGN A;  1TRW A;  1GTA A;  1XOA A;  1VRS D;  4KND A;  4AJ6 A;  4K1F A;  5IM9 A;  5D9X A;  4ECI A;  1XWK A;  4USS A;  1A8L A;  1O73 A;  5ECO B;  3PIN A;  2X8H A;  5EL8 A;  4TXO B;  1WWJ A;  3D4T A;  2PMT A;  1R5A A;  3UBK A;  2DJJ A;  2R2J A;  2ON5 A;  3DKS A;  1XW5 A;  1FHE A;  1AIU A;  4HOJ A;  1EOG A;  3GRX A;  2JZS A;  2P0G A;  2REM A;  4I2T A;  3LQ7 A;  2K8S A;  3FR6 A;  3CSJ A;  1NM3 A;  5B6N A;  1QXH A;  3HVS A;  2PUK C;  3L4N A;  1QUW A;  7GSS A;  1K0A A;  3DML A;  4CDO A;  4OFM A;  2CZ2 A;  4PQI A;  3HJO A;  1PSQ A;  4GLT A;  3WGX A;  2RM6 A;  1XWG A;  3F3Q A;  4KB3 A;  1Y25 A;  3EYT A;  3CBU A;  4HU9 A;  2VCZ A;  1X5C A;  4EDZ A;  3NZN A;  2H66 A;  1B48 A;  1BQ7 A;  1XOB A;  3P2A A;  2ZUP A;  3FW2 A;  3FEU A;  3PR8 A;  3G7J A;  1DBY A;  2E2G A;  4BL7 B;  5ECN B;  5J4U A;  4ML6 A;  2PVQ A;  1Q4J A;  2OKA A;  2H74 A;  2YJ7 A;  4YH2 A;  2AUV A;  1UVZ A;  5HR3 A;  4FO5 A;  1WE0 A;  3ISO A;  4MJC A;  4F82 A;  2DJ2 A;  2JSZ A;  3UJ1 A;  3GST A;  4ZL8 A;  4BPY A;  2OE0 A;  4YQU A;  1KEB A;  2HQT A;  4ID0 A;  4I8B A;  3JCM L;  4WF5 A;  2X8G A;  4XS4 A;  1SJI A;  1EEM A;  1Y6E A;  1TP9 A;  3IDV A;  1PL2 A;  3VWV A;  5B7C A;  4ZIL A;  2TRX A;  3I69 A;  1PRX A;  2FWG A;  3GSS A;  4WEY A;  3FKF A;  1RK4 A;  4WR5 A;  5IPH A;  5B6M A;  4XIH A;  3F0I A;  1J08 A;  4PQH A;  4J2F A;  4KSM A;  1MD3 A;  4MH2 A;  1T3B A;  3ZVJ A;  2ZCT A;  4RQR A;  4EF0 A;  4PUF C;  1URM A;  1NHO A;  3UOM A;  1A23 A;  4ZB6 A;  2DML A;  2IPA A;  2PGT A;  3APO A;  2V41 A;  3HVX A;  5HR1 A;  3TKS A;  2K9F A;  2YV9 A;  3PH9 A;  1ILO A;  3VPT A;  5EPF A;  3ZRD A;  1FAA A;  1I5G A;  4IS0 A;  4YAP A;  2VCW A;  2CZ3 A;  1RQM A;  1XWB A;  5HQP A;  1GSY A;  2C80 A;  1YZX A;  3HA9 A;  3FZ5 A;  1OC8 A;  4EUY A;  5B8B A;  2HRA A;  2YP6 A;  3S9F A;  3GIX A;  3ED3 A;  3LWA A;  3HKR A;  2VCV A;  4PUA A;  3CMI A;  4GWR A;  3UBL A;  1EGR A;  19GS A;  1JZR A;  2VOC A;  5DAK A;  1KTE A;  4OMV A;  2DJ0 A;  5CP1 A;  3GTU A;  3L9U A;  3O76 A;  2N5B A;  3VWW A;  3DD3 A;  1VF3 A;  5J9C A;  3DGQ A;  3W8J A;  2N5F A;  3QCP A;  4MF6 A;  3C71 A;  1SU9 A;  2RII A;  1XFL A;  5G5E A;  1ZMA A;  5H5S A;  2UZ8 A;  4IGJ A;  3GYK A;  4GTU A;  4FIW A;  2H6Y A;  3DIE A;  1T4Z A;  4IJI A;  2L6C A;  3SBC A;  3IBH A;  4ISD A;  2PN8 A;  3VPQ A;  5D9W A;  2BJX A;  4KCE A;  1M99 A;  1N8J A;  3ME7 A;  2IFQ B;  3MWH A;  2H75 A;  1FG4 A;  1ZYQ B;  4E8H A;  4EVM A;  1AXD A;  4QL7 A;  1PQN A;  4XS1 A;  2WRT A;  4K6X A;  1GUH A;  1TRS A;  1FO5 A;  22GS A;  1PGT A;  2F3M A;  4LA1 A;  4GSN A;  4FQU A;  3R2Q A;  5JCU A;  2X64 A;  1T8E B;  3ZIJ A;  5ECH B;  2QSI A;  3ZMK A;  1SK1 A;  1FVJ A;  4JE1 A;  5CRW A;  5GZZ B;  1W4V A;  2VM2 A;  5JWR B;  5ID2 A;  2NVL A;  2E2M A;  2L59 A;  3D6I A;  4JZQ A;  2NTO A;  2KP1 A;  2AAW A;  5IMF A;  3P8W A;  2GT6 A;  1XBS A;  1M2D A;  1F37 A;  1LJR A;  3LEF A;  1B4Q A;  4KGI A;  2QC7 A;  4ZL9 A;  2HZF A;  3I43 A;  2PPT A;  5JCW A;  3F6D A;  1AAZ A;  4WF4 A;  4JR6 A;  4G0L A;  2A4V A;  2L4C A;  1CQG A;  6GSS A;  3H79 A;  5DBQ A;  4NHZ A;  5JWQ B;  4MJE A;  4AJ8 A;  5KN0 A;  4BVX A;  1XZO A;  1GUK A;  3LYP A;  4ECB A;  2RM5 A;  4MCU A;  1KBN A;  4TN8 A;  4CHS A;  1YY7 A;  2VCT A;  1XVQ A;  1GNE A;  1GLQ A;  5FT3 A;  2LV3 A;  3RBT A;  5A4W A;  4K7O A;  5GAP D;  1K0C A;  1OC3 A;  9GSS A;  5DCH A;  16GS A;  3LXZ A;  3CYN A;  1TK5 B;  1T7P B;  1WJK A;  1ML6 A;  8GSS A;  4IQ1 A;  1Z3E A;  4TR4 A;  3MNG A;  2XBI A;  4I2U A;  5CRE A;  3WD6 A;  2FWH A;  1NSW A;  1GH2 A;  1SEN A;  2CAI A;  2CA8 A;  2HYX A;  3M0F A;  3VLN A;  1M2A A;  1BJX A;  1VF4 A;  3BCI A;  1MD4 A;  1S3D A;  1ERW A;  2PVO C;  3MAK A;  1KNG A;  1YKA A;  2O8V B;  3IR4 A;  2WZ9 A;  3QAV A;  3TJG A;  1YEX A;  1PKW A;  1Z6N A;  10GS A;  2MMZ A;  3GN3 A;  3GV1 A;  3DWV A;  2JSY A;  5EY6 A;  3QMX A;  3QPM A;  3TRX A;  3BCK A;  1PMT A;  3P7X A;  2LNT A;  3IAM 2;  1Z7R A;  4G10 A;  3C73 A;  1GLP A;  4ZBD A;  4XHM A;  3MDK A;  1THO A;  4WET A;  3FY7 A;  4J56 E;  1M0U A;  2K18 A;  1THX A;  4K0N A;  3IRA A;  1FVK A;  5C00 A;  2L5O A;  3ZYW A;  3E0U A;  4EDY A;  4F2I A;  4DSS A;  4ACS A;  3IPZ A;  3EMX A;  2B7K A;  4ILF A;  1F6M C;  4GQC A;  1ERT A;  3NIV A;  1T00 A;  3KCM A;  1SKR B;  3D21 A;  3M1G A;  1SKW B;  4XRA A;  1ERV A;  4GQF A;  4XS4 B;  4HZ4 A;  2OE1 A;  2QGV A;  3KTL A;  3IV4 A;  3UAP A;  5IMD A;  3L9V A;  3P90 A;  1AQX A;  1FOV A;  4POB A;  12GS A;  4N0V A;  1T1V A;  2R3X A;  2C8U A;  1TU8 A;  5AIS A;  5IIZ A;  3G9B A;  5E4W A;  4I5Q A;  2HRK B;  3KTB A;  3TOT A;  2IIY A;  4HI7 A;  2LJA A;  1H4O A;  3VFI A;  2JL4 A;  4D73 A;  3Q18 A;  3LG6 A;  1F3B A;  4N10 A;  1SD9 A;  4IP6 A;  1XW9 A;  3TRQ A;  1E6B A;  2H76 A;  2WDU A;  4WBR D;  5F8B A;  3D22 A;  3LXT A;  2AV4 A;  4NXI A;  11GS A;  1TI1 A;  4KW6 A;  3GKK A;  1EEJ A;  3HYP A;  3D4M A;  4DVC A;  4G0K A;  3U5R E;  1X5D A;  1O7U A;  6GSV A;  1PL1 A;  18GS A;  4POM A;  2WS2 A;  2WB9 A;  2QKE A;  5IMA A;  1OKD A;  4MLY A;  1PX6 A;  3M3M A;  5H5R A;  1FB6 A;  3C1S A;  2H0H A;  3F4R A;  1TKD B;  5H5Q A;  4MJA A;  4NAX A;  1O85 A;  2Z9S A;  