8GSSA

Human glutathione s-transferase p1-1, complex with glutathione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
publication title The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 8gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 8gssA01
4X0XA 2ZNMA 2FCHA 2NPBA 4I5QA 2YZUA 3GKMA 3TDGA 3VURA 4PNFA 4MJCA 4XHMA 5ECOB 3P2AA 4IN0A 5B8AA 4FO5A 1AIUA 4XIHA 3TKPA 3EE2A 5ECQB 4FH8A 3QR6A 2EIRA 2H73A 1FB6A 3DGQA 4O5RA 3LYPA 5H5RA 1YKCA 4KH7A 2JZTA 4RQRA 2GZYA 2EC4A 4LA1A 4WETA 3KMOA 1K0BA 2IIYA 3F0IA 2PMTA 1SD9A 2HSNB 1Z3EA 4PQ1A 3D6IA 2V41A 5C00A 3BJ5A 1V98A 3KH9A 5AIXA 2X8CA 1Z7RA 3HY2A 1V58A 3GSSA 3E9JB 2H74A 5D96A 1YJ6A 1BAYA 1PKWA 5ELAA 5ECSA 4ECCA 1TRWA 2LJKA 1SENA 2R2JA 4I2UA 2B5YA 1XOBA 2X8GA 1ZOFA 4AGSA 2PERA 4N10A 1R4WA 3TRPA 5IOXA 2H1DA 4GSSA 3C1SA 2BJXA 3KXOA 1SL1B 4JEDA 1J0FA 1PSQA 20GSA 5GSSA 4EF0A 1YEXA 3VWXA 5DBQA 2C0GA 3DRNA 2RM6A 1N8JA 5DQYA 3RHBA 5JWQB 4NXIA 1GSSA 4WR5A 3QFAC 4KAEA 2AV4A 4ECJA 4G19A 2H30A 2GSRA 5D9VA 2CQ9A 4ZB8A 3GH9A 2PVQA 5DAKA 4LLRA 4MH2A 5J5NA 2R6KA 3CBUA 1PX6A 3LYKA 1YDKA 4LL4B 2HQTA 1EEMA 2HRKA 3V1WA 2FHEA 3S9FA 1F37A 1X5DA 3HD5A 2EIOA 8GSSA 1M99A 2O89A 5AISA 4YQUA 3FYGA 2ES7A 4QL9A 1B9YC 4EKZA 4F0BA 5KN0A 1PL1A 4KDXA 1QK8A 10GSA 3ERWA 3IR4A 4HUAA 4WBRD 4MCUA 1AC1A 1GTIA 2VM2A 1X5CA 3ZFLA 4EUYA 2GSTA 3PPUA 4MPFA 1H4OA 1IYHA 4EE0A 2R4VA 3GA4A 3IOSA 4PTSA 4K2DA 2FNOA 2XPDA 5DAKB 3TJJA 3TRQA 3GHAA 3EYTA 4TN8A 1RW1A 4IKHA 1ACVA 3D21A 1NM3A 3GTUA 4L8EA 3UBLA 1K3LA 2HRKB 1JZOA 3TUEA 3VK9A 3C73A 5EL8A 1QFNA 1XW5A 1XFLA 1DE2A 3WT2A 1PA3A 13GSA 2KUCA 3CRTA 2FWHA 3HVXA 1G7EA 1MDKA 2FLSA 1F9MA 2H1AA 1MD3A 1TDIA 1K0AA 1K0CA 3SBCA 4GQFA 3ZIJA 5G5FA 4YH2A 3FEUA 3LG6A 3QD9A 4KB3A 2PVOC 4OCFA 5DJLA 1TU7A 2P5QA 2C0FA 1WRYA 4I2TA 4IJ3A 3OR5A 5CO3A 3GTUB 4EDYA 1MD4A 1O8WA 1TK5B 4IELA 2L6CA 2F8FA 4Q5NA 2WFCA 2NTOA 4FYCA 2R37A 1NHYA 2VCVA 4P3YB 2O87A 2HRAA 4K8MA 1VRSD 4BPYA 4PUFC 1S3CA 1O85A 1M2AA 3TRXA 1RQMA 2YWIA 1C72A 1XWKA 5J9CA 3H1NA 1B4PA 1PX7A 2MMNA 3QAGA 4H86A 2V32A 2CA8A 3UOMA 3IXRA 4F0CA 1XWAA 3D4MA 2XBQA 4I6XA 5J9BA 3TJFA 1ZGNA 5FWGA 2GVPA 4IP1A 3F6DA 1N2AA 4PQIA 4MH3A 4MMMA 3HZ4A 4LMWA 1B9XC 3VLNA 2A4VA 3CSJA 1TRUA 4HJMA 2DMMA 4KDYA 2KOKA 4HU7A 3RAZA 1F3AA 3KMNA 3C1RA 3LWAA 2MBSA 4J2FA 2B5XA 3PINA 5CAXA 1AUCA 4MA9A 3TB2A 2KLXA 5DQSA 2L4CA 4PNGA 4J57E 3ZMLA 4JBBA 1XZOA 2IPAA 3H79A 2VL9A 4IQAA 4L0WA 3A5WA 1X9SB 3UVHA 4DVCA 3PGTA 5ECLB 3W6GA 1SL2B 2FA4A 3GFKA 2RM5A 4G0IA 5BMUA 1WJKA 4K1FA 1ZYEA 1XOAA 4GWRA 3E0UA 4DSSA 4BWSA 5IOWA 3LGCA 1ZCPA 3ZFBA 4MK3A 2IWTA 3KD0A 4X43A 3F3RA 1U3IA 1T3BA 4NAXA 2KHPA 1Z5YE 4CDOA 1U3AA 2CZ2A 4XCSA 4OFTA 1M9BA 2DIZA 1AQWA 11GSA 3TKSC 3Q19A 2IJYA 1J08A 1UN2A 2WCIA 3KP8A 4PURA 5G5EA 1TKDB 2YWOA 3APOA 4F82A 3GIXA 3KZQA 5DJMA 5HR3A 2LEGA 2B1LA 4DSSB 5JCUA 3I69A 4HS1A 4Q5RA 1ZZYA 5EVOA 2JZRA 3CMIA 6GSVA 4MABA 4HU9A 4K9ZA 1GULA 4BWQA 5E59A 5F06A 2DSAA 2AJQB 4L5OA 1B48A 5FHIA 3HVSA 3TJKA 1VGLA 4OD7A 3W8JA 2FUG2 5B6MA 4K7IA 4K7NA 2VAFA 2GGTA 1M2BA 1UC7A 4YAPA 2YV7A 2E2GA 1OKDA 2XPEA 4MF6A 1S3AA 2LV3A 5JCWA 1S3DA 3GN3A 4RUVA 3IPZA 4XRAA 3FR3A 4F2IA 4POMA 1R5AA 4QL7A 3IK9A 1SK2A 4FYBA 2N5AA 1THOA 3MNGA 1XCCA 5IMDA 1YY7A 1SU9A 4V1Ag 4G0LA 4WF5A 3TGZA 5AIVA 2GS3A 2JSYA 6GSWA 3MWHA 3Q74A 3O76A 3EURA 3RDWA 4BVYA 2CAIA 3GRXA 4L5LA 4IGJA 5ELGA 4KCAA 2M80A 2JSZA 4IP6A 1JLWA 4TRXA 1SKRB 2HRNA 3L78A 1V2AA 3FR6A 4OO5A 2VL2A 4XTSA 1FVJA 1RK4A 2XBIA 1OE7A 1EP7A 4OFMA 5IMAA 3HYPA 1ERWA 3ZREA 4K0NA 4MPGA 1O6JA 1ST9A 1XWGA 5G1LA 4KW6A 4E8HA 4PQHA 2DIYA 4LMVA 2WJUA 3ME8A 1B8XA 4ECIA 4BVYB 1GUMA 1OC8A 4RI7A 2WB9A 1PRXA 3PH9A 3APQA 5EY6A 3IRAA 5CRHA 4TVEA 1R26A 2VLVA 4GRFA 1A24A 4GQCA 4XRDA 2NDOA 2YJ7A 2JADA 2HE3A 4JR6A 1K0DA 3FR9A 5ECMB 5LD0A 3VWUA 5IMCA 2YN1A 3FY7A 19GSA 1PMTA 5DALA 2VOCA 1F3BA 3KP9A 1TU8A 3KIJA 2TIRA 4ZXGA 2VM1A 1BEDA 4KX4A 1SYXA 2IMDA 3L9UA 5GAPD 4WR4A 4G0KA 2I3YA 4EDZA 2HZEA 2YNXA 4POLA 4Q5QA 1YEPA 1A2JA 5IMFA 2F51A 2VIMA 4OO4A 4KUNA 4J56E 4KSMA 2RUEA 1U88A 1EWXA 3ZLPA 1YF1A 2VLTA 4ZILA 1DUGA 1HNCA 3M3MA 2YCDA 2H01A 2PU9C 3CTFA 3WGEA 1F6MC 1DSBA 1T4YA 5IMZA 4NV5A 2M72A 3LXTA 1U87A 2K8SA 2C3QA 2AYTA 2H6YA 3KTBA 3G7YA 5H5SA 2X64A 1OE8A 1MDJA 6GSTA 1WP0A 1GL8A 3O3TA 3IC8A 2ZUPA 2V6KA 3F8UA 2MMAA 1WE0A 3GKXA 2MMZA 4JE1A 2HT9A 4PGTA 2FA8A 1SJ6A 2JACA 4BVXA 4MZBA 3ZVJD 3VWWA 5FT3A 4G9HA 4IW9A 3DMLA 5HR2A 1NSWA 3HVVA 3IK7A 2YP6A 1XWCA 2FWGA 1LBKA 3ED3A 1A2LA 3C8EA 2L4QA 4PUAA 3G7JA 2CX3A 1GLPA 5DVBA 3C71A 3N9JA 1LU4A 3EU4A 4L0UA 4ID0A 2LJAA 5G31A 4V2NA 4EO3A 5DCHA 2LRNA 4HQZA 1GNEA 3GKNA 5CYYA 5EPFA 2X99A 5CRGA 4MLYA 3U6VA 5JCGA 3IA1A 5GSTA 2JZSA 2B3SA 1Q4JA 2AB6A 2I81A 5ECRB 1JFUA 2VCXA 5JWOB 3MDKA 2I4AA 3F4RA 2O8VB 5E4WA 3FZ4A 2H72A 2QGVA 1TI3A 3QDNA 2LRCA 3D22A 3UEMA 3FZAA 2R3XA 1A23A 1VF3A 1EEJA 5F0GA 1GUKA 1JZRA 2CZ3A 4N11A 3TCOA 1YF0A 2BMXA 4GF0A 17GSA 3TOUA 3GYKA 3VPTA 4HI7A 1A2MA 3L9SA 2GSSA 1OC9A 4MJEA 4FIWA 2H8LA 4YQVA 2B7JA 4JZQA 2GQLA 1PD21 