7GSSA

Human glutathione s-transferase p1-1, complex with glutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
publication title The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 7gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 7gssA01
3DRNA 4EO3A 4YQMA 4TN8A 3PH9A 3HZ4A 1R5AA 1X5CA 4OO5A 4XS6A 1HD2A 4HJ2A 1M7TA 3KP8A 2A2RA 1F6MC 2E2MA 1OYJA 4JBBA 1OC9B 3V1WA 20GSA 3UMAA 4I2UA 4Q5RA 1XWBA 4YAPA 5FT3A 1AUCA 2CAQA 3KMOA 2XPEA 2FLSA 1GRXA 4GTUA 5JWQB 3RHBA 3HCZA 2FA8A 1YKCA 1A23A 3VI5A 3KTLA 5ECHB 1MD3A 2IL3A 3GUSA 2C0DA 1M9AA 2M46A 3MWHA 2IMEA 5IMVA 2E7PA 2A4VA 5ABRA 18GSA 1T8EB 4ECBA 3F6FA 1SKWB 1USBA 2R2JA 10GSA 2H6ZA 1TXXA 3RAZA 3ZRDA 3VPTA 4DSSA 2QKEA 1UC7A 2HSYA 4TR1A 1SKSB 2VM2A 1KEBA 2HT9A 3TKRA 1A2JA 3FHKA 2HNLA 3E3EA 1BX9A 2FWEA 2KP1A 4F82A 4GLTA 2NDOA 4WBRD 1SJZA 1T1VA 1JZOA 2IMDA 3RDWA 1GNEA 1PRXA 1DSBA 1XFLA 2KHPA 1QUWA 3GKKA 4V2MA 4POBA 2HRAA 2UZ8A 2HRFA 1PL1A 4AF2A 1K3YA 4FYUA 3ERWA 2HI7A 3FR9A 4MK3A 3CTFA 3GKXA 3FEUA 4GWRA 4YQVA 1YY7A 3KGKA 3FR3A 1YDKA 2H70A 1QK8A 3K8NA 3ZIJA 6GSVA 4EE0A 2V6KA 4PUAA 4XRDA 4L0WA 1JHBA 2M72A 2EIQA 3QPMA 4PNGA 2B7JA 4K9ZA 4D73B 4DVCA 4O5RA 1AW9A 3VFIA 2HSHA 3L78A 5ELGA 3P2AA 2XPDA 3IOSA 17GSA 3L9UA 3UVTA 1Z3EA 2I3YA 2GVPA 4G0LA 11GSA 2X8GA 1THOA 5ID2A 1VF3A 5F05A 4NAXA 2RM5A 4YQUA 1PD21 1Z7PA 2K6VA 4XCSA 4PX1A 4MP4A 3W6GA 1VF1A 2K9FA 2VCVA 2WULA 1C72A 2FGXA 2H0IA 4V2NA 3EWLA 2O87A 2GQKA 1VF4A 3WT2A 3UEMA 1BJXA 5GZZB 1SK2A 3RPNA 1ERWA 2X8HA 4J57E 4OD7A 2IN3A 4CHSA 4K6XA 1QGVA 3EINA 2H1GA 5INYA 1SK1A 1EEMA 1U87A 2L5LA 1SL1B 5JCWA 3M0FA 1XXUA 4YAVA 1V57A 2H6XA 5KEJA 4V2LA 1Z5YE 6GSUA 2OE1A 2H76A 2P31A 2X8CA 5DJMA 2VL2C 3GHAA 3IV4A 5DJLA 3EU4A 1A0RP 3ED3A 4ZILA 4HUAA 1GSUA 3H8QA 2E0QA 4MPFA 1F3AA 1K0AA 4LA1A 3TRQA 4XHMA 5ENUA 2IIYA 4F0CA 4P3YB 1KNGA 2YWIA 1DE1A 1B4QA 1GWCA 1OC9A 3P8WA 3MAKA 5B7CA 5DCGA 1AQVA 2H1DA 2MMAA 3KTBA 3S9FA 3TJKA 1YEPA 1ZMAA 2V6OA 1SJIA 2QGVA 3IRAA 1A8YA 2LQOA 3VWWA 2H71A 5KN3A 2C1YA 5GAND 3UBKA 3EVIA 2CAIA 2H73A 2JSYA 1EP7A 4AJ6A 3TKSA 2H72A 4PQ1A 7GSSA 3P90A 2V2GA 3GH6A 3BCKA 1VGLA 1ACVA 1XPVA 5G5FA 3TKQA 1S3CA 3KCMA 4ZIJA 3IHQA 3FKFA 3UVHA 2BMXA 2O85A 2IJYA 1X9WB 2QC7A 5A5KA 22GSA 5KN2A 2HLSA 5H5QA 4IBPA 3E9JB 1GNWA 1PX6A 2YWOA 2XBIA 4GSSA 3LXZA 3PPUA 2F8AA 4IKHA 3TDGA 3GN3A 5LD0A 2I4AA 3A2WA 3UL3A 2A2SA 4RI6A 4ILFA 3CBUA 2RLIA 1DE2A 1FO5A 1PSQA 4NHZA 2YWNA 3TKPA 1QXHA 1TP9A 2TRCP 3GSSA 3IE3A 3M3MA 2GT5A 2B3SA 3I69A 3HYPA 5ELAA 2LJAA 1TKDB 1M0UA 4D73A 2VCZA 1FVJA 2LNSA 2TRXA 5IIZA 2O8VB 2AAWA 3IBHA 2XHFA 3IDVA 3M9JA 5EY6A 4I2TA 2P0GA 1SKRB 2GQMA 3ZMLA 2RIIA 2OA7A 5J41A 3KH7A 1OVNA 2YV9A 3GKNA 4J56E 2F8FA 1FB6A 5GAPD 4IJ3A 5IM9A 1GH2A 1K0BA 2L59A 3CYNA 5HFGA 2CZ3A 3QMXA 4K7IA 4EVMA 2GZYA 1JLWA 3ZTLA 13GSA 6GSTA 4KX4A 4CDOA 3TJBA 3TJGA 2ON5A 1TTZA 2GGTA 2WCIA 2PWJA 2WGRA 4HJMA 3TCOA 4OMVA 1MEKA 5COHA 2O89A 2ZCTA 4QL7A 5J9BA 4K0GA 2VL9A 2AYTA 4EC0A 4ZBAA 3VK9A 3TOUA 4WETA 3I43A 3GRXA 3QFAC 3TJFA 1ML6A 4FYBA 1OC8A 3LORA 5JCUA 1TJDA 3HJPA 3VLNA 4TKYA 3CXGA 2L4QA 2LJKA 4EDZA 1V9WA 4ML6A 3CSJA 2GT6A 2YZHA 4NPBA 1G6YA 4BA7A 1GL8A 3I6AA 2HRKB 2DJJA 3IC4A 3QAVA 4G0IA 5ECPB 4HU7A 1PA3A 2XC2A 2J9HA 2R37A 5CRGA 4GQCA 3J7Yk 5IPGA 4POLA 4KNDA 4F9ZA 1U88A 3O3TA 3Q19A 2N5BA 3EC3A 4GSTA 3O6TA 4ZXGA 4BL7B 1T4YA 1U3AA 5CRDA 1TRSA 3M1GA 3F4TA 3NIVA 5DDLA 5D93A 5HFIA 1PX7A 5ECSA 1MTCA 3SWLA 2AJQB 5B6NA 2GS3A 2JACA 1Z6MA 2WRTA 1FHEA 4BVXB 16GSA 4ISDA 1GLQA 1H75A 3HHVA 3KH9A 4IN0A 1PMTA 4X43A 2D2ZA 1MDIA 5DCHA 4KA0A 4MH2A 5EVOA 1GTUA 3R3EA 2LKUA 1N2AA 5B6MA 3GL3A 2VL2A 5ECIB 3JCML 2OE3A 3U5RE 5D96A 5D9WA 1GTAA 4IP6A 3GNJA 5D9XA 3O76A 1JLVA 2C3QA 5JWRB 3ZZXA 1ZZYA 4POKA 3DEXA 3A5WA 1THXA 2ES7A 3D21A 4ZB8A 3IAS2 1Z7RA 1WP0A 1TW9A 1XBSA 2X64A 2H0GA 3ZVJD 3ZVJA 3ZREA 4GCIA 3DKSA 1AXDA 4ZB9A 5EL8A 3SBCA 2DC5A 2BTOT 2VCXA 2LRNA 1PQNA 2KP2A 1A2LA 2OJLA 3FR6A 4ZL7A 4PGTA 1QFNA 2OKAA 1JFUA 1XIYA 2FCHA 3WGEA 2HQTA 4L8EA 4I8BA 3J7Yb 2K8SA 5CREA 2H30A 2FWFA 1NM3A 4KGIA 3AY8A 1SD9A 2HZFA 5G30A 4WF4A 2LQQA 1ST9A 5G2ZA 3N5OA 2M80A 4GSNA 4I6XA 1ZYEA 5IMAA 4RQXA 2ALBA 4NWYA 1EGRA 4QL9A 3ZLPA 2C3TA 2MZCA 2LS5A 3D4TA 3UAPA 2JZTA 1BG5A 1BAYA 2FY6A 1LJRA 1SJ6A 5IOWA 4GF0A 2HZEB 2L6CA 2X99A 2O7KA 4LLRA 1EEJA 1SL2B 3UIWA 2GDRA 1EZKA 4ZL9A 2GZZA 1GSEA 3OR5A 2HRNA 4PXOA 4E8HA 2VAFA 2MBTA 1M2BA 2VLUA 3APQA 1K0NA 2CVBA 4MPGA 1B4PA 6GSYA 5H5RA 2C0FA 4NXIA 2PVQA 4JU5A 2KOKA 2GLRA 4KF9A 3ERFA 5HR0A 1N8JA 2N5FA 1TRVA 2MBSA 1TU8A 3LQ7A 2DSAA 5HQPA 3C1RA 4MJEA 1KTEA 4MDCA 3F3RA 2CX3A 2CVKA 3ISOA 5IPHA 1LU4A 1JZWA 1EWXA 4BWQA 2YOIA 1ZCPA 3LWAA 1R5PA 2HRKA 4WKWA 1F2EA 4LL1B 3FYGA 4G2EA 2H1AA 3NOFA 1WWJA 2IFQB 3F4SA 1Z9HA 3KMNA 1EP8A 4MH3A 19GSA 2VCTA 2FUG2 2JZRA 3LJRA 4KH7A 1FW1A 2B5EA 4MJAA 4OWYA 1ABAA 4Q5NA 3D0ZA 1YKAA 3ME8A 4E8EA 2LTKA 1K3LA 1Y25A 2JADA 5J9CA 2LJRA 4BL7A 3KM6A 2YPMA 3HVVA 1M2AA 2H0HA 2WB9A 3PINA 4I97A 3L9SA 2B5XA 5LCZA 4RI7A 5D8IA 3IA1A 3G9BA 4HU9A 4DSRA 4OCFA 3TRXA 3GV1A 1WE0A 3BOAA 1XVQA 5GSSA 4JEDA 4MZWA 2I81A 3GX8A 4BVXA 2I1UA 1BEDA 1AIUA 2AV4A 3BJ5A 3BCIA 4ECIA 4PQHA 1JZDA 1YF0A 1F37A 5D73A 1V58A 2RUFA 4BVYB 4FIWA 4MMMA 1F3BA 4NHWA 2EC4A 4KCEA 4OFTA 2WDUA 2VD0A 2I9HA 3FW2A 4G9HA 4LMWA 4AGSA 2LRTA 3LXTA 4WR5A 4TXOB 4O92A 1Y6EA 3LEFA 4EUYA 1MD4A 5ECOB 3HD5A 2HFDA 1TRWA 3ZYWA 1WMJA 3US3A 5B8BA 3PGTA 4N11A 2YZUA 2VCQA 4KCAA 5ECLB 2CQ9A 3GMFA 4TR0A 1BYEA 4MA9A 4G10A 1O85A 5CP1A 4NMUA 2F9SA 5GSTA 1K3OA 1TI3A 1BQ7A 5DAKB 1S3DA 3HVXA 4JRRA 2AUVA 2TIRA 1GSQA 2PUKC 2R5GA 4XS1A 3U6VA 1TOFA 2GQLA 1ON4A 4XIHA 2L5OA 3F8UA 1GTIA 4Q5QA 4HQSA 5J4UA 3D22A 4N0ZA 3QDNA 5IO2A 4DSQA 1ZOFA 2DJ3A 1OAZA 2HE3A 3TB2A 4N10A 5ECQB 2H01A 2B5YA 5EPFA 3QCPA 4KSMA 4X1UA 1HNAA 2AB6A 3MDKA 3C71A 1S3AA 2NVLA 4RQRA 4KDYA 4IQAA 2P5RA 2IPAA 3G7IA 1G6WA 3EURA 2HZEA 4HS1A 2GSTA 3WT1A 1X0RA 3G7JA 1ZYQB 1W4VA 2PU9C 2OBIA 2ZNMA 3IXRA 3HKRA 2H8LA 4O7HA 3D5JA 3IPZA 1EGOA 3DIEA 2CX4A 5HR2A 2VM1A 3CMIA 5J5NA 4XRAA 3F4RA 2WFCA 4HEA2 2H75A 2R6KA 1H4OA 5ECMB 3I9V2 1RK4A 1XW9A 2FD3A 2C3NA 1QMVA 2DJ0A 3FRCA 3KXOA 1XW6A 4POMA 3HVSA 1TU7A 3WYWA 3CSHA 1SENA 4V1Ag 5C04A 4AJ7A 3HA9A 4TR3A 2RUEA 2F3MA 1PKZA 4MF7A 1OKTA 2B1LA 3E0UA 1WPIA 1B48A 3IR4A 2YCDA 2LNTA 1ZL9A 1K0MA 1YF1A 1X5DA 1CQHA 3HZ8A 1M99A 3W8JA 1FOVA 1G0TA 4L5LA 1Q98A 5DBQA 5AIVA 2IMFA 1TDIA 3QFBC 3IAM2 2YNXA 2VLVA 1J0FA 2MMNA 2IFQA 4HDEA 2IMIA 5BMUA 1R4WA 1SD8A 4F03A 4KE3A 2P5QA 4ECJA 3LG6A 5F07A 1SL0B 3TUEA 8GSSA 2OADA 4I5QA 1U3IA 3UJ1A 1O8XA 2ON7A 2C8UA 1HYUA 2H66A 2PERA 1YEXA 4X0XA 3DXBA 3HDCA 5CO3A 3RPPA 1SYXA 4ZL8A 2VOCA 5G5EA 4IVFA 2LRCA 5CNWA 3EU3A 3LYPA 3GX0A 4TRXA 2HSMB 3F9UA 1ERVA 5DALB 2OACA 2QSIA 4IELA 2YANA 1IYHA 3PR8A 1B8XA 5AGYA 2DMMA 4F0BA 1TK5B 4DEJA 2MYGA 5G31A 4TOPA 4Q5FA 3Q18A 3VPQA 3WGDA 3LSZA 3G7YA 2LUSA 4BVYA 2XBQA 1VF2A 3IC8A 2HSNB 2PVOC 4MABA 4PURA 1LBKA 3D6IA 3TJJA 2B1KA 3GL5A 3UBLA 4MJBA 4F2IA 4TXOA 4WBJA 1FAAA 4K0NA 1NSWA 2OE0A 2CT6A 2B6MA 3C7MA 3F0IA 3MNGA 3ZFLA 1WJKA 1K0OA 4O32A 1O73A 5JWOB 2N5AA 3FZ9A 1GUMA 4FYCA 1A0FA 1AQXA 4JZQA 2AHEA 4GXZA 2PMTA 3CRTA 4BPYA 1OC3A 2YV7A 4ECCA 2EIOA 2JZSA 5DAKA 4IGJA 3F63A 5ECRB 1Q4JA 3EE2A 4OFMA 5DVBA 1XW5A 3GH9A 1X9MB 5ECKB 4MF5A 3GTUA 3VI7A 1YQ1A 4L5OA 3DVXA 4OFNA 4ZB6A 1FVKA 3KEBA 2L57A 3TGZA 1WOUA 1MDKA 1PL2A 4XS4B 1HQOA 1K0DA 2BJXA 4K1FA 1EV9A 2WZ9A 2HXKA 1XWKA 4FO5A 2PGTA 2JU5A 6GSSA 4PNFA 2IMKA 1XOAA 3H93A 5IQYA 1XWCA 2KUCA 4MLYA 2L6DA 1AQWA 3RHCA 2DIZA 4HQZA 5J3RA 3DWVA 4IP1A 2DLXA 3DMLA 1J08A 5CRWA 4HI7A 1TK8B 3NZNA 4WF5A 3GSTA 3F6DA 2B7KA 2H19A 3IK7A 5IO0A 3MSZA 1A8LA 5JCGA 1ZGNA 4Z7XA 2LSTA 1IYIA 5CAXA 4JR4A 4LL4B 1SYRA 1GSDA 4K7OA 3IK9A 2HYXA 2K8VA 3KIJA 2C0GA 5AISA 5CYYA 2H74A 5CRHA 1DBYA 3UOMA 1RQMA 5IMFA 2Z9SA 3DD3A 1M9BA 1XCCA 1T3BA 3H4KA 5LNKe 2G0FA 5A4UA 3APOA 3FZ5A 2GSRA 1FB0A 2VIMA 2JL4A 2VUPA 3HJMA 1XVWA 2C80A 3M8NA 3EMPA 2V1MA 1VRSD 5ECNB 4K7NA 3L9VA 3Q74A 2K18A 2LV3A 1V40A 2WS2A 2GSQA 1R26A 3TKSE 3R2QA 4RUVA 5D9VA 3M9KA 4EDYA 3VWUA 1M2DA 4GRFA 1OE7A 1T00A 1XWAA 1F9MA 1UVZA 5KN0A 2PPTA 3H79A 4MCUA 4PQIA 3GKMA 2HSMA 4IHUA 5DALA 2ZUPA 3KZQA 1O8WA 3ZFBA 2R3XA 2CZ2A 2C4JA 3LFLA 1GTBA 4KUNA 1QQ2A 3L4NA 4USSA 1I5GA 3KD0A 5B8AA 1K0CA 3GIXA 2VL3A 3C1SA 1ERTA 3KJYA 5IOXA 1O7UA 1KBNA 2G2QA 2NTOA 3TRPA 3CRUA 1V2AA 1T7PB 1I9DA 4N30A 3LGCA 2GSSA 3L0HA 4WR4A 2YJ7A 3VWXA 5A4WA 3DYRA 4NV5A 3UARA 4JR6A 2CVDA 3GA4A 5G1KA 4IW9A 3BBYA 4FH8A 2MMOA 4KB3A 4J2FA 4MF6A 4ULXA 12GSA 2YJHA 2R4VA 2YN1A 5IMDA 5L71A 1EOGA 5IMZA 1A24A 3DVWA 3EYTA 3H1NA 1AAZA 2CV4A 1EV4A 2DJKA 1GULA 5A4VA 4L0UA 1XWGA 4NV2A 4AJ8A 5FHIA 2KLXA 4KDUA 5DQYA 5E59A 1B9XC 3APSA 4K2DA 1R7HA 2EIRA 3LYKA 4IJIA 2L4CA 3ZITA 5DQSA 4XS4A 3EMXA 1GUHA 2FWHA 4MJCA 3ZMKA 2CA8A 4GQFA 4TR4A 1GSSA 4ACSA 9GSSA 3QAGA 3HXSA 1YZXA 1NW2A 2F51A 2FWGA 3Q6OA 2DMLA 4OCEA 1X9SB 1PGTA 5G1LA 1ILOA 2FNOA 3ZIVA 3TOTA 1ERUA 3FK8A 4WEYA 1UA5A 3RBTA 6GSXA 2FHEA 5HR1A 4IS0A 4IQ1A 3HJOA 2GZPA 2V32A 3GTUB 2JSZA 3DGQA 1FG4A 2E2GA 3WGXA 4EF0A 1GSYA 1MDJA 4MZBA 3GYKA 3GFKA 3QOUA 5F06A 1GLPA 4PUFC 4PTSA 4G19A 4ZBDA 5HR3A 1JZRA 2OBKA 2GTUA 3D4MA 2NBSA 3CTGA 1CQGA 3A2VA 3A2XA 3FY7A 4EXJA 2YP6A 2VLTA 4TVEA 1E6BA 4CW9A 4DSSB 1EOHA 4TR1B 4WXTA 4EKZA 2VD1A 4MZCA 1NHYA 1URMA 1G7EA 2V41A 4TW5A 1WIKA 3GURA 1PN9A 1OKDA 5E4WA 1E2YA 4H86A 1PKWA 3CSIA 1TI1A 1YJ6A 3A3TA 2REMA 4KW6A 1G7OA 3BD2A 2H1BA 1J9BA 3ZL5A 4OO4A 4ID0A 2FA4A 4V1Ap 1Z6NA 3FZ4A 2PBJA 1HNBA 3P7XA 2IWTA 2VCWA 1XZOA 5F8BA 2LEGA 1W89A 1A2MA 4HZ4A 4HOJA 6GSWA 14GSA 2DIYA 3ME7A 4ZBBA 2DBCA 1TRUA 1SK0A 3QAWA 5F0GA 1DUGA 2H6YA 2DJ1A 3VWVA 1O81A 5FWGA 2YWMA 4FQUA 1GUKA 4ML1A 5ID2B 4BWSA 5H5SA 4QQ7A 5HFKA 1SU9A 3N9JA 4HZ2A 4KSOA 3HY2A 4KAEA 5IMCA 4JE1A 5KN1A 2J23A 4K8MA 1WRYA 3C73A 1GP1A 5AN1A 2DJ2A 4XTSA 3QD9A 2C0EA 5AIXA 1T4ZA 1HNCA 3FZAA 1TK0B 3TKSC 4KDXA 1UN2A 3C8EA 4LMVA 1RW1A 3VURA 2RM6A 4TXVA 4EL1A 5D9TA 3W8SA 1AC1A 1V98A 1OE8A 2WJUA 1B9YC 1XOBA 3ERGA 3KP9A 2MMZA 3F3QA 1O6JA 3WD6A 5C00A 1NHOA 2VO4A 4G0KA 3QR6A 4YH2A 1GSFA 1U6TA 1X5EA 2NPBA 2PN8A 4N0VA