3WGD A;  1R7H A;  1LBK A;  4PTS A;  2G0F A;  2VAF A;  5DAK B;  1PA3 A;  1HYU A;  4PX1 A;  3GH6 A;  4GF0 A;  2PBJ A;  4MH3 A;  3CTG A;  1Z5Y E;  2B6M A;  1R4W A;  1GSE A;  1MEK A;  2C3T A;  4BWQ A;  2C3N A;  2IL3 A;  4TR1 B;  4YAV A;  3R3E A;  3DEX A;  4NPB A;  1ZYE A;  2OA7 A;  2HT9 A;  2GQM A;  2YPM A;  1R26 A;  1I9D A;  1GWC A;  2YAN A;  5IPG A;  4OCE A;  1V9W A;  1VGL A;  2HFD A;  5G31 A;  2B5E A;  4MZB A;  2H19 A;  2OAD A;  3KJY A;  4F9Z A;  1AUC A;  5CAX A;  4QL9 A;  5ECP B;  1F2E A;  1H75 A;  3J7Y k;  3ERF A;  3C8E A;  2KUC A;  3F4S A;  3ZML A;  2LJK A;  6GSX A;  1K3O A;  2VL9 A;  1M7T A;  1V58 A;  1K0D A;  2CVB A;  4POL A;  4ML1 A;  3SWL A;  2WGR A;  2N5A A;  4OO5 A;  3ZVJ D;  3A3T A;  3GKX A;  1TDI A;  2H8L A;  5GST A;  2WCI A;  2FA8 A;  3F3R A;  1SD8 A;  1M2B A;  1EGO A;  3ERW A;  4X1U A;  5DCG A;  1OE8 A;  2GVP A;  3GNJ A;  3HHV A;  3KIJ A;  2GDR A;  3TB2 A;  1G7O A;  4KDX A;  4KA0 A;  5DAL B;  1YF0 A;  5CO3 A;  4O5R A;  4TR3 A;  2CVK A;  2YCD A;  1A0F A;  2K8V A;  4KSO A;  3DXB A;  4MK3 A;  3RHB A;  5AGY A;  2WJU A;  5ECS A;  5G2Z A;  5HFK A;  3TJF A;  4MZC A;  4MJB A;  5HR2 A;  1R5P A;  2B5Y A;  3W6G A;  1F9M A;  2V2G A;  4PQ1 A;  3Q74 A;  1G6Y A;  2LJR A;  1O8X A;  4LMW A;  2H01 A;  4WKW A;  3ERG A;  1ZOF A;  3GA4 A;  14GS A;  5IO2 A;  1QGV A;  1RW1 A;  2YWI A;  2E7P A;  4TXO A;  2TRC P;  2I4A A;  3GKN A;  1TXX A;  4BVX B;  3LOR A;  4NWY A;  2L6D A;  4IKH A;  4FYU A;  4ZIJ A;  3TKS E;  2CQ9 A;  2FWF A;  2OBK A;  4L5L A;  1Q98 A;  3QR6 A;  1G7E A;  2IME A;  2GSQ A;  4MF5 A;  2AYT A;  2VD1 A;  2KHP A;  4LL4 B;  4NMU A;  4F0C A;  2F9S A;  1G0T A;  5CRD A;  2R5G A;  3E3E A;  1K3L A;  3ZRE A;  4POK A;  1UN2 A;  3HCZ A;  5FWG A;  1SKS B;  4GSS A;  3IXR A;  2C4J A;  2H71 A;  3QDN A;  4GXZ A;  3TKS C;  1N2A A;  5G30 A;  3RPP A;  1TOF A;  4HQZ A;  3L78 A;  3HY2 A;  2HZE A;  2MYG A;  3TKR A;  2E0Q A;  4EL1 A;  5AIV A;  4GST A;  2YWO A;  3C1R A;  3ZTL A;  1TI3 A;  1X9S B;  1GUL A;  2H30 A;  5CRG A;  5COH A;  1V2A A;  4PGT A;  4PNG A;  3VWU A;  2HSH A;  2L4Q A;  1OC9 B;  4KAE A;  3FZA A;  1WRY A;  3BBY A;  3QFB C;  2H73 A;  4MP4 A;  4N11 A;  1PD2 1;  2H0I A;  4ULX A;  3M9K A;  3I6A A;  4GCI A;  2MBT A;  2C0D A;  4BL7 A;  3TJB A;  3HXS A;  4XCS A;  1GSU A;  2HRN A;  2OE3 A;  4NV5 A;  3J7Y b;  3HD5 A;  5DVB A;  4BVY B;  2FWE A;  5IOX A;  2DLX A;  4G9H A;  1OKT A;  3E9J B;  3ZL5 A;  5A4U A;  5LD0 A;  4BWS A;  4H86 A;  1FW1 A;  5HFI A;  2VLT A;  2DIY A;  2X8C A;  1ERU A;  3TRP A;  1X9M B;  4HU7 A;  2FLS A;  1V40 A;  1DUG A;  3BD2 A;  2DC5 A;  1U3A A;  3ZFL A;  4K7I A;  3A2V A;  3TKP A;  4F03 A;  17GS A;  4DSS B;  4ECC A;  3EC3 A;  3TJK A;  3EVI A;  3APS A;  4JBB A;  2GT5 A;  4MF7 A;  1WP0 A;  4HDE A;  1WMJ A;  3LGC A;  2O87 A;  4V2M A;  4YQV A;  2M80 A;  3TUE A;  3VWX A;  5ENU A;  2O7K A;  5JCG A;  1CQH A;  5HFG A;  4LMV A;  3MSZ A;  1HD2 A;  3AY8 A;  2HSM A;  1ZZY A;  1EOH A;  1YEP A;  4KCA A;  5LNK e;  1A24 A;  3IHQ A;  4MZW A;  4Q5N A;  1NW2 A;  1GRX A;  2HNL A;  4L0U A;  2VCX A;  5KN2 A;  3VK9 A;  4L8E A;  1PX7 A;  2RUF A;  3KM6 A;  2B3S A;  5CYY A;  3TGZ A;  3TDG A;  4IEL A;  2R6K A;  1GUM A;  4G19 A;  2CX3 A;  5J3R A;  3WT2 A;  2NBS A;  1JZW A;  1B4P A;  3F8U A;  1GP1 A;  2YWM A;  6GST A;  1MTC A;  3HDC A;  3Q6O A;  5JWO B;  2FNO A;  2LQQ A;  4N30 A;  1PN9 A;  3F9U A;  2G2Q A;  1XVW A;  3EUR A;  2BTO T;  1DE2 A;  4XS6 A;  4OD7 A;  4Q5Q A;  4MPG A;  3F4T A;  1PKZ A;  4PUR A;  4F0B A;  4YQM A;  3C7M A;  2VLU A;  2AJQ B;  3M9J A;  2YWN A;  4G0I A;  1SL0 B;  1GSF A;  3US3 A;  4G2E A;  3RHC A;  2LRT A;  2CAQ A;  2LTK A;  3G7Y A;  2H1D A;  1UC7 A;  2B5X A;  3CRT A;  1A2M A;  4MMM A;  1ZL9 A;  2HE3 A;  2GZZ A;  5F0G A;  3HZ4 A;  3N9J A;  5ECL B;  2B1K A;  3FHK A;  3KMO A;  2PU9 C;  3VI5 A;  5G1K A;  4OFT A;  1B9Y C;  3GUS A;  3CRU A;  4TXV A;  1AC1 A;  1XWC A;  2H6X A;  3TOU A;  1GTU A;  2IFQ A;  2RLI A;  3CSH A;  1B9X C;  3KXO A;  4IN0 A;  2GTU A;  3VUR A;  1K0N A;  3IC8 A;  2H0G A;  2VUP A;  4V1A g;  2H70 A;  2VM1 A;  5GAN D;  2PER A;  2FCH A;  1U3I A;  4V2L A;  4O7H A;  2XBQ A;  2IMI A;  2LST A;  1SK2 A;  3L0H A;  1MDJ A;  2HSN B;  2VD0 A;  3KGK A;  4ZBB A;  5C04 A;  2DJK A;  2FGX A;  4N0Z A;  3UVH A;  2MZC A;  4OO4 A;  1U88 A;  2VIM A;  3APQ A;  4NHW A;  1GNW A;  5D96 A;  3EU4 A;  5LCZ A;  3GMF A;  2H1B A;  2VLV A;  1O6J A;  3TJJ A;  1AQV A;  2IJY A;  5DJL A;  3IC4 A;  1ON4 A;  1UA5 A;  2LKU A;  3HZ8 A;  3G7I A;  4TVE A;  1O8W A;  1Z9H A;  1ACV A;  1EZK A;  3IOS A;  1GL8 A;  2JU5 A;  4OCF A;  3UL3 A;  4K7N A;  1X5E A;  1XXU A;  3RPN A;  5G5F A;  2F8A A;  3CTF A;  5EVO A;  2LS5 A;  2H72 A;  2VL3 A;  5ABR A;  4KDY A;  4JU5 A;  5BMU A;  3F63 A;  4QQ7 A;  1XWA A;  3KD0 A;  5IQY A;  1XIY A;  3RAZ A;  2B1L A;  3EMP A;  1X9W B;  3WYW A;  1BAY A;  2EIQ A;  3HJM A;  6GSW A; 
#chains in the Genus database with same CATH topology