3CXGA 4AJ8A 3P90A 3C7MA 1K3OA 3HHVA 2C3TA 2OE0A 3L0HA 3LEFA 2A2SA 5ECNB 3GX8A 3CRUA 4D73A 2G2QA 4HZ4A 2G0FA 3GNJA 4I8BA 1MDIA 3CYNA 4ZL9A 4BA7A 5ABRA 1GH2A 3EMXA 5J41A 1OC9B 2LS5A 5F8BA 4TR0A 4MZCA 4FYUA 1PN9A 5CP1A 3F6FA 1UVZA 4DEJA 2KP2A 2OE1A 2WZ9A 5KN3A 5D8IA 5A4VA 3GSTA 3KGKA 2JL4A 3TKSA 3LSZA 1SJZA 5D9TA 4GTUA 5F05A 3EU3A 4Z7XA 3TKRA 4D73B 3K8NA 4F9ZA 2YV9A 3M0FA 2M46A 2DBCA 2HNLA 2WRTA 1XIYA 4AF2A 4IQ1A 2DJ2A 1HNBA 2IN3A 3TKSE 3A2XA 4ULXA 5G30A 2VD0A 1NW2A 3KM6A 4OCEA 4TOPA 2D2ZA 3US3A 1BQ7A 2F8AA 2REMA 5GAND 3G7IA 6GSXA 1BJXA 2X8HA 1EGOA 4ACSA 1JZWA 5ENUA 5LNKe 2IMKA 4O92A 4RI6A 1NHOA 1GRXA 1GSYA 3I6AA 4IS0A 5IPHA 4E8EA 1EV9A 1O81A 3A2VA 2IL3A 2DJJA 1Z9HA 3MSZA 2HXKA 1M7TA 1ZL9A 2HZFA 2WS2A 1FG4A 3UVTA 1XPVA 2LUSA 1TP9A 1ERVA 1V9WA 1EGRA 2LNSA 3U5RE 4GLTA 1IYIA 5ECIB 1T1VA 3GL5A 6GSSA 3TKQA 2VUPA 4JRRA 1K3YA 1SK1A 3LORA 4IVFA 3VI7A 3ZVJA 1V57A 3M9JA 3IAS2 1XW9A 4KF9A 2HSYA 3IE3A 3HJMA 4G10A 4ZBAA 2LQQA 2P5RA 4PX1A 1DBYA 1XWBA 4NHWA 4ZIJA 2DJ0A 2VCZA 5HQPA 4V2LA 3L4NA 3IHQA 4ZBBA 3J7Yb 2J9HA 3WGXA 2CX4A 2YOIA 3IDVA 4GSTA 2B7KA 2HSHA 4NMUA 1PL2A 2RUFA 4DSQA 3BCIA 3QAWA 3D0ZA 1Q98A 3F63A 1GSFA 3DIEA 1A0RP 3ISOA 3Q6OA 3QAVA 1G0TA 1OAZA 1Y25A 2HFDA 2GQMA 2HLSA 3FZ5A 3UMAA 3VWVA 3VI5A 2LNTA 2B1KA 4ML6A 3KJYA 2L6DA 4QQ7A 2H75A 3ZZXA 4CW9A 3DKSA 3EC3A 4Q5FA 5CRDA 2H19A 3FW2A 1THXA 2MBTA 5KN2A 3GKKA 3R3EA 5INYA 4V1Ap 1T4ZA 1XXUA 5D9XA 2H0HA 2AUVA 5F07A 5ECKB 18GSA 3KCMA 3QFBC 4XS1A 2YPMA 2VL3A 3ZRDA 1TK0B 4HOJA 1SK0A 1ML6A 2CV4A 3A2WA 3GURA 2YANA 3TJBA 2FWEA 3VPQA 4HZ2A 1HYUA 2V1MA 1QMVA 3RHCA 1X0RA 1EZKA 3L9VA 2F9SA 1T7PB 3F9UA 2CVDA 1JZDA 1Y6EA 4O32A 1G6YA 4IBPA 5A4UA 3UIWA 2ZCTA 3EMPA 3BCKA 3W8SA 1TXXA 1SKSB 4K6XA 2OADA 1K0OA 4POBA 4N0VA 3TOTA 1ZMAA 2DJKA 2VCWA 3ERFA 1HNAA 4MDCA 4ZL8A 1R5PA 1FB0A 5CREA 2H0IA 1J9BA 3HDCA 1X9MB 2E0QA 1KNGA 2L5OA 1GNWA 3Q18A 3JCML 2OA7A 2QSIA 1ON4A 2GLRA 1TI1A 2HSMA 2GSQA 1GTBA 1BX9A 4OWYA 1TRSA 1Z6MA 3DVWA 3CTGA 1GSQA 1FO5A 2ON5A 3AY8A 5H5QA 3F4SA 4WKWA 2L5LA 3HJOA 4HQSA 2IFQA 3HJPA 3DXBA 1GSEA 3DD3A 16GSA 1GSDA 1Z6NA 4HDEA 1A8YA 3HKRA 4XS4A 1AXDA 2LRTA 3CSHA 1O8XA 4ISDA 1SJIA 2MYGA 5AN1A 1TJDA 2HRFA 3UAPA 2PWJA 3NZNA 3NIVA 1KTEA 2H6XA 5DDLA 3N5OA 4N0ZA 2HSMB 2C0EA 1PGTA 2PUKC 2YWNA 3WT1A 5ECHB 5KEJA 5ID2A 4KDUA 3FZ9A 5DALB 1WOUA 1WIKA 2H76A 3FKFA 2DMLA 3LFLA 1FVKA 1BYEA 2RIIA 2H1BA 2PN8A 7GSSA 2HYXA 5B7CA 1AW9A 1YQ1A 2IFQB 4MP4A 2HZEB 3HA9A 3DWVA 1W89A 3HZ8A 2H66A 3I9V2 2VL2C 1LJRA 5HFKA 4TXOA 3EVIA 4XS4B 1GWCA 2DJ3A 5ECPB 1TOFA 2P0GA 2Z9SA 1X5EA 4WBJA 4CHSA 2ALBA 3J7Yk 1W4VA 2OKAA 2F3MA 1ERTA 3WGDA 5G1KA 2VCQA 1MEKA 3RPPA 2VO4A 2K18A 2LTKA 5ID2B 1URMA 1MTCA 4ILFA 1X9WB 3MAKA 5JWRB 1UA5A 2R5GA 4WEYA 2QKEA 2H0GA 3I43A 3QCPA 2EIQA 3IV4A 5COHA 2FY6A 2E7PA 4TR1A 4NHZA 1O73A 4MJBA 2DC5A 3M9KA 4TXOB 3TJGA 5CNWA 4O7HA 4BVXB 3EWLA 3UL3A 4ECBA 3VFIA 2NVLA 4MF7A 2DJ1A 1Z7PA 2TRCP 3BD2A 3A3TA 4V2MA 2OJLA 5IPGA 2C8UA 2RLIA 2I9HA 2FGXA 3UJ1A 4EC0A 6GSUA 4GCIA 1EV4A 1K0NA 1FHEA 1ABAA 2CAQA 4KSOA 2GZPA 14GSA 1TK8B 1CQGA 4ZB9A 2LKUA 1E6BA 3DEXA 4IJIA 4TR1B 1VF2A 1OYJA 1AQXA 1GTUA 3KTLA 2VD1A 1GUHA 1AQVA 1WMJA 2WGRA 1I5GA 1QUWA 3FRCA 1M0UA 1FAAA 2C80A 2IMFA 1ZYQB 3M1GA 3F4TA 4YQMA 2A2RA 2GDRA 3GL3A 3P8WA 1XBSA 1DE1A 1QXHA 1CQHA 3G9BA 3GMFA 1B4QA 1HQOA 2C3NA 2I1UA 2OACA 4K7OA 3ZIVA 4EXJA 5IMVA 1FOVA 4XS6A 1QGVA 3WYWA 5B8BA 2TRXA 4IHUA 2O85A 3ME7A 2XC2A 1HD2A 4TR3A 3HXSA 4TR4A 5C04A 1T8EB 2NBSA 2N5BA 1FW1A 5IIZA 1ERUA 2XHFA 5A5KA 2H1GA 2WDUA 2LJRA 3KEBA 3ZITA 1I9DA 5G2ZA 2O7KA 1SL0B 3RPNA 3D4TA 4WF4A 2QC7A 1GTAA 4NV2A 1VF4A 1KBNA 4ML1A 3ERGA 2FWFA 3EINA 1JHBA 4OFNA 1YZXA 2L59A 2H70A 3QPMA 1EOGA 5LCZA 3E3EA 1O7UA 3UBKA 4ZBDA 2P31A 4MJAA 4AJ7A 3IAM2 2CVKA 1K0MA 3CSIA 2UZ8A 4USSA 4DSRA 2B5EA 5AGYA 4RQXA 1H75A 4GSNA 5GZZB 1USBA 2IMIA 2BTOT 22GSA 1U6TA 3APSA 3RBTA 4KNDA 4TKYA 2V6OA 4X1UA 3KH7A 5J4UA 1BG5A 3PR8A 5CRWA 2FD3A 5HFGA 4KGIA 3BBYA 1OC3A 2OE3A 3GUSA 2ON7A 3IBHA 3GX0A 2K8VA 5A4WA 2C4JA 5D73A 4ZL7A 2DLXA 2K6VA 2AHEA 3ZMKA 3ZL5A 2YWMA 2WULA 4HJ2A 2C0DA 2CT6A 4I97A 1TW9A 4YAVA 3ZTLA 1QQ2A 1SD8A 3H8QA 3SWLA 1OVNA 1SKWB 2KP1A 5B6NA 3GV1A 2YZHA 1A0FA 1WWJA 3DVXA 1EOHA 3IC4A 5HR0A 2L57A 3ZYWA 2GTUA 5L71A 1XVWA 3R2QA 1GSUA 1PQNA 4FQUA 1XVQA 3H93A 5J3RA 1ILOA 1OKTA 4JR4A 4WXTA 1E2YA 5IO0A 3D5JA 5IO2A 4PXOA 5D93A 5HFIA 3LXZA 1F2EA 3UARA 2CVBA 2H71A 4ZB6A 9GSSA 2GQKA 3QMXA 6GSYA 3M8NA 1G6WA 2HI7A 4K0GA 2LSTA 2E2MA 5D9WA 4LL1B 2N5FA 2VCTA 4POKA 4NWYA 5DCGA 2AAWA 3QOUA 4KA0A 4NPBA 2GZZA 1T00A 4KCEA 4MZWA 2GT5A 3WD6A 1GLQA 2MZCA 4KE3A 4BL7A 1YKAA 2VLUA 1PKZA 3FK8A 1R7HA 1TTZA 4EL1A 1A8LA 3HCZA 4OMVA 3DYRA 5KN1A 1M2DA 12GSA 2PPTA 2LQOA 4GXZA 1VF1A 2C1YA 2K9FA 2JU5A 2J23A 4TW5A 3LJRA 5HR1A 1V40A 2PBJA 1M9AA 1XW6A 2GT6A 4N30A 1TRVA 1EP8A 4AJ6A 1GP1A 3H4KA 1AAZA 3O6TA 4TXVA 4MF5A 4EVMA 2YJHA 3BOAA 2V2GA 3F3QA 2MMOA 2OBIA 2IMEA 4G2EA 4BL7B 3LQ7A 2B6MA 2PGTA 4HEA2 3FHKA 1G7OA 2H6ZA 3GH6A 1WPIA 3NOFA 4JU5A 4F03A 5IM9A 1JLVA 1KEBA 1SYRA 5IQYA 3P7XA 2OBKA