chains in the Genus database with same CATH superfamily
3DRNA 4EO3A 4YQMA 4TN8A 3PH9A 3A5IA 3HZ4A 1R5AA 1X5CA 4OO5A 4XS6A 1HD2A 4HJ2A 1M7TA 3KP8A 2A2RA 1F6MC 2E2MA 1OYJA 4JBBA 1OC9B 3V1WA 20GSA 3UMAA 4I2UA 4Q5RA 5A34A 1XWBA 4YAPA 5FT3A 1AUCA 2CAQA 3KMOA 2XPEA 2FLSA 1GRXA 4GTUA 5JWQB 3RHBA 3HCZA 2FA8A 1YKCA 1A23A 3VI5A 3KTLA 5ECHB 1MD3A 2IL3A 3GUSA 2C0DA 1M9AA 2M46A 3MWHA 2IMEA 5IMVA 2E7PA 2A4VA 5BRTA 5ABRA 18GSA 1T8EB 4ECBA 3F6FA 1SKWB 1USBA 2R2JA 10GSA 1BF5A 2H6ZA 1TXXA 3RAZA 3ZRDA 3VPTA 4DSSA 2QKEA 1UC7A 2HSYA 1I1IP 4TR1A 1SKSB 2VM2A 1KEBA 2HT9A 3TKRA 1A2JA 3FHKA 2HNLA 3E3EA 1BX9A 2FWEA 2KP1A 4F82A 4GLTA 2NDOA 4WBRD 1SJZA 1T1VA 1JZOA 2IMDA 3RDWA 1GNEA 1PRXA 1DSBA 1XFLA 2KHPA 1PFOA 1QUWA 3GKKA 4V2MA 4POBA 2HRAA 2UZ8A 2HRFA 1PL1A 4AF2A 1K3YA 4FYUA 3ERWA 2HI7A 3FR9A 4MK3A 3CTFA 3GKXA 3FEUA 4GWRA 4YQVA 1YY7A 3KGKA 3FR3A 1YDKA 2H70A 4O5QA 1QK8A 3K8NA 3ZIJA 6GSVA 4EE0A 2V6KA 4PUAA 4XRDA 4L0WA 1JHBA 2M72A 2EIQA 3QPMA 4PNGA 2B7JA 4K9ZA 4D73B 4DVCA 4O5RA 1AW9A 3VFIA 2HSHA 3L78A 5ELGA 3P2AA 2XPDA 3IOSA 17GSA 3L9UA 3UVTA 1Z3EA 2A4HA 2I3YA 2R0GA 2GVPA 3RGBC 4G0LA 4CY6A 11GSA 2X8GA 1THOA 5ID2A 1VF3A 5F05A 4NAXA 2RM5A 4YQUA 4YKFA 1PD21 1Z7PA 2K6VA 4XCSA 4PX1A 4MP4A 3W6GA 2O3EA 1VF1A 2K9FA 2VCVA 2WULA 1C72A 2FGXA 2H0IA 4V2NA 3EWLA 2O87A 2GQKA 1VF4A 3WT2A 3UEMA 1BJXA 5GZZB 1SK2A 3RPNA 1ERWA 2X8HA 4J57E 4OD7A 2IN3A 4CHSA 4K6XA 1QGVA 3EINA 2H1GA 5INYA 1SK1A 1EEMA 1U87A 2L5LA 1SL1B 5JCWA 3M0FA 1XXUA 4YAVA 1V57A 2DKHA 2H6XA 5KEJA 4V2LA 1Z5YE 2WZSA 6GSUA 2OE1A 2H76A 3MIXA 1ZYNA 2P31A 2X8CA 5DJMA 2VL2C 3GHAA 3IV4A 5DJLA 3EU4A 4N3ZA 2EFDA 1A0RP 2UV8G 3ED3A 4ZILA 4HUAA 1GSUA 3H8QA 2E0QA 4MPFA 1F3AA 1K0AA 4LA1A 3TRQA 4XHMA 5ENUA 2IIYA 4F0CA 4P3YB 1KNGA 2YWIA 1DE1A 1B4QA 1GWCA 4AKIA 1OC9A 3P8WA 3MAKA 5B7CA 5DCGA 1AQVA 2H1DA 2MMAA 3KTBA 3S9FA 3TJKA 1YEPA 1ZMAA 2V6OA 1SJIA 2QGVA 3IRAA 1A8YA 2LQOA 3VWWA 2H71A 5KN3A 2C1YA 5GAND 3UBKA 3EVIA 2CAIA 2H73A 2JSYA 3HMJG 1EP7A 4AJ6A 3TKSA 2H72A 4PQ1A 7GSSA 3P90A 2V2GA 3GH6A 3BCKA 1VGLA 1ACVA 1XPVA 5G5FA 3TKQA 1S3CA 3KCMA 4ZIJA 3IHQA 3FKFA 3UVHA 2EFEA 2BMXA 2O85A 2IJYA 1X9WB 2QC7A 5A5KA 22GSA 5KN2A 2HLSA 5H5QA 4IBPA 3E9JB 1GNWA 1PX6A 2YWOA 2XBIA 4GSSA 3LXZA 3PPUA 2F8AA 4IKHA 3TDGA 3GN3A 5LD0A 2I4AA 3A2WA 1M3JA 3UL3A 2A2SA 4RI6A 5J4VA 4ILFA 3CBUA 2RLIA 1DE2A 1FO5A 1PSQA 4NHZA 2YWNA 3TKPA 1QXHA 1TP9A 2TRCP 3GSSA 3IE3A 2O36A 3M3MA 2GT5A 2B3SA 3I69A 4Z2TA 1S3RA 3HYPA 5ELAA 2LJAA 1TKDB 1M0UA 4D73A 2VCZA 1FVJA 2LNSA 2TRXA 5IIZA 2O8VB 2AAWA 3IBHA 2XHFA 3IDVA 3M9JA 5EY6A 4I2TA 2P0GA 1SKRB 2GQMA 3ZMLA 2RIIA 5A5HB 2OA7A 5J41A 3KH7A 1OVNA 3HVNA 2YV9A 3GKNA 4J56E 2F8FA 1FB6A 5GAPD 4IJ3A 5IM9A 1GH2A 1K0BA 4HSCX 2L59A 3CYNA 5HFGA 2CZ3A 3QMXA 4K7IA 4EVMA 2GZYA 1JLWA 3ZTLA 13GSA 2OT3A 6GSTA 4KX4A 4CDOA 3TJBA 2QA1A 3TJGA 2ON5A 1TTZA 2GGTA 2WCIA 2PWJA 2WGRA 4HJMA 3TCOA 4OMVA 1MEKA 5COHA 2O89A 2ZCTA 4QL7A 5J9BA 4K0GA 2VL9A 2AYTA 4EC0A 4ZBAA 3VK9A 3TOUA 4WETA 3I43A 3GRXA 3QFAC 4BIKA 3TJFA 1ML6A 4FYBA 1OC8A 3LORA 5JCUA 1TJDA 3HJPA 3VLNA 4TKYA 3CXGA 2L4QA 2LJKA 4EDZA 3TU3B 4YKGA 1V9WA 4ML6A 3CSJA 2GT6A 2YZHA 2R0CA 4NPBA 1G6YA 4BA7A 1GL8A 3I6AA 2HRKB 2DJJA 3IC4A 3QAVA 4G0IA 5ECPB 4HU7A 1PA3A 2XC2A 2J9HA 2R37A 5CRGA 4GQCA 3J7Yk 5IPGA 4POLA 4KNDA 4F9ZA 1U88A 3O3TA 3Q19A 2N5BA 3EC3A 2WW3A 4GSTA 3O6TA 4ZXGA 4BL7B 1T4YA 1U3AA 5CRDA 1TRSA 3M1GA 3F4TA 3NIVA 5DDLA 5D93A 5HFIA 1PX7A 5ECSA 1MTCA 3SWLA 1PN0A 2AJQB 5B6NA 2GS3A 2JACA 1Z6MA 2WRTA 1FHEA 4BVXB 16GSA 4ISDA 1GLQA 1H75A 3HHVA 3KH9A 4IN0A 1PMTA 4X43A 2D2ZA 4Z2RA 1MDIA 5DCHA 4KA0A 4MH2A 5EVOA 1GTUA 1SVLA 3R3EA 2LKUA 1N2AA 5B6MA 3GL3A 2VL2A 5ECIB 2WVYA 3JCML 2OE3A 3U5RE 5D96A 5D9WA 1GTAA 4IP6A 3GNJA 5D9XA 3O76A 1JLVA 2C3QA 5JWRB 3ZZXA 1ZZYA 4POKA 3DEXA 3A5WA 1THXA 2ES7A 3D21A 4ZB8A 3IAS2 1TXUA 1Z7RA 1WP0A 1TW9A 1XBSA 2X64A 2H0GA 3ZVJD 4PI2C 3ZVJA 3ZREA 4GCIA 3DKSA 1AXDA 4ZB9A 5EL8A 3SBCA 2DC5A 2BTOT 2VCXA 2LRNA 1PQNA 2KP2A 1A2LA 2OJLA 3FR6A 4ZL7A 4PGTA 2WVXB 1QFNA 2OKAA 1JFUA 1XIYA 2FCHA 3WGEA 2A2PA 2HQTA 4L8EA 4I8BA 5J40A 3J7Yb 2K8SA 5CREA 2H30A 2FWFA 1NM3A 4KGIA 3AY8A 1SD9A 2HZFA 5A5HA 5G30A 4WF4A 2LQQA 1ST9A 5G2ZA 3N5OA 2M80A 4GSNA 4I6XA 1ZYEA 5IMAA 4RQXA 2ALBA 4NWYA 1EGRA 4QL9A 3ZLPA 2C3TA 2MZCA 2LS5A 3D4TA 3UAPA 2JZTA 1BG5A 1BAYA 2FY6A 1LJRA 1SJ6A 5IOWA 4GF0A 2HZEB 2L6CA 2X99A 2O7KA 4LLRA 1EEJA 1SL2B 3UIWA 2GDRA 1EZKA 4ZL9A 2GZZA 1GSEA 3OR5A 2HRNA 4PXOA 4E8HA 2VAFA 2MBTA 1M2BA 2VLUA 3APQA 1ZYPA 1K0NA 2CVBA 4MPGA 1B4PA 6GSYA 5H5RA 2C0FA 4NXIA 3RFRC 2PVQA 4JU5A 2KOKA 2GLRA 4KF9A 3ERFA 5HR0A 1N8JA 2N5FA 5A1NB 1TRVA 2MBSA 1TU8A 3LQ7A 2DSAA 5HQPA 3C1RA 4MJEA 1KTEA 4MDCA 3F3RA 2CX3A 2CVKA 1M3IA 3ISOA 5IPHA 1LU4A 1JZWA 1EWXA 4BWQA 2YOIA 1ZCPA 3LWAA 1R5PA 2HRKA 4WKWA 1F2EA 4LL1B 3FYGA 4G2EA 2H1AA 3NOFA 4MNNA 1WWJA 2IFQB 4FXYP 2WW0A 3F4SA 1Z9HA 3KMNA 5BMUB 1EP8A 1FOHA 4MH3A 19GSA 2VCTA 5J47A 2FUG2 2JZRA 3LJRA 4KH7A 1FW1A 2B5EA 4MJAA 4OWYA 1ABAA 4Q5NA 3D0ZA 1YKAA 3ME8A 4E8EA 2LTKA 1K3LA 1Y25A 2JADA 5J9CA 2LJRA 4BL7A 3KM6A 2YPMA 3HVVA 1M2AA 2H0HA 2WB9A 3PINA 4I97A 3L9SA 2B5XA 5LCZA 4RI7A 5D8IA 3IA1A 3G9BA 4HU9A 4DSRA 4OCFA 3TRXA 3GV1A 1WE0A 3BOAA 1XVQA 5GSSA 4JEDA 4MZWA 2I81A 3GX8A 4BVXA 2I1UA 1BEDA 1AIUA 2AV4A 3BJ5A 3BCIA 4ECIA 4PQHA 1JZDA 1YF0A 1F37A 5D73A 1V58A 2RUFA 4BVYB 4FIWA 4MMMA 1F3BA 4NHWA 2EC4A 4KCEA 4OFTA 2WDUA 2VD0A 1SVMA 2I9HA 3FW2A 4G9HA 4LMWA 4AGSA 2LRTA 4X4JA 3LXTA 4WR5A 4TXOB 4O92A 1Y6EA 1BG1A 3LEFA 4EUYA 1MD4A 5ECOB 3HD5A 2HFDA 1TRWA 3ZYWA 1WMJA 3US3A 5B8BA 3PGTA 4N11A 2YZUA 2VCQA 4KCAA 5ECLB 2CQ9A 3GMFA 4TR0A 1BYEA 4MA9A 4G10A 1O85A 5CP1A 2VKZG 4NMUA 2F9SA 5GSTA 1K3OA 1TI3A 1BQ7A 4ZB7A 5DAKB 1S3DA 2WVXA 3HVXA 4JRRA 2AUVA 2TIRA 1GSQA 2PUKC 2R5GA 2R0PA 4XS1A 3U6VA 1TOFA 2GQLA 1ON4A 4XIHA 2L5OA 4EIQA 3F8UA 1GTIA 4Q5QA 4HQSA 5J4UA 3D22A 4N0ZA 3QDNA 5IO2A 4DSQA 1ZOFA 4CY8A 2DJ3A 1OAZA 2HE3A 3TB2A 4N10A 5ECQB 2H01A 2B5YA 5EPFA 3QCPA 4KSMA 4X1UA 5KOXA 1HNAA 2AB6A 3MDKA 3C71A 1S3AA 2NVLA 4RQRA 4KDYA 4IQAA 2P5RA 2IPAA 3G7IA 1G6WA 3EURA 2HZEA 4HS1A 2GSTA 3WT1A 1X0RA 3G7JA 1ZYQB 1W4VA 2PU9C 2OBIA 2ZNMA 3IXRA 3HKRA 2H8LA 4O7HA 3D5JA 3IPZA 1EGOA 3DIEA 2CX4A 5HR2A 2VM1A 3CMIA 5J5NA 4XRAA 4AI6A 3F4RA 2WFCA 4HEA2 3EPTA 2H75A 2R6KA 1H4OA 5ECMB 3I9V2 1RK4A 1XW9A 2FD3A 2C3NA 1QMVA 2DJ0A 3FRCA 2DKIA 3KXOA 1XW6A 4POMA 5J4YA 3HVSA 1TU7A 3WYWA 3CSHA 1SENA 5A1NA 4V1Ag 5C04A 4AJ7A 2WW1A 3HA9A 4TR3A 2RUEA 2F3MA 1PKZA 4MF7A 1OKTA 2B1LA 3E0UA 1WPIA 1B48A 3IR4A 2YCDA 2LNTA 1ZL9A 1K0MA 1YF1A 1X5DA 1CQHA 3HZ8A 1M99A 3W8JA 1FOVA 1G0TA 4L5LA 1Q98A 4Z2UA 5DBQA 5AIVA 2IMFA 1TDIA 3QFBC 3IAM2 2YNXA 2VLVA 1J0FA 2MMNA 2IFQA 4HDEA 2IMIA 5BMUA 1R4WA 1SD8A 4F03A 4KE3A 2P5QA 4ECJA 3LG6A 5F07A 2EFCA 1SL0B 3TUEA 8GSSA 2OADA 4I5QA 1U3IA 3UJ1A 1O8XA 2ON7A 2C8UA 1HYUA 2H66A 2PERA 1YEXA 2EFHA 4X0XA 3DXBA 3HDCA 5CO3A 3RPPA 1SYXA 4ZL8A 2VOCA 5G5EA 2X49A 4IVFA 2LRCA 5CNWA 3EU3A 3LYPA 3GX0A 4TRXA 2HSMB 3F9UA 3CHXC 1ERVA 5DALB 2OACA 2QSIA 4IELA 2YANA 1IYHA 3PR8A 1B8XA 5AGYA 2DMMA 4F0BA 1TK5B 4DEJA 2MYGA 5G31A 4TOPA 4Q5FA 3Q18A 3VPQA 3WGDA 3LSZA 3G7YA 2LUSA 4BVYA 2XBQA 1VF2A 3IC8A 3FMWA 2HSNB 2PVOC 4MABA 4PURA 1LBKA 3D6IA 4PHZC 3TJJA 2B1KA 3GL5A 3UBLA 4MJBA 4F2IA 4A5PA 4TXOA 4WBJA 1FAAA 4K0NA 1NSWA 2OE0A 2CT6A 2B6MA 3C7MA 3F0IA 3MNGA 3ZFLA 1WJKA 1K0OA 4O32A 1O73A 5JWOB 2N5AA 3FZ9A 1GUMA 4FYCA 1A0FA 1AQXA 4JZQA 2AHEA 4GXZA 2PMTA 3CRTA 4BPYA 1OC3A 2YV7A 4ECCA 2EIOA 2JZSA 5DAKA 4IGJA 3F63A 5ECRB 1Q4JA 3CWGA 3EE2A 4OFMA 2O5VA 5DVBA 1XW5A 3GH9A 1X9MB 5ECKB 4MF5A 3GTUA 3VI7A 1YQ1A 4L5OA 3DVXA 1YEWC 4OFNA 4ZB6A 1FVKA 3KEBA 2L57A 3TGZA 1WOUA 1MDKA 1PL2A 4XS4B 1HQOA 1K0DA 2BJXA 4K1FA 4PI0C 1EV9A 2WZ9A 2HXKA 1XWKA 4FO5A 2PGTA 2JU5A 6GSSA 4PNFA 2IMKA 1XOAA 3H93A 5IQYA 1XWCA 2KUCA 4MLYA 2X4AA 2L6DA 1AQWA 3RHCA 3IHGA 1Y1UA 2DIZA 3LW9A 4HQZA 5J3RA 3DWVA 3DMLA 2DLXA 4IP1A 1J08A 5CRWA 4HI7A 1TK8B 3NZNA 4WF5A 3GSTA 3MYDA 3F6DA 2B7KA 2H19A 3CQFA 3IK7A 5IO0A 3MSZA 1A8LA 5JCGA 1ZGNA 4Z7XA 2LSTA 1IYIA 5CAXA 4JR4A 4LL4B 1SYRA 1GSDA 4K7OA 3IK9A 2HYXA 2K8VA 3KIJA 2C0GA 5AISA 5CYYA 2H74A 5CRHA 1DBYA 3UOMA 1RQMA 5IMFA 2Z9SA 3DD3A 1M9BA 1XCCA 1T3BA 4G01A 3H4KA 5LNKe 2G0FA 5A4UA 3APOA 3FZ5A 2GSRA 1FB0A 2VIMA 2JL4A 2VUPA 3HJMA 1XVWA 2C80A 3M8NA 3EMPA 2V1MA 1VRSD 5ECNB 4K7NA 3L9VA 4E68A 3Q74A 4K5SA 2K18A 2LV3A 1V40A 2WS2A 2GSQA 1R26A 3TKSE 3R2QA 4RUVA 5D9VA 3M9KA 4EDYA 3VWUA 1M2DA 4GRFA 1OE7A 1T00A 1XWAA 1F9MA 1UVZA 5KN0A 2PPTA 3H79A 4MCUA 4PQIA 3GKMA 2HSMA 4ICYA 4IHUA 5DALA 2ZUPA 3KZQA 1O8WA 3ZFBA 2R3XA 1YVLA 2CZ2A 2C4JA 3LFLA 1GTBA 4KUNA 1QQ2A 3L4NA 4USSA 2WW2A 1I5GA 3KD0A 5B8AA 1K0CA 3GIXA 4K2XA 5KOWA 2VL3A 3C1SA 2HSNA 1ERTA 3KJYA 5IOXA 1O7UA 1KBNA 2G2QA 2NTOA 3TRPA 3CRUA 1V2AA 1T7PB 1I9DA 4QMKA 4N30A 3LGCA 2GSSA 3L0HA 4WR4A 2YJ7A 3VWXA 5A4WA 3DYRA 4NV5A 3UARA 4JR6A 2CVDA 3GA4A 5G1KA 4IW9A 3BBYA 4FH8A 2MMOA 4KB3A 4J2FA 4MF6A 4ULXA 12GSA 2YJHA 2R4VA 1SVOA 2YN1A 5IMDA 5L71A 1EOGA 5IMZA 1A24A 3DVWA 3EYTA 3H1NA 1AAZA 2CV4A 1EV4A 2DJKA 1GULA 5A4VA 4L0UA 1XWGA 4NV2A 4AJ8A 5FHIA 2KLXA 4AKGA 4KDUA 5DQYA 5E59A 1B9XC 3APSA 4K2DA 1R7HA 2EIRA 3LYKA 4IJIA 2L4CA 3ZITA 5DQSA 4XS4A 3EMXA 1GUHA 2FWHA 4MJCA 3ZMKA 2CA8A 4GQFA 4TR4A 1GSSA 4ACSA 9GSSA 3QAGA 3HXSA 5A34B 1YZXA 1NW2A 2F51A 2FWGA 3Q6OA 2DMLA 4OCEA 1X9SB 1PGTA 4AKHA 5G1LA 1ILOA 2FNOA 3ZIVA 3TOTA 1ERUA 3FK8A 4WEYA 1UA5A 3RBTA 6GSXA 2FHEA 5HR1A 4IS0A 4IQ1A 3HJOA 4GDFA 2GZPA 2V32A 3GTUB 2JSZA 3DGQA 1FG4A 2E2GA 3WGXA 4EF0A 1GSYA 1MDJA 4MZBA 3GYKA 3GFKA 3QOUA 4K5RA 5F06A 4O5UA 1GLPA 4PUFC 1N25A 4G19A 4PTSA 4ZBDA 5HR3A 1JZRA 2OBKA 2GTUA 3D4MA 2NBSA 3CTGA 1CQGA 3A2VA 3A2XA 3FY7A 4EXJA 2YP6A 2VLTA 4TVEA 1E6BA 4CW9A 4DSSB 1EOHA 4TR1B 4WXTA 4EKZA 2VD1A 4MZCA 1NHYA 1URMA 1G7EA 2V41A 4TW5A 1WIKA 3GURA 1PN9A 1OKDA 5E4WA 1E2YA 4H86A 1PKWA 3CSIA 1TI1A 1YJ6A 3A3TA 2REMA 4KW6A 1G7OA 3BD2A 2QA2A 2H1BA 1J9BA 3ZL5A 4OO4A 4ID0A 2FA4A 4V1Ap 1Z6NA 4EIPA 3FZ4A 2PBJA 1HNBA 3P7XA 2IWTA 2VCWA 1XZOA 5F8BA 2LEGA 1W89A 1XG8A 1A2MA 4HZ4A 4HOJA 6GSWA 14GSA 2DIYA 3ME7A 4ZBBA 2DBCA 1TRUA 1SK0A 3QAWA 5F0GA 1DUGA 2H6YA 2DJ1A 3VWVA 1O81A 5FWGA 1S4BP 2YWMA 4FQUA 1GUKA 4ML1A 5ID2B 4BWSA 5H5SA 4QQ7A 5HFKA 1SU9A 3N9JA 4HZ2A 4KSOA 3HY2A 4KAEA 5IMCA 4JE1A 5KN1A 2J23A 4K8MA 1WRYA 4W66A 4AKXB 3C73A 1GP1A 5AN1A 2DJ2A 4XTSA 3QD9A 2C0EA 5AIXA 1T4ZA 1HNCA 3FZAA 1TK0B 3TKSC 4KDXA 1UN2A 3C8EA 4LMVA 1RW1A 3VURA 2RM6A 4TXVA 4EL1A 5D9TA 3W8SA 1AC1A 1V98A 1OE8A 2WJUA 2H1LA 1B9YC 1XOBA 3ERGA 3KP9A 2MMZA 3F3QA 1O6JA 3WD6A 5C00A 1NHOA 2VO4A 4G0KA 3QR6A 4YH2A 1GSFA 1U6TA 1X5EA 2NPBA 2PN8A 4N0VA 2WVZA