 1XPV A;  2HXK A;  5A1N A;  2O85 A;  3N5O A;  2V6K A;  3UAR A;  3WGE A;  2HRF A;  1SL1 B;  3ME8 A;  5ELG A;  20GS A;  2WVX B;  3LSZ A;  4ZB9 A;  2MMA A;  4Z7X A;  2JZT A;  2KP2 A;  2A2R A;  4I6X A;  2LRN A;  1OAZ A;  4V1A p;  2GST A;  4RUV A;  1OE7 A;  3PGT A;  4JR4 A;  4MDC A;  2EIR A;  2FA4 A;  1V57 A;  2EFE A;  4V2N A;  3V1W A;  4K2D A;  3GTU B;  5D93 A;  3A5W A;  3DVW A;  3O6T A;  4RQX A;  2DBC A;  2YOI A;  5KN1 A;  5F07 A;  1BX9 A;  4K5S A;  3KZQ A;  2HZE B;  5D9V A;  1A8Y A;  5KN3 A;  2LRC A;  3H1N A;  6GSU A;  3GUR A;  2DSA A;  4IBP A;  3L9S A;  1JLV A;  2EC4 A;  4OWY A;  4EKZ A;  2CVD A;  4WBJ A;  2GQL A;  4KDU A;  4IP1 A;  2H1G A;  2GS3 A;  3EE2 A;  1BYE A;  4O32 A;  4HEA 2;  4KF9 A;  3DRN A;  4IVF A;  1BED A;  5FHI A;  2V6O A;  4O92 A;  4BA7 A;  2VL2 A;  4J57 E;  3DVX A;  6GSY A;  1YF1 A;  1M9B A;  2H6Z A;  2ALB A;  3PPU A;  2DKH A;  3H8Q A;  5A34 B;  4K8M A;  2IMK A;  5J5N A;  5ECI B;  3M8N A;  4E68 A;  4TRX A;  5ID2 B;  1ZYN A;  1EWX A;  2WUL A;  1FB0 A;  1O81 A;  2KLX A;  2X99 A;  4FYB A;  3KMN A;  3ZZX A;  1ZCP A;  5B8A A;  1SJZ A;  2HRK A;  3EIN A;  4ZXG A;  4KE3 A;  4TOP A;  3RDW A;  3KEB A;  1EV4 A;  5A5K A;  2GGT A;  2C0E A;  2HSM B;  1A2L A;  1QMV A;  5L71 A;  2I3Y A;  1TRV A;  2VL2 C;  4P3Y B;  2HSY A;  5J9B A;  4L5O A;  1Z6M A;  4YKF A;  1K0M A;  1YJ6 A;  3IAS 2;  2WW2 A;  2FHE A;  3NOF A;  3KH9 A;  2YZU A;  3BJ5 A;  4K0G A;  4ECJ A;  1E2Y A;  4CW9 A;  4ZL7 A;  1QQ2 A;  2GSS A;  1TRU A;  5DDL A;  1MDK A;  3GX0 A;  5G1L A;  3HJP A;  2MMO A;  4KX4 A;  5AN1 A;  2HLS A;  3K8N A;  3UMA A;  1I1I P;  3GHA A;  4MAB A;  4HZ2 A;  3D5J A;  4I97 A;  3F6F A;  4Q5R A;  4JRR A;  3BOA A;  1S3C A;  1T4Y A;  1Y1U A;  1GTI A;  1J0F A;  5CRH A;  5ECM B;  1EP7 A;  2GZP A;  1K0B A;  3Q19 A;  1GSQ A;  2AHE A;  1JHB A;  3I9V 2;  3VI7 A;  2OAC A;  2IN3 A;  2XC2 A;  4E8E A;  1MDI A;  4HJ2 A;  1M9A A;  3W8S A;  3LFL A;  2JAD A;  2GQK A;  5CNW A;  3HVV A;  1EP8 A;  4ICY A;  2IMF A;  4TR1 A;  3GFK A;  4IW9 A;  1BG5 A;  4DSR A;  5F05 A;  2DMM A;  4XRD A;  4TKY A;  1X0R A;  5IMZ A;  1K3Y A;  4JED A;  2ES7 A;  2L5L A;  2WW0 A;  1YVL A;  1YDK A;  2P5Q A;  5D9T A;  2ZNM A;  1F3A A;  3FR9 A;  1SL2 B;  2OT3 A;  4IQA A;  4Z2T A;  1OYJ A;  2MMN A;  2B7J A;  3DYR A;  3GL3 A;  4K9Z A;  1VF1 A;  4AGS A;  3GX8 A;  3FRC A;  1QFN A;  4EXJ A;  5GSS A;  4EO3 A;  1HNB A;  2K6V A;  2DJ3 A;  4GRF A;  3FZ4 A;  4WR4 A;  3LJR A;  5IMV A;  5INY A;  1V98 A;  1TJD A;  3KP8 A;  3KP9 A;  1W89 A;  4ZB8 A;  5E59 A;  4KUN A;  3ZIT A;  3IA1 A;  1LU4 A;  1JZD A;  2YN1 A;  1TW9 A;  5HR0 A;  2A2S A;  2F8F A;  5DAL A;  2TIR A;  5IO0 A;  2XHF A;  3KH7 A;  4HSC X;  4IJ3 A;  3O3T A;  1A0R P;  5DQY A;  2YNX A;  3ZLP A;  1ST9 A;  4DEJ A;  4K2X A;  1SYX A;  2DIZ A;  3OR5 A;  1C72 A;  3GKM A;  1U6T A;  3IK9 A;  4EE0 A;  5D73 A;  2R37 A;  5AIX A;  5ECQ B;  1B8X A;  2LUS A;  5ECR B;  4AF2 A;  4D73 B;  4PXO A;  5IMC A;  3HMJ G;  5J41 A;  1J9B A;  1IYH A;  3GH9 A;  2L57 A;  3D0Z A;  1SYR A;  1WPI A;  3A2W A;  2C3Q A;  1WOU A;  1A2J A;  1SVL A;  4DSQ A;  1S3A A;  2GLR A;  2C0G A;  2YJH A;  1IYI A;  2LQO A;  1XW6 A;  3WT1 A;  5A1N B;  4ZBA A;  3FR3 A;  2O89 A;  2J9H A;  2NPB A;  1SJ6 A;  4X43 A;  3LYK A;  5ECK B;  2C0F A;  4LL1 B;  1HNA A;  4L0W A;  4X4J A;  2D2Z A;  4Q5F A;  1DSB A;  4TR0 A;  1TK8 B;  4LLR A;  3IK7 A;  5ELA A;  3ZFB A;  2OBI A;  2FD3 A;  4FYC A;  1QK8 A;  1GSS A;  2WFC A;  4AJ7 A;  4HUA A;  1VF2 A;  4EC0 A;  2IMD A;  1USB A;  5F06 A;  1K0O A;  4MPF A;  2P5R A;  1U87 A;  3EU3 A;  2C1Y A;  2XPD A;  2NDO A;  2M46 A;  1OC9 A;  1TU7 A;  2XPE A;  2YZH A;  1TTZ A;  2O5V A;  2YV7 A;  1ABA A;  4BIK A;  3QFA C;  4HS1 A;  4PNF A;  2VO4 A;  1AQW A;  2JZR A;  3H93 A;  5A4V A;  1XG8 A;  1YKC A;  4XTS A;  2M72 A;  1TK0 B;  5DQS A;  2V1M A;  4ZB7 A;  3GL5 A;  4OFN A;  1Z7P A;  3QAG A;  4IHU A;  3FK8 A;  2PWJ A;  2EIO A;  2GZY A;  2OJL A;  3UEM A;  4BVY A;  1SK0 A;  3TCO A;  4MA9 A;  2H1A A;  1G6W A;  1JLW A;  3ZIV A;  2P31 A;  3CSI A;  5D8I A;  2HI7 A;  2VCQ A;  1OVN A;  3CXG A;  3FZ9 A;  2I9H A;  4HQS A;  3UVT A;  3QD9 A;  4RI7 A;  5KOW A;  1EV9 A;  3U6V A;  2GSR A;  3TKQ A;  1AW9 A;  2KOK A;  2IWT A;  1GTB A;  5DJM A;  3IE3 A;  2I1U A;  1YQ1 A;  3FMW A;  1HNC A;  13GS A;  4RI6 A;  2BMX A;  4FH8 A;  2JAC A;  3EWL A;  1WIK A;  1NHY A;  2DJ1 A;  4TW5 A;  2QA1 A;  3UIW A;  2MBS A;  1JZO A;  2FUG 2;  2LNS A;  1XCC A;  2CX4 A;  5KEJ A;  2V32 A;  2LEG A;  2RUE A;  5IOW A;  4KH7 A;  3QAW A;  4WXT A;  2F51 A;  2CT6 A;  2AB6 A;  2R4V A;  4HJM A;  2CV4 A;  4X0X A;  1S4B P;  1HQO A;  2FY6 A;  4NV2 A;  3H4K A;  3A2X A;  3QOU A;  1DE1 A;  2ON7 A;  1GSD A;  3FYG A;  2J23 A;  2I81 A;  1JFU A;  1ZGN A;  1TRW A;  1GTA A;  1XOA A;  1VRS D;  4KND A;  4AJ6 A;  4K1F A;  5IM9 A;  5D9X A;  4ECI A;  1XWK A;  4USS A;  1A8L A;  2VKZ G;  1O73 A;  5ECO B;  3PIN A;  2X8H A;  5EL8 A;  4TXO B;  1WWJ A;  3D4T A;  2PMT A;  1R5A A;  3UBK A;  2DJJ A;  2R2J A;  3MYD A;  2ON5 A;  3DKS A;  1XW5 A;  1FHE A;  1AIU A;  4HOJ A;  1EOG A;  3GRX A;  2JZS A;  1PN0 A;  2P0G A;  2REM A;  4I2T A;  3LQ7 A;  1S3R A;  2K8S A;  4AKG A;  3FR6 A;  3CSJ A;  4CY8 A;  1NM3 A;  5B6N A;  1QXH A;  3HVS A;  2PUK C;  3L4N A;  1QUW A;  7GSS A;  1K0A A;  3DML A;  4CDO A;  4OFM A;  2CZ2 A;  