chains in the Genus database with same CATH superfamily
4X0XA 2ZNMA 4HSCX 5A34B 2FCHA 2NPBA 4I5QA 2YZUA 3GKMA 3TDGA 3VURA 4PNFA 4MJCA 4XHMA 5ECOB 3P2AA 4IN0A 5B8AA 4FO5A 1AIUA 4XIHA 3TKPA 3EE2A 5ECQB 4FH8A 3QR6A 2EIRA 2H73A 1FB6A 3DGQA 4O5RA 3LYPA 5H5RA 1YKCA 4KH7A 3RFRC 2JZTA 4RQRA 2GZYA 2EC4A 4LA1A 4WETA 3KMOA 1K0BA 2IIYA 1I1IP 2PMTA 1SD9A 3F0IA 2HSNB 1Z3EA 4AKGA 4PQ1A 3D6IA 2V41A 5C00A 3BJ5A 1V98A 3KH9A 5AIXA 2X8CA 1Z7RA 3HY2A 1V58A 3GSSA 3E9JB 2H74A 5D96A 1YJ6A 1BAYA 1PKWA 5ELAA 5ECSA 4ECCA 5J4VA 1TRWA 2LJKA 1SENA 2R2JA 4I2UA 2B5YA 4K2XA 1XOBA 2X8GA 1ZOFA 4AGSA 2PERA 4N10A 1R4WA 3TRPA 5IOXA 2H1DA 4GSSA 3C1SA 2BJXA 3KXOA 1SL1B 4JEDA 1J0FA 1PSQA 20GSA 5GSSA 4EF0A 5BRTA 1YEXA 3VWXA 5DBQA 2C0GA 3DRNA 2RM6A 1N8JA 5DQYA 3RHBA 5JWQB 4NXIA 1GSSA 4WR5A 3QFAC 4KAEA 2AV4A 4ECJA 4G19A 2QA1A 2H30A 2GSRA 5D9VA 2CQ9A 4ZB8A 3GH9A 2PVQA 5DAKA 4LLRA 4MH2A 5J5NA 2R6KA 3CBUA 3CQFA 1PX6A 3LYKA 1YDKA 4LL4B 2HQTA 1EEMA 4W66A 2HRKA 3V1WA 2FHEA 3S9FA 1F37A 1X5DA 3HD5A 2EIOA 8GSSA 1M99A 2O89A 5AISA 4K5SA 4YQUA 3FYGA 2ES7A 4QL9A 1B9YC 4EKZA 4F0BA 5KN0A 1PL1A 4KDXA 1QK8A 10GSA 3ERWA 3IR4A 4HUAA 4WBRD 4MCUA 1AC1A 1GTIA 2VM2A 1X5CA 3ZFLA 4Z2UA 5J47A 4X4JA 4EUYA 2GSTA 3PPUA 4MPFA 1H4OA 1IYHA 4EE0A 2R4VA 3GA4A 3IOSA 4PTSA 4K2DA 2FNOA 2XPDA 5DAKB 3TJJA 3TRQA 3GHAA 3EYTA 4TN8A 1RW1A 4IKHA 1ACVA 3D21A 1NM3A 3GTUA 4L8EA 2R0CA 4E68A 3UBLA 1K3LA 2HRKB 1JZOA 3TUEA 3VK9A 3C73A 5EL8A 1QFNA 1XW5A 1XFLA 1DE2A 3WT2A 1PA3A 13GSA 2KUCA 3CRTA 2FWHA 3HVXA 1G7EA 1MDKA 2FLSA 1F9MA 2H1AA 1MD3A 1TDIA 1K0AA 1K0CA 3SBCA 4GQFA 3ZIJA 5G5FA 4YH2A 3FEUA 5A1NA 3LG6A 3QD9A 4KB3A 2PVOC 4OCFA 5DJLA 1TU7A 2P5QA 2C0FA 1WRYA 4I2TA 4IJ3A 3OR5A 5CO3A 3GTUB 4EDYA 1MD4A 1O8WA 1TK5B 2WW0A 4IELA 2L6CA 2F8FA 4G01A 4Q5NA 2WFCA 2NTOA 4FYCA 2R37A 1NHYA 2VCVA 4P3YB 2O87A 2HRAA 4K8MA 1VRSD 4BPYA 4PUFC 1S3CA 1O85A 1M2AA 3TRXA 1RQMA 2YWIA 1C72A 1XWKA 5J9CA 3H1NA 1B4PA 1PX7A 2MMNA 3QAGA 4H86A 5A1NB 2V32A 2CA8A 3UOMA 3IXRA 4GDFA 4F0CA 1XWAA 3D4MA 2XBQA 4I6XA 5J9BA 3TJFA 1ZGNA 5FWGA 2GVPA 4IP1A 3F6DA 3EPTA 1N2AA 4PQIA 4MH3A 4MMMA 3HZ4A 4LMWA 1B9XC 3VLNA 2A4VA 3CSJA 1TRUA 4HJMA 2DMMA 4KDYA 2KOKA 4HU7A 3RAZA 3RGBC 1F3AA 3KMNA 3C1RA 3LWAA 2MBSA 4J2FA 2B5XA 1TXUA 3PINA 4AI6A 5CAXA 1AUCA 4MA9A 3TB2A 2KLXA 5DQSA 2L4CA 4PNGA 4J57E 3ZMLA 4JBBA 1XZOA 2IPAA 3H79A 2VL9A 4IQAA 4L0WA 3A5WA 1X9SB 3UVHA 4DVCA 3PGTA 5ECLB 3W6GA 1SL2B 2FA4A 3GFKA 2RM5A 4G0IA 5BMUA 1WJKA 4K1FA 1ZYEA 1XOAA 4GWRA 3E0UA 4DSSA 4BWSA 5IOWA 3LGCA 1ZCPA 4MNNA 3ZFBA 4MK3A 2IWTA 3KD0A 4X43A 3F3RA 1U3IA 1T3BA 4NAXA 2KHPA 1Z5YE 4CDOA 1U3AA 2CZ2A 1FOHA 4XCSA 4OFTA 1M9BA 2DIZA 1AQWA 11GSA 3TKSC 3Q19A 2IJYA 1J08A 1UN2A 2WCIA 3KP8A 4PURA 5G5EA 1TKDB 2YWOA 3APOA 4F82A 3GIXA 3KZQA 5DJMA 4CY6A 5BMUB 5HR3A 2LEGA 2B1LA 4DSSB 5JCUA 3I69A 4HS1A 4Q5RA 1ZZYA 5EVOA 2JZRA 3CMIA 6GSVA 4MABA 4HU9A 4K9ZA 1GULA 4BWQA 5E59A 5F06A 2DSAA 2AJQB 4L5OA 1B48A 5FHIA 3HVSA 3TJKA 1VGLA 4OD7A 3W8JA 2FUG2 5B6MA 4K7IA 4K7NA 2VAFA 2GGTA 1M2BA 1UC7A 4YAPA 2YV7A 2E2GA 1OKDA 2XPEA 4MF6A 1S3AA 2LV3A 5JCWA 1S3DA 1XG8A 3GN3A 4RUVA 3IPZA 4XRAA 3FR3A 4F2IA 4POMA 1R5AA 4BIKA 4QL7A 3IK9A 1SK2A 4FYBA 2N5AA 1Y1UA 1THOA 3MNGA 1XCCA 5IMDA 1YY7A 1SU9A 4V1Ag 4G0LA 4WF5A 3TGZA 5AIVA 4FXYP 4PHZC 2GS3A 2JSYA 6GSWA 3MWHA 3Q74A 3O76A 3EURA 3RDWA 4BVYA 2WVXB 2CAIA 3GRXA 4L5LA 4IGJA 5ELGA 4KCAA 2M80A 2JSZA 4IP6A 1JLWA 4TRXA 1SKRB 2HRNA 3L78A 2EFCA 1V2AA 3FR6A 1BG1A 4OO5A 2VL2A 4XTSA 1FVJA 1RK4A 2XBIA 1OE7A 1EP7A 4OFMA 5IMAA 3HYPA 1ERWA 3ZREA 3CWGA 4K0NA 4MPGA 1O6JA 1ST9A 1XWGA 5G1LA 4KW6A 4E8HA 4PQHA 2DIYA 4LMVA 2WJUA 3ME8A 1B8XA 4ECIA 4BVYB 1GUMA 1OC8A 4RI7A 2WB9A 1PRXA 3PH9A 3APQA 5EY6A 3IRAA 5CRHA 4TVEA 1R26A 2VLVA 2WVZA 4GRFA 1A24A 4GQCA 4XRDA 2NDOA 2YJ7A 2JADA 2HE3A 4JR6A 1K0DA 3FR9A 5ECMB 5LD0A 3VWUA 5IMCA 3MIXA 2YN1A 3FY7A 19GSA 4ICYA 1PMTA 5DALA 2VOCA 1F3BA 1TU8A 3KP9A 3KIJA 2TIRA 4ZXGA 2VM1A 4O5QA 1S3RA 1BEDA 4KX4A 1SYXA 2IMDA 3L9UA 5GAPD 4WR4A 4G0KA 2I3YA 2WW1A 4EDZA 2HZEA 2YNXA 4YKGA 4POLA 4Q5QA 1YEPA 1A2JA 5IMFA 2F51A 2VIMA 4OO4A 4KUNA 4J56E 4KSMA 2RUEA 1U88A 1EWXA 5J4YA 3ZLPA 2WW2A 1YF1A 2VLTA 4ZILA 3FMWA 1DUGA 1HNCA 3M3MA 2YCDA 2H01A 2PU9C 3CTFA 3WGEA 1F6MC 1DSBA 1T4YA 5IMZA 4NV5A 2M72A 3LXTA 1U87A 2K8SA 4O5UA 2C3QA 2AYTA 2H6YA 3KTBA 3G7YA 5H5SA 2X64A 1OE8A 1MDJA 6GSTA 1WP0A 1GL8A 3O3TA 3IC8A 2ZUPA 3IHGA 2V6KA 3F8UA 2MMAA 1WE0A 3GKXA 2MMZA 4JE1A 2HT9A 4PGTA 2FA8A 1SJ6A 2JACA 4BVXA 4MZBA 4AKHA 3ZVJD 3VWWA 5FT3A 4G9HA 4IW9A 3DMLA 5HR2A 1NSWA 3HVVA 3IK7A 2YP6A 1XWCA 2FWGA 1LBKA 3ED3A 1A2LA 3C8EA 2L4QA 4PUAA 3G7JA 2CX3A 1GLPA 5DVBA 3C71A 3N9JA 1LU4A 2R0GA 3EU4A 4L0UA 4ID0A 2LJAA 5G31A 4V2NA 4EO3A 5DCHA 2LRNA 4HQZA 1GNEA 3GKNA 5CYYA 5EPFA 2X99A 5CRGA 4MLYA 3U6VA 5JCGA 3HVNA 3IA1A 5GSTA 2JZSA 2B3SA 1Q4JA 2EFHA 2AB6A 2I81A 5ECRB 1JFUA 2VCXA 5JWOB 3MDKA 2I4AA 3F4RA 2O8VB 5E4WA 3FZ4A 2H72A 2QGVA 1TI3A 3QDNA 2LRCA 3D22A 3UEMA 3FZAA 2R3XA 1A23A 1VF3A 