chains in the Genus database with same CATH topology
3DRNA 4EO3A 4YQMA 4TN8A 3PH9A 3A5IA 3HZ4A 1R5AA 1X5CA 4OO5A 4XS6A 1HD2A 4HJ2A 1M7TA 3KP8A 2A2RA 1F6MC 2E2MA 1OYJA 4JBBA 1OC9B 3V1WA 20GSA 3UMAA 4I2UA 4Q5RA 5A34A 1XWBA 4YAPA 5FT3A 1AUCA 2CAQA 3KMOA 2XPEA 2FLSA 1GRXA 4GTUA 5JWQB 3RHBA 3HCZA 2FA8A 1YKCA 1A23A 3VI5A 3KTLA 5ECHB 1MD3A 2IL3A 3GUSA 2C0DA 1M9AA 2M46A 3MWHA 2IMEA 5IMVA 2E7PA 2A4VA 5BRTA 5ABRA 18GSA 1T8EB 4ECBA 3F6FA 1SKWB 1USBA 2R2JA 10GSA 1BF5A 2H6ZA 1TXXA 3RAZA 3ZRDA 3VPTA 4DSSA 2QKEA 1UC7A 2HSYA 4TR1A 1SKSB 2VM2A 1KEBA 2HT9A 3TKRA 1A2JA 3FHKA 2HNLA 3E3EA 1BX9A 2FWEA 2KP1A 4F82A 4GLTA 2NDOA 4WBRD 1SJZA 1T1VA 1JZOA 2IMDA 3RDWA 1GNEA 1PRXA 1DSBA 1XFLA 2KHPA 1QUWA 3GKKA 4V2MA 4POBA 2HRAA 2UZ8A 2HRFA 1PL1A 4AF2A 1K3YA 4FYUA 3ERWA 2HI7A 3FR9A 4MK3A 3CTFA 3GKXA 3FEUA 4GWRA 4YQVA 1YY7A 3KGKA 3FR3A 1YDKA 2H70A 4O5QA 1QK8A 3K8NA 3ZIJA 6GSVA 4EE0A 2V6KA 4PUAA 4XRDA 4L0WA 1JHBA 2M72A 2EIQA 3QPMA 4PNGA 2B7JA 4K9ZA 4D73B 4DVCA 4O5RA 1AW9A 3VFIA 2HSHA 3L78A 5ELGA 3P2AA 2XPDA 3IOSA 17GSA 3L9UA 3UVTA 1Z3EA 2A4HA 2I3YA 2R0GA 2GVPA 4G0LA 4CY6A 11GSA 2X8GA 1THOA 5ID2A 1VF3A 5F05A 4NAXA 2RM5A 4YQUA 4YKFA 1PD21 1Z7PA 2K6VA 4XCSA 4PX1A 4MP4A 3W6GA 1VF1A 2K9FA 2VCVA 2WULA 1C72A 2FGXA 2H0IA 4V2NA 3EWLA 2O87A 2GQKA 1VF4A 3WT2A 3UEMA 1BJXA 5GZZB 1SK2A 3RPNA 1ERWA 2X8HA 4J57E 4OD7A 2IN3A 4CHSA 4K6XA 1QGVA 3EINA 2H1GA 5INYA 1SK1A 1EEMA 1U87A 2L5LA 1SL1B 5JCWA 3M0FA 1XXUA 4YAVA 1V57A 2DKHA 2H6XA 5KEJA 4V2LA 1Z5YE 6GSUA 2OE1A 2H76A 3MIXA 1ZYNA 2P31A 2X8CA 5DJMA 2VL2C 3GHAA 3IV4A 5DJLA 3EU4A 4N3ZA 2EFDA 1A0RP 2UV8G 3ED3A 4ZILA 4HUAA 1GSUA 3H8QA 2E0QA 4MPFA 1F3AA 1K0AA 4LA1A 3TRQA 4XHMA 5ENUA 2IIYA 4F0CA 4P3YB 1KNGA 2YWIA 1DE1A 1B4QA 1GWCA 4AKIA 1OC9A 3P8WA 3MAKA 5B7CA 5DCGA 1AQVA 2H1DA 2MMAA 3KTBA 3S9FA 3TJKA 1YEPA 1ZMAA 2V6OA 1SJIA 2QGVA 3IRAA 1A8YA 2LQOA 3VWWA 2H71A 5KN3A 2C1YA 5GAND 3UBKA 3EVIA 2CAIA 2H73A 2JSYA 3HMJG 1EP7A 4AJ6A 3TKSA 2H72A 4PQ1A 7GSSA 3P90A 2V2GA 3GH6A 3BCKA 1VGLA 1ACVA 1XPVA 5G5FA 3TKQA 1S3CA 3KCMA 4ZIJA 3IHQA 3FKFA 3UVHA 2EFEA 2BMXA 2O85A 2IJYA 1X9WB 2QC7A 5A5KA 22GSA 5KN2A 2HLSA 5H5QA 4IBPA 3E9JB 1GNWA 1PX6A 2YWOA 2XBIA 4GSSA 3LXZA 3PPUA 2F8AA 4IKHA 3TDGA 3GN3A 5LD0A 2I4AA 3A2WA 3UL3A 2A2SA 4RI6A 5J4VA 4ILFA 3CBUA 2RLIA 1DE2A 1FO5A 1PSQA 4NHZA 2YWNA 3TKPA 1QXHA 1TP9A 2TRCP 3GSSA 3IE3A 3M3MA 2GT5A 2B3SA 3I69A 4Z2TA 3HYPA 5ELAA 2LJAA 1TKDB 1M0UA 4D73A 2VCZA 1FVJA 2LNSA 2TRXA 5IIZA 2O8VB 2AAWA 3IBHA 2XHFA 3IDVA 3M9JA 5EY6A 4I2TA 2P0GA 1SKRB 2GQMA 3ZMLA 2RIIA 5A5HB 2OA7A 5J41A 3KH7A 1OVNA 2YV9A 3GKNA 4J56E 2F8FA 1FB6A 5GAPD 4IJ3A 5IM9A 1GH2A 1K0BA 2L59A 3CYNA 5HFGA 2CZ3A 3QMXA 4K7IA 4EVMA 2GZYA 1JLWA 3ZTLA 13GSA 2OT3A 6GSTA 4KX4A 4CDOA 3TJBA 2QA1A 3TJGA 2ON5A 1TTZA 2GGTA 2WCIA 2PWJA 2WGRA 4HJMA 3TCOA 4OMVA 1MEKA 5COHA 2O89A 2ZCTA 4QL7A 5J9BA 4K0GA 2VL9A 2AYTA 4EC0A 4ZBAA 3VK9A 3TOUA 4WETA 3I43A 3GRXA 3QFAC 3TJFA 1ML6A 4FYBA 1OC8A 3LORA 5JCUA 1TJDA 3HJPA 3VLNA 4TKYA 3CXGA 2L4QA 2LJKA 4EDZA 3TU3B 4YKGA 1V9WA 4ML6A 3CSJA 2GT6A 2YZHA 2R0CA 4NPBA 1G6YA 4BA7A 1GL8A 3I6AA 2HRKB 2DJJA 3IC4A 3QAVA 4G0IA 5ECPB 4HU7A 1PA3A 2XC2A 2J9HA 2R37A 5CRGA 4GQCA 3J7Yk 5IPGA 4POLA 4KNDA 4F9ZA 1U88A 3O3TA 3Q19A 2N5BA 3EC3A 4GSTA 3O6TA 4ZXGA 4BL7B 1T4YA 1U3AA 5CRDA 1TRSA 3M1GA 3F4TA 3NIVA 5DDLA 5D93A 5HFIA 1PX7A 5ECSA 1MTCA 3SWLA 1PN0A 2AJQB 5B6NA 2GS3A 2JACA 1Z6MA 2WRTA 1FHEA 4BVXB 16GSA 4ISDA 1GLQA 1H75A 3HHVA 3KH9A 4IN0A 1PMTA 4X43A 2D2ZA 4Z2RA 1MDIA 5DCHA 4KA0A 4MH2A 5EVOA 1GTUA 1SVLA 3R3EA 2LKUA 1N2AA 5B6MA 3GL3A 2VL2A 5ECIB 3JCML 2OE3A 3U5RE 5D96A 5D9WA 1GTAA 4IP6A 3GNJA 5D9XA 3O76A 1JLVA 2C3QA 5JWRB 3ZZXA 1ZZYA 4POKA 3DEXA 3A5WA 1THXA 2ES7A 3D21A 4ZB8A 3IAS2 1TXUA 1Z7RA 1WP0A 1TW9A 1XBSA 2X64A 2H0GA 3ZVJD 3ZVJA 3ZREA 4GCIA 3DKSA 1AXDA 4ZB9A 5EL8A 3SBCA 2DC5A 2BTOT 2VCXA 2LRNA 1PQNA 2KP2A 1A2LA 2OJLA 3FR6A 4ZL7A 4PGTA 1QFNA 2OKAA 1JFUA 1XIYA 2FCHA 3WGEA 2A2PA 2HQTA 4L8EA 4I8BA 5J40A 3J7Yb 2K8SA 5CREA 2H30A 2FWFA 1NM3A 4KGIA 3AY8A 1SD9A 2HZFA 5A5HA 5G30A 4WF4A 2LQQA 1ST9A 5G2ZA 3N5OA 2M80A 4GSNA 4I6XA 1ZYEA 5IMAA 4RQXA 2ALBA 4NWYA 1EGRA 4QL9A 3ZLPA 2C3TA 2MZCA 2LS5A 3D4TA 3UAPA 2JZTA 1BG5A 1BAYA 2FY6A 1LJRA 1SJ6A 5IOWA 4GF0A 2HZEB 2L6CA 2X99A 2O7KA 4LLRA 1EEJA 1SL2B 3UIWA 2GDRA 1EZKA 4ZL9A 2GZZA 1GSEA 3OR5A 2HRNA 4PXOA 4E8HA 2VAFA 2MBTA 1M2BA 2VLUA 3APQA 1ZYPA 1K0NA 2CVBA 4MPGA 1B4PA 6GSYA 5H5RA 2C0FA 4NXIA 2PVQA 4JU5A 2KOKA 2GLRA 4KF9A 3ERFA 5HR0A 1N8JA 2N5FA 5A1NB 1TRVA 2MBSA 1TU8A 3LQ7A 2DSAA 5HQPA 3C1RA 4MJEA 1KTEA 4MDCA 3F3RA 2CX3A 2CVKA 3ISOA 5IPHA 1LU4A 1JZWA 1EWXA 4BWQA 2YOIA 1ZCPA 3LWAA 1R5PA 2HRKA 4WKWA 1F2EA 4LL1B 3FYGA 4G2EA 2H1AA 3NOFA 4MNNA 1WWJA 2IFQB 3F4SA 1Z9HA 3KMNA 5BMUB 1EP8A 1FOHA 4MH3A 19GSA 2VCTA 5J47A 2FUG2 2JZRA 3LJRA 4KH7A 1FW1A 2B5EA 4MJAA 4OWYA 1ABAA 4Q5NA 3D0ZA 1YKAA 3ME8A 4E8EA 2LTKA 1K3LA 1Y25A 2JADA 5J9CA 2LJRA 4BL7A 3KM6A 2YPMA 3HVVA 1M2AA 2H0HA 2WB9A 3PINA 4I97A 3L9SA 2B5XA 5LCZA 4RI7A 5D8IA 3IA1A 3G9BA 4HU9A 4DSRA 4OCFA 3TRXA 3GV1A 1WE0A 3BOAA 1XVQA 5GSSA 4JEDA 4MZWA 2I81A 3GX8A 4BVXA 2I1UA 1BEDA 1AIUA 2AV4A 3BJ5A 3BCIA 4ECIA 4PQHA 1JZDA 1YF0A 1F37A 5D73A 1V58A 2RUFA 4BVYB 4FIWA 4MMMA 1F3BA 4NHWA 2EC4A 4KCEA 4OFTA 2WDUA 2VD0A 1SVMA 2I9HA 3FW2A 4G9HA 4LMWA 4AGSA 2LRTA 4X4JA 3LXTA 4WR5A 4TXOB 4O92A 1Y6EA 1BG1A 3LEFA 4EUYA 1MD4A 5ECOB 3HD5A 2HFDA 1TRWA 3ZYWA 1WMJA 3US3A 5B8BA 3PGTA 4N11A 2YZUA 2VCQA 4KCAA 5ECLB 2CQ9A 3GMFA 4TR0A 1BYEA 4MA9A 4G10A 1O85A 5CP1A 2VKZG 4NMUA 2F9SA 5GSTA 1K3OA 1TI3A 1BQ7A 4ZB7A 5DAKB 1S3DA 3HVXA 4JRRA 2AUVA 2TIRA 1GSQA 2PUKC 2R5GA 2R0PA 4XS1A 3U6VA 1TOFA 2GQLA 1ON4A 4XIHA 2L5OA 4EIQA 3F8UA 1GTIA 4Q5QA 4HQSA 5J4UA 3D22A 4N0ZA 3QDNA 5IO2A 4DSQA 1ZOFA 4CY8A 2DJ3A 1OAZA 2HE3A 3TB2A 4N10A 5ECQB 2H01A 2B5YA 5EPFA 3QCPA 4KSMA 4X1UA 5KOXA 1HNAA 2AB6A 3MDKA 3C71A 1S3AA 2NVLA 4RQRA 4KDYA 4IQAA 2P5RA 2IPAA 3G7IA 1G6WA 3EURA 2HZEA 4HS1A 2GSTA 3WT1A 1X0RA 3G7JA 1ZYQB 1W4VA 2PU9C 2OBIA 2ZNMA 3IXRA 3HKRA 2H8LA 4O7HA 3D5JA 3IPZA 1EGOA 3DIEA 2CX4A 5HR2A 2VM1A 3CMIA 5J5NA 4XRAA 4AI6A 3F4RA 2WFCA 4HEA2 3EPTA 2H75A 2R6KA 1H4OA 5ECMB 3I9V2 1RK4A 1XW9A 2FD3A 2C3NA 1QMVA 2DJ0A 3FRCA 2DKIA 3KXOA 1XW6A 4POMA 5J4YA 3HVSA 1TU7A 3WYWA 3CSHA 1SENA 5A1NA 4V1Ag 5C04A 4AJ7A 3HA9A 4TR3A 2RUEA 2F3MA 1PKZA 4MF7A 1OKTA 2B1LA 3E0UA 1WPIA 1B48A 3IR4A 2YCDA 2LNTA 1ZL9A 1K0MA 1YF1A 1X5DA 1CQHA 3HZ8A 1M99A 3W8JA 1FOVA 1G0TA 4L5LA 1Q98A 4Z2UA 5DBQA 5AIVA 2IMFA 1TDIA 3QFBC 3IAM2 2YNXA 2VLVA 1J0FA 2MMNA 2IFQA 4HDEA 2IMIA 5BMUA 1R4WA 1SD8A 4F03A 4KE3A 2P5QA 4ECJA 3LG6A 5F07A 2EFCA 1SL0B 3TUEA 8GSSA 2OADA 4I5QA 1U3IA 3UJ1A 1O8XA 2ON7A 2C8UA 1HYUA 2H66A 2PERA 1YEXA 2EFHA 4X0XA 3DXBA 3HDCA 5CO3A 3RPPA 1SYXA 4ZL8A 2VOCA 5G5EA 2X49A 4IVFA 2LRCA 5CNWA 3EU3A 3LYPA 3GX0A 4TRXA 2HSMB 3F9UA 1ERVA 5DALB 2OACA 2QSIA 4IELA 2YANA 1IYHA 3PR8A 1B8XA 5AGYA 2DMMA 4F0BA 1TK5B 4DEJA 2MYGA 5G31A 4TOPA 4Q5FA 3Q18A 3VPQA 3WGDA 3LSZA 3G7YA 2LUSA 4BVYA 2XBQA 1VF2A 3IC8A 3FMWA 2HSNB 2PVOC 4MABA 4PURA 1LBKA 3D6IA 3TJJA 2B1KA 3GL5A 3UBLA 4MJBA 4F2IA 4A5PA 4TXOA 4WBJA 1FAAA 4K0NA 1NSWA 2OE0A 2CT6A 2B6MA 3C7MA 3F0IA 3MNGA 3ZFLA 1WJKA 1K0OA 4O32A 1O73A 5JWOB 2N5AA 3FZ9A 1GUMA 4FYCA 1A0FA 1AQXA 4JZQA 2AHEA 4GXZA 2PMTA 3CRTA 4BPYA 1OC3A 2YV7A 4ECCA 2EIOA 2JZSA 5DAKA 4IGJA 3F63A 5ECRB 1Q4JA 3CWGA 3EE2A 4OFMA 2O5VA 5DVBA 1XW5A 3GH9A 1X9MB 5ECKB 4MF5A 3GTUA 3VI7A 1YQ1A 4L5OA 3DVXA 4OFNA 4ZB6A 1FVKA 3KEBA 2L57A 3TGZA 1WOUA 1MDKA 1PL2A 4XS4B 1HQOA 1K0DA 2BJXA 4K1FA 1EV9A 2WZ9A 2HXKA 1XWKA 4FO5A 2PGTA 2JU5A 6GSSA 4PNFA 2IMKA 1XOAA 3H93A 5IQYA 1XWCA 2KUCA 4MLYA 2X4AA 2L6DA 1AQWA 3RHCA 3IHGA 1Y1UA 2DIZA 3LW9A 4HQZA 5J3RA 3DWVA 3DMLA 2DLXA 4IP1A 1J08A 5CRWA 4HI7A 1TK8B 3NZNA 4WF5A 3GSTA 3MYDA 3F6DA 2B7KA 2H19A 3IK7A 5IO0A 3MSZA 1A8LA 5JCGA 1ZGNA 4Z7XA 2LSTA 1IYIA 5CAXA 4JR4A 4LL4B 1SYRA 1GSDA 4K7OA 3IK9A 2HYXA 2K8VA 3KIJA 2C0GA 5AISA 5CYYA 2H74A 5CRHA 1DBYA 3UOMA 1RQMA 5IMFA 2Z9SA 3DD3A 1M9BA 1XCCA 1T3BA 4G01A 3H4KA 5LNKe 2G0FA 5A4UA 3APOA 3FZ5A 2GSRA 1FB0A 2VIMA 2JL4A 2VUPA 3HJMA 1XVWA 2C80A 3M8NA 3EMPA 2V1MA 1VRSD 5ECNB 4K7NA 3L9VA 4E68A 3Q74A 4K5SA 2K18A 2LV3A 1V40A 2WS2A 2GSQA 1R26A 3TKSE 3R2QA 4RUVA 5D9VA 3M9KA 4EDYA 3VWUA 1M2DA 4GRFA 1OE7A 1T00A 1XWAA 1F9MA 1UVZA 5KN0A 2PPTA 3H79A 4MCUA 4PQIA 3GKMA 