4PQI A;  3HJO A;  1PSQ A;  4GLT A;  3WGX A;  2RM6 A;  1XWG A;  2A2P A;  3F3Q A;  4KB3 A;  1Y25 A;  3EYT A;  3CBU A;  4HU9 A;  2VCZ A;  1X5C A;  4EDZ A;  3NZN A;  2H66 A;  1B48 A;  1BQ7 A;  1XOB A;  3P2A A;  2ZUP A;  3FW2 A;  3FEU A;  3PR8 A;  3G7J A;  1DBY A;  2E2G A;  4BL7 B;  5ECN B;  5J4U A;  4ML6 A;  2PVQ A;  1Q4J A;  2OKA A;  2H74 A;  2YJ7 A;  4YH2 A;  2AUV A;  1UVZ A;  5HR3 A;  2HSN A;  4FO5 A;  1WE0 A;  3ISO A;  4MJC A;  4F82 A;  2DJ2 A;  2JSZ A;  3UJ1 A;  3GST A;  4ZL8 A;  4BPY A;  2UV8 G;  2OE0 A;  4YQU A;  1M3J A;  1KEB A;  2HQT A;  4ID0 A;  3IHG A;  4I8B A;  3JCM L;  4WF5 A;  2X8G A;  4XS4 A;  1SJI A;  1EEM A;  1Y6E A;  1TP9 A;  3IDV A;  1PL2 A;  3VWV A;  5B7C A;  4ZIL A;  2TRX A;  3I69 A;  1PRX A;  2H1L A;  3GSS A;  2FWG A;  4WEY A;  3FKF A;  1RK4 A;  4WR5 A;  5IPH A;  4G01 A;  5B6M A;  4XIH A;  3F0I A;  1J08 A;  4PQH A;  4J2F A;  4KSM A;  1MD3 A;  4MH2 A;  1T3B A;  3ZVJ A;  2ZCT A;  4RQR A;  4EF0 A;  5J40 A;  4PUF C;  1URM A;  3CWG A;  1NHO A;  3UOM A;  1A23 A;  4ZB6 A;  2DML A;  2IPA A;  2PGT A;  3APO A;  2V41 A;  3HVX A;  5HR1 A;  3TKS A;  2K9F A;  2YV9 A;  3PH9 A;  1ILO A;  3VPT A;  5EPF A;  3ZRD A;  1FAA A;  1I5G A;  4IS0 A;  4YAP A;  2VCW A;  2CZ3 A;  1RQM A;  1XWB A;  5HQP A;  1GSY A;  2C80 A;  1YZX A;  3HA9 A;  3FZ5 A;  1OC8 A;  4EUY A;  5B8B A;  2HRA A;  2YP6 A;  3S9F A;  3GIX A;  2WVX A;  3ED3 A;  3LWA A;  3HKR A;  2VCV A;  4PUA A;  3CMI A;  4GWR A;  3UBL A;  1EGR A;  19GS A;  1JZR A;  2VOC A;  5DAK A;  1KTE A;  4OMV A;  2DJ0 A;  5CP1 A;  3GTU A;  3RFR C;  3L9U A;  3O76 A;  2N5B A;  3VWW A;  3DD3 A;  1VF3 A;  5J9C A;  3DGQ A;  3W8J A;  2N5F A;  3QCP A;  4MF6 A;  3C71 A;  1SU9 A;  2RII A;  1XFL A;  5G5E A;  1ZMA A;  5H5S A;  2UZ8 A;  4IGJ A;  3GYK A;  3A5I A;  4GTU A;  4FIW A;  2H6Y A;  3DIE A;  1T4Z A;  4IJI A;  2L6C A;  3SBC A;  3IBH A;  4ISD A;  2PN8 A;  3VPQ A;  5D9W A;  2BJX A;  4KCE A;  1M99 A;  1N8J A;  3ME7 A;  2IFQ B;  5A5H A;  3MWH A;  2H75 A;  1FG4 A;  1ZYQ B;  4E8H A;  4EVM A;  5BRT A;  1AXD A;  4QL7 A;  1PQN A;  4XS1 A;  2WRT A;  4K6X A;  1GUH A;  1TRS A;  1FO5 A;  22GS A;  1PGT A;  2F3M A;  4LA1 A;  4GSN A;  4FQU A;  3R2Q A;  5JCU A;  2X64 A;  1T8E B;  3ZIJ A;  5ECH B;  5J4V A;  2QSI A;  2X4A A;  3ZMK A;  1SK1 A;  1FVJ A;  4JE1 A;  5CRW A;  5GZZ B;  1W4V A;  2VM2 A;  5JWR B;  5ID2 A;  2NVL A;  2E2M A;  2L59 A;  3D6I A;  4JZQ A;  2NTO A;  2KP1 A;  2AAW A;  5IMF A;  3P8W A;  2GT6 A;  1XBS A;  1M2D A;  1F37 A;  1LJR A;  3LEF A;  1B4Q A;  4KGI A;  2QC7 A;  4ZL9 A;  2HZF A;  4YKG A;  3I43 A;  4Z2U A;  2PPT A;  5JCW A;  3F6D A;  1AAZ A;  4WF4 A;  4JR6 A;  4G0L A;  2A4V A;  2L4C A;  1CQG A;  6GSS A;  3H79 A;  5DBQ A;  4NHZ A;  5JWQ B;  4MJE A;  4AJ8 A;  5KN0 A;  5KOX A;  4BVX A;  5BMU B;  1XZO A;  1GUK A;  3LYP A;  4ECB A;  2RM5 A;  4MCU A;  1KBN A;  4TN8 A;  4CHS A;  1YY7 A;  2VCT A;  1XVQ A;  1GNE A;  1GLQ A;  5FT3 A;  2LV3 A;  3RBT A;  5A4W A;  4K7O A;  5GAP D;  1K0C A;  1OC3 A;  9GSS A;  5DCH A;  16GS A;  3LXZ A;  3CYN A;  1TK5 B;  1T7P B;  1WJK A;  1ML6 A;  8GSS A;  4IQ1 A;  1Z3E A;  4TR4 A;  3MNG A;  2XBI A;  4I2U A;  5CRE A;  3WD6 A;  2FWH A;  1NSW A;  1GH2 A;  1SEN A;  2CAI A;  2CA8 A;  2HYX A;  3M0F A;  3VLN A;  1M2A A;  1BJX A;  1VF4 A;  3BCI A;  4Z2R A;  1MD4 A;  1S3D A;  2EFH A;  1ERW A;  2PVO C;  3MAK A;  1KNG A;  1YKA A;  2O8V B;  4FXY P;  3IR4 A;  2WZ9 A;  3QAV A;  3TJG A;  1YEX A;  1PKW A;  1Z6N A;  2EFD A;  10GS A;  2MMZ A;  3GN3 A;  3GV1 A;  3DWV A;  2JSY A;  5EY6 A;  3QMX A;  3QPM A;  3TRX A;  3BCK A;  1PMT A;  3P7X A;  2WZS A;  2LNT A;  3IAM 2;  1Z7R A;  4G10 A;  3C73 A;  1GLP A;  4ZBD A;  4XHM A;  3MDK A;  1THO A;  4WET A;  3FY7 A;  4QMK A;  4J56 E;  1M0U A;  4EIP A;  5J47 A;  2K18 A;  1THX A;  4K0N A;  3IRA A;  1FVK A;  5C00 A;  2L5O A;  3ZYW A;  3E0U A;  4EDY A;  4F2I A;  4DSS A;  4ACS A;  3IPZ A;  3EMX A;  2B7K A;  4ILF A;  1F6M C;  4GQC A;  2WVZ A;  1ERT A;  3NIV A;  1T00 A;  3KCM A;  1SKR B;  3D21 A;  3M1G A;  1SKW B;  4XRA A;  4GDF A;  1ERV A;  4GQF A;  4XS4 B;  4HZ4 A;  2OE1 A;  2QGV A;  3KTL A;  3IV4 A;  3UAP A;  5IMD A;  3L9V A;  3P90 A;  1AQX A;  4O5Q A;  4POB A;  1FOV A;  12GS A;  4N0V A;  1T1V A;  2R3X A;  4W66 A;  2C8U A;  4AKX B;  1TU8 A;  5AIS A;  5IIZ A;  3G9B A;  5E4W A;  4I5Q A;  2HRK B;  3KTB A;  3TOT A;  2IIY A;  2A4H A;  4HI7 A;  2LJA A;  1H4O A;  3VFI A;  2JL4 A;  4D73 A;  3Q18 A;  3LG6 A;  1F3B A;  4A5P A;  4N10 A;  1SD9 A;  4IP6 A;  1XW9 A;  1BG1 A;  3TRQ A;  4O5U A;  1E6B A;  2H76 A;  2DKI A;  2WDU A;  4WBR D;  5F8B A;  3D22 A;  2WW3 A;  3LXT A;  2AV4 A;  2EFC A;  1BF5 A;  4NXI A;  11GS A;  1TI1 A;  4KW6 A;  3GKK A;  1EEJ A;  3HYP A;  3D4M A;  4DVC A;  4G0K A;  3U5R E;  1X5D A;  1O7U A;  6GSV A;  1PL1 A;  18GS A;  4POM A;  2WS2 A;  2WB9 A;  2QKE A;  5IMA A;  1OKD A;  4MLY A;  1PX6 A;  3M3M A;  5H5R A;  1FB6 A;  3C1S A;  2H0H A;  3F4R A;  1TKD B;  5H5Q A;  4PHZ C;  4NAX A;  4MJA A;  1O85 A;  2Z9S A;  3WGD A;  1R7H A;  1LBK A;  4PTS A;  2G0F A;  2VAF A;  5DAK B;  1PA3 A;  1HYU A;  4PX1 A;  3GH6 A;  4GF0 A;  2PBJ A;  4MH3 A;  