1EEJA 5F0GA 1GUKA 1JZRA 2CZ3A 4N11A 3TCOA 1YF0A 2BMXA 4GF0A 17GSA 3TOUA 3GYKA 3VPTA 2WVYA 4HI7A 1A2MA 3L9SA 2GSSA 1OC9A 4MJEA 4FIWA 2H8LA 4YQVA 2B7JA 4JZQA 2GQLA 1PD21 3CXGA 4AJ8A 3P90A 3C7MA 1K3OA 3HHVA 2C3TA 2OE0A 3L0HA 3LEFA 2A2SA 5ECNB 3GX8A 3CRUA 4D73A 2G2QA 4HZ4A 2G0FA 3GNJA 4I8BA 3TU3B 1MDIA 3CYNA 4ZL9A 4BA7A 5ABRA 1GH2A 3EMXA 5J41A 1OC9B 2LS5A 5F8BA 4TR0A 4AKIA 4MZCA 4FYUA 1PN9A 5CP1A 3F6FA 1UVZA 4DEJA 2KP2A 2OE1A 2WZ9A 5KN3A 5D8IA 5A4VA 3GSTA 2EFEA 3KGKA 2JL4A 3TKSA 3LSZA 1SJZA 5D9TA 4GTUA 5F05A 3EU3A 4Z7XA 3TKRA 4D73B 1M3JA 3K8NA 4F9ZA 2YV9A 3M0FA 2M46A 5KOXA 2DBCA 2HNLA 2WRTA 1SVLA 1XIYA 4AF2A 4IQ1A 2DJ2A 1HNBA 2IN3A 3TKSE 3A2XA 4ULXA 5G30A 2VD0A 1NW2A 3KM6A 4OCEA 4TOPA 2D2ZA 3US3A 1BQ7A 2F8AA 2REMA 5GAND 3G7IA 4EIPA 6GSXA 1BJXA 2X8HA 1EGOA 4ACSA 1JZWA 5ENUA 5LNKe 2IMKA 4O92A 4RI6A 1M3IA 1NHOA 2EFDA 1GRXA 1GSYA 3I6AA 4IS0A 5IPHA 4E8EA 1EV9A 1O81A 1N25A 3A2VA 2IL3A 2DJJA 1Z9HA 3MSZA 2HXKA 1M7TA 1ZL9A 2HZFA 2WS2A 1FG4A 3UVTA 1XPVA 2LUSA 2WZSA 1TP9A 1ERVA 1V9WA 3MYDA 1EGRA 1YVLA 4YKFA 2LNSA 3U5RE 4GLTA 1IYIA 5ECIB 1T1VA 3GL5A 6GSSA 3TKQA 2VUPA 4JRRA 1K3YA 1SK1A 3LORA 4IVFA 3VI7A 3ZVJA 1V57A 3M9JA 3IAS2 4QMKA 1XW9A 4KF9A 2HSYA 3IE3A 3HJMA 4G10A 4ZBAA 2LQQA 2P5RA 4PX1A 1DBYA 1XWBA 4NHWA 4ZIJA 2DJ0A 2VCZA 5HQPA 4V2LA 3L4NA 3IHQA 4ZBBA 3J7Yb 2R0PA 2J9HA 3WGXA 2CX4A 2YOIA 3IDVA 4GSTA 2B7KA 2HSHA 4NMUA 1PL2A 2RUFA 4DSQA 3BCIA 3QAWA 3D0ZA 1Q98A 3F63A 1GSFA 3DIEA 1A0RP 3ISOA 3Q6OA 4A5PA 3QAVA 1G0TA 1OAZA 1Y25A 2HFDA 2GQMA 2HLSA 3FZ5A 3UMAA 3VWVA 3VI5A 2LNTA 2B1KA 4ML6A 3KJYA 2L6DA 4QQ7A 2H75A 3ZZXA 4CW9A 3DKSA 3EC3A 4Q5FA 5CRDA 5J40A 2H19A 3FW2A 1THXA 2MBTA 5KN2A 4Z2TA 3GKKA 3R3EA 4N3ZA 5INYA 4V1Ap 1T4ZA 1XXUA 5D9XA 2H0HA 2H1LA 2AUVA 5F07A 5ECKB 18GSA 3KCMA 3QFBC 4XS1A 2YPMA 2VL3A 3ZRDA 1TK0B 4HOJA 1SK0A 1ML6A 2CV4A 3A2WA 3GURA 2YANA 3TJBA 2FWEA 5A34A 3VPQA 4HZ2A 1HYUA 2V1MA 1QMVA 3RHCA 1X0RA 1EZKA 3L9VA 2F9SA 1T7PB 3F9UA 2CVDA 1JZDA 1Y6EA 4O32A 1G6YA 4IBPA 5A4UA 3UIWA 4EIQA 2ZCTA 3EMPA 3BCKA 3W8SA 1TXXA 1SKSB 4K6XA 2OADA 1K0OA 4POBA 4N0VA 3TOTA 3CHXC 1ZMAA 2DJKA 4PI0C 2VCWA 3ERFA 1HNAA 4MDCA 4ZL8A 2O3EA 1R5PA 1FB0A 5CREA 2H0IA 1J9BA 3HDCA 1X9MB 2E0QA 1KNGA 2L5OA 1GNWA 3Q18A 3JCML 2OA7A 2QSIA 1ON4A 2GLRA 1TI1A 2HSMA 2GSQA 1GTBA 1BX9A 4OWYA 1TRSA 1Z6MA 3DVWA 3CTGA 1GSQA 1FO5A 2ON5A 3AY8A 5H5QA 3F4SA 1PFOA 4WKWA 2L5LA 3HJOA 4HQSA 2IFQA 3HJPA 3DXBA 1GSEA 3DD3A 16GSA 1GSDA 1Z6NA 4HDEA 2DKHA 1A8YA 3HKRA 4XS4A 1AXDA 2LRTA 3CSHA 1O8XA 4ISDA 1SJIA 2MYGA 5AN1A 1TJDA 1S4BP 2HRFA 3UAPA 2PWJA 3NZNA 3NIVA 1KTEA 2H6XA 5DDLA 3N5OA 4N0ZA 2HSMB 2C0EA 1PGTA 2PUKC 2YWNA 3WT1A 5ECHB 5KEJA 5ID2A 4KDUA 3FZ9A 5DALB 1WOUA 1WIKA 2H76A 3FKFA 2DMLA 3LFLA 1FVKA 1BYEA 2RIIA 2H1BA 2PN8A 7GSSA 2HYXA 5B7CA 1AW9A 1YQ1A 2IFQB 4MP4A 2HZEB 3HA9A 3DWVA 1W89A 3HZ8A 2H66A 3I9V2 2VL2C 1LJRA 5HFKA 4TXOA 3EVIA 4XS4B 1GWCA 2DJ3A 5ECPB 1TOFA 2P0GA 2Z9SA 1X5EA 4WBJA 4CHSA 2ALBA 3J7Yk 1W4VA 2OKAA 2F3MA 1ERTA 3WGDA 5G1KA 2VCQA 1MEKA 3RPPA 2VO4A 2K18A 2LTKA 5ID2B 4Z2RA 1URMA 1MTCA 4ILFA 1X9WB 3MAKA 5JWRB 1UA5A 2R5GA 4WEYA 2QKEA 2H0GA 3I43A 3QCPA 5A5HA 2EIQA 3IV4A 5COHA 2FY6A 2E7PA 4TR1A 4NHZA 1O73A 4MJBA 2DC5A 3HMJG 3M9KA 4TXOB 3TJGA 5CNWA 4O7HA 4BVXB 3EWLA 3UL3A 4ECBA 3VFIA 2NVLA 4MF7A 3A5IA 2DJ1A 1Z7PA 2TRCP 3BD2A 3A3TA 4V2MA 2OJLA 5IPGA 2C8UA 2WW3A 2RLIA 2I9HA 2FGXA 3UJ1A 5KOWA 4EC0A 6GSUA 4GCIA 1EV4A 1K0NA 1FHEA 1ABAA 2CAQA 4KSOA 2GZPA 5A5HB 14GSA 1TK8B 1CQGA 4ZB9A 2LKUA 1E6BA 3DEXA 4IJIA 4TR1B 1VF2A 1OYJA 1ZYNA 1AQXA 1GTUA 3KTLA 2VD1A 1GUHA 1AQVA 1WMJA 2WGRA 1I5GA 1QUWA 3FRCA 1M0UA 1FAAA 2C80A 2IMFA 1ZYQB 3M1GA 3F4TA 4YQMA 4AKXB 2A2RA 2GDRA 3GL3A 3P8WA 1XBSA 1DE1A 1QXHA 1CQHA 3G9BA 3GMFA 1B4QA 1HQOA 2C3NA 2I1UA 2OACA 4K7OA 3ZIVA 4EXJA 1ZYPA 5IMVA 1FOVA 4XS6A 1QGVA 3WYWA 5B8BA 2TRXA 4IHUA 2O85A 3ME7A 2XC2A 1HD2A 4TR3A 3HXSA 4TR4A 5C04A 1T8EB 2NBSA 2N5BA 1FW1A 5IIZA 1ERUA 2XHFA 5A5KA 2H1GA 2WDUA 2LJRA 3KEBA 3ZITA 4PI2C 1I9DA 5G2ZA 2O7KA 1SL0B 3RPNA 3D4TA 4WF4A 2QC7A 1GTAA 4NV2A 1VF4A 1KBNA 4ML1A 3ERGA 2FWFA 3EINA 1JHBA 2O36A 4OFNA 1YZXA 2L59A 2H70A 3QPMA 1EOGA 5LCZA 3E3EA 1O7UA 3UBKA 4ZBDA 2P31A 4MJAA 4AJ7A 3IAM2 2CVKA 1K0MA 3CSIA 2UZ8A 4USSA 4DSRA 2B5EA 5AGYA 4K5RA 4RQXA 1SVMA 1H75A 4GSNA 5GZZB 1USBA 2IMIA 4CY8A 2BTOT 22GSA 1U6TA 3APSA 3RBTA 4KNDA 4TKYA 2V6OA 4X1UA 3KH7A 5J4UA 1BG5A 3PR8A 2QA2A 5CRWA 2FD3A 5HFGA 4KGIA 3BBYA 4ZB7A 1OC3A 2OE3A 3GUSA 2X4AA 2ON7A 3IBHA 3GX0A 2K8VA 5A4WA 2C4JA 5D73A 4ZL7A 2DLXA 2K6VA 2A2PA 2AHEA 2VKZG 3ZMKA 3ZL5A 2YWMA 2WULA 4HJ2A 2C0DA 2CT6A 4I97A 1TW9A 4YAVA 3ZTLA 1QQ2A 1SD8A 3H8QA 3SWLA 1OVNA 1SKWB 2KP1A 5B6NA 3GV1A 2YZHA 1A0FA 1WWJA 3DVXA 1EOHA 3IC4A 5HR0A 2L57A 3ZYWA 2A4HA 2GTUA 5L71A 1XVWA 3R2QA 1GSUA 1PQNA 4FQUA 1XVQA 3H93A 5J3RA 1ILOA 2X49A 1OKTA 4JR4A 4WXTA 1E2YA 5IO0A 3D5JA 5IO2A 4PXOA 5D93A 2UV8G 5HFIA 3LXZA 1F2EA 3UARA 2CVBA 2H71A 4ZB6A 9GSSA 2GQKA 3QMXA 6GSYA 3M8NA 1G6WA 2HI7A 4K0GA 2LSTA 2E2MA 5D9WA 4LL1B 1BF5A 2N5FA 2VCTA 4POKA 4NWYA 5DCGA 2WVXA 2AAWA 3QOUA 4KA0A 4NPBA 2GZZA 1T00A 4KCEA 4MZWA 2GT5A 3WD6A 1PN0A 1GLQA 2MZCA 4KE3A 4BL7A 1YKAA 2VLUA 2O5VA 1PKZA 3FK8A 1R7HA 1TTZA 4EL1A 1A8LA 3HCZA 4OMVA 3DYRA 5KN1A 1M2DA 12GSA 2DKIA 2PPTA 2LQOA 4GXZA 1VF1A 2C1YA 2K9FA 2JU5A 2J23A 4TW5A 3LJRA 5HR1A 1V40A 2PBJA 1M9AA 1SVOA 1XW6A 2GT6A 2OT3A 4N30A 1TRVA 1EP8A 4AJ6A 1GP1A 3H4KA 1AAZA 3O6TA 4TXVA 4MF5A 4EVMA 2YJHA 3BOAA 2V2GA 3F3QA 2MMOA 2OBIA 2IMEA 4G2EA 4BL7B 1YEWC 3LW9A 3LQ7A 2B6MA 2PGTA 4HEA2 3FHKA 1G7OA 2H6ZA 3GH6A 1WPIA 3NOFA 4JU5A 2HSNA 4F03A 5IM9A 1JLVA 1KEBA 1SYRA 5IQYA 3P7XA 2OBKA