2HSMA 4ICYA 4IHUA 5DALA 2ZUPA 3KZQA 1O8WA 3ZFBA 2R3XA 1YVLA 2CZ2A 2C4JA 3LFLA 1GTBA 4KUNA 1QQ2A 3L4NA 4USSA 1I5GA 3KD0A 5B8AA 1K0CA 3GIXA 4K2XA 5KOWA 2VL3A 3C1SA 2HSNA 1ERTA 3KJYA 5IOXA 1O7UA 1KBNA 2G2QA 2NTOA 3TRPA 3CRUA 1V2AA 1T7PB 1I9DA 4QMKA 4N30A 3LGCA 2GSSA 3L0HA 4WR4A 2YJ7A 3VWXA 5A4WA 3DYRA 4NV5A 3UARA 4JR6A 2CVDA 3GA4A 5G1KA 4IW9A 3BBYA 4FH8A 2MMOA 4KB3A 4J2FA 4MF6A 4ULXA 12GSA 2YJHA 2R4VA 1SVOA 2YN1A 5IMDA 5L71A 1EOGA 5IMZA 1A24A 3DVWA 3EYTA 3H1NA 1AAZA 2CV4A 1EV4A 2DJKA 1GULA 5A4VA 4L0UA 1XWGA 4NV2A 4AJ8A 5FHIA 2KLXA 4AKGA 4KDUA 5DQYA 5E59A 1B9XC 3APSA 4K2DA 1R7HA 2EIRA 3LYKA 4IJIA 2L4CA 3ZITA 5DQSA 4XS4A 3EMXA 1GUHA 2FWHA 4MJCA 3ZMKA 2CA8A 4GQFA 4TR4A 1GSSA 4ACSA 9GSSA 3QAGA 3HXSA 5A34B 1YZXA 1NW2A 2F51A 2FWGA 3Q6OA 2DMLA 4OCEA 1X9SB 1PGTA 4AKHA 5G1LA 1ILOA 2FNOA 3ZIVA 3TOTA 1ERUA 3FK8A 4WEYA 1UA5A 3RBTA 6GSXA 2FHEA 5HR1A 4IS0A 4IQ1A 3HJOA 4GDFA 2GZPA 2V32A 3GTUB 2JSZA 3DGQA 1FG4A 2E2GA 3WGXA 4EF0A 1GSYA 1MDJA 4MZBA 3GYKA 3GFKA 3QOUA 4K5RA 5F06A 4O5UA 1GLPA 4PUFC 1N25A 4G19A 4PTSA 4ZBDA 5HR3A 1JZRA 2OBKA 2GTUA 3D4MA 2NBSA 3CTGA 1CQGA 3A2VA 3A2XA 3FY7A 4EXJA 2YP6A 2VLTA 4TVEA 1E6BA 4CW9A 4DSSB 1EOHA 4TR1B 4WXTA 4EKZA 2VD1A 4MZCA 1NHYA 1URMA 1G7EA 2V41A 4TW5A 1WIKA 3GURA 1PN9A 1OKDA 5E4WA 1E2YA 4H86A 1PKWA 3CSIA 1TI1A 1YJ6A 3A3TA 2REMA 4KW6A 1G7OA 3BD2A 2QA2A 2H1BA 1J9BA 3ZL5A 4OO4A 4ID0A 2FA4A 4V1Ap 1Z6NA 4EIPA 3FZ4A 2PBJA 1HNBA 3P7XA 2IWTA 2VCWA 1XZOA 5F8BA 2LEGA 1W89A 1A2MA 4HZ4A 4HOJA 6GSWA 14GSA 2DIYA 3ME7A 4ZBBA 2DBCA 1TRUA 1SK0A 3QAWA 5F0GA 1DUGA 2H6YA 2DJ1A 3VWVA 1O81A 5FWGA 2YWMA 4FQUA 1GUKA 4ML1A 5ID2B 4BWSA 5H5SA 4QQ7A 5HFKA 1SU9A 3N9JA 4HZ2A 4KSOA 3HY2A 4KAEA 5IMCA 4JE1A 5KN1A 2J23A 4K8MA 1WRYA 4W66A 4AKXB 3C73A 1GP1A 5AN1A 2DJ2A 4XTSA 3QD9A 2C0EA 5AIXA 1T4ZA 1HNCA 3FZAA 1TK0B 3TKSC 4KDXA 1UN2A 3C8EA 4LMVA 1RW1A 3VURA 2RM6A 4TXVA 4EL1A 5D9TA 3W8SA 1AC1A 1V98A 1OE8A 2WJUA 2H1LA 1B9YC 1XOBA 3ERGA 3KP9A 2MMZA 3F3QA 1O6JA 3WD6A 5C00A 1NHOA 2VO4A 4G0KA 3QR6A 4YH2A 1GSFA 1U6TA 1X5EA 2NPBA 2PN8A 4N0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRN A;  4EO3 A;  4YQM A;  4TN8 A;  3PH9 A;  3HZ4 A;  1R5A A;  1X5C A;  4OO5 A;  4XS6 A;  1HD2 A;  4HJ2 A;  1M7T A;  3KP8 A;  2A2R A;  1F6M C;  2E2M A;  1OYJ A;  4JBB A;  1OC9 B;  3V1W A;  20GS A;  3UMA A;  4I2U A;  4Q5R A;  1XWB A;  4YAP A;  5FT3 A;  1AUC A;  2CAQ A;  3KMO A;  2XPE A;  2FLS A;  1GRX A;  4GTU A;  5JWQ B;  3RHB A;  3HCZ A;  2FA8 A;  1YKC A;  1A23 A;  3VI5 A;  3KTL A;  5ECH B;  1MD3 A;  2IL3 A;  3GUS A;  2C0D A;  1M9A A;  2M46 A;  3MWH A;  2IME A;  5IMV A;  2E7P A;  2A4V A;  5ABR A;  18GS A;  1T8E B;  4ECB A;  3F6F A;  1SKW B;  1USB A;  2R2J A;  10GS A;  2H6Z A;  1TXX A;  3RAZ A;  3ZRD A;  3VPT A;  4DSS A;  2QKE A;  1UC7 A;  2HSY A;  4TR1 A;  1SKS B;  2VM2 A;  1KEB A;  2HT9 A;  3TKR A;  1A2J A;  3FHK A;  2HNL A;  3E3E A;  1BX9 A;  2FWE A;  2KP1 A;  4F82 A;  4GLT A;  2NDO A;  4WBR D;  1SJZ A;  1T1V A;  1JZO A;  2IMD A;  3RDW A;  1GNE A;  1PRX A;  1DSB A;  1XFL A;  2KHP A;  1QUW A;  3GKK A;  4V2M A;  4POB A;  2HRA A;  2UZ8 A;  2HRF A;  1PL1 A;  4AF2 A;  1K3Y A;  4FYU A;  3ERW A;  2HI7 A;  3FR9 A;  4MK3 A;  3CTF A;  3GKX A;  3FEU A;  4GWR A;  4YQV A;  1YY7 A;  3KGK A;  3FR3 A;  1YDK A;  2H70 A;  1QK8 A;  3K8N A;  3ZIJ A;  6GSV A;  4EE0 A;  2V6K A;  4PUA A;  4XRD A;  4L0W A;  1JHB A;  2M72 A;  2EIQ A;  3QPM A;  4PNG A;  2B7J A;  4K9Z A;  4D73 B;  4DVC A;  4O5R A;  1AW9 A;  3VFI A;  2HSH A;  3L78 A;  5ELG A;  3P2A A;  2XPD A;  3IOS A;  17GS A;  3L9U A;  3UVT A;  1Z3E A;  2I3Y A;  2GVP A;  4G0L A;  11GS A;  2X8G A;  1THO A;  5ID2 A;  1VF3 A;  5F05 A;  4NAX A;  2RM5 A;  4YQU A;  1PD2 1;  1Z7P A;  2K6V A;  4XCS A;  4PX1 A;  4MP4 A;  3W6G A;  1VF1 A;  2K9F A;  2VCV A;  2WUL A;  1C72 A;  2FGX A;  2H0I A;  4V2N A;  3EWL A;  2O87 A;  2GQK A;  1VF4 A;  3WT2 A;  3UEM A;  1BJX A;  5GZZ B;  1SK2 A;  3RPN A;  1ERW A;  2X8H A;  4J57 E;  4OD7 A;  2IN3 A;  4CHS A;  4K6X A;  1QGV A;  3EIN A;  2H1G A;  5INY A;  1SK1 A;  1EEM A;  1U87 A;  2L5L A;  1SL1 B;  5JCW A;  3M0F A;  1XXU A;  4YAV A;  1V57 A;  2H6X A;  5KEJ A;  4V2L A;  1Z5Y E;  6GSU A;  2OE1 A;  2H76 A;  2P31 A;  2X8C A;  5DJM A;  2VL2 C;  3GHA A;  3IV4 A;  5DJL A;  3EU4 A;  1A0R P;  3ED3 A;  4ZIL A;  4HUA A;  1GSU A;  3H8Q A;  2E0Q A;  4MPF A;  1F3A A;  1K0A A;  4LA1 A;  3TRQ A;  4XHM A;  5ENU A;  2IIY A;  4F0C A;  4P3Y B;  1KNG A;  2YWI A;  1DE1 A;  1B4Q A;  1GWC A;  1OC9 A;  3P8W A;  3MAK A;  5B7C A;  5DCG A;  1AQV A;  2H1D A;  2MMA A;  3KTB A;  3S9F A;  3TJK A;  1YEP A;  1ZMA A;  2V6O A;  1SJI A;  2QGV A;  3IRA A;  1A8Y A;  2LQO A;  3VWW A;  2H71 A;  5KN3 A;  2C1Y A;  5GAN D;  3UBK A;  3EVI A;  2CAI A;  2H73 A;  2JSY A;  1EP7 A;  4AJ6 A;  3TKS A;  2H72 A;  4PQ1 A;  7GSS A;  3P90 A;  2V2G A;  3GH6 A;  3BCK A;  1VGL A;  1ACV A;  1XPV A;  5G5F A;  3TKQ A;  1S3C A;  3KCM A;  4ZIJ A;  3IHQ A;  3FKF A;  3UVH A;  2BMX A;  2O85 A;  2IJY A;  1X9W B;  2QC7 A;  5A5K A;  22GS A;  5KN2 A;  2HLS A;  5H5Q A;  4IBP A;  3E9J B;  1GNW A;  1PX6 A;  2YWO A;  2XBI A;  4GSS A;  3LXZ A;  3PPU A;  2F8A A;  4IKH A;  3TDG A;  3GN3 A;  5LD0 A;  2I4A A;  3A2W A;  3UL3 A;  2A2S A;  4RI6 A;  4ILF A;  3CBU A;  2RLI A;  1DE2 A;  1FO5 A;  1PSQ A;  4NHZ A;  2YWN A;  3TKP A;  1QXH A;  1TP9 A;  2TRC P;  3GSS A;  3IE3 A;  3M3M A;  2GT5 A;  2B3S A;  3I69 A;  3HYP A;  5ELA A;  2LJA A;  1TKD B;  1M0U A;  4D73 A;  2VCZ A;  1FVJ A;  2LNS A;  2TRX A;  5IIZ A;  2O8V B;  2AAW A;  3IBH A;  2XHF A;  3IDV A;  3M9J A;  5EY6 A;  4I2T A;  2P0G A;  1SKR B;  2GQM A;  3ZML A;  2RII A;  2OA7 A;  5J41 A;  3KH7 A;  1OVN A;  2YV9 A;  3GKN A;  4J56 E;  2F8F A;  1FB6 A;  5GAP D;  4IJ3 A;  5IM9 A;  1GH2 A;  1K0B A;  2L59 A;  3CYN A;  5HFG A;  2CZ3 A;  3QMX A;  4K7I A;  4EVM A;  2GZY A;  1JLW A;  3ZTL A;  13GS A;  6GST A;  4KX4 A;  4CDO A;  3TJB A;  3TJG A;  2ON5 A;  1TTZ A;  2GGT A;  2WCI A;  2PWJ A;  2WGR A;  4HJM A;  3TCO A;  4OMV A;  1MEK A;  5COH A;  2O89 A;  2ZCT A;  4QL7 A;  5J9B A;  4K0G A;  2VL9 A;  2AYT A;  4EC0 A;  4ZBA A;  3VK9 A;  3TOU A;  4WET A;  3I43 A;  3GRX A;  3QFA C;  3TJF A;  1ML6 A;  4FYB A;  1OC8 A;  3LOR A;  5JCU A;  1TJD A;  3HJP A;  3VLN A;  4TKY A;  3CXG A;  2L4Q A;  2LJK A;  4EDZ A;  1V9W A;  4ML6 A;  3CSJ A;  2GT6 A;  2YZH A;  4NPB A;  1G6Y A;  4BA7 A;  1GL8 A;  3I6A A;  2HRK B;  2DJJ A;  3IC4 A;  3QAV A;  4G0I A;  5ECP B;  4HU7 A;  1PA3 A;  2XC2 A;  2J9H A;  2R37 A;  5CRG A;  4GQC A;  3J7Y k;  5IPG A;  4POL A;  4KND A;  4F9Z A;  1U88 A;  3O3T A;  3Q19 A;  2N5B A;  3EC3 A;  4GST A;  3O6T A;  4ZXG A;  4BL7 B;  1T4Y A;  1U3A A;  5CRD A;  1TRS A;  3M1G A;  3F4T A;  3NIV A;  5DDL A;  5D93 A;  5HFI A;  1PX7 A;  5ECS A;  1MTC A;  3SWL A;  2AJQ B;  5B6N A;  2GS3 A;  2JAC A;  1Z6M A;  2WRT A;  1FHE A;  4BVX B;  16GS A;  4ISD A;  1GLQ A;  1H75 A;  3HHV A;  3KH9 A;  4IN0 A;  1PMT A;  4X43 A;  2D2Z A;  1MDI A;  5DCH A;  4KA0 A;  4MH2 A;  5EVO A;  1GTU A;  3R3E A;  2LKU A;  1N2A A;  5B6M A;  3GL3 A;  2VL2 A;  5ECI B;  3JCM L;  2OE3 A;  3U5R E;  5D96 A;  5D9W A;  1GTA A;  4IP6 A;  3GNJ A;  5D9X A;  3O76 A;  1JLV A;  2C3Q A;  5JWR B;  3ZZX A;  1ZZY A;  4POK A;  3DEX A;  3A5W A;  1THX A;  2ES7 A;  3D21 A;  4ZB8 A;  3IAS 2;  1Z7R A;  1WP0 A;  1TW9 A;  1XBS A;  2X64 A;  2H0G A;  3ZVJ D;  3ZVJ A;  3ZRE A;  4GCI A;  3DKS A;  1AXD A;  4ZB9 A;  5EL8 A;  3SBC A;  2DC5 A;  2BTO T;  2VCX A;  2LRN A;  1PQN A;  2KP2 A;  1A2L A;  2OJL A;  3FR6 A;  4ZL7 A;  4PGT A;  1QFN A;  2OKA A;  1JFU A;  1XIY A;  2FCH A;  3WGE A;  2HQT A;  4L8E A;  4I8B A;  3J7Y b;  2K8S A;  5CRE A;  2H30 A;  2FWF A;  1NM3 A;  4KGI A;  3AY8 A;  1SD9 A;  2HZF A;  5G30 A;  4WF4 A;  2LQQ A;  1ST9 A;  5G2Z A;  3N5O A;  2M80 A;  4GSN A;  4I6X A;  1ZYE A;  5IMA A;  4RQX A;  2ALB A;  4NWY A;  1EGR A;  4QL9 A;  3ZLP A;  2C3T A;  2MZC A;  2LS5 A;  3D4T A;  3UAP A;  2JZT A;  1BG5 A;  1BAY A;  2FY6 A;  1LJR A;  1SJ6 A;  5IOW A;  4GF0 A;  2HZE B;  2L6C A;  2X99 A;  2O7K A;  4LLR A;  1EEJ A;  1SL2 B;  3UIW A;  2GDR A;  1EZK A;  4ZL9 A;  2GZZ A;  1GSE A;  3OR5 A;  2HRN A;  4PXO A;  4E8H A;  2VAF A;  2MBT A;  1M2B A;  2VLU A;  3APQ A;  1K0N A;  2CVB A;  4MPG A;  1B4P A;  6GSY A;  5H5R A;  2C0F A;  4NXI A;  2PVQ A;  4JU5 A;  2KOK A;  2GLR A;  4KF9 A;  3ERF A;  5HR0 A;  1N8J A;  2N5F A;  1TRV A;  2MBS A;  1TU8 A;  3LQ7 A;  2DSA A;  5HQP A;  3C1R A;  4MJE A;  1KTE A;  4MDC A;  3F3R A;  2CX3 A;  2CVK A;  3ISO A;  5IPH A;  1LU4 A;  1JZW A;  1EWX A;  4BWQ A;  2YOI A;  1ZCP A;  3LWA A;  1R5P A;  2HRK A;  4WKW A;  1F2E A;  4LL1 B;  3FYG A;  4G2E A;  2H1A A;  3NOF A;  1WWJ A;  2IFQ B;  3F4S A;  1Z9H A;  3KMN A;  1EP8 A;  4MH3 A;  19GS A;  2VCT A;  2FUG 2;  2JZR A;  3LJR A;  4KH7 A;  1FW1 A;  2B5E A;  4MJA A;  4OWY A;  1ABA A;  4Q5N A;  3D0Z A;  1YKA A;  3ME8 A;  4E8E A;  2LTK A;  1K3L A;  1Y25 A;  2JAD A;  5J9C A;  2LJR A;  4BL7 A;  3KM6 A;  2YPM A;  3HVV A;  1M2A A;  2H0H A;  2WB9 A;  3PIN A;  4I97 A;  3L9S A;  2B5X A;  5LCZ A;  4RI7 A;  5D8I A;  3IA1 A;  3G9B A;  4HU9 A;  4DSR A;  4OCF A;  3TRX A;  3GV1 A;  1WE0 A;  3BOA A;  1XVQ A;  5GSS A;  4JED A;  4MZW A;  2I81 A;  3GX8 A;  4BVX A;  2I1U A;  1BED A;  1AIU A;  2AV4 A;  3BJ5 A;  3BCI A;  4ECI A;  4PQH A;  1JZD A;  1YF0 A;  1F37 A;  5D73 A;  1V58 A;  2RUF A;  4BVY B;  4FIW A;  4MMM A;  1F3B A;  4NHW A;  2EC4 A;  4KCE A;  4OFT A;  2WDU A;  2VD0 A;  2I9H A;  3FW2 A;  4G9H A;  4LMW A;  4AGS A;  2LRT A;  3LXT A;  4WR5 A;  4TXO B;  4O92 A;  1Y6E