3CTG A;  1Z5Y E;  2B6M A;  1R4W A;  1GSE A;  1MEK A;  2C3T A;  4BWQ A;  2C3N A;  2IL3 A;  4TR1 B;  4YAV A;  3R3E A;  3DEX A;  4NPB A;  1ZYE A;  2OA7 A;  2HT9 A;  2GQM A;  2O3E A;  2YPM A;  1R26 A;  1I9D A;  1GWC A;  2YAN A;  5IPG A;  4OCE A;  1V9W A;  1VGL A;  2HFD A;  5G31 A;  2B5E A;  4MZB A;  2H19 A;  2OAD A;  3KJY A;  4F9Z A;  1AUC A;  5CAX A;  4QL9 A;  5ECP B;  1F2E A;  5A5H B;  1H75 A;  3J7Y k;  3ERF A;  3C8E A;  2KUC A;  3F4S A;  3ZML A;  2LJK A;  6GSX A;  1K3O A;  2VL9 A;  1M7T A;  1V58 A;  1K0D A;  2CVB A;  4POL A;  4ML1 A;  3SWL A;  3CQF A;  2WGR A;  3EPT A;  2N5A A;  4OO5 A;  3ZVJ D;  3A3T A;  3GKX A;  1TDI A;  2H8L A;  5GST A;  2WCI A;  2FA8 A;  3F3R A;  1SD8 A;  1M2B A;  1EGO A;  3ERW A;  4X1U A;  5DCG A;  1OE8 A;  2GVP A;  3GNJ A;  3HHV A;  3KIJ A;  2GDR A;  3TB2 A;  3HVN A;  1ZYP A;  1G7O A;  4KDX A;  4KA0 A;  5DAL B;  1YF0 A;  5CO3 A;  4O5R A;  4CY6 A;  4TR3 A;  2CVK A;  2YCD A;  1A0F A;  2K8V A;  4AKH A;  4AKI A;  4KSO A;  3DXB A;  4MK3 A;  3RHB A;  5AGY A;  2WJU A;  5ECS A;  5G2Z A;  5HFK A;  3TJF A;  4MZC A;  4MJB A;  5HR2 A;  1SVO A;  1R5P A;  2B5Y A;  3W6G A;  1F9M A;  2V2G A;  4PQ1 A;  3Q74 A;  1G6Y A;  3CHX C;  2LJR A;  1O8X A;  4LMW A;  2H01 A;  4WKW A;  3ERG A;  1ZOF A;  3GA4 A;  14GS A;  2WW1 A;  5IO2 A;  1QGV A;  1RW1 A;  2YWI A;  2E7P A;  4TXO A;  2TRC P;  2I4A A;  3GKN A;  1TXX A;  4BVX B;  3LOR A;  4NWY A;  2L6D A;  4IKH A;  4FYU A;  4ZIJ A;  3TKS E;  2CQ9 A;  2FWF A;  2OBK A;  4L5L A;  1Q98 A;  3QR6 A;  1G7E A;  2IME A;  2GSQ A;  4MF5 A;  2AYT A;  2VD1 A;  2KHP A;  4LL4 B;  4NMU A;  4F0C A;  2F9S A;  1G0T A;  5CRD A;  2R5G A;  3E3E A;  1K3L A;  3ZRE A;  4POK A;  1UN2 A;  3HCZ A;  5FWG A;  1SKS B;  4GSS A;  3IXR A;  2C4J A;  2H71 A;  3QDN A;  4GXZ A;  3TKS C;  1N2A A;  4PI2 C;  5G30 A;  3RPP A;  1TOF A;  4HQZ A;  2WVY A;  2R0P A;  3L78 A;  3HY2 A;  2HZE A;  2MYG A;  3TKR A;  2E0Q A;  4EL1 A;  5AIV A;  4GST A;  2YWO A;  3C1R A;  3ZTL A;  1TI3 A;  1X9S B;  1GUL A;  2H30 A;  5CRG A;  5COH A;  1V2A A;  4PGT A;  4PNG A;  3VWU A;  2HSH A;  2L4Q A;  1OC9 B;  4KAE A;  3FZA A;  1WRY A;  3BBY A;  3QFB C;  2H73 A;  4MP4 A;  4N11 A;  1PD2 1;  2H0I A;  4ULX A;  3M9K A;  3I6A A;  4GCI A;  2MBT A;  1SVM A;  2C0D A;  4BL7 A;  3TJB A;  3HXS A;  4XCS A;  3LW9 A;  1GSU A;  2HRN A;  2OE3 A;  4NV5 A;  3J7Y b;  3HD5 A;  5DVB A;  4BVY B;  2FWE A;  5IOX A;  2DLX A;  4G9H A;  1OKT A;  3E9J B;  3ZL5 A;  2R0C A;  5A4U A;  5LD0 A;  4BWS A;  4H86 A;  1YEW C;  1FW1 A;  5HFI A;  2VLT A;  2DIY A;  2X8C A;  5A34 A;  1ERU A;  3TRP A;  4HU7 A;  2FLS A;  1X9M B;  1V40 A;  2O36 A;  1DUG A;  3BD2 A;  2DC5 A;  3MIX A;  1U3A A;  3ZFL A;  4K7I A;  3A2V A;  3TKP A;  4F03 A;  3RGB C;  17GS A;  4DSS B;  4ECC A;  3EC3 A;  3TJK A;  3EVI A;  3APS A;  4JBB A;  2GT5 A;  4MF7 A;  1WP0 A;  4HDE A;  1WMJ A;  3LGC A;  2O87 A;  4V2M A;  4YQV A;  2M80 A;  3TUE A;  3VWX A;  5ENU A;  2O7K A;  5JCG A;  1CQH A;  5HFG A;  4LMV A;  3MSZ A;  1HD2 A;  3AY8 A;  2HSM A;  1ZZY A;  1EOH A;  1YEP A;  4KCA A;  5LNK e;  1A24 A;  3IHQ A;  4MZW A;  4Q5N A;  1NW2 A;  1GRX A;  2HNL A;  4L0U A;  2VCX A;  5KN2 A;  3VK9 A;  4L8E A;  1PX7 A;  2RUF A;  3KM6 A;  2B3S A;  5CYY A;  3TGZ A;  3TDG A;  4IEL A;  2R6K A;  1GUM A;  4G19 A;  2CX3 A;  5J3R A;  3WT2 A;  2NBS A;  1JZW A;  1B4P A;  3F8U A;  1GP1 A;  2YWM A;  6GST A;  1MTC A;  3HDC A;  3Q6O A;  5JWO B;  2FNO A;  2LQQ A;  1PFO A;  4N30 A;  1PN9 A;  3F9U A;  2G2Q A;  1XVW A;  3EUR A;  4K5R A;  2BTO T;  1DE2 A;  4XS6 A;  4OD7 A;  4Q5Q A;  4MPG A;  3F4T A;  1PKZ A;  4PUR A;  4F0B A;  3TU3 B;  2R0G A;  4YQM A;  3C7M A;  2VLU A;  2AJQ B;  3M9J A;  2YWN A;  4G0I A;  1SL0 B;  1GSF A;  4PI0 C;  3US3 A;  4G2E A;  3RHC A;  2LRT A;  2CAQ A;  2LTK A;  3G7Y A;  2H1D A;  1UC7 A;  2B5X A;  3CRT A;  1A2M A;  4MMM A;  1ZL9 A;  2HE3 A;  2GZZ A;  5F0G A;  3HZ4 A;  3N9J A;  5ECL B;  2B1K A;  3FHK A;  3KMO A;  2PU9 C;  3VI5 A;  5G1K A;  4OFT A;  1B9Y C;  3GUS A;  3CRU A;  2QA2 A;  4TXV A;  1AC1 A;  1XWC A;  1N25 A;  2H6X A;  3TOU A;  1GTU A;  2IFQ A;  2RLI A;  3CSH A;  1B9X C;  3KXO A;  4IN0 A;  2GTU A;  3VUR A;  1K0N A;  3IC8 A;  2H0G A;  2VUP A;  4V1A g;  2H70 A;  2VM1 A;  5GAN D;  2PER A;  2FCH A;  1U3I A;  4V2L A;  4O7H A;  2XBQ A;  2IMI A;  1TXU A;  2LST A;  5J4Y A;  1SK2 A;  3L0H A;  1MDJ A;  2HSN B;  2VD0 A;  3KGK A;  4ZBB A;  5C04 A;  2DJK A;  2FGX A;  4N0Z A;  3UVH A;  2MZC A;  4OO4 A;  1U88 A;  2VIM A;  1M3I A;  3APQ A;  4NHW A;  1GNW A;  5D96 A;  3EU4 A;  5LCZ A;  3GMF A;  2H1B A;  2VLV A;  1O6J A;  3TJJ A;  1AQV A;  1FOH A;  2IJY A;  5DJL A;  4N3Z A;  3IC4 A;  1ON4 A;  1UA5 A;  2LKU A;  3HZ8 A;  3G7I A;  4TVE A;  1O8W A;  1Z9H A;  1ACV A;  1EZK A;  3IOS A;  2X49 A;  1GL8 A;  2JU5 A;  4OCF A;  3UL3 A;  4K7N A;  1X5E A;  1XXU A;  3RPN A;  4MNN A;  5G5F A;  2F8A A;  3CTF A;  5EVO A;  4AI6 A;  2LS5 A;  2H72 A;  2VL3 A;  5ABR A;  4KDY A;  4JU5 A;  5BMU A;  3F63 A;  4QQ7 A;  1XWA A;  3KD0 A;  5IQY A;  4EIQ A;  1XIY A;  3RAZ A;  2B1L A;  3EMP A;  1X9W B;  3WYW A;  1BAY A;  2EIQ A;  3HJM A;  6GSW A; 