chains in the Genus database with same CATH topology
4X0XA 2ZNMA 5A34B 2FCHA 2NPBA 4I5QA 2YZUA 3GKMA 3TDGA 3VURA 4PNFA 4MJCA 4XHMA 5ECOB 3P2AA 4IN0A 5B8AA 4FO5A 1AIUA 4XIHA 3TKPA 3EE2A 5ECQB 4FH8A 3QR6A 2EIRA 2H73A 1FB6A 3DGQA 4O5RA 3LYPA 5H5RA 1YKCA 4KH7A 2JZTA 4RQRA 2GZYA 2EC4A 4LA1A 4WETA 3KMOA 1K0BA 2IIYA 3F0IA 2PMTA 1SD9A 2HSNB 1Z3EA 4AKGA 4PQ1A 3D6IA 2V41A 5C00A 3BJ5A 1V98A 3KH9A 5AIXA 2X8CA 1Z7RA 3HY2A 1V58A 3GSSA 3E9JB 2H74A 5D96A 1YJ6A 1BAYA 1PKWA 5ELAA 5ECSA 4ECCA 5J4VA 1TRWA 2LJKA 1SENA 2R2JA 4I2UA 2B5YA 4K2XA 1XOBA 2X8GA 1ZOFA 4AGSA 2PERA 4N10A 1R4WA 3TRPA 5IOXA 2H1DA 4GSSA 3C1SA 2BJXA 3KXOA 1SL1B 4JEDA 1J0FA 1PSQA 20GSA 5GSSA 4EF0A 5BRTA 1YEXA 3VWXA 5DBQA 2C0GA 3DRNA 2RM6A 1N8JA 5DQYA 3RHBA 5JWQB 4NXIA 1GSSA 4WR5A 3QFAC 4KAEA 2AV4A 4ECJA 4G19A 2QA1A 2H30A 2GSRA 5D9VA 2CQ9A 4ZB8A 3GH9A 2PVQA 5DAKA 4LLRA 4MH2A 5J5NA 2R6KA 3CBUA 1PX6A 3LYKA 1YDKA 4LL4B 2HQTA 1EEMA 4W66A 2HRKA 3V1WA 2FHEA 3S9FA 1F37A 1X5DA 3HD5A 2EIOA 8GSSA 1M99A 2O89A 5AISA 4K5SA 4YQUA 3FYGA 2ES7A 4QL9A 1B9YC 4EKZA 4F0BA 5KN0A 1PL1A 4KDXA 1QK8A 10GSA 3ERWA 3IR4A 4HUAA 4WBRD 4MCUA 1AC1A 1GTIA 2VM2A 1X5CA 3ZFLA 4Z2UA 5J47A 4X4JA 4EUYA 2GSTA 3PPUA 4MPFA 1H4OA 1IYHA 4EE0A 2R4VA 3GA4A 3IOSA 4PTSA 4K2DA 2FNOA 2XPDA 5DAKB 3TJJA 3TRQA 3GHAA 3EYTA 4TN8A 1RW1A 4IKHA 1ACVA 3D21A 1NM3A 3GTUA 4L8EA 2R0CA 4E68A 3UBLA 1K3LA 2HRKB 1JZOA 3TUEA 3VK9A 3C73A 5EL8A 1QFNA 1XW5A 1XFLA 1DE2A 3WT2A 1PA3A 13GSA 2KUCA 3CRTA 2FWHA 3HVXA 1G7EA 1MDKA 2FLSA 1F9MA 2H1AA 1MD3A 1TDIA 1K0AA 1K0CA 3SBCA 4GQFA 3ZIJA 5G5FA 4YH2A 3FEUA 5A1NA 3LG6A 3QD9A 4KB3A 2PVOC 4OCFA 5DJLA 1TU7A 2P5QA 2C0FA 1WRYA 4I2TA 4IJ3A 3OR5A 5CO3A 3GTUB 4EDYA 1MD4A 1O8WA 1TK5B 4IELA 2L6CA 2F8FA 4G01A 4Q5NA 2WFCA 2NTOA 4FYCA 2R37A 1NHYA 2VCVA 4P3YB 2O87A 2HRAA 4K8MA 1VRSD 4BPYA 4PUFC 1S3CA 1O85A 1M2AA 3TRXA 1RQMA 2YWIA 1C72A 1XWKA 5J9CA 3H1NA 1B4PA 1PX7A 2MMNA 3QAGA 4H86A 5A1NB 2V32A 2CA8A 3UOMA 3IXRA 4GDFA 4F0CA 1XWAA 3D4MA 2XBQA 4I6XA 5J9BA 3TJFA 1ZGNA 5FWGA 2GVPA 4IP1A 3F6DA 3EPTA 1N2AA 4PQIA 4MH3A 4MMMA 3HZ4A 4LMWA 1B9XC 3VLNA 2A4VA 3CSJA 1TRUA 4HJMA 2DMMA 4KDYA 2KOKA 4HU7A 3RAZA 1F3AA 3KMNA 3C1RA 3LWAA 2MBSA 4J2FA 2B5XA 1TXUA 3PINA 4AI6A 5CAXA 1AUCA 4MA9A 3TB2A 2KLXA 5DQSA 2L4CA 4PNGA 4J57E 3ZMLA 4JBBA 1XZOA 2IPAA 3H79A 2VL9A 4IQAA 4L0WA 3A5WA 1X9SB 3UVHA 4DVCA 3PGTA 5ECLB 3W6GA 1SL2B 2FA4A 3GFKA 2RM5A 4G0IA 5BMUA 1WJKA 4K1FA 1ZYEA 1XOAA 4GWRA 3E0UA 4DSSA 4BWSA 5IOWA 3LGCA 1ZCPA 4MNNA 3ZFBA 4MK3A 2IWTA 3KD0A 4X43A 3F3RA 1U3IA 1T3BA 4NAXA 2KHPA 1Z5YE 4CDOA 1U3AA 2CZ2A 1FOHA 4XCSA 4OFTA 1M9BA 2DIZA 1AQWA 11GSA 3TKSC 3Q19A 2IJYA 1J08A 1UN2A 2WCIA 3KP8A 4PURA 5G5EA 1TKDB 2YWOA 3APOA 4F82A 3GIXA 3KZQA 5DJMA 4CY6A 5BMUB 5HR3A 2LEGA 2B1LA 4DSSB 5JCUA 3I69A 4HS1A 4Q5RA 1ZZYA 5EVOA 2JZRA 3CMIA 6GSVA 4MABA 4HU9A 4K9ZA 1GULA 4BWQA 5E59A 5F06A 2DSAA 2AJQB 4L5OA 1B48A 5FHIA 3HVSA 3TJKA 1VGLA 4OD7A 3W8JA 2FUG2 5B6MA 4K7IA 4K7NA 2VAFA 2GGTA 1M2BA 1UC7A 4YAPA 2YV7A 2E2GA 1OKDA 2XPEA 4MF6A 1S3AA 2LV3A 5JCWA 1S3DA 3GN3A 4RUVA 3IPZA 4XRAA 3FR3A 4F2IA 4POMA 1R5AA 4QL7A 3IK9A 1SK2A 4FYBA 2N5AA 1Y1UA 1THOA 3MNGA 1XCCA 5IMDA 1YY7A 1SU9A 4V1Ag 4G0LA 4WF5A 3TGZA 5AIVA 2GS3A 2JSYA 6GSWA 3MWHA 3Q74A 3O76A 3EURA 3RDWA 4BVYA 2CAIA 3GRXA 4L5LA 4IGJA 5ELGA 4KCAA 2M80A 2JSZA 4IP6A 1JLWA 4TRXA 1SKRB 2HRNA 3L78A 2EFCA 1V2AA 3FR6A 1BG1A 4OO5A 2VL2A 4XTSA 1FVJA 1RK4A 2XBIA 1OE7A 1EP7A 4OFMA 5IMAA 3HYPA 1ERWA 3ZREA 3CWGA 4K0NA 4MPGA 1O6JA 1ST9A 1XWGA 5G1LA 4KW6A 4E8HA 4PQHA 2DIYA 4LMVA 2WJUA 3ME8A 1B8XA 4ECIA 4BVYB 1GUMA 1OC8A 4RI7A 2WB9A 1PRXA 3PH9A 3APQA 5EY6A 3IRAA 5CRHA 4TVEA 1R26A 2VLVA 4GRFA 1A24A 4GQCA 4XRDA 2NDOA 2YJ7A 2JADA 2HE3A 4JR6A 1K0DA 3FR9A 5ECMB 5LD0A 3VWUA 5IMCA 3MIXA 2YN1A 3FY7A 19GSA 4ICYA 1PMTA 5DALA 2VOCA 1F3BA 3KP9A 1TU8A 3KIJA 2TIRA 4ZXGA 2VM1A 4O5QA 1BEDA 4KX4A 1SYXA 2IMDA 3L9UA 5GAPD 4WR4A 4G0KA 2I3YA 4EDZA 2HZEA 2YNXA 4YKGA 4POLA 4Q5QA 1YEPA 1A2JA 5IMFA 2F51A 2VIMA 4OO4A 4KUNA 4J56E 4KSMA 2RUEA 1U88A 1EWXA 5J4YA 3ZLPA 1YF1A 2VLTA 4ZILA 3FMWA 1DUGA 1HNCA 3M3MA 2YCDA 2H01A 2PU9C 3CTFA 3WGEA 1F6MC 1DSBA 1T4YA 5IMZA 4NV5A 2M72A 3LXTA 1U87A 2K8SA 4O5UA 2C3QA 2AYTA 2H6YA 3KTBA 3G7YA 5H5SA 2X64A 1OE8A 1MDJA 6GSTA 1WP0A 1GL8A 3O3TA 3IC8A 2ZUPA 3IHGA 2V6KA 3F8UA 2MMAA 1WE0A 3GKXA 2MMZA 4JE1A 2HT9A 4PGTA 2FA8A 1SJ6A 2JACA 4BVXA 4MZBA 4AKHA 3ZVJD 