A;  3LEF A;  4EUY A;  1MD4 A;  5ECO B;  3HD5 A;  2HFD A;  1TRW A;  3ZYW A;  1WMJ A;  3US3 A;  5B8B A;  3PGT A;  4N11 A;  2YZU A;  2VCQ A;  4KCA A;  5ECL B;  2CQ9 A;  3GMF A;  4TR0 A;  1BYE A;  4MA9 A;  4G10 A;  1O85 A;  5CP1 A;  4NMU A;  2F9S A;  5GST A;  1K3O A;  1TI3 A;  1BQ7 A;  5DAK B;  1S3D A;  3HVX A;  4JRR A;  2AUV A;  2TIR A;  1GSQ A;  2PUK C;  2R5G A;  4XS1 A;  3U6V A;  1TOF A;  2GQL A;  1ON4 A;  4XIH A;  2L5O A;  3F8U A;  1GTI A;  4Q5Q A;  4HQS A;  5J4U A;  3D22 A;  4N0Z A;  3QDN A;  5IO2 A;  4DSQ A;  1ZOF A;  2DJ3 A;  1OAZ A;  2HE3 A;  3TB2 A;  4N10 A;  5ECQ B;  2H01 A;  2B5Y A;  5EPF A;  3QCP A;  4KSM A;  4X1U A;  1HNA A;  2AB6 A;  3MDK A;  3C71 A;  1S3A A;  2NVL A;  4RQR A;  4KDY A;  4IQA A;  2P5R A;  2IPA A;  3G7I A;  1G6W A;  3EUR A;  2HZE A;  4HS1 A;  2GST A;  3WT1 A;  1X0R A;  3G7J A;  1ZYQ B;  1W4V A;  2PU9 C;  2OBI A;  2ZNM A;  3IXR A;  3HKR A;  2H8L A;  4O7H A;  3D5J A;  3IPZ A;  1EGO A;  3DIE A;  2CX4 A;  5HR2 A;  2VM1 A;  3CMI A;  5J5N A;  4XRA A;  3F4R A;  2WFC A;  4HEA 2;  2H75 A;  2R6K A;  1H4O A;  5ECM B;  3I9V 2;  1RK4 A;  1XW9 A;  2FD3 A;  2C3N A;  1QMV A;  2DJ0 A;  3FRC A;  3KXO A;  1XW6 A;  4POM A;  3HVS A;  1TU7 A;  3WYW A;  3CSH A;  1SEN A;  4V1A g;  5C04 A;  4AJ7 A;  3HA9 A;  4TR3 A;  2RUE A;  2F3M A;  1PKZ A;  4MF7 A;  1OKT A;  2B1L A;  3E0U A;  1WPI A;  1B48 A;  3IR4 A;  2YCD A;  2LNT A;  1ZL9 A;  1K0M A;  1YF1 A;  1X5D A;  1CQH A;  3HZ8 A;  1M99 A;  3W8J A;  1FOV A;  1G0T A;  4L5L A;  1Q98 A;  5DBQ A;  5AIV A;  2IMF A;  1TDI A;  3QFB C;  3IAM 2;  2YNX A;  2VLV A;  1J0F A;  2MMN A;  2IFQ A;  4HDE A;  2IMI A;  5BMU A;  1R4W A;  1SD8 A;  4F03 A;  4KE3 A;  2P5Q A;  4ECJ A;  3LG6 A;  5F07 A;  1SL0 B;  3TUE A;  8GSS A;  2OAD A;  4I5Q A;  1U3I A;  3UJ1 A;  1O8X A;  2ON7 A;  2C8U A;  1HYU A;  2H66 A;  2PER A;  1YEX A;  4X0X A;  3DXB A;  3HDC A;  5CO3 A;  3RPP A;  1SYX A;  4ZL8 A;  2VOC A;  5G5E A;  4IVF A;  2LRC A;  5CNW A;  3EU3 A;  3LYP A;  3GX0 A;  4TRX A;  2HSM B;  3F9U A;  1ERV A;  5DAL B;  2OAC A;  2QSI A;  4IEL A;  2YAN A;  1IYH A;  3PR8 A;  1B8X A;  5AGY A;  2DMM A;  4F0B A;  1TK5 B;  4DEJ A;  2MYG A;  5G31 A;  4TOP A;  4Q5F A;  3Q18 A;  3VPQ A;  3WGD A;  3LSZ A;  3G7Y A;  2LUS A;  4BVY A;  2XBQ A;  1VF2 A;  3IC8 A;  2HSN B;  2PVO C;  4MAB A;  4PUR A;  1LBK A;  3D6I A;  3TJJ A;  2B1K A;  3GL5 A;  3UBL A;  4MJB A;  4F2I A;  4TXO A;  4WBJ A;  1FAA A;  4K0N A;  1NSW A;  2OE0 A;  2CT6 A;  2B6M A;  3C7M A;  3F0I A;  3MNG A;  3ZFL A;  1WJK A;  1K0O A;  4O32 A;  1O73 A;  5JWO B;  2N5A A;  3FZ9 A;  1GUM A;  4FYC A;  1A0F A;  1AQX A;  4JZQ A;  2AHE A;  4GXZ A;  2PMT A;  3CRT A;  4BPY A;  1OC3 A;  2YV7 A;  4ECC A;  2EIO A;  2JZS A;  5DAK A;  4IGJ A;  3F63 A;  5ECR B;  1Q4J A;  3EE2 A;  4OFM A;  5DVB A;  1XW5 A;  3GH9 A;  1X9M B;  5ECK B;  4MF5 A;  3GTU A;  3VI7 A;  1YQ1 A;  4L5O A;  3DVX A;  4OFN A;  4ZB6 A;  1FVK A;  3KEB A;  2L57 A;  3TGZ A;  1WOU A;  1MDK A;  1PL2 A;  4XS4 B;  1HQO A;  1K0D A;  2BJX A;  4K1F A;  1EV9 A;  2WZ9 A;  2HXK A;  1XWK A;  4FO5 A;  2PGT A;  2JU5 A;  6GSS A;  4PNF A;  2IMK A;  1XOA A;  3H93 A;  5IQY A;  1XWC A;  2KUC A;  4MLY A;  2L6D A;  1AQW A;  3RHC A;  2DIZ A;  4HQZ A;  5J3R A;  3DWV A;  4IP1 A;  2DLX A;  3DML A;  1J08 A;  5CRW A;  4HI7 A;  1TK8 B;  3NZN A;  4WF5 A;  3GST A;  3F6D A;  2B7K A;  2H19 A;  3IK7 A;  5IO0 A;  3MSZ A;  1A8L A;  5JCG A;  1ZGN A;  4Z7X A;  2LST A;  1IYI A;  5CAX A;  4JR4 A;  4LL4 B;  1SYR A;  1GSD A;  4K7O A;  3IK9 A;  2HYX A;  2K8V A;  3KIJ A;  2C0G A;  5AIS A;  5CYY A;  2H74 A;  5CRH A;  1DBY A;  3UOM A;  1RQM A;  5IMF A;  2Z9S A;  3DD3 A;  1M9B A;  1XCC A;  1T3B A;  3H4K A;  5LNK e;  2G0F A;  5A4U A;  3APO A;  3FZ5 A;  2GSR A;  1FB0 A;  2VIM A;  2JL4 A;  2VUP A;  3HJM A;  1XVW A;  2C80 A;  3M8N A;  3EMP A;  2V1M A;  1VRS D;  5ECN B;  4K7N A;  3L9V A;  3Q74 A;  2K18 A;  2LV3 A;  1V40 A;  2WS2 A;  2GSQ A;  1R26 A;  3TKS E;  3R2Q A;  4RUV A;  5D9V A;  3M9K A;  4EDY A;  3VWU A;  1M2D A;  4GRF A;  1OE7 A;  1T00 A;  1XWA A;  1F9M A;  1UVZ A;  5KN0 A;  2PPT A;  3H79 A;  4MCU A;  4PQI A;  3GKM A;  2HSM A;  4IHU A;  5DAL A;  2ZUP A;  3KZQ A;  1O8W A;  3ZFB A;  2R3X A;  2CZ2 A;  2C4J A;  3LFL A;  1GTB A;  4KUN A;  1QQ2 A;  3L4N A;  4USS A;  1I5G A;  3KD0 A;  5B8A A;  1K0C A;  3GIX A;  2VL3 A;  3C1S A;  1ERT A;  3KJY A;  5IOX A;  1O7U A;  1KBN A;  2G2Q A;  2NTO A;  3TRP A;  3CRU A;  1V2A A;  1T7P B;  1I9D A;  4N30 A;  3LGC A;  2GSS A;  3L0H A;  4WR4 A;  2YJ7 A;  3VWX A;  5A4W A;  3DYR A;  4NV5 A;  3UAR A;  4JR6 A;  2CVD A;  3GA4 A;  5G1K A;  4IW9 A;  3BBY A;  4FH8 A;  2MMO A;  4KB3 A;  4J2F A;  4MF6 A;  4ULX A;  12GS A;  2YJH A;  2R4V A;  2YN1 A;  5IMD A;  5L71 A;  1EOG A;  5IMZ A;  1A24 A;  3DVW A;  3EYT A;  3H1N A;  1AAZ A;  2CV4 A;  1EV4 A;  2DJK A;  1GUL A;  5A4V A;  4L0U A;  1XWG A;  4NV2 A;  4AJ8 A;  5FHI A;  2KLX A;  4KDU A;  5DQY A;  5E59 A;  1B9X C;  3APS A;  4K2D A;  1R7H A;  2EIR A;  3LYK A;  4IJI A;  2L4C A;  3ZIT A;  5DQS A;  4XS4 A;  3EMX A;  1GUH A;  2FWH A;  4MJC A;  3ZMK A;  2CA8 A;  4GQF A;  4TR4 A;  1GSS A;  4ACS A;  9GSS A;  3QAG A;  3HXS A;  1YZX A;  1NW2 A;  2F51 A;  2FWG A;  3Q6O A;  2DML A;  4OCE A;  1X9S B;  1PGT A;  5G1L A;  1ILO A;  2FNO A;  3ZIV A;  3TOT A;  1ERU A;  3FK8 A;  4WEY A;  1UA5 A;  3RBT A;  6GSX A;  2FHE A;  5HR1 A;  4IS0 A;  4IQ1 A;  3HJO A;  2GZP A;  2V32 A;  3GTU B;  2JSZ A;  3DGQ A;  1FG4 A;  2E2G A;  3WGX A;  4EF0 A;  1GSY A;  1MDJ A;  4MZB A;  3GYK A;  3GFK A;  3QOU A;  5F06 A;  1GLP A;  4PUF C;  4PTS A;  4G19 A;  4ZBD A;  5HR3 A;  1JZR A;  2OBK A;  2GTU A;  3D4M A;  2NBS A;  3CTG A;  1CQG A;  3A2V A;  3A2X A;  3FY7 A;  4EXJ A;  2YP6 A;  2VLT A;  4TVE A;  1E6B A;  4CW9 A;  4DSS B;  1EOH A;  4TR1 B;  4WXT A;  4EKZ A;  2VD1 A;  4MZC A;  1NHY A;  1URM A;  1G7E A;  2V41 A;  4TW5 A;  1WIK A;  3GUR A;  1PN9 A;  1OKD A;  5E4W A;  1E2Y A;  4H86 A;  1PKW A;  3CSI A;  1TI1 A;  1YJ6 A;  3A3T A;  2REM A;  4KW6 A;  1G7O A;  3BD2 A;  2H1B A;  1J9B A;  3ZL5 A;  4OO4 A;  4ID0 A;  2FA4 A;  4V1A p;  1Z6N A;  3FZ4 A;  2PBJ A;  1HNB A;  3P7X A;  2IWT A;  2VCW A;  1XZO A;  5F8B A;  2LEG A;  1W89 A;  1A2M A;  4HZ4 A;  4HOJ A;  6GSW A;  14GS A;  2DIY A;  3ME7 A;  4ZBB A;  2DBC A;  1TRU A;  1SK0 A;  3QAW A;  5F0G A;  1DUG A;  2H6Y A;  2DJ1 A;  3VWV A;  1O81 A;  5FWG A;  2YWM A;  4FQU A;  1GUK A;  4ML1 A;  5ID2 B;  4BWS A;  5H5S A;  4QQ7 A;  5HFK A;  1SU9 A;  3N9J A;  4HZ2 A;  4KSO A;  3HY2 A;  4KAE A;  5IMC A;  4JE1 A;  5KN1 A;  2J23 A;  4K8M A;  1WRY A;  3C73 A;  1GP1 A;  5AN1 A;  2DJ2 A;  4XTS A;  3QD9 A;  2C0E A;  5AIX A;  1T4Z A;  1HNC A;  3FZA A;  1TK0 B;  3TKS C;  4KDX A;  1UN2 A;  3C8E A;  4LMV A;  1RW1 A;  3VUR A;  2RM6 A;  4TXV A;  4EL1 A;  5D9T A;  3W8S A;  1AC1 A;  1V98 A;  1OE8 A;  2WJU A;  1B9Y C;  1XOB A;  3ERG A;  3KP9 A;  2MMZ A;  3F3Q A;  1O6J A;  3WD6 A;  5C00 A;  1NHO A;  2VO4 A;  4G0K A;  3QR6 A;  4YH2 A;  1GSF A;  1U6T A;  1X5E A;  2NPB A;  2PN8 A;  4N0V A; 
#chains in the Genus database with same CATH topology
 3DRN A;  4EO3 A;  4YQM A;  4TN8 A;  3PH9 A;  3A5I A;  3HZ4 A;  1R5A A;  1X5C A;  4OO5 A;  4XS6 A;  1HD2 A;  4HJ2 A;  1M7T A;  3KP8 A;  2A2R A;  1F6M C;  2E2M A;  1OYJ A;  4JBB A;  1OC9 B;  3V1W A;  20GS A;  3UMA A;  4I2U A;  4Q5R A;  5A34 A;  1XWB A;  4YAP A;  5FT3 A;  1AUC A;  2CAQ A;  3KMO A;  2XPE A;  2FLS A;  1GRX A;  4GTU A;  5JWQ B;  3RHB A;  3HCZ A;  2FA8 A;  1YKC A;  1A23 A;  3VI5 A;  3KTL A;  5ECH B;  1MD3 A;  2IL3 A;  3GUS A;  2C0D A;  1M9A A;  2M46 A;  3MWH A;  2IME A;  5IMV A;  2E7P A;  2A4V A;  5BRT A;  5ABR A;  18GS A;  1T8E B;  4ECB A;  3F6F A;  1SKW B;  1USB A;  2R2J A;  10GS A;  1BF5 A;  2H6Z A;  1TXX A;  3RAZ A;  3ZRD A;  3VPT A;  4DSS A;  2QKE A;  1UC7 A;  2HSY A;  1I1I P;  4TR1 A;  1SKS B;  2VM2 A;  1KEB A;  2HT9 A;  3TKR A;  1A2J A;  3FHK A;  2HNL A;  3E3E A;  1BX9 A;  2FWE A;  2KP1 A;  4F82 A;  4GLT A;  2NDO A;  4WBR D;  1SJZ A;  1T1V A;  1JZO A;  2IMD A;  3RDW A;  1GNE A;  1PRX A;  1DSB A;  1XFL A;  2KHP A;  1PFO A;  1QUW A;  3GKK A;  4V2M A;  4POB A;  2HRA A;  2UZ8 A;  2HRF A;  1PL1 A;  4AF2 A;  1K3Y A;  4FYU A;  3ERW A;  2HI7 A;  3FR9 A;  4MK3 A;  3CTF A;  3GKX A;  3FEU A;  4GWR A;  4YQV A;  1YY7 A;  3KGK A;  3FR3 A;  1YDK A;  2H70 A;  4O5Q A;  1QK8 A;  3K8N A;  3ZIJ A;  6GSV A;  4EE0 A;  2V6K A;  4PUA A;  4XRD A;  4L0W A;  1JHB A;  2M72 A;  2EIQ A;  3QPM A;  4PNG A;  2B7J A;  4K9Z A;  4D73 B;  4DVC A;  4O5R A;  1AW9 A;  3VFI A;  2HSH A;  3L78 A;  5ELG A;  3P2A A;  2XPD A;  3IOS A;  17GS A;  3L9U A;  3UVT A;  1Z3E A;  2A4H A;  2I3Y A;  2R0G A;  2GVP A;  3RGB C;  4G0L A;  4CY6 A;  11GS A;  2X8G A;  1THO A;  5ID2 A;  1VF3 A;  5F05 A;  4NAX A;  2RM5 A;  4YQU A;  4YKF A;  1PD2 1;  1Z7P A;  2K6V A;  4XCS A;  4PX1 A;  4MP4 A;  3W6G A;  2O3E A;  1VF1 A;  2K9F A;  2VCV A;  2WUL A;  1C72 A;  2FGX A;  2H0I A;  4V2N A;  3EWL A;  2O87 A;  2GQK A;  1VF4 A;  3WT2 A;  3UEM A;  1BJX A;  5GZZ B;  1SK2 A;  3RPN A;  1ERW A;  2X8H A;  4J57 E;  4OD7 A;  2IN3 A;  4CHS A;  4K6X A;  1QGV A;  3EIN A;  2H1G A;  5INY A;  1SK1 A;  1EEM A;  1U87 A;  2L5L A;  1SL1 B;  5JCW A;  3M0F A;  1XXU A;  4YAV A;  1V57 A;  2DKH A;  2H6X A;  5KEJ A;  4V2L A;  1Z5Y E;  2WZS A;  6GSU A;  2OE1 A;  2H76 A;  3MIX A;  1ZYN A;  2P31 A;  2X8C A;  5DJM A;  2VL2 C;  3GHA A;  3IV4 A;  5DJL A;  3EU4 A;  4N3Z A;  2EFD A;  1A0R P;  2UV8 G;  3ED3 A;  4ZIL A;  4HUA A;  1GSU A;  3H8Q A;  2E0Q A;  4MPF