#chains in the Genus database with same CATH homology
 1XPV A;  2HXK A;  5A1N A;  2O85 A;  3N5O A;  2V6K A;  3UAR A;  3WGE A;  2HRF A;  1SL1 B;  3ME8 A;  5ELG A;  20GS A;  3LSZ A;  4ZB9 A;  2MMA A;  4Z7X A;  2JZT A;  2KP2 A;  2A2R A;  4I6X A;  2LRN A;  1OAZ A;  4V1A p;  2GST A;  4RUV A;  1OE7 A;  3PGT A;  4JR4 A;  4MDC A;  2EIR A;  2FA4 A;  1V57 A;  2EFE A;  4V2N A;  3V1W A;  4K2D A;  3GTU B;  5D93 A;  3A5W A;  3DVW A;  3O6T A;  4RQX A;  2DBC A;  2YOI A;  5KN1 A;  5F07 A;  1BX9 A;  4K5S A;  3KZQ A;  2HZE B;  5D9V A;  1A8Y A;  5KN3 A;  2LRC A;  3H1N A;  6GSU A;  3GUR A;  2DSA A;  4IBP A;  3L9S A;  1JLV A;  2EC4 A;  4OWY A;  4EKZ A;  2CVD A;  4WBJ A;  2GQL A;  4KDU A;  4IP1 A;  2H1G A;  2GS3 A;  3EE2 A;  1BYE A;  4O32 A;  4HEA 2;  4KF9 A;  3DRN A;  4IVF A;  1BED A;  5FHI A;  2V6O A;  4O92 A;  4BA7 A;  2VL2 A;  4J57 E;  3DVX A;  6GSY A;  1YF1 A;  1M9B A;  2H6Z A;  2ALB A;  3PPU A;  2DKH A;  3H8Q A;  5A34 B;  4K8M A;  2IMK A;  5J5N A;  5ECI B;  3M8N A;  4E68 A;  4TRX A;  5ID2 B;  1ZYN A;  1EWX A;  2WUL A;  1FB0 A;  1O81 A;  2KLX A;  2X99 A;  4FYB A;  3KMN A;  3ZZX A;  1ZCP A;  5B8A A;  1SJZ A;  2HRK A;  3EIN A;  4ZXG A;  4KE3 A;  4TOP A;  3RDW A;  3KEB A;  1EV4 A;  5A5K A;  2GGT A;  2C0E A;  2HSM B;  1A2L A;  1QMV A;  5L71 A;  2I3Y A;  1TRV A;  2VL2 C;  4P3Y B;  2HSY A;  5J9B A;  4L5O A;  1Z6M A;  4YKF A;  1K0M A;  1YJ6 A;  3IAS 2;  2FHE A;  3NOF A;  3KH9 A;  2YZU A;  3BJ5 A;  4K0G A;  4ECJ A;  1E2Y A;  4CW9 A;  4ZL7 A;  1QQ2 A;  2GSS A;  1TRU A;  5DDL A;  1MDK A;  3GX0 A;  5G1L A;  3HJP A;  2MMO A;  4KX4 A;  5AN1 A;  2HLS A;  3K8N A;  3UMA A;  3GHA A;  4MAB A;  4HZ2 A;  3D5J A;  4I97 A;  3F6F A;  4Q5R A;  4JRR A;  3BOA A;  1S3C A;  1T4Y A;  1Y1U A;  1GTI A;  1J0F A;  5CRH A;  5ECM B;  1EP7 A;  2GZP A;  1K0B A;  3Q19 A;  1GSQ A;  2AHE A;  1JHB A;  3I9V 2;  3VI7 A;  2OAC A;  2IN3 A;  2XC2 A;  4E8E A;  1MDI A;  4HJ2 A;  1M9A A;  3W8S A;  3LFL A;  2JAD A;  2GQK A;  5CNW A;  3HVV A;  1EP8 A;  4ICY A;  2IMF A;  4TR1 A;  3GFK A;  4IW9 A;  1BG5 A;  4DSR A;  5F05 A;  2DMM A;  4XRD A;  4TKY A;  1X0R A;  5IMZ A;  1K3Y A;  4JED A;  2ES7 A;  2L5L A;  1YVL A;  1YDK A;  2P5Q A;  5D9T A;  2ZNM A;  1F3A A;  3FR9 A;  1SL2 B;  2OT3 A;  4IQA A;  4Z2T A;  1OYJ A;  2MMN A;  2B7J A;  3DYR A;  3GL3 A;  4K9Z A;  1VF1 A;  4AGS A;  3GX8 A;  3FRC A;  1QFN A;  4EXJ A;  5GSS A;  4EO3 A;  1HNB A;  2K6V A;  2DJ3 A;  4GRF A;  3FZ4 A;  4WR4 A;  3LJR A;  5IMV A;  5INY A;  1V98 A;  1TJD A;  3KP8 A;  3KP9 A;  1W89 A;  4ZB8 A;  5E59 A;  4KUN A;  3ZIT A;  3IA1 A;  1LU4 A;  1JZD A;  2YN1 A;  1TW9 A;  5HR0 A;  2A2S A;  2F8F A;  5DAL A;  2TIR A;  5IO0 A;  2XHF A;  3KH7 A;  4IJ3 A;  3O3T A;  1A0R P;  5DQY A;  2YNX A;  3ZLP A;  1ST9 A;  4DEJ A;  4K2X A;  1SYX A;  2DIZ A;  3OR5 A;  1C72 A;  3GKM A;  1U6T A;  3IK9 A;  4EE0 A;  5D73 A;  2R37 A;  5AIX A;  5ECQ B;  1B8X A;  2LUS A;  5ECR B;  4AF2 A;  4D73 B;  4PXO A;  5IMC A;  3HMJ G;  5J41 A;  1J9B A;  1IYH A;  3GH9 A;  2L57 A;  3D0Z A;  1SYR A;  1WPI A;  3A2W A;  2C3Q A;  1WOU A;  1A2J A;  1SVL A;  4DSQ A;  1S3A A;  2GLR A;  2C0G A;  2YJH A;  1IYI A;  2LQO A;  1XW6 A;  3WT1 A;  5A1N B;  4ZBA A;  3FR3 A;  2O89 A;  2J9H A;  2NPB A;  1SJ6 A;  4X43 A;  3LYK A;  5ECK B;  2C0F A;  4LL1 B;  1HNA A;  4L0W A;  4X4J A;  2D2Z A;  4Q5F A;  1DSB A;  4TR0 A;  1TK8 B;  4LLR A;  3IK7 A;  5ELA A;  3ZFB A;  2OBI A;  2FD3 A;  4FYC A;  1QK8 A;  1GSS A;  2WFC A;  4AJ7 A;  4HUA A;  1VF2 A;  4EC0 A;  2IMD A;  1USB A;  5F06 A;  1K0O A;  4MPF A;  2P5R A;  1U87 A;  3EU3 A;  2C1Y A;  2XPD A;  2NDO A;  2M46 A;  1OC9 A;  1TU7 A;  2XPE A;  2YZH A;  1TTZ A;  2O5V A;  2YV7 A;  1ABA A;  3QFA C;  4HS1 A;  4PNF A;  2VO4 A;  1AQW A;  2JZR A;  3H93 A;  5A4V A;  1YKC A;  4XTS A;  2M72 A;  1TK0 B;  5DQS A;  2V1M A;  4ZB7 A;  3GL5 A;  4OFN A;  1Z7P A;  3QAG A;  4IHU A;  3FK8 A;  2PWJ A;  2EIO A;  2GZY A;  2OJL A;  3UEM A;  4BVY A;  1SK0 A;  3TCO A;  4MA9 A;  2H1A A;  1G6W A;  1JLW A;  3ZIV A;  2P31 A;  3CSI A;  5D8I A;  2HI7 A;  2VCQ A;  1OVN A;  3CXG A;  3FZ9 A;  2I9H A;  4HQS A;  3UVT A;  3QD9 A;  4RI7 A;  5KOW A;  1EV9 A;  3U6V A;  2GSR A;  3TKQ A;  1AW9 A;  2KOK A;  2IWT A;  1GTB A;  5DJM A;  3IE3 A;  2I1U A;  1YQ1 A;  3FMW A;  1HNC A;  13GS A;  4RI6 A;  2BMX A;  4FH8 A;  2JAC A;  3EWL A;  1WIK A;  1NHY A;  2DJ1 A;  4TW5 A;  2QA1 A;  3UIW A;  2MBS A;  1JZO A;  2FUG 2;  2LNS A;  1XCC A;  2CX4 A;  5KEJ A;  2V32 A;  2LEG A;  2RUE A;  5IOW A;  4KH7 A;  3QAW A;  4WXT A;  2F51 A;  2CT6 A;  2AB6 A;  2R4V A;  4HJM A;  2CV4 A;  4X0X A;  1HQO A;  2FY6 A;  4NV2 A;  3H4K A;  3A2X A;  3QOU A;  1DE1 A;  2ON7 A;  1GSD A;  3FYG A;  2J23 A;  2I81 A;  1JFU A;  1ZGN A;  1TRW A;  1GTA A;  1XOA A;  1VRS D;  4KND A;  4AJ6 A;  4K1F A;  5IM9 A;  5D9X A;  4ECI A;  1XWK A;  4USS A;  1A8L A;  2VKZ G;  1O73 A;  5ECO B;  3PIN A;  2X8H A;  5EL8 A;  4TXO B;  1WWJ A;  3D4T A;  2PMT A;  1R5A A;  3UBK A;  2DJJ A;  2R2J A;  3MYD A;  2ON5 A;  3DKS A;  1XW5 A;  1FHE A;  1AIU A;  4HOJ A;  1EOG A;  3GRX A;  2JZS A;  1PN0 A;  2P0G A;  2REM A;  4I2T A;  3LQ7 A;  2K8S A;  4AKG