3VWWA 5FT3A 4G9HA 4IW9A 3DMLA 5HR2A 1NSWA 3HVVA 3IK7A 2YP6A 1XWCA 2FWGA 1LBKA 3ED3A 1A2LA 3C8EA 2L4QA 4PUAA 3G7JA 2CX3A 1GLPA 5DVBA 3C71A 3N9JA 1LU4A 2R0GA 3EU4A 4L0UA 4ID0A 2LJAA 5G31A 4V2NA 4EO3A 5DCHA 2LRNA 4HQZA 1GNEA 3GKNA 5CYYA 5EPFA 2X99A 5CRGA 4MLYA 3U6VA 5JCGA 3IA1A 5GSTA 2JZSA 2B3SA 1Q4JA 2EFHA 2AB6A 2I81A 5ECRB 1JFUA 2VCXA 5JWOB 3MDKA 2I4AA 3F4RA 2O8VB 5E4WA 3FZ4A 2H72A 2QGVA 1TI3A 3QDNA 2LRCA 3D22A 3UEMA 3FZAA 2R3XA 1A23A 1VF3A 1EEJA 5F0GA 1GUKA 1JZRA 2CZ3A 4N11A 3TCOA 1YF0A 2BMXA 4GF0A 17GSA 3TOUA 3GYKA 3VPTA 4HI7A 1A2MA 3L9SA 2GSSA 1OC9A 4MJEA 4FIWA 2H8LA 4YQVA 2B7JA 4JZQA 2GQLA 1PD21 3CXGA 4AJ8A 3P90A 3C7MA 1K3OA 3HHVA 2C3TA 2OE0A 3L0HA 3LEFA 2A2SA 5ECNB 3GX8A 3CRUA 4D73A 2G2QA 4HZ4A 2G0FA 3GNJA 4I8BA 3TU3B 1MDIA 3CYNA 4ZL9A 4BA7A 5ABRA 1GH2A 3EMXA 5J41A 1OC9B 2LS5A 5F8BA 4TR0A 4AKIA 4MZCA 4FYUA 1PN9A 5CP1A 3F6FA 1UVZA 4DEJA 2KP2A 2OE1A 2WZ9A 5KN3A 5D8IA 5A4VA 3GSTA 2EFEA 3KGKA 2JL4A 3TKSA 3LSZA 1SJZA 5D9TA 4GTUA 5F05A 3EU3A 4Z7XA 3TKRA 4D73B 3K8NA 4F9ZA 2YV9A 3M0FA 2M46A 5KOXA 2DBCA 2HNLA 2WRTA 1SVLA 1XIYA 4AF2A 4IQ1A 2DJ2A 1HNBA 2IN3A 3TKSE 3A2XA 4ULXA 5G30A 2VD0A 1NW2A 3KM6A 4OCEA 4TOPA 2D2ZA 3US3A 1BQ7A 2F8AA 2REMA 5GAND 3G7IA 4EIPA 6GSXA 1BJXA 2X8HA 1EGOA 4ACSA 1JZWA 5ENUA 5LNKe 2IMKA 4O92A 4RI6A 1NHOA 2EFDA 1GRXA 1GSYA 3I6AA 4IS0A 5IPHA 4E8EA 1EV9A 1O81A 1N25A 3A2VA 2IL3A 2DJJA 1Z9HA 3MSZA 2HXKA 1M7TA 1ZL9A 2HZFA 2WS2A 1FG4A 3UVTA 1XPVA 2LUSA 1TP9A 1ERVA 1V9WA 3MYDA 1EGRA 1YVLA 4YKFA 2LNSA 3U5RE 4GLTA 1IYIA 5ECIB 1T1VA 3GL5A 6GSSA 3TKQA 2VUPA 4JRRA 1K3YA 1SK1A 3LORA 4IVFA 3VI7A 3ZVJA 1V57A 3M9JA 3IAS2 4QMKA 1XW9A 4KF9A 2HSYA 3IE3A 3HJMA 4G10A 4ZBAA 2LQQA 2P5RA 4PX1A 1DBYA 1XWBA 4NHWA 4ZIJA 2DJ0A 2VCZA 5HQPA 4V2LA 3L4NA 3IHQA 4ZBBA 3J7Yb 2R0PA 2J9HA 3WGXA 2CX4A 2YOIA 3IDVA 4GSTA 2B7KA 2HSHA 4NMUA 1PL2A 2RUFA 4DSQA 3BCIA 3QAWA 3D0ZA 1Q98A 3F63A 1GSFA 3DIEA 1A0RP 3ISOA 3Q6OA 4A5PA 3QAVA 1G0TA 1OAZA 1Y25A 2HFDA 2GQMA 2HLSA 3FZ5A 3UMAA 3VWVA 3VI5A 2LNTA 2B1KA 4ML6A 3KJYA 2L6DA 4QQ7A 2H75A 3ZZXA 4CW9A 3DKSA 3EC3A 4Q5FA 5CRDA 5J40A 2H19A 3FW2A 1THXA 2MBTA 5KN2A 4Z2TA 3GKKA 3R3EA 4N3ZA 5INYA 4V1Ap 1T4ZA 1XXUA 5D9XA 2H0HA 2H1LA 2AUVA 5F07A 5ECKB 18GSA 3KCMA 3QFBC 4XS1A 2YPMA 2VL3A 3ZRDA 1TK0B 4HOJA 1SK0A 1ML6A 2CV4A 3A2WA 3GURA 2YANA 3TJBA 2FWEA 5A34A 3VPQA 4HZ2A 1HYUA 2V1MA 1QMVA 3RHCA 1X0RA 1EZKA 3L9VA 2F9SA 1T7PB 3F9UA 2CVDA 1JZDA 1Y6EA 4O32A 1G6YA 4IBPA 5A4UA 3UIWA 4EIQA 2ZCTA 3EMPA 3BCKA 3W8SA 1TXXA 1SKSB 4K6XA 2OADA 1K0OA 4POBA 4N0VA 3TOTA 1ZMAA 2DJKA 2VCWA 3ERFA 1HNAA 4MDCA 4ZL8A 1R5PA 1FB0A 5CREA 2H0IA 1J9BA 3HDCA 1X9MB 2E0QA 1KNGA 2L5OA 1GNWA 3Q18A 3JCML 2OA7A 2QSIA 1ON4A 2GLRA 1TI1A 2HSMA 2GSQA 1GTBA 1BX9A 4OWYA 1TRSA 1Z6MA 3DVWA 3CTGA 1GSQA 1FO5A 2ON5A 3AY8A 5H5QA 3F4SA 4WKWA 2L5LA 3HJOA 4HQSA 2IFQA 3HJPA 3DXBA 1GSEA 3DD3A 16GSA 1GSDA 1Z6NA 4HDEA 2DKHA 1A8YA 3HKRA 4XS4A 1AXDA 2LRTA 3CSHA 1O8XA 4ISDA 1SJIA 2MYGA 5AN1A 1TJDA 2HRFA 3UAPA 2PWJA 3NZNA 3NIVA 1KTEA 2H6XA 5DDLA 3N5OA 4N0ZA 2HSMB 2C0EA 1PGTA 2PUKC 2YWNA 3WT1A 5ECHB 5KEJA 5ID2A 4KDUA 3FZ9A 5DALB 1WOUA 1WIKA 2H76A 3FKFA 2DMLA 3LFLA 1FVKA 1BYEA 2RIIA 2H1BA 2PN8A 7GSSA 2HYXA 5B7CA 1AW9A 1YQ1A 2IFQB 4MP4A 2HZEB 3HA9A 3DWVA 1W89A 3HZ8A 2H66A 3I9V2 2VL2C 1LJRA 5HFKA 4TXOA 3EVIA 4XS4B 1GWCA 2DJ3A 5ECPB 1TOFA 2P0GA 2Z9SA 1X5EA 4WBJA 4CHSA 2ALBA 3J7Yk 1W4VA 2OKAA 2F3MA 1ERTA 3WGDA 5G1KA 2VCQA 1MEKA 3RPPA 2VO4A 2K18A 2LTKA 5ID2B 4Z2RA 1URMA 1MTCA 4ILFA 1X9WB 3MAKA 5JWRB 1UA5A 2R5GA 4WEYA 2QKEA 2H0GA 3I43A 3QCPA 5A5HA 2EIQA 3IV4A 5COHA 2FY6A 2E7PA 4TR1A 4NHZA 1O73A 4MJBA 2DC5A 3HMJG 3M9KA 4TXOB 3TJGA 5CNWA 4O7HA 4BVXB 3EWLA 3UL3A 4ECBA 3VFIA 2NVLA 4MF7A 3A5IA 2DJ1A 1Z7PA 2TRCP 3BD2A 3A3TA 4V2MA 2OJLA 5IPGA 2C8UA 2RLIA 2I9HA 2FGXA 3UJ1A 5KOWA 4EC0A 6GSUA 4GCIA 1EV4A 1K0NA 1FHEA 1ABAA 2CAQA 4KSOA 2GZPA 5A5HB 14GSA 1TK8B 1CQGA 4ZB9A 2LKUA 1E6BA 3DEXA 4IJIA 4TR1B 1VF2A 1OYJA 1ZYNA 1AQXA 1GTUA 3KTLA 2VD1A 1GUHA 1AQVA 1WMJA 2WGRA 1I5GA 1QUWA 3FRCA 1M0UA 1FAAA 2C80A 2IMFA 1ZYQB 3M1GA 3F4TA 4YQMA 4AKXB 2A2RA 2GDRA 3GL3A 3P8WA 1XBSA 1DE1A 1QXHA 1CQHA 3G9BA 3GMFA 1B4QA 1HQOA 2C3NA 2I1UA 2OACA 4K7OA 3ZIVA 4EXJA 1ZYPA 5IMVA 1FOVA 4XS6A 1QGVA 3WYWA 5B8BA 2TRXA 4IHUA 2O85A 3ME7A 2XC2A 1HD2A 4TR3A 3HXSA 4TR4A 5C04A 1T8EB 2NBSA 2N5BA 1FW1A 5IIZA 1ERUA 2XHFA 5A5KA 2H1GA 2WDUA 2LJRA 3KEBA 3ZITA 1I9DA 5G2ZA 2O7KA 1SL0B 3RPNA 3D4TA 4WF4A 2QC7A 1GTAA 4NV2A 1VF4A 1KBNA 4ML1A 3ERGA 2FWFA 3EINA 1JHBA 4OFNA 1YZXA 2L59A 2H70A 3QPMA 1EOGA 5LCZA 3E3EA 1O7UA 3UBKA 4ZBDA 2P31A 4MJAA 4AJ7A 3IAM2 2CVKA 1K0MA 3CSIA 2UZ8A 4USSA 4DSRA 2B5EA 5AGYA 4K5RA 4RQXA 1SVMA 1H75A 4GSNA 5GZZB 1USBA 2IMIA 4CY8A 2BTOT 22GSA 1U6TA 3APSA 3RBTA 4KNDA 4TKYA 2V6OA 4X1UA 3KH7A 5J4UA 1BG5A 3PR8A 2QA2A 5CRWA 2FD3A 5HFGA 4KGIA 3BBYA 4ZB7A 1OC3A 2OE3A 3GUSA 2X4AA 2ON7A 3IBHA 3GX0A 2K8VA 5A4WA 2C4JA 5D73A 4ZL7A 2DLXA 2K6VA 2A2PA 2AHEA 2VKZG 3ZMKA 3ZL5A 2YWMA 2WULA 4HJ2A 2C0DA 2CT6A 4I97A 1TW9A 4YAVA 3ZTLA 