A;  1F3A A;  1K0A A;  4LA1 A;  3TRQ A;  4XHM A;  5ENU A;  2IIY A;  4F0C A;  4P3Y B;  1KNG A;  2YWI A;  1DE1 A;  1B4Q A;  1GWC A;  4AKI A;  1OC9 A;  3P8W A;  3MAK A;  5B7C A;  5DCG A;  1AQV A;  2H1D A;  2MMA A;  3KTB A;  3S9F A;  3TJK A;  1YEP A;  1ZMA A;  2V6O A;  1SJI A;  2QGV A;  3IRA A;  1A8Y A;  2LQO A;  3VWW A;  2H71 A;  5KN3 A;  2C1Y A;  5GAN D;  3UBK A;  3EVI A;  2CAI A;  2H73 A;  2JSY A;  3HMJ G;  1EP7 A;  4AJ6 A;  3TKS A;  2H72 A;  4PQ1 A;  7GSS A;  3P90 A;  2V2G A;  3GH6 A;  3BCK A;  1VGL A;  1ACV A;  1XPV A;  5G5F A;  3TKQ A;  1S3C A;  3KCM A;  4ZIJ A;  3IHQ A;  3FKF A;  3UVH A;  2EFE A;  2BMX A;  2O85 A;  2IJY A;  1X9W B;  2QC7 A;  5A5K A;  22GS A;  5KN2 A;  2HLS A;  5H5Q A;  4IBP A;  3E9J B;  1GNW A;  1PX6 A;  2YWO A;  2XBI A;  4GSS A;  3LXZ A;  3PPU A;  2F8A A;  4IKH A;  3TDG A;  3GN3 A;  5LD0 A;  2I4A A;  3A2W A;  1M3J A;  3UL3 A;  2A2S A;  4RI6 A;  5J4V A;  4ILF A;  3CBU A;  2RLI A;  1DE2 A;  1FO5 A;  1PSQ A;  4NHZ A;  2YWN A;  3TKP A;  1QXH A;  1TP9 A;  2TRC P;  3GSS A;  3IE3 A;  2O36 A;  3M3M A;  2GT5 A;  2B3S A;  3I69 A;  4Z2T A;  1S3R A;  3HYP A;  5ELA A;  2LJA A;  1TKD B;  1M0U A;  4D73 A;  2VCZ A;  1FVJ A;  2LNS A;  2TRX A;  5IIZ A;  2O8V B;  2AAW A;  3IBH A;  2XHF A;  3IDV A;  3M9J A;  5EY6 A;  4I2T A;  2P0G A;  1SKR B;  2GQM A;  3ZML A;  2RII A;  5A5H B;  2OA7 A;  5J41 A;  3KH7 A;  1OVN A;  3HVN A;  2YV9 A;  3GKN A;  4J56 E;  2F8F A;  1FB6 A;  5GAP D;  4IJ3 A;  5IM9 A;  1GH2 A;  1K0B A;  4HSC X;  2L59 A;  3CYN A;  5HFG A;  2CZ3 A;  3QMX A;  4K7I A;  4EVM A;  2GZY A;  1JLW A;  3ZTL A;  13GS A;  2OT3 A;  6GST A;  4KX4 A;  4CDO A;  3TJB A;  2QA1 A;  3TJG A;  2ON5 A;  1TTZ A;  2GGT A;  2WCI A;  2PWJ A;  2WGR A;  4HJM A;  3TCO A;  4OMV A;  1MEK A;  5COH A;  2O89 A;  2ZCT A;  4QL7 A;  5J9B A;  4K0G A;  2VL9 A;  2AYT A;  4EC0 A;  4ZBA A;  3VK9 A;  3TOU A;  4WET A;  3I43 A;  3GRX A;  3QFA C;  4BIK A;  3TJF A;  1ML6 A;  4FYB A;  1OC8 A;  3LOR A;  5JCU A;  1TJD A;  3HJP A;  3VLN A;  4TKY A;  3CXG A;  2L4Q A;  2LJK A;  4EDZ A;  3TU3 B;  4YKG A;  1V9W A;  4ML6 A;  3CSJ A;  2GT6 A;  2YZH A;  2R0C A;  4NPB A;  1G6Y A;  4BA7 A;  1GL8 A;  3I6A A;  2HRK B;  2DJJ A;  3IC4 A;  3QAV A;  4G0I A;  5ECP B;  4HU7 A;  1PA3 A;  2XC2 A;  2J9H A;  2R37 A;  5CRG A;  4GQC A;  3J7Y k;  5IPG A;  4POL A;  4KND A;  4F9Z A;  1U88 A;  3O3T A;  3Q19 A;  2N5B A;  3EC3 A;  2WW3 A;  4GST A;  3O6T A;  4ZXG A;  4BL7 B;  1T4Y A;  1U3A A;  5CRD A;  1TRS A;  3M1G A;  3F4T A;  3NIV A;  5DDL A;  5D93 A;  5HFI A;  1PX7 A;  5ECS A;  1MTC A;  3SWL A;  1PN0 A;  2AJQ B;  5B6N A;  2GS3 A;  2JAC A;  1Z6M A;  2WRT A;  1FHE A;  4BVX B;  16GS A;  4ISD A;  1GLQ A;  1H75 A;  3HHV A;  3KH9 A;  4IN0 A;  1PMT A;  4X43 A;  2D2Z A;  4Z2R A;  1MDI A;  5DCH A;  4KA0 A;  4MH2 A;  5EVO A;  1GTU A;  1SVL A;  3R3E A;  2LKU A;  1N2A A;  5B6M A;  3GL3 A;  2VL2 A;  5ECI B;  2WVY A;  3JCM L;  2OE3 A;  3U5R E;  5D96 A;  5D9W A;  1GTA A;  4IP6 A;  3GNJ A;  5D9X A;  3O76 A;  1JLV A;  2C3Q A;  5JWR B;  3ZZX A;  1ZZY A;  4POK A;  3DEX A;  3A5W A;  1THX A;  2ES7 A;  3D21 A;  4ZB8 A;  3IAS 2;  1TXU A;  1Z7R A;  1WP0 A;  1TW9 A;  1XBS A;  2X64 A;  2H0G A;  3ZVJ D;  4PI2 C;  3ZVJ A;  3ZRE A;  4GCI A;  3DKS A;  1AXD A;  4ZB9 A;  5EL8 A;  3SBC A;  2DC5 A;  2BTO T;  2VCX A;  2LRN A;  1PQN A;  2KP2 A;  1A2L A;  2OJL A;  3FR6 A;  4ZL7 A;  4PGT A;  2WVX B;  1QFN A;  2OKA A;  1JFU A;  1XIY A;  2FCH A;  3WGE A;  2A2P A;  2HQT A;  4L8E A;  4I8B A;  5J40 A;  3J7Y b;  2K8S A;  5CRE A;  2H30 A;  2FWF A;  1NM3 A;  4KGI A;  3AY8 A;  1SD9 A;  2HZF A;  5A5H A;  5G30 A;  4WF4 A;  2LQQ A;  1ST9 A;  5G2Z A;  3N5O A;  2M80 A;  4GSN A;  4I6X A;  1ZYE A;  5IMA A;  4RQX A;  2ALB A;  4NWY A;  1EGR A;  4QL9 A;  3ZLP A;  2C3T A;  2MZC A;  2LS5 A;  3D4T A;  3UAP A;  2JZT A;  1BG5 A;  1BAY A;  2FY6 A;  1LJR A;  1SJ6 A;  5IOW A;  4GF0 A;  2HZE B;  2L6C A;  2X99 A;  2O7K A;  4LLR A;  1EEJ A;  1SL2 B;  3UIW A;  2GDR A;  1EZK A;  4ZL9 A;  2GZZ A;  1GSE A;  3OR5 A;  2HRN A;  4PXO A;  4E8H A;  2VAF A;  2MBT A;  1M2B A;  2VLU A;  3APQ A;  1ZYP A;  1K0N A;  2CVB A;  4MPG A;  1B4P A;  6GSY A;  5H5R A;  2C0F A;  4NXI A;  3RFR C;  2PVQ A;  4JU5 A;  2KOK A;  2GLR A;  4KF9 A;  3ERF A;  5HR0 A;  1N8J A;  2N5F A;  5A1N B;  1TRV A;  2MBS A;  1TU8 A;  3LQ7 A;  2DSA A;  5HQP A;  3C1R A;  4MJE A;  1KTE A;  4MDC A;  3F3R A;  2CX3 A;  2CVK A;  1M3I A;  3ISO A;  5IPH A;  1LU4 A;  1JZW A;  1EWX A;  4BWQ A;  2YOI A;  1ZCP A;  3LWA A;  1R5P A;  2HRK A;  4WKW A;  1F2E A;  4LL1 B;  3FYG A;  4G2E A;  2H1A A;  3NOF A;  4MNN A;  1WWJ A;  2IFQ B;  4FXY P;  2WW0 A;  3F4S A;  1Z9H A;  3KMN A;  5BMU B;  1EP8 A;  1FOH A;  4MH3 A;  19GS A;  2VCT A;  5J47 A;  2FUG 2;  2JZR A;  3LJR A;  4KH7 A;  1FW1 A;  2B5E A;  4MJA A;  4OWY A;  1ABA A;  4Q5N A;  3D0Z A;  1YKA A;  3ME8 A;  4E8E A;  2LTK A;  1K3L A;  1Y25 A;  2JAD A;  5J9C A;  2LJR A;  4BL7 A;  3KM6 A;  2YPM A;  3HVV A;  1M2A A;  2H0H A;  2WB9 A;  3PIN A;  4I97 A;  3L9S A;  2B5X A;  5LCZ A;  4RI7 A;  5D8I A;  3IA1 A;  3G9B A;  4HU9 A;  4DSR A;  4OCF A;  3TRX A;  3GV1 A;  1WE0 A;  3BOA A;  1XVQ A;  5GSS A;  4JED A;  4MZW A;  2I81 A;  3GX8 A;  4BVX A;  2I1U A;  1BED A;  1AIU A;  2AV4 A;  3BJ5 A;  3BCI A;  4ECI A;  4PQH A;  1JZD A;  1YF0 A;  1F37 A;  5D73 A;  1V58 A;  2RUF A;  4BVY B;  4FIW A;  4MMM A;  1F3B A;  4NHW A;  2EC4 A;  4KCE A;  4OFT A;  2WDU A;  2VD0 A;  1SVM A;  2I9H A;  3FW2 A;  4G9H A;  4LMW A;  4AGS A;  2LRT A;  4X4J A;  3LXT A;  4WR5 A;  4TXO B;  4O92 A;  1Y6E A;  1BG1 A;  3LEF A;  4EUY A;  1MD4 A;  5ECO B;  3HD5 A;  2HFD A;  1TRW A;  3ZYW A;  1WMJ A;  3US3 A;  5B8B A;  3PGT A;  4N11 A;  2YZU A;  2VCQ A;  4KCA A;  5ECL B;  2CQ9 A;  3GMF A;  4TR0 A;  1BYE A;  4MA9 A;  4G10 A;  1O85 A;  5CP1 A;  2VKZ G;  4NMU A;  2F9S A;  5GST A;  1K3O A;  1TI3 A;  1BQ7 A;  4ZB7 A;  5DAK B;  1S3D A;  2WVX A;  3HVX A;  4JRR A;  2AUV A;  2TIR A;  1GSQ A;  2PUK C;  2R5G A;  2R0P A;  4XS1 A;  3U6V A;  1TOF A;  2GQL A;  1ON4 A;  4XIH A;  2L5O A;  4EIQ A;  3F8U A;  1GTI A;  4Q5Q A;  4HQS A;  5J4U A;  3D22 A;  4N0Z A;  3QDN A;  5IO2 A;  4DSQ A;  1ZOF A;  4CY8 A;  2DJ3 A;  1OAZ A;  2HE3 A;  3TB2 A;  4N10 A;  5ECQ B;  2H01 A;  2B5Y A;  5EPF A;  3QCP A;  4KSM A;  4X1U A;  5KOX A;  1HNA A;  2AB6 A;  3MDK A;  3C71 A;  1S3A A;  2NVL A;  4RQR A;  4KDY A;  4IQA A;  2P5R A;  2IPA A;  3G7I A;  1G6W A;  3EUR A;  2HZE A;  4HS1 A;  2GST A;  3WT1 A;  1X0R A;  3G7J A;  1ZYQ B;  1W4V A;  2PU9 C;  2OBI A;  2ZNM A;  3IXR A;  3HKR A;  2H8L A;  4O7H A;  3D5J A;  3IPZ A;  1EGO A;  3DIE A;  2CX4 A;  5HR2 A;  2VM1 A;  3CMI A;  5J5N A;  4XRA A;  4AI6 A;  3F4R A;  2WFC A;  4HEA 2;  3EPT A;  2H75 A;  2R6K A;  1H4O A;  5ECM B;  3I9V 2;  1RK4 A;  1XW9 A;  2FD3 A;  2C3N A;  1QMV A;  2DJ0 A;  3FRC A;  2DKI A;  3KXO A;  1XW6 A;  4POM A;  5J4Y A;  3HVS A;  1TU7 A;  3WYW A;  3CSH A;  1SEN A;  5A1N A;  4V1A g;  5C04 A;  4AJ7 A;  2WW1 A;  3HA9 A;  4TR3 A;  2RUE A;  2F3M A;  1PKZ A;  4MF7 A;  1OKT A;  2B1L A;  3E0U A;  1WPI A;  1B48 A;  3IR4 A;  2YCD A;  2LNT A;  1ZL9 A;  1K0M A;  1YF1 A;  1X5D A;  1CQH A;  3HZ8 A;  1M99 A;  3W8J A;  1FOV A;  1G0T A;  4L5L A;  1Q98 A;  4Z2U A;  5DBQ A;  5AIV A;  2IMF A;  1TDI A;  3QFB C;  3IAM 2;  2YNX A;  2VLV A;  1J0F A;  2MMN A;  2IFQ A;  4HDE A;  2IMI A;  5BMU A;  1R4W A;  1SD8 A;  4F03 A;  4KE3 A;  2P5Q A;  4ECJ A;  3LG6 A;  5F07 A;  2EFC A;  1SL0 B;  3TUE A;  8GSS A;  2OAD A;  4I5Q A;  1U3I A;  3UJ1 A;  1O8X A;  2ON7 A;  2C8U A;  1HYU A;  2H66 A;  2PER A;  1YEX A;  2EFH A;  4X0X A;  3DXB A;  3HDC A;  5CO3 A;  3RPP A;  1SYX A;  4ZL8 A;  2VOC A;  5G5E A;  2X49 A;  4IVF A;  2LRC A;  5CNW A;  3EU3 A;  3LYP A;  3GX0 A;  4TRX A;  2HSM B;  3F9U A;  3CHX C;  1ERV A;  5DAL B;  2OAC A;  2QSI A;  4IEL A;  2YAN A;  1IYH A;  3PR8 A;  1B8X A;  5AGY A;  2DMM A;  4F0B A;  1TK5 B;  4DEJ A;  2MYG A;  5G31 A;  4TOP A;  4Q5F A;  3Q18 A;  3VPQ A;  3WGD A;  3LSZ A;  3G7Y A;  2LUS A;  4BVY A;  2XBQ A;  1VF2 A;  3IC8 A;  3FMW A;  2HSN B;  2PVO C;  4MAB A;  4PUR A;  1LBK A;  3D6I A;  4PHZ C;  3TJJ A;  2B1K A;  3GL5 A;  3UBL A;  4MJB A;  4F2I A;  4A5P A;  4TXO A;  4WBJ A;  1FAA A;  4K0N A;  1NSW A;  2OE0 A;  2CT6 A;  2B6M A;  3C7M A;  3F0I A;  3MNG A;  3ZFL A;  1WJK A;  1K0O A;  4O32 A;  1O73 A;  5JWO B;  2N5A A;  3FZ9 A;  1GUM A;  4FYC A;  1A0F A;  1AQX A;  4JZQ A;  2AHE A;  4GXZ A;  2PMT A;  3CRT A;  4BPY A;  1OC3 A;  2YV7 A;  4ECC A;  2EIO A;  2JZS A;  5DAK A;  4IGJ A;  3F63 A;  5ECR B;  1Q4J A;  3CWG A;  3EE2 A;  4OFM A;  2O5V A;  5DVB A;  1XW5 A;  3GH9 A;  1X9M B;  5ECK B;  4MF5 A;  3GTU A;  3VI7 A;  1YQ1 A;  4L5O A;  3DVX A;  1YEW C;  4OFN A;  4ZB6 A;  1FVK A;  3KEB A;  2L57 A;  3TGZ A;  1WOU A;  1MDK A;  1PL2 A;  4XS4 B;  1HQO A;  1K0D A;  2BJX A;  4K1F A;  4PI0 C;  1EV9 A;  2WZ9 A;  2HXK A;  1XWK A;  4FO5 A;  2PGT A;  2JU5 A;  6GSS A;  4PNF A;  2IMK A;  1XOA A;  3H93 A;  5IQY A;  1XWC A;  2KUC A;  4MLY A;  2X4A A;  2L6D A;  1AQW A;  3RHC A;  3IHG A;  1Y1U A;  2DIZ A;  3LW9 A;  4HQZ A;  5J3R A;  3DWV A;  3DML A;  2DLX A;  4IP1 A;  1J08 A;  5CRW A;  4HI7 A;  1TK8 B;  3NZN A;  4WF5 A;  3GST A;  3MYD A;  3F6D A;  2B7K A;  2H19 A;  3CQF A;  3IK7 A;  5IO0 A;  3MSZ A;  1A8L A;  5JCG A;  1ZGN A;  4Z7X A;  2LST A;  1IYI A;  5CAX A;  4JR4 A;  4LL4 B;  1SYR A;  1GSD A;  4K7O A;  3IK9 A;  2HYX A;  2K8V A;  3KIJ A;  2C0G A;  5AIS A;  5CYY A;  2H74 A;  5CRH A;  1DBY A;  3UOM A;  1RQM A;  5IMF A;  2Z9S