A;  3FR6 A;  3CSJ A;  4CY8 A;  1NM3 A;  5B6N A;  1QXH A;  3HVS A;  2PUK C;  3L4N A;  1QUW A;  7GSS A;  1K0A A;  3DML A;  4CDO A;  4OFM A;  2CZ2 A;  4PQI A;  3HJO A;  1PSQ A;  4GLT A;  3WGX A;  2RM6 A;  1XWG A;  2A2P A;  3F3Q A;  4KB3 A;  1Y25 A;  3EYT A;  3CBU A;  4HU9 A;  2VCZ A;  1X5C A;  4EDZ A;  3NZN A;  2H66 A;  1B48 A;  1BQ7 A;  1XOB A;  3P2A A;  2ZUP A;  3FW2 A;  3FEU A;  3PR8 A;  3G7J A;  1DBY A;  2E2G A;  4BL7 B;  5ECN B;  5J4U A;  4ML6 A;  2PVQ A;  1Q4J A;  2OKA A;  2H74 A;  2YJ7 A;  4YH2 A;  2AUV A;  1UVZ A;  5HR3 A;  2HSN A;  4FO5 A;  1WE0 A;  3ISO A;  4MJC A;  4F82 A;  2DJ2 A;  2JSZ A;  3UJ1 A;  3GST A;  4ZL8 A;  4BPY A;  2UV8 G;  2OE0 A;  4YQU A;  1KEB A;  2HQT A;  4ID0 A;  3IHG A;  4I8B A;  3JCM L;  4WF5 A;  2X8G A;  4XS4 A;  1SJI A;  1EEM A;  1Y6E A;  1TP9 A;  3IDV A;  1PL2 A;  3VWV A;  5B7C A;  4ZIL A;  2TRX A;  3I69 A;  1PRX A;  2H1L A;  3GSS A;  2FWG A;  4WEY A;  3FKF A;  1RK4 A;  4WR5 A;  5IPH A;  4G01 A;  5B6M A;  4XIH A;  3F0I A;  1J08 A;  4PQH A;  4J2F A;  4KSM A;  1MD3 A;  4MH2 A;  1T3B A;  3ZVJ A;  2ZCT A;  4RQR A;  4EF0 A;  5J40 A;  4PUF C;  1URM A;  3CWG A;  1NHO A;  3UOM A;  1A23 A;  4ZB6 A;  2DML A;  2IPA A;  2PGT A;  3APO A;  2V41 A;  3HVX A;  5HR1 A;  3TKS A;  2K9F A;  2YV9 A;  3PH9 A;  1ILO A;  3VPT A;  5EPF A;  3ZRD A;  1FAA A;  1I5G A;  4IS0 A;  4YAP A;  2VCW A;  2CZ3 A;  1RQM A;  1XWB A;  5HQP A;  1GSY A;  2C80 A;  1YZX A;  3HA9 A;  3FZ5 A;  1OC8 A;  4EUY A;  5B8B A;  2HRA A;  2YP6 A;  3S9F A;  3GIX A;  3ED3 A;  3LWA A;  3HKR A;  2VCV A;  4PUA A;  3CMI A;  4GWR A;  3UBL A;  1EGR A;  19GS A;  1JZR A;  2VOC A;  5DAK A;  1KTE A;  4OMV A;  2DJ0 A;  5CP1 A;  3GTU A;  3L9U A;  3O76 A;  2N5B A;  3VWW A;  3DD3 A;  1VF3 A;  5J9C A;  3DGQ A;  3W8J A;  2N5F A;  3QCP A;  4MF6 A;  3C71 A;  1SU9 A;  2RII A;  1XFL A;  5G5E A;  1ZMA A;  5H5S A;  2UZ8 A;  4IGJ A;  3GYK A;  3A5I A;  4GTU A;  4FIW A;  2H6Y A;  3DIE A;  1T4Z A;  4IJI A;  2L6C A;  3SBC A;  3IBH A;  4ISD A;  2PN8 A;  3VPQ A;  5D9W A;  2BJX A;  4KCE A;  1M99 A;  1N8J A;  3ME7 A;  2IFQ B;  5A5H A;  3MWH A;  2H75 A;  1FG4 A;  1ZYQ B;  4E8H A;  4EVM A;  5BRT A;  1AXD A;  4QL7 A;  1PQN A;  4XS1 A;  2WRT A;  4K6X A;  1GUH A;  1TRS A;  1FO5 A;  22GS A;  1PGT A;  2F3M A;  4LA1 A;  4GSN A;  4FQU A;  3R2Q A;  5JCU A;  2X64 A;  1T8E B;  3ZIJ A;  5ECH B;  5J4V A;  2QSI A;  2X4A A;  3ZMK A;  1SK1 A;  1FVJ A;  4JE1 A;  5CRW A;  5GZZ B;  1W4V A;  2VM2 A;  5JWR B;  5ID2 A;  2NVL A;  2E2M A;  2L59 A;  3D6I A;  4JZQ A;  2NTO A;  2KP1 A;  2AAW A;  5IMF A;  3P8W A;  2GT6 A;  1XBS A;  1M2D A;  1F37 A;  1LJR A;  3LEF A;  1B4Q A;  4KGI A;  2QC7 A;  4ZL9 A;  2HZF A;  4YKG A;  3I43 A;  4Z2U A;  2PPT A;  5JCW A;  3F6D A;  1AAZ A;  4WF4 A;  4JR6 A;  4G0L A;  2A4V A;  2L4C A;  1CQG A;  6GSS A;  3H79 A;  5DBQ A;  4NHZ A;  5JWQ B;  4MJE A;  4AJ8 A;  5KN0 A;  5KOX A;  4BVX A;  5BMU B;  1XZO A;  1GUK A;  3LYP A;  4ECB A;  2RM5 A;  4MCU A;  1KBN A;  4TN8 A;  4CHS A;  1YY7 A;  2VCT A;  1XVQ A;  1GNE A;  1GLQ A;  5FT3 A;  2LV3 A;  3RBT A;  5A4W A;  4K7O A;  5GAP D;  1K0C A;  1OC3 A;  9GSS A;  5DCH A;  16GS A;  3LXZ A;  3CYN A;  1TK5 B;  1T7P B;  1WJK A;  1ML6 A;  8GSS A;  4IQ1 A;  1Z3E A;  4TR4 A;  3MNG A;  2XBI A;  4I2U A;  5CRE A;  3WD6 A;  2FWH A;  1NSW A;  1GH2 A;  1SEN A;  2CAI A;  2CA8 A;  2HYX A;  3M0F A;  3VLN A;  1M2A A;  1BJX A;  1VF4 A;  3BCI A;  4Z2R A;  1MD4 A;  1S3D A;  2EFH A;  1ERW A;  2PVO C;  3MAK A;  1KNG A;  1YKA A;  2O8V B;  3IR4 A;  2WZ9 A;  3QAV A;  3TJG A;  1YEX A;  1PKW A;  1Z6N A;  2EFD A;  10GS A;  2MMZ A;  3GN3 A;  3GV1 A;  3DWV A;  2JSY A;  5EY6 A;  3QMX A;  3QPM A;  3TRX A;  3BCK A;  1PMT A;  3P7X A;  2LNT A;  3IAM 2;  1Z7R A;  4G10 A;  3C73 A;  1GLP A;  4ZBD A;  4XHM A;  3MDK A;  1THO A;  4WET A;  3FY7 A;  4QMK A;  4J56 E;  1M0U A;  4EIP A;  5J47 A;  2K18 A;  1THX A;  4K0N A;  3IRA A;  1FVK A;  5C00 A;  2L5O A;  3ZYW A;  3E0U A;  4EDY A;  4F2I A;  4DSS A;  4ACS A;  3IPZ A;  3EMX A;  2B7K A;  4ILF A;  1F6M C;  4GQC A;  1ERT A;  3NIV A;  1T00 A;  3KCM A;  1SKR B;  3D21 A;  3M1G A;  1SKW B;  4XRA A;  4GDF A;  1ERV A;  4GQF A;  4XS4 B;  4HZ4 A;  2OE1 A;  2QGV A;  3KTL A;  3IV4 A;  3UAP A;  5IMD A;  3L9V A;  3P90 A;  1AQX A;  4O5Q A;  4POB A;  1FOV A;  12GS A;  4N0V A;  1T1V A;  2R3X A;  4W66 A;  2C8U A;  4AKX B;  1TU8 A;  5AIS A;  5IIZ A;  3G9B A;  5E4W A;  4I5Q A;  2HRK B;  3KTB A;  3TOT A;  2IIY A;  2A4H A;  4HI7 A;  2LJA A;  1H4O A;  3VFI A;  2JL4 A;  4D73 A;  3Q18 A;  3LG6 A;  1F3B A;  4A5P A;  4N10 A;  1SD9 A;  4IP6 A;  1XW9 A;  1BG1 A;  3TRQ A;  4O5U A;  1E6B A;  2H76 A;  2DKI A;  2WDU A;  4WBR D;  5F8B A;  3D22 A;  3LXT A;  2AV4 A;  2EFC A;  1BF5 A;  4NXI A;  11GS A;  1TI1 A;  4KW6 A;  3GKK A;  1EEJ A;  3HYP A;  3D4M A;  4DVC A;  4G0K A;  3U5R E;  1X5D A;  1O7U A;  6GSV A;  1PL1 A;  18GS A;  4POM A;  2WS2 A;  2WB9 A;  2QKE A;  5IMA A;  1OKD A;  4MLY A;  1PX6 A;  3M3M A;  5H5R A;  1FB6 A;  3C1S A;  2H0H A;  3F4R A;  1TKD B;  5H5Q A;  4MJA A;  4NAX A;  1O85 A;  2Z9S A;  3WGD A;  1R7H A;  1LBK A;  4PTS A;  2G0F A;  2VAF