1QQ2A 1SD8A 3H8QA 3SWLA 1OVNA 1SKWB 2KP1A 5B6NA 3GV1A 2YZHA 1A0FA 1WWJA 3DVXA 1EOHA 3IC4A 5HR0A 2L57A 3ZYWA 2A4HA 2GTUA 5L71A 1XVWA 3R2QA 1GSUA 1PQNA 4FQUA 1XVQA 3H93A 5J3RA 1ILOA 2X49A 1OKTA 4JR4A 4WXTA 1E2YA 5IO0A 3D5JA 5IO2A 4PXOA 5D93A 2UV8G 5HFIA 3LXZA 1F2EA 3UARA 2CVBA 2H71A 4ZB6A 9GSSA 2GQKA 3QMXA 6GSYA 3M8NA 1G6WA 2HI7A 4K0GA 2LSTA 2E2MA 5D9WA 4LL1B 1BF5A 2N5FA 2VCTA 4POKA 4NWYA 5DCGA 2AAWA 3QOUA 4KA0A 4NPBA 2GZZA 1T00A 4KCEA 4MZWA 2GT5A 3WD6A 1PN0A 1GLQA 2MZCA 4KE3A 4BL7A 1YKAA 2VLUA 2O5VA 1PKZA 3FK8A 1R7HA 1TTZA 4EL1A 1A8LA 3HCZA 4OMVA 3DYRA 5KN1A 1M2DA 12GSA 2DKIA 2PPTA 2LQOA 4GXZA 1VF1A 2C1YA 2K9FA 2JU5A 2J23A 4TW5A 3LJRA 5HR1A 1V40A 2PBJA 1M9AA 1SVOA 1XW6A 2GT6A 2OT3A 4N30A 1TRVA 1EP8A 4AJ6A 1GP1A 3H4KA 1AAZA 3O6TA 4TXVA 4MF5A 4EVMA 2YJHA 3BOAA 2V2GA 3F3QA 2MMOA 2OBIA 2IMEA 4G2EA 4BL7B 3LW9A 3LQ7A 2B6MA 2PGTA 4HEA2 3FHKA 1G7OA 2H6ZA 3GH6A 1WPIA 3NOFA 4JU5A 2HSNA 4F03A 5IM9A 1JLVA 1KEBA 1SYRA 5IQYA 3P7XA 2OBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X0X A;  2ZNM A;  2FCH A;  2NPB A;  4I5Q A;  2YZU A;  3GKM A;  3TDG A;  3VUR A;  4PNF A;  4MJC A;  4XHM A;  5ECO B;  3P2A A;  4IN0 A;  5B8A A;  4FO5 A;  1AIU A;  4XIH A;  3TKP A;  3EE2 A;  5ECQ B;  4FH8 A;  3QR6 A;  2EIR A;  2H73 A;  1FB6 A;  3DGQ A;  4O5R A;  3LYP A;  5H5R A;  1YKC A;  4KH7 A;  2JZT A;  4RQR A;  2GZY A;  2EC4 A;  4LA1 A;  4WET A;  3KMO A;  1K0B A;  2IIY A;  3F0I A;  2PMT A;  1SD9 A;  2HSN B;  1Z3E A;  4PQ1 A;  3D6I A;  2V41 A;  5C00 A;  3BJ5 A;  1V98 A;  3KH9 A;  5AIX A;  2X8C A;  1Z7R A;  3HY2 A;  1V58 A;  3GSS A;  3E9J B;  2H74 A;  5D96 A;  1YJ6 A;  1BAY A;  1PKW A;  5ELA A;  5ECS A;  4ECC A;  1TRW A;  2LJK A;  1SEN A;  2R2J A;  4I2U A;  2B5Y A;  1XOB A;  2X8G A;  1ZOF A;  4AGS A;  2PER A;  4N10 A;  1R4W A;  3TRP A;  5IOX A;  2H1D A;  4GSS A;  3C1S A;  2BJX A;  3KXO A;  1SL1 B;  4JED A;  1J0F A;  1PSQ A;  20GS A;  5GSS A;  4EF0 A;  1YEX A;  3VWX A;  5DBQ A;  2C0G A;  3DRN A;  2RM6 A;  1N8J A;  5DQY A;  3RHB A;  5JWQ B;  4NXI A;  1GSS A;  4WR5 A;  3QFA C;  4KAE A;  2AV4 A;  4ECJ A;  4G19 A;  2H30 A;  2GSR A;  5D9V A;  2CQ9 A;  4ZB8 A;  3GH9 A;  2PVQ A;  5DAK A;  4LLR A;  4MH2 A;  5J5N A;  2R6K A;  3CBU A;  1PX6 A;  3LYK A;  1YDK A;  4LL4 B;  2HQT A;  1EEM A;  2HRK A;  3V1W A;  2FHE A;  3S9F A;  1F37 A;  1X5D A;  3HD5 A;  2EIO A;  8GSS A;  1M99 A;  2O89 A;  5AIS A;  4YQU A;  3FYG A;  2ES7 A;  4QL9 A;  1B9Y C;  4EKZ A;  4F0B A;  5KN0 A;  1PL1 A;  4KDX A;  1QK8 A;  10GS A;  3ERW A;  3IR4 A;  4HUA A;  4WBR D;  4MCU A;  1AC1 A;  1GTI A;  2VM2 A;  1X5C A;  3ZFL A;  4EUY A;  2GST A;  3PPU A;  4MPF A;  1H4O A;  1IYH A;  4EE0 A;  2R4V A;  3GA4 A;  3IOS A;  4PTS A;  4K2D A;  2FNO A;  2XPD A;  5DAK B;  3TJJ A;  3TRQ A;  3GHA A;  3EYT A;  4TN8 A;  1RW1 A;  4IKH A;  1ACV A;  3D21 A;  1NM3 A;  3GTU A;  4L8E A;  3UBL A;  1K3L A;  2HRK B;  1JZO A;  3TUE A;  3VK9 A;  3C73 A;  5EL8 A;  1QFN A;  1XW5 A;  1XFL A;  1DE2 A;  3WT2 A;  1PA3 A;  13GS A;  2KUC A;  3CRT A;  2FWH A;  3HVX A;  1G7E A;  1MDK A;  2FLS A;  1F9M A;  2H1A A;  1MD3 A;  1TDI A;  1K0A A;  1K0C A;  3SBC A;  4GQF A;  3ZIJ A;  5G5F A;  4YH2 A;  3FEU A;  3LG6 A;  3QD9 A;  4KB3 A;  2PVO C;  4OCF A;  5DJL A;  1TU7 A;  2P5Q A;  2C0F A;  1WRY A;  4I2T A;  4IJ3 A;  3OR5 A;  5CO3 A;  3GTU B;  4EDY A;  1MD4 A;  1O8W A;  1TK5 B;  4IEL A;  2L6C A;  2F8F A;  4Q5N A;  2WFC A;  2NTO A;  4FYC A;  2R37 A;  1NHY A;  2VCV A;  4P3Y B;  2O87 A;  2HRA A;  4K8M A;  1VRS D;  4BPY A;  4PUF C;  1S3C A;  1O85 A;  1M2A A;  3TRX A;  1RQM A;  2YWI A;  1C72 A;  1XWK A;  5J9C A;  3H1N A;  1B4P A;  1PX7 A;  2MMN A;  3QAG A;  4H86 A;  2V32 A;  2CA8 A;  3UOM A;  3IXR A;  4F0C A;  1XWA A;  3D4M A;  2XBQ A;  4I6X A;  5J9B A;  3TJF A;  1ZGN A;  5FWG A;  2GVP A;  4IP1 A;  3F6D A;  1N2A A;  4PQI A;  4MH3 A;  4MMM A;  3HZ4 A;  4LMW A;  1B9X C;  3VLN A;  2A4V A;  3CSJ A;  1TRU A;  4HJM A;  2DMM A;  4KDY A;  2KOK A;  4HU7 A;  3RAZ A;  1F3A A;  3KMN A;  3C1R A;  3LWA A;  2MBS A;  4J2F A;  2B5X A;  3PIN A;  5CAX A;  1AUC A;  4MA9 A;  3TB2 A;  2KLX A;  5DQS A;  2L4C A;  4PNG A;  4J57 E;  3ZML A;  4JBB A;  1XZO A;  2IPA A;  3H79 A;  2VL9 A;  4IQA A;  4L0W A;  3A5W A;  1X9S B;  3UVH A;  4DVC A;  3PGT A;  5ECL B;  3W6G A;  1SL2 B;  2FA4 A;  3GFK A;  2RM5 A;  4G0I A;  5BMU A;  1WJK A;  4K1F A;  1ZYE A;  1XOA A;  4GWR A;  3E0U A;  4DSS A;  4BWS A;  5IOW A;  3LGC A;  1ZCP A;  3ZFB A;  4MK3 A;  2IWT A;  3KD0 A;  4X43 A;  3F3R A;  1U3I A;  1T3B A;  4NAX A;  2KHP A;  1Z5Y E;  4CDO A;  1U3A A;  2CZ2 A;  4XCS A;  4OFT A;  1M9B A;  2DIZ A;  1AQW A;  11GS A;  3TKS C;  3Q19 A;  2IJY A;  1J08 A;  1UN2 A;  2WCI A;  3KP8 A;  4PUR A;  5G5E A;  1TKD B;  2YWO A;  3APO A;  4F82 A;  3GIX A;  3KZQ A;  5DJM A;  5HR3 A;  2LEG A;  2B1L A;  4DSS B;  5JCU A;  3I69 A;  4HS1 A;  4Q5R A;  1ZZY A;  5EVO A;  2JZR A;  3CMI A;  6GSV A;  4MAB A;  4HU9 A;  4K9Z