A;  3DD3 A;  1M9B A;  1XCC A;  1T3B A;  4G01 A;  3H4K A;  5LNK e;  2G0F A;  5A4U A;  3APO A;  3FZ5 A;  2GSR A;  1FB0 A;  2VIM A;  2JL4 A;  2VUP A;  3HJM A;  1XVW A;  2C80 A;  3M8N A;  3EMP A;  2V1M A;  1VRS D;  5ECN B;  4K7N A;  3L9V A;  4E68 A;  3Q74 A;  4K5S A;  2K18 A;  2LV3 A;  1V40 A;  2WS2 A;  2GSQ A;  1R26 A;  3TKS E;  3R2Q A;  4RUV A;  5D9V A;  3M9K A;  4EDY A;  3VWU A;  1M2D A;  4GRF A;  1OE7 A;  1T00 A;  1XWA A;  1F9M A;  1UVZ A;  5KN0 A;  2PPT A;  3H79 A;  4MCU A;  4PQI A;  3GKM A;  2HSM A;  4ICY A;  4IHU A;  5DAL A;  2ZUP A;  3KZQ A;  1O8W A;  3ZFB A;  2R3X A;  1YVL A;  2CZ2 A;  2C4J A;  3LFL A;  1GTB A;  4KUN A;  1QQ2 A;  3L4N A;  4USS A;  2WW2 A;  1I5G A;  3KD0 A;  5B8A A;  1K0C A;  3GIX A;  4K2X A;  5KOW A;  2VL3 A;  3C1S A;  2HSN A;  1ERT A;  3KJY A;  5IOX A;  1O7U A;  1KBN A;  2G2Q A;  2NTO A;  3TRP A;  3CRU A;  1V2A A;  1T7P B;  1I9D A;  4QMK A;  4N30 A;  3LGC A;  2GSS A;  3L0H A;  4WR4 A;  2YJ7 A;  3VWX A;  5A4W A;  3DYR A;  4NV5 A;  3UAR A;  4JR6 A;  2CVD A;  3GA4 A;  5G1K A;  4IW9 A;  3BBY A;  4FH8 A;  2MMO A;  4KB3 A;  4J2F A;  4MF6 A;  4ULX A;  12GS A;  2YJH A;  2R4V A;  1SVO A;  2YN1 A;  5IMD A;  5L71 A;  1EOG A;  5IMZ A;  1A24 A;  3DVW A;  3EYT A;  3H1N A;  1AAZ A;  2CV4 A;  1EV4 A;  2DJK A;  1GUL A;  5A4V A;  4L0U A;  1XWG A;  4NV2 A;  4AJ8 A;  5FHI A;  2KLX A;  4AKG A;  4KDU A;  5DQY A;  5E59 A;  1B9X C;  3APS A;  4K2D A;  1R7H A;  2EIR A;  3LYK A;  4IJI A;  2L4C A;  3ZIT A;  5DQS A;  4XS4 A;  3EMX A;  1GUH A;  2FWH A;  4MJC A;  3ZMK A;  2CA8 A;  4GQF A;  4TR4 A;  1GSS A;  4ACS A;  9GSS A;  3QAG A;  3HXS A;  5A34 B;  1YZX A;  1NW2 A;  2F51 A;  2FWG A;  3Q6O A;  2DML A;  4OCE A;  1X9S B;  1PGT A;  4AKH A;  5G1L A;  1ILO A;  2FNO A;  3ZIV A;  3TOT A;  1ERU A;  3FK8 A;  4WEY A;  1UA5 A;  3RBT A;  6GSX A;  2FHE A;  5HR1 A;  4IS0 A;  4IQ1 A;  3HJO A;  4GDF A;  2GZP A;  2V32 A;  3GTU B;  2JSZ A;  3DGQ A;  1FG4 A;  2E2G A;  3WGX A;  4EF0 A;  1GSY A;  1MDJ A;  4MZB A;  3GYK A;  3GFK A;  3QOU A;  4K5R A;  5F06 A;  4O5U A;  1GLP A;  4PUF C;  1N25 A;  4G19 A;  4PTS A;  4ZBD A;  5HR3 A;  1JZR A;  2OBK A;  2GTU A;  3D4M A;  2NBS A;  3CTG A;  1CQG A;  3A2V A;  3A2X A;  3FY7 A;  4EXJ A;  2YP6 A;  2VLT A;  4TVE A;  1E6B A;  4CW9 A;  4DSS B;  1EOH A;  4TR1 B;  4WXT A;  4EKZ A;  2VD1 A;  4MZC A;  1NHY A;  1URM A;  1G7E A;  2V41 A;  4TW5 A;  1WIK A;  3GUR A;  1PN9 A;  1OKD A;  5E4W A;  1E2Y A;  4H86 A;  1PKW A;  3CSI A;  1TI1 A;  1YJ6 A;  3A3T A;  2REM A;  4KW6 A;  1G7O A;  3BD2 A;  2QA2 A;  2H1B A;  1J9B A;  3ZL5 A;  4OO4 A;  4ID0 A;  2FA4 A;  4V1A p;  1Z6N A;  4EIP A;  3FZ4 A;  2PBJ A;  1HNB A;  3P7X A;  2IWT A;  2VCW A;  1XZO A;  5F8B A;  2LEG A;  1W89 A;  1XG8 A;  1A2M A;  4HZ4 A;  4HOJ A;  6GSW A;  14GS A;  2DIY A;  3ME7 A;  4ZBB A;  2DBC A;  1TRU A;  1SK0 A;  3QAW A;  5F0G A;  1DUG A;  2H6Y A;  2DJ1 A;  3VWV A;  1O81 A;  5FWG A;  1S4B P;  2YWM A;  4FQU A;  1GUK A;  4ML1 A;  5ID2 B;  4BWS A;  5H5S A;  4QQ7 A;  5HFK A;  1SU9 A;  3N9J A;  4HZ2 A;  4KSO A;  3HY2 A;  4KAE A;  5IMC A;  4JE1 A;  5KN1 A;  2J23 A;  4K8M A;  1WRY A;  4W66 A;  4AKX B;  3C73 A;  1GP1 A;  5AN1 A;  2DJ2 A;  4XTS A;  3QD9 A;  2C0E A;  5AIX A;  1T4Z A;  1HNC A;  3FZA A;  1TK0 B;  3TKS C;  4KDX A;  1UN2 A;  3C8E A;  4LMV A;  1RW1 A;  3VUR A;  2RM6 A;  4TXV A;  4EL1 A;  5D9T A;  3W8S A;  1AC1 A;  1V98 A;  1OE8 A;  2WJU A;  2H1L A;  1B9Y C;  1XOB A;  3ERG A;  3KP9 A;  2MMZ A;  3F3Q A;  1O6J A;  3WD6 A;  5C00 A;  1NHO A;  2VO4 A;  4G0K A;  3QR6 A;  4YH2 A;  1GSF A;  1U6T A;  1X5E A;  2NPB A;  2PN8 A;  4N0V A;  2WVZ A; 
#chains in the Genus database with same CATH homology
 3DRN A;  4EO3 A;  4YQM A;  4TN8 A;  3PH9 A;  3A5I A;  3HZ4 A;  1R5A A;  1X5C A;  4OO5 A;  4XS6 A;  1HD2 A;  4HJ2 A;  1M7T A;  3KP8 A;  2A2R A;  1F6M C;  2E2M A;  1OYJ A;  4JBB A;  1OC9 B;  3V1W A;  20GS A;  3UMA A;  4I2U A;  4Q5R A;  5A34 A;  1XWB A;  4YAP A;  5FT3 A;  1AUC A;  2CAQ A;  3KMO A;  2XPE A;  2FLS A;  1GRX A;  4GTU A;  5JWQ B;  3RHB A;  3HCZ A;  2FA8 A;  1YKC A;  1A23 A;  3VI5 A;  3KTL A;  5ECH B;  1MD3 A;  2IL3 A;  3GUS A;  2C0D A;  1M9A A;  2M46 A;  3MWH A;  2IME A;  5IMV A;  2E7P A;  2A4V A;  5BRT A;  5ABR A;  18GS A;  1T8E B;  4ECB A;  3F6F A;  1SKW B;  1USB A;  2R2J A;  10GS A;  1BF5 A;  2H6Z A;  1TXX A;  3RAZ A;  3ZRD A;  3VPT A;  4DSS A;  2QKE A;  1UC7 A;  2HSY A;  4TR1 A;  1SKS B;  2VM2 A;  1KEB A;  2HT9 A;  3TKR A;  1A2J A;  3FHK A;  2HNL A;  3E3E A;  1BX9 A;  2FWE A;  2KP1 A;  4F82 A;  4GLT A;  2NDO A;  4WBR D;  1SJZ A;  1T1V A;  1JZO A;  2IMD A;  3RDW A;  1GNE A;  1PRX A;  1DSB A;  1XFL A;  2KHP A;  1QUW A;  3GKK A;  4V2M A;  4POB A;  2HRA A;  2UZ8 A;  2HRF A;  1PL1 A;  4AF2 A;  1K3Y A;  4FYU A;  3ERW A;  2HI7 A;  3FR9 A;  4MK3 A;  3CTF A;  3GKX A;  3FEU A;  4GWR A;  4YQV A;  1YY7 A;  3KGK A;  3FR3 A;  1YDK A;  2H70 A;  4O5Q A;  1QK8 A;  3K8N A;  3ZIJ A;  6GSV A;  4EE0 A;  2V6K A;  4PUA A;  4XRD A;  4L0W A;  1JHB A;  2M72 A;  2EIQ A;  3QPM A;  4PNG A;  2B7J A;  4K9Z A;  4D73 B;  4DVC A;  4O5R A;  1AW9 A;  3VFI A;  2HSH A;  3L78 A;  5ELG A;  3P2A A;  2XPD A;  3IOS A;  17GS A;  3L9U A;  3UVT A;  1Z3E A;  2A4H A;  2I3Y A;  2R0G A;  2GVP A;  4G0L A;  4CY6 A;  11GS A;  2X8G A;  1THO A;  5ID2 A;  1VF3 A;  5F05 A;  4NAX A;  2RM5 A;  4YQU A;  4YKF A;  1PD2 1;  1Z7P A;  2K6V A;  4XCS A;  4PX1 A;  4MP4 A;  3W6G A;  1VF1 A;  2K9F A;  2VCV A;  2WUL A;  1C72 A;  2FGX A;  2H0I A;  4V2N A;  3EWL A;  2O87 A;  2GQK A;  1VF4 A;  3WT2 A;  3UEM A;  1BJX A;  5GZZ B;  1SK2 A;  3RPN A;  1ERW A;  2X8H A;  4J57 E;  4OD7 A;  2IN3 A;  4CHS A;  4K6X A;  1QGV A;  3EIN A;  2H1G A;  5INY A;  1SK1 A;  1EEM A;  1U87 A;  2L5L A;  1SL1 B;  5JCW A;  3M0F A;  1XXU A;  4YAV A;  1V57 A;  2DKH A;  2H6X A;  5KEJ A;  4V2L A;  1Z5Y E;  6GSU A;  2OE1 A;  2H76 A;  3MIX A;  1ZYN A;  2P31 A;  2X8C A;  5DJM A;  2VL2 C;  3GHA A;  3IV4 A;  5DJL A;  3EU4 A;  4N3Z A;  2EFD A;  1A0R P;  2UV8 G;  3ED3 A;  4ZIL A;  4HUA A;  1GSU A;  3H8Q A;  2E0Q A;  4MPF A;  1F3A A;  1K0A A;  4LA1 A;  3TRQ A;  4XHM A;  5ENU A;  2IIY A;  4F0C A;  4P3Y B;  1KNG A;  2YWI A;  1DE1 A;  1B4Q A;  1GWC A;  4AKI A;  1OC9 A;  3P8W A;  3MAK A;  5B7C A;  5DCG A;  1AQV A;  2H1D A;  2MMA A;  3KTB A;  3S9F A;  3TJK A;  1YEP A;  1ZMA A;  2V6O A;  1SJI A;  2QGV A;  3IRA A;  1A8Y A;  2LQO A;  3VWW A;  2H71 A;  5KN3 A;  2C1Y A;  5GAN D;  3UBK A;  3EVI A;  2CAI A;  2H73 A;  2JSY A;  3HMJ G;  1EP7 A;  4AJ6 A;  3TKS A;  2H72 A;  4PQ1 A;  7GSS A;  3P90 A;  2V2G A;  3GH6 A;  3BCK A;  1VGL A;  1ACV A;  1XPV A;  5G5F A;  3TKQ A;  1S3C A;  3KCM A;  4ZIJ A;  3IHQ A;  3FKF A;  3UVH A;  2EFE A;  2BMX A;  2O85 A;  2IJY A;  1X9W B;  2QC7 A;  5A5K A;  22GS A;  5KN2 A;  2HLS A;  5H5Q A;  4IBP A;  3E9J B;  1GNW A;  1PX6 A;  2YWO A;  2XBI A;  4GSS A;  3LXZ A;  3PPU A;  2F8A A;  4IKH A;  3TDG A;  3GN3 A;  5LD0 A;  2I4A A;  3A2W A;  3UL3 A;  2A2S A;  4RI6 A;  5J4V A;  4ILF A;  3CBU A;  2RLI A;  1DE2 A;  1FO5 A;  1PSQ A;  4NHZ A;  2YWN A;  3TKP A;  1QXH A;  1TP9 A;  2TRC P;  3GSS A;  3IE3 A;  3M3M A;  2GT5 A;  2B3S A;  3I69 A;  4Z2T A;  3HYP A;  5ELA A;  2LJA A;  1TKD B;  1M0U A;  4D73 A;  2VCZ A;  1FVJ A;  2LNS A;  2TRX A;  5IIZ A;  2O8V B;  2AAW A;  3IBH A;  2XHF A;  3IDV A;  3M9J A;  5EY6 A;  4I2T A;  2P0G A;  1SKR B;  2GQM A;  3ZML A;  2RII A;  5A5H B;  2OA7 A;  5J41 A;  3KH7 A;  1OVN A;  2YV9 A;  3GKN A;  4J56 E;  2F8F A;  1FB6 A;  5GAP D;  4IJ3 A;  5IM9 A;  1GH2 A;  1K0B A;  2L59 A;  3CYN A;  5HFG A;  2CZ3 A;  3QMX A;  4K7I A;  4EVM A;  2GZY A;  1JLW A;  3ZTL A;  13GS A;  2OT3 A;  6GST A;  4KX4 A;  4CDO A;  3TJB A;  2QA1 A;  3TJG A;  2ON5 A;  1TTZ A;  2GGT A;  2WCI A;  2PWJ A;  2WGR A;  4HJM A;  3TCO A;  4OMV A;  1MEK A;  5COH A;  2O89 A;  2ZCT A;  4QL7 A;  5J9B A;  4K0G A;  2VL9 A;  2AYT A;  4EC0 A;  4ZBA A;  3VK9 A;  3TOU A;  4WET A;  3I43 A;  3GRX A;  3QFA C;  3TJF A;  1ML6 A;  4FYB A;  1OC8 A;  3LOR A;  5JCU A;  1TJD A;  3HJP A;  3VLN A;  4TKY A;  3CXG A;  2L4Q A;  2LJK A;  4EDZ A;  3TU3 B;  4YKG A;  1V9W A;  4ML6 A;  3CSJ A;  2GT6 A;  2YZH A;  2R0C A;  4NPB A;  1G6Y A;  4BA7 A;  1GL8 A;  3I6A A;  2HRK B;  2DJJ A;  3IC4 A;  3QAV A;  4G0I A;  5ECP B;  4HU7 A;  1PA3 A;  2XC2 A;  2J9H A;  2R37 A;  5CRG A;  4GQC A;  3J7Y k;  5IPG A;  4POL A;  4KND A;  4F9Z A;  1U88 A;  3O3T A;  3Q19 A;  2N5B A;  3EC3 A;  4GST A;  3O6T A;  4ZXG A;  4BL7 B;  1T4Y A;  1U3A A;  5CRD A;  1TRS A;  3M1G A;  3F4T A;  3NIV A;  5DDL A;  5D93 A;  5HFI A;  1PX7 A;  5ECS A;  1MTC A;  3SWL A;  1PN0 A;  2AJQ B;  5B6N A;  2GS3 A;  2JAC A;  1Z6M A;  2WRT A;  1FHE A;  4BVX B;  16GS A;  4ISD A;  1GLQ A;  1H75 A;  3HHV A;  3KH9 A;  4IN0 A;  1PMT A;  4X43 A;  2D2Z A;  4Z2R A;  1MDI A;  5DCH A;  4KA0 A;  4MH2 A;  5EVO A;  1GTU A;  1SVL A;  3R3E A;  2LKU A;  1N2A A;  5B6M A;  3GL3 A;  2VL2 A;  5ECI B;  3JCM L;  2OE3 A;  3U5R E;  5D96 A;  5D9W A;  1GTA A;  4IP6 A;  3GNJ A;  5D9X A;  3O76 A;  1JLV A;  2C3Q A;  5JWR B;  3ZZX A;  1ZZY A;  4POK A;  3DEX A;  3A5W A;  1THX A;  2ES7 A;  3D21 A;  4ZB8 A;  3IAS 2;  1TXU A;  1Z7R A;  1WP0 A;  1TW9 A;  1XBS A;  2X64 A;  2H0G A;  3ZVJ D;  3ZVJ A;  3ZRE A;  4GCI A;  3DKS A;  1AXD A;  4ZB9 A;  5EL8 A;  3SBC A;  2DC5 A;  2BTO T;  2VCX A;  2LRN A;  1PQN A;  2KP2 A;  1A2L A;  2OJL A;  3FR6 A;  4ZL7 A;  4PGT A;  1QFN A;  2OKA A;  1JFU A;  1XIY A;  2FCH A;  3WGE A;  2A2P A;  2HQT A;  4L8E A;  4I8B A;  5J40 A;  3J7Y b;  2K8S A;  5CRE