A;  5DAK B;  1PA3 A;  1HYU A;  4PX1 A;  3GH6 A;  4GF0 A;  2PBJ A;  4MH3 A;  3CTG A;  1Z5Y E;  2B6M A;  1R4W A;  1GSE A;  1MEK A;  2C3T A;  4BWQ A;  2C3N A;  2IL3 A;  4TR1 B;  4YAV A;  3R3E A;  3DEX A;  4NPB A;  1ZYE A;  2OA7 A;  2HT9 A;  2GQM A;  2YPM A;  1R26 A;  1I9D A;  1GWC A;  2YAN A;  5IPG A;  4OCE A;  1V9W A;  1VGL A;  2HFD A;  5G31 A;  2B5E A;  4MZB A;  2H19 A;  2OAD A;  3KJY A;  4F9Z A;  1AUC A;  5CAX A;  4QL9 A;  5ECP B;  1F2E A;  5A5H B;  1H75 A;  3J7Y k;  3ERF A;  3C8E A;  2KUC A;  3F4S A;  3ZML A;  2LJK A;  6GSX A;  1K3O A;  2VL9 A;  1M7T A;  1V58 A;  1K0D A;  2CVB A;  4POL A;  4ML1 A;  3SWL A;  2WGR A;  3EPT A;  2N5A A;  4OO5 A;  3ZVJ D;  3A3T A;  3GKX A;  1TDI A;  2H8L A;  5GST A;  2WCI A;  2FA8 A;  3F3R A;  1SD8 A;  1M2B A;  1EGO A;  3ERW A;  4X1U A;  5DCG A;  1OE8 A;  2GVP A;  3GNJ A;  3HHV A;  3KIJ A;  2GDR A;  3TB2 A;  1ZYP A;  1G7O A;  4KDX A;  4KA0 A;  5DAL B;  1YF0 A;  5CO3 A;  4O5R A;  4CY6 A;  4TR3 A;  2CVK A;  2YCD A;  1A0F A;  2K8V A;  4AKH A;  4AKI A;  4KSO A;  3DXB A;  4MK3 A;  3RHB A;  5AGY A;  2WJU A;  5ECS A;  5G2Z A;  5HFK A;  3TJF A;  4MZC A;  4MJB A;  5HR2 A;  1SVO A;  1R5P A;  2B5Y A;  3W6G A;  1F9M A;  2V2G A;  4PQ1 A;  3Q74 A;  1G6Y A;  2LJR A;  1O8X A;  4LMW A;  2H01 A;  4WKW A;  3ERG A;  1ZOF A;  3GA4 A;  14GS A;  5IO2 A;  1QGV A;  1RW1 A;  2YWI A;  2E7P A;  4TXO A;  2TRC P;  2I4A A;  3GKN A;  1TXX A;  4BVX B;  3LOR A;  4NWY A;  2L6D A;  4IKH A;  4FYU A;  4ZIJ A;  3TKS E;  2CQ9 A;  2FWF A;  2OBK A;  4L5L A;  1Q98 A;  3QR6 A;  1G7E A;  2IME A;  2GSQ A;  4MF5 A;  2AYT A;  2VD1 A;  2KHP A;  4LL4 B;  4NMU A;  4F0C A;  2F9S A;  1G0T A;  5CRD A;  2R5G A;  3E3E A;  1K3L A;  3ZRE A;  4POK A;  1UN2 A;  3HCZ A;  5FWG A;  1SKS B;  4GSS A;  3IXR A;  2C4J A;  2H71 A;  3QDN A;  4GXZ A;  3TKS C;  1N2A A;  5G30 A;  3RPP A;  1TOF A;  4HQZ A;  2R0P A;  3L78 A;  3HY2 A;  2HZE A;  2MYG A;  3TKR A;  2E0Q A;  4EL1 A;  5AIV A;  4GST A;  2YWO A;  3C1R A;  3ZTL A;  1TI3 A;  1X9S B;  1GUL A;  2H30 A;  5CRG A;  5COH A;  1V2A A;  4PGT A;  4PNG A;  3VWU A;  2HSH A;  2L4Q A;  1OC9 B;  4KAE A;  3FZA A;  1WRY A;  3BBY A;  3QFB C;  2H73 A;  4MP4 A;  4N11 A;  1PD2 1;  2H0I A;  4ULX A;  3M9K A;  3I6A A;  4GCI A;  2MBT A;  1SVM A;  2C0D A;  4BL7 A;  3TJB A;  3HXS A;  4XCS A;  3LW9 A;  1GSU A;  2HRN A;  2OE3 A;  4NV5 A;  3J7Y b;  3HD5 A;  5DVB A;  4BVY B;  2FWE A;  5IOX A;  2DLX A;  4G9H A;  1OKT A;  3E9J B;  3ZL5 A;  2R0C A;  5A4U A;  5LD0 A;  4BWS A;  4H86 A;  1FW1 A;  5HFI A;  2VLT A;  2DIY A;  2X8C A;  5A34 A;  1ERU A;  3TRP A;  4HU7 A;  2FLS A;  1X9M B;  1V40 A;  1DUG A;  3BD2 A;  2DC5 A;  3MIX A;  1U3A A;  3ZFL A;  4K7I A;  3A2V A;  3TKP A;  4F03 A;  17GS A;  4DSS B;  4ECC A;  3EC3 A;  3TJK A;  3EVI A;  3APS A;  4JBB A;  2GT5 A;  4MF7 A;  1WP0 A;  4HDE A;  1WMJ A;  3LGC A;  2O87 A;  4V2M A;  4YQV A;  2M80 A;  3TUE A;  3VWX A;  5ENU A;  2O7K A;  5JCG A;  1CQH A;  5HFG A;  4LMV A;  3MSZ A;  1HD2 A;  3AY8 A;  2HSM A;  1ZZY A;  1EOH A;  1YEP A;  4KCA A;  5LNK e;  1A24 A;  3IHQ A;  4MZW A;  4Q5N A;  1NW2 A;  1GRX A;  2HNL A;  4L0U A;  2VCX A;  5KN2 A;  3VK9 A;  4L8E A;  1PX7 A;  2RUF A;  3KM6 A;  2B3S A;  5CYY A;  3TGZ A;  3TDG A;  4IEL A;  2R6K A;  1GUM A;  4G19 A;  2CX3 A;  5J3R A;  3WT2 A;  2NBS A;  1JZW A;  1B4P A;  3F8U A;  1GP1 A;  2YWM A;  6GST A;  1MTC A;  3HDC A;  3Q6O A;  5JWO B;  2FNO A;  2LQQ A;  4N30 A;  1PN9 A;  3F9U A;  2G2Q A;  1XVW A;  3EUR A;  4K5R A;  2BTO T;  1DE2 A;  4XS6 A;  4OD7 A;  4Q5Q A;  4MPG A;  3F4T A;  1PKZ A;  4PUR A;  4F0B A;  3TU3 B;  2R0G A;  4YQM A;  3C7M A;  2VLU A;  2AJQ B;  3M9J A;  2YWN A;  4G0I A;  1SL0 B;  1GSF A;  3US3 A;  4G2E A;  3RHC A;  2LRT A;  2CAQ A;  2LTK A;  3G7Y A;  2H1D A;  1UC7 A;  2B5X A;  3CRT A;  1A2M A;  4MMM A;  1ZL9 A;  2HE3 A;  2GZZ A;  5F0G A;  3HZ4 A;  3N9J A;  5ECL B;  2B1K A;  3FHK A;  3KMO A;  2PU9 C;  3VI5 A;  5G1K A;  4OFT A;  1B9Y C;  3GUS A;  3CRU A;  2QA2 A;  4TXV A;  1AC1 A;  1XWC A;  1N25 A;  2H6X A;  3TOU A;  1GTU A;  2IFQ A;  2RLI A;  3CSH A;  1B9X C;  3KXO A;  4IN0 A;  2GTU A;  3VUR A;  1K0N A;  3IC8 A;  2H0G A;  2VUP A;  4V1A g;  2H70 A;  2VM1 A;  5GAN D;  2PER A;  2FCH A;  1U3I A;  4V2L A;  4O7H A;  2XBQ A;  2IMI A;  1TXU A;  2LST A;  5J4Y A;  1SK2 A;  3L0H A;  1MDJ A;  2HSN B;  2VD0 A;  3KGK A;  4ZBB A;  5C04 A;  2DJK A;  2FGX A;  4N0Z A;  3UVH A;  2MZC A;  4OO4 A;  1U88 A;  2VIM A;  3APQ A;  4NHW A;  1GNW A;  5D96 A;  3EU4 A;  5LCZ A;  3GMF A;  2H1B A;  2VLV A;  1O6J A;  3TJJ A;  1AQV A;  1FOH A;  2IJY A;  5DJL A;  4N3Z A;  3IC4 A;  1ON4 A;  1UA5 A;  2LKU A;  3HZ8 A;  3G7I A;  4TVE A;  1O8W A;  1Z9H A;  1ACV A;  1EZK A;  3IOS A;  2X49 A;  1GL8 A;  2JU5 A;  4OCF A;  3UL3 A;  4K7N A;  1X5E A;  1XXU A;  3RPN A;  4MNN A;  5G5F A;  2F8A A;  3CTF A;  5EVO A;  4AI6 A;  2LS5 A;  2H72 A;  2VL3 A;  5ABR A;  4KDY A;  4JU5 A;  5BMU A;  3F63 A;  4QQ7 A;  1XWA A;  3KD0 A;  5IQY A;  4EIQ A;  1XIY A;  3RAZ A;  2B1L A;  3EMP A;  1X9W B;  3WYW A;  1BAY A;  2EIQ A;  3HJM A;  6GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...