A;  2H30 A;  2FWF A;  1NM3 A;  4KGI A;  3AY8 A;  1SD9 A;  2HZF A;  5A5H A;  5G30 A;  4WF4 A;  2LQQ A;  1ST9 A;  5G2Z A;  3N5O A;  2M80 A;  4GSN A;  4I6X A;  1ZYE A;  5IMA A;  4RQX A;  2ALB A;  4NWY A;  1EGR A;  4QL9 A;  3ZLP A;  2C3T A;  2MZC A;  2LS5 A;  3D4T A;  3UAP A;  2JZT A;  1BG5 A;  1BAY A;  2FY6 A;  1LJR A;  1SJ6 A;  5IOW A;  4GF0 A;  2HZE B;  2L6C A;  2X99 A;  2O7K A;  4LLR A;  1EEJ A;  1SL2 B;  3UIW A;  2GDR A;  1EZK A;  4ZL9 A;  2GZZ A;  1GSE A;  3OR5 A;  2HRN A;  4PXO A;  4E8H A;  2VAF A;  2MBT A;  1M2B A;  2VLU A;  3APQ A;  1ZYP A;  1K0N A;  2CVB A;  4MPG A;  1B4P A;  6GSY A;  5H5R A;  2C0F A;  4NXI A;  2PVQ A;  4JU5 A;  2KOK A;  2GLR A;  4KF9 A;  3ERF A;  5HR0 A;  1N8J A;  2N5F A;  5A1N B;  1TRV A;  2MBS A;  1TU8 A;  3LQ7 A;  2DSA A;  5HQP A;  3C1R A;  4MJE A;  1KTE A;  4MDC A;  3F3R A;  2CX3 A;  2CVK A;  3ISO A;  5IPH A;  1LU4 A;  1JZW A;  1EWX A;  4BWQ A;  2YOI A;  1ZCP A;  3LWA A;  1R5P A;  2HRK A;  4WKW A;  1F2E A;  4LL1 B;  3FYG A;  4G2E A;  2H1A A;  3NOF A;  4MNN A;  1WWJ A;  2IFQ B;  3F4S A;  1Z9H A;  3KMN A;  5BMU B;  1EP8 A;  1FOH A;  4MH3 A;  19GS A;  2VCT A;  5J47 A;  2FUG 2;  2JZR A;  3LJR A;  4KH7 A;  1FW1 A;  2B5E A;  4MJA A;  4OWY A;  1ABA A;  4Q5N A;  3D0Z A;  1YKA A;  3ME8 A;  4E8E A;  2LTK A;  1K3L A;  1Y25 A;  2JAD A;  5J9C A;  2LJR A;  4BL7 A;  3KM6 A;  2YPM A;  3HVV A;  1M2A A;  2H0H A;  2WB9 A;  3PIN A;  4I97 A;  3L9S A;  2B5X A;  5LCZ A;  4RI7 A;  5D8I A;  3IA1 A;  3G9B A;  4HU9 A;  4DSR A;  4OCF A;  3TRX A;  3GV1 A;  1WE0 A;  3BOA A;  1XVQ A;  5GSS A;  4JED A;  4MZW A;  2I81 A;  3GX8 A;  4BVX A;  2I1U A;  1BED A;  1AIU A;  2AV4 A;  3BJ5 A;  3BCI A;  4ECI A;  4PQH A;  1JZD A;  1YF0 A;  1F37 A;  5D73 A;  1V58 A;  2RUF A;  4BVY B;  4FIW A;  4MMM A;  1F3B A;  4NHW A;  2EC4 A;  4KCE A;  4OFT A;  2WDU A;  2VD0 A;  1SVM A;  2I9H A;  3FW2 A;  4G9H A;  4LMW A;  4AGS A;  2LRT A;  4X4J A;  3LXT A;  4WR5 A;  4TXO B;  4O92 A;  1Y6E A;  1BG1 A;  3LEF A;  4EUY A;  1MD4 A;  5ECO B;  3HD5 A;  2HFD A;  1TRW A;  3ZYW A;  1WMJ A;  3US3 A;  5B8B A;  3PGT A;  4N11 A;  2YZU A;  2VCQ A;  4KCA A;  5ECL B;  2CQ9 A;  3GMF A;  4TR0 A;  1BYE A;  4MA9 A;  4G10 A;  1O85 A;  5CP1 A;  2VKZ G;  4NMU A;  2F9S A;  5GST A;  1K3O A;  1TI3 A;  1BQ7 A;  4ZB7 A;  5DAK B;  1S3D A;  3HVX A;  4JRR A;  2AUV A;  2TIR A;  1GSQ A;  2PUK C;  2R5G A;  2R0P A;  4XS1 A;  3U6V A;  1TOF A;  2GQL A;  1ON4 A;  4XIH A;  2L5O A;  4EIQ A;  3F8U A;  1GTI A;  4Q5Q A;  4HQS A;  5J4U A;  3D22 A;  4N0Z A;  3QDN A;  5IO2 A;  4DSQ A;  1ZOF A;  4CY8 A;  2DJ3 A;  1OAZ A;  2HE3 A;  3TB2 A;  4N10 A;  5ECQ B;  2H01 A;  2B5Y A;  5EPF A;  3QCP A;  4KSM A;  4X1U A;  5KOX A;  1HNA A;  2AB6 A;  3MDK A;  3C71 A;  1S3A A;  2NVL A;  4RQR A;  4KDY A;  4IQA A;  2P5R A;  2IPA A;  3G7I A;  1G6W A;  3EUR A;  2HZE A;  4HS1 A;  2GST A;  3WT1 A;  1X0R A;  3G7J A;  1ZYQ B;  1W4V A;  2PU9 C;  2OBI A;  2ZNM A;  3IXR A;  3HKR A;  2H8L A;  4O7H A;  3D5J A;  3IPZ A;  1EGO A;  3DIE A;  2CX4 A;  5HR2 A;  2VM1 A;  3CMI A;  5J5N A;  4XRA A;  4AI6 A;  3F4R A;  2WFC A;  4HEA 2;  3EPT A;  2H75 A;  2R6K A;  1H4O A;  5ECM B;  3I9V 2;  1RK4 A;  1XW9 A;  2FD3 A;  2C3N A;  1QMV A;  2DJ0 A;  3FRC A;  2DKI A;  3KXO A;  1XW6 A;  4POM A;  5J4Y A;  3HVS A;  1TU7 A;  3WYW A;  3CSH A;  1SEN A;  5A1N A;  4V1A g;  5C04 A;  4AJ7 A;  3HA9 A;  4TR3 A;  2RUE A;  2F3M A;  1PKZ A;  4MF7 A;  1OKT A;  2B1L A;  3E0U A;  1WPI A;  1B48 A;  3IR4 A;  2YCD A;  2LNT A;  1ZL9 A;  1K0M A;  1YF1 A;  1X5D A;  1CQH A;  3HZ8 A;  1M99 A;  3W8J A;  1FOV A;  1G0T A;  4L5L A;  1Q98 A;  4Z2U A;  5DBQ A;  5AIV A;  2IMF A;  1TDI A;  3QFB C;  3IAM 2;  2YNX A;  2VLV A;  1J0F A;  2MMN A;  2IFQ A;  4HDE A;  2IMI A;  5BMU A;  1R4W A;  1SD8 A;  4F03 A;  4KE3 A;  2P5Q A;  4ECJ A;  3LG6 A;  5F07 A;  2EFC A;  1SL0 B;  3TUE A;  8GSS A;  2OAD A;  4I5Q A;  1U3I A;  3UJ1 A;  1O8X A;  2ON7 A;  2C8U A;  1HYU A;  2H66 A;  2PER A;  1YEX A;  2EFH A;  4X0X A;  3DXB A;  3HDC A;  5CO3 A;  3RPP A;  1SYX A;  4ZL8 A;  2VOC A;  5G5E A;  2X49 A;  4IVF A;  2LRC A;  5CNW A;  3EU3 A;  3LYP A;  3GX0 A;  4TRX A;  2HSM B;  3F9U A;  1ERV A;  5DAL B;  2OAC A;  2QSI A;  4IEL A;  2YAN A;  1IYH A;  3PR8 A;  1B8X A;  5AGY A;  2DMM A;  4F0B A;  1TK5 B;  4DEJ A;  2MYG A;  5G31 A;  4TOP A;  4Q5F A;  3Q18 A;  3VPQ A;  3WGD A;  3LSZ A;  3G7Y A;  2LUS A;  4BVY A;  2XBQ A;  1VF2 A;  3IC8 A;  3FMW A;  2HSN B;  2PVO C;  4MAB A;  4PUR A;  1LBK A;  3D6I A;  3TJJ A;  2B1K A;  3GL5 A;  3UBL A;  4MJB A;  4F2I A;  4A5P A;  4TXO A;  4WBJ A;  1FAA A;  4K0N A;  1NSW A;  2OE0 A;  2CT6 A;  2B6M A;  3C7M A;  3F0I A;  3MNG A;  3ZFL A;  1WJK A;  1K0O A;  4O32 A;  1O73 A;  5JWO B;  2N5A A;  3FZ9 A;  1GUM A;  4FYC A;  1A0F A;  1AQX A;  4JZQ A;  2AHE A;  4GXZ A;  2PMT A;  3CRT A;  4BPY A;  1OC3 A;  2YV7 A;  4ECC A;  2EIO A;  2JZS A;  5DAK A;  4IGJ A;  3F63 A;  5ECR B;  1Q4J A;  3CWG A;  3EE2 A;  4OFM A;  2O5V A;  5DVB A;  1XW5 A;  3GH9 A;  1X9M B;  5ECK B;  4MF5 A;  3GTU A;  3VI7 A;  1YQ1 A;  4L5O A;  3DVX A;  4OFN A;  4ZB6 A;  1FVK A;  3KEB A;  2L57 A;  3TGZ A;  1WOU A;  1MDK A;  1PL2 A;  4XS4 B;  1HQO A;  1K0D A;  2BJX A;  4K1F A;  1EV9 A;  2WZ9 A;  2HXK A;  1XWK A;  4FO5 A;  2PGT A;  2JU5 A;  6GSS A;  4PNF A;  2IMK A;  1XOA A;  3H93 A;  5IQY A;  1XWC A;  2KUC A;  4MLY A;  2X4A A;  2L6D A;  1AQW A;  3RHC A;  3IHG A;  1Y1U A;  2DIZ A;  3LW9 A;  4HQZ A;  5J3R A;  3DWV A;  3DML A;  2DLX A;  4IP1 A;  1J08 A;  5CRW A;  4HI7 A;  1TK8 B;  3NZN A;  4WF5 A;  3GST A;  3MYD A;  3F6D A;  2B7K A;  2H19 A;  3IK7 A;  5IO0 A;  3MSZ A;  1A8L A;  5JCG A;  1ZGN A;  4Z7X A;  2LST A;  1IYI A;  5CAX A;  4JR4 A;  4LL4 B;  1SYR A;  1GSD A;  4K7O A;  3IK9 A;  2HYX A;  2K8V A;  3KIJ A;  2C0G A;  5AIS A;  5CYY A;  2H74 A;  5CRH A;  1DBY A;  3UOM A;  1RQM A;  5IMF A;  2Z9S A;  3DD3 A;  1M9B A;  1XCC A;  1T3B A;  4G01 A;  3H4K A;  5LNK e;  2G0F A;  5A4U A;  3APO A;  3FZ5 A;  2GSR A;  1FB0 A;  2VIM A;  2JL4 A;  2VUP A;  3HJM A;  1XVW A;  2C80 A;  3M8N A;  3EMP A;  2V1M A;  1VRS D;  5ECN B;  4K7N A;  3L9V A;  4E68 A;  3Q74 A;  4K5S A;  2K18 A;  2LV3 A;  1V40 A;  2WS2 A;  2GSQ A;  1R26 A;  3TKS E;  3R2Q A;  4RUV A;  5D9V A;  3M9K A;  4EDY A;  3VWU A;  1M2D A;  4GRF A;  1OE7 A;  1T00 A;  1XWA A;  1F9M A;  1UVZ A;  5KN0 A;  2PPT A;  3H79 A;  4MCU A;  4PQI A;  3GKM A;  2HSM A;  4ICY A;  4IHU A;  5DAL A;  2ZUP A;  3KZQ A;  1O8W A;  3ZFB A;  2R3X A;  1YVL A;  2CZ2 A;  2C4J A;  3LFL A;  1GTB A;  4KUN A;  1QQ2 A;  3L4N A;  4USS A;  1I5G A;  3KD0 A;  5B8A A;  1K0C A;  3GIX A;  4K2X A;  5KOW A;  2VL3 A;  3C1S A;  2HSN A;  1ERT A;  3KJY A;  5IOX A;  1O7U A;  1KBN A;  2G2Q A;  2NTO A;  3TRP A;  3CRU A;  1V2A A;  1T7P B;  1I9D A;  4QMK A;  4N30 A;  3LGC A;  2GSS A;  3L0H A;  4WR4 A;  2YJ7 A;  3VWX A;  5A4W A;  3DYR A;  4NV5 A;  3UAR A;  4JR6 A;  2CVD A;  3GA4 A;  5G1K A;  4IW9 A;  3BBY A;  4FH8 A;  2MMO A;  4KB3 A;  4J2F A;  4MF6 A;  4ULX A;  12GS A;  2YJH A;  2R4V A;  1SVO A;  2YN1 A;  5IMD A;  5L71 A;  1EOG A;  5IMZ A;  1A24 A;  3DVW A;  3EYT A;  3H1N A;  1AAZ A;  2CV4 A;  1EV4 A;  2DJK A;  1GUL A;  5A4V A;  4L0U A;  1XWG A;  4NV2 A;  4AJ8 A;  5FHI A;  2KLX A;  4AKG A;  4KDU A;  5DQY A;  5E59 A;  1B9X C;  3APS A;  4K2D A;  1R7H A;  2EIR A;  3LYK A;  4IJI A;  2L4C A;  3ZIT A;  5DQS A;  4XS4 A;  3EMX A;  1GUH A;  2FWH A;  4MJC A;  3ZMK A;  2CA8 A;  4GQF A;  4TR4 A;  1GSS A;  4ACS A;  9GSS A;  3QAG A;  3HXS A;  5A34 B;  1YZX A;  1NW2 A;  2F51 A;  2FWG A;  3Q6O A;  2DML A;  4OCE A;  1X9S B;  1PGT A;  4AKH A;  5G1L A;  1ILO A;  2FNO A;  3ZIV A;  3TOT A;  1ERU A;  3FK8 A;  4WEY A;  1UA5 A;  3RBT A;  6GSX A;  2FHE A;  5HR1 A;  4IS0 A;  4IQ1 A;  3HJO A;  4GDF A;  2GZP A;  2V32 A;  3GTU B;  2JSZ A;  3DGQ A;  1FG4 A;  2E2G A;  3WGX A;  4EF0 A;  1GSY A;  1MDJ A;  4MZB A;  3GYK A;  3GFK A;  3QOU A;  4K5R A;  5F06 A;  4O5U A;  1GLP A;  4PUF C;  1N25 A;  4G19 A;  4PTS A;  4ZBD A;  5HR3 A;  1JZR A;  2OBK A;  2GTU A;  3D4M A;  2NBS A;  3CTG A;  1CQG A;  3A2V A;  3A2X A;  3FY7 A;  4EXJ A;  2YP6 A;  2VLT A;  4TVE A;  1E6B A;  4CW9 A;  4DSS B;  1EOH A;  4TR1 B;  4WXT A;  4EKZ A;  2VD1 A;  4MZC A;  1NHY A;  1URM A;  1G7E A;  2V41 A;  4TW5 A;  1WIK A;  3GUR A;  1PN9 A;  1OKD A;  5E4W A;  1E2Y A;  4H86 A;  1PKW A;  3CSI A;  1TI1 A;  1YJ6 A;  3A3T A;  2REM A;  4KW6 A;  1G7O A;  3BD2 A;  2QA2 A;  2H1B A;  1J9B A;  3ZL5 A;  4OO4 A;  4ID0 A;  2FA4 A;  4V1A p;  1Z6N A;  4EIP A;  3FZ4 A;  2PBJ A;  1HNB A;  3P7X A;  2IWT A;  2VCW A;  1XZO A;  5F8B A;  2LEG A;  1W89 A;  1A2M A;  4HZ4 A;  4HOJ A;  6GSW A;  14GS A;  2DIY A;  3ME7 A;  4ZBB A;  2DBC A;  1TRU A;  1SK0 A;  3QAW A;  5F0G A;  1DUG A;  2H6Y A;  2DJ1 A;  3VWV A;  1O81 A;  5FWG A;  2YWM A;  4FQU A;  1GUK A;  4ML1 A;  5ID2 B;  4BWS A;  5H5S A;  4QQ7 A;  5HFK A;  1SU9 A;  3N9J A;  4HZ2 A;  4KSO A;  3HY2 A;  4KAE A;  5IMC A;  4JE1 A;  5KN1 A;  2J23 A;  4K8M A;  1WRY A;  4W66 A;  4AKX B;  3C73 A;  1GP1 A;  5AN1 A;  2DJ2 A;  4XTS A;  3QD9 A;  2C0E A;  5AIX A;  1T4Z A;  1HNC A;  3FZA A;  1TK0 B;  3TKS C;  4KDX A;  1UN2 A;  3C8E A;  4LMV A;  1RW1 A;  3VUR A;  2RM6 A;  4TXV A;  4EL1 A;  5D9T A;  3W8S A;  1AC1 A;  1V98 A;  1OE8 A;  2WJU A;  2H1L A;  1B9Y C;  1XOB A;  3ERG A;  3KP9 A;  2MMZ A;  3F3Q A;  1O6J A;  3WD6 A;  5C00 A;  1NHO A;  2VO4 A;  4G0K A;  3QR6 A;  4YH2 A;  1GSF A;  1U6T A;  1X5E A;  2NPB A;  2PN8 A;  4N0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...