A;  1GUL A;  4BWQ A;  5E59 A;  5F06 A;  2DSA A;  2AJQ B;  4L5O A;  1B48 A;  5FHI A;  3HVS A;  3TJK A;  1VGL A;  4OD7 A;  3W8J A;  2FUG 2;  5B6M A;  4K7I A;  4K7N A;  2VAF A;  2GGT A;  1M2B A;  1UC7 A;  4YAP A;  2YV7 A;  2E2G A;  1OKD A;  2XPE A;  4MF6 A;  1S3A A;  2LV3 A;  5JCW A;  1S3D A;  3GN3 A;  4RUV A;  3IPZ A;  4XRA A;  3FR3 A;  4F2I A;  4POM A;  1R5A A;  4QL7 A;  3IK9 A;  1SK2 A;  4FYB A;  2N5A A;  1THO A;  3MNG A;  1XCC A;  5IMD A;  1YY7 A;  1SU9 A;  4V1A g;  4G0L A;  4WF5 A;  3TGZ A;  5AIV A;  2GS3 A;  2JSY A;  6GSW A;  3MWH A;  3Q74 A;  3O76 A;  3EUR A;  3RDW A;  4BVY A;  2CAI A;  3GRX A;  4L5L A;  4IGJ A;  5ELG A;  4KCA A;  2M80 A;  2JSZ A;  4IP6 A;  1JLW A;  4TRX A;  1SKR B;  2HRN A;  3L78 A;  1V2A A;  3FR6 A;  4OO5 A;  2VL2 A;  4XTS A;  1FVJ A;  1RK4 A;  2XBI A;  1OE7 A;  1EP7 A;  4OFM A;  5IMA A;  3HYP A;  1ERW A;  3ZRE A;  4K0N A;  4MPG A;  1O6J A;  1ST9 A;  1XWG A;  5G1L A;  4KW6 A;  4E8H A;  4PQH A;  2DIY A;  4LMV A;  2WJU A;  3ME8 A;  1B8X A;  4ECI A;  4BVY B;  1GUM A;  1OC8 A;  4RI7 A;  2WB9 A;  1PRX A;  3PH9 A;  3APQ A;  5EY6 A;  3IRA A;  5CRH A;  4TVE A;  1R26 A;  2VLV A;  4GRF A;  1A24 A;  4GQC A;  4XRD A;  2NDO A;  2YJ7 A;  2JAD A;  2HE3 A;  4JR6 A;  1K0D A;  3FR9 A;  5ECM B;  5LD0 A;  3VWU A;  5IMC A;  2YN1 A;  3FY7 A;  19GS A;  1PMT A;  5DAL A;  2VOC A;  1F3B A;  3KP9 A;  1TU8 A;  3KIJ A;  2TIR A;  4ZXG A;  2VM1 A;  1BED A;  4KX4 A;  1SYX A;  2IMD A;  3L9U A;  5GAP D;  4WR4 A;  4G0K A;  2I3Y A;  4EDZ A;  2HZE A;  2YNX A;  4POL A;  4Q5Q A;  1YEP A;  1A2J A;  5IMF A;  2F51 A;  2VIM A;  4OO4 A;  4KUN A;  4J56 E;  4KSM A;  2RUE A;  1U88 A;  1EWX A;  3ZLP A;  1YF1 A;  2VLT A;  4ZIL A;  1DUG A;  1HNC A;  3M3M A;  2YCD A;  2H01 A;  2PU9 C;  3CTF A;  3WGE A;  1F6M C;  1DSB A;  1T4Y A;  5IMZ A;  4NV5 A;  2M72 A;  3LXT A;  1U87 A;  2K8S A;  2C3Q A;  2AYT A;  2H6Y A;  3KTB A;  3G7Y A;  5H5S A;  2X64 A;  1OE8 A;  1MDJ A;  6GST A;  1WP0 A;  1GL8 A;  3O3T A;  3IC8 A;  2ZUP A;  2V6K A;  3F8U A;  2MMA A;  1WE0 A;  3GKX A;  2MMZ A;  4JE1 A;  2HT9 A;  4PGT A;  2FA8 A;  1SJ6 A;  2JAC A;  4BVX A;  4MZB A;  3ZVJ D;  3VWW A;  5FT3 A;  4G9H A;  4IW9 A;  3DML A;  5HR2 A;  1NSW A;  3HVV A;  3IK7 A;  2YP6 A;  1XWC A;  2FWG A;  1LBK A;  3ED3 A;  1A2L A;  3C8E A;  2L4Q A;  4PUA A;  3G7J A;  2CX3 A;  1GLP A;  5DVB A;  3C71 A;  3N9J A;  1LU4 A;  3EU4 A;  4L0U A;  4ID0 A;  2LJA A;  5G31 A;  4V2N A;  4EO3 A;  5DCH A;  2LRN A;  4HQZ A;  1GNE A;  3GKN A;  5CYY A;  5EPF A;  2X99 A;  5CRG A;  4MLY A;  3U6V A;  5JCG A;  3IA1 A;  5GST A;  2JZS A;  2B3S A;  1Q4J A;  2AB6 A;  2I81 A;  5ECR B;  1JFU A;  2VCX A;  5JWO B;  3MDK A;  2I4A A;  3F4R A;  2O8V B;  5E4W A;  3FZ4 A;  2H72 A;  2QGV A;  1TI3 A;  3QDN A;  2LRC A;  3D22 A;  3UEM A;  3FZA A;  2R3X A;  1A23 A;  1VF3 A;  1EEJ A;  5F0G A;  1GUK A;  1JZR A;  2CZ3 A;  4N11 A;  3TCO A;  1YF0 A;  2BMX A;  4GF0 A;  17GS A;  3TOU A;  3GYK A;  3VPT A;  4HI7 A;  1A2M A;  3L9S A;  2GSS A;  1OC9 A;  4MJE A;  4FIW A;  2H8L A;  4YQV A;  2B7J A;  4JZQ A;  2GQL A;  1PD2 1;  3CXG A;  4AJ8 A;  3P90 A;  3C7M A;  1K3O A;  3HHV A;  2C3T A;  2OE0 A;  3L0H A;  3LEF A;  2A2S A;  5ECN B;  3GX8 A;  3CRU A;  4D73 A;  2G2Q A;  4HZ4 A;  2G0F A;  3GNJ A;  4I8B A;  1MDI A;  3CYN A;  4ZL9 A;  4BA7 A;  5ABR A;  1GH2 A;  3EMX A;  5J41 A;  1OC9 B;  2LS5 A;  5F8B A;  4TR0 A;  4MZC A;  4FYU A;  1PN9 A;  5CP1 A;  3F6F A;  1UVZ A;  4DEJ A;  2KP2 A;  2OE1 A;  2WZ9 A;  5KN3 A;  5D8I A;  5A4V A;  3GST A;  3KGK A;  2JL4 A;  3TKS A;  3LSZ A;  1SJZ A;  5D9T A;  4GTU A;  5F05 A;  3EU3 A;  4Z7X A;  3TKR A;  4D73 B;  3K8N A;  4F9Z A;  2YV9 A;  3M0F A;  2M46 A;  2DBC A;  2HNL A;  2WRT A;  1XIY A;  4AF2 A;  4IQ1 A;  2DJ2 A;  1HNB A;  2IN3 A;  3TKS E;  3A2X A;  4ULX A;  5G30 A;  2VD0 A;  1NW2 A;  3KM6 A;  4OCE A;  4TOP A;  2D2Z A;  3US3 A;  1BQ7 A;  2F8A A;  2REM A;  5GAN D;  3G7I A;  6GSX A;  1BJX A;  2X8H A;  1EGO A;  4ACS A;  1JZW A;  5ENU A;  5LNK e;  2IMK A;  4O92 A;  4RI6 A;  1NHO A;  1GRX A;  1GSY A;  3I6A A;  4IS0 A;  5IPH A;  4E8E A;  1EV9 A;  1O81 A;  3A2V A;  2IL3 A;  2DJJ A;  1Z9H A;  3MSZ A;  2HXK A;  1M7T A;  1ZL9 A;  2HZF A;  2WS2 A;  1FG4 A;  3UVT A;  1XPV A;  2LUS A;  1TP9 A;  1ERV A;  1V9W A;  1EGR A;  2LNS A;  3U5R E;  4GLT A;  1IYI A;  5ECI B;  1T1V A;  3GL5 A;  6GSS A;  3TKQ A;  2VUP A;  4JRR A;  1K3Y A;  1SK1 A;  3LOR A;  4IVF A;  3VI7 A;  3ZVJ A;  1V57 A;  3M9J A;  3IAS 2;  1XW9 A;  4KF9 A;  2HSY A;  3IE3 A;  3HJM A;  4G10 A;  4ZBA A;  2LQQ A;  2P5R A;  4PX1 A;  1DBY A;  1XWB A;  4NHW A;  4ZIJ A;  2DJ0 A;  2VCZ A;  5HQP A;  4V2L A;  3L4N A;  3IHQ A;  4ZBB A;  3J7Y b;  2J9H A;  3WGX A;  2CX4 A;  2YOI A;  3IDV A;  4GST A;  2B7K A;  2HSH A;  4NMU A;  1PL2 A;  2RUF A;  4DSQ A;  3BCI A;  3QAW A;  3D0Z A;  1Q98 A;  3F63 A;  1GSF A;  3DIE A;  1A0R P;  3ISO A;  3Q6O A;  3QAV A;  1G0T A;  1OAZ A;  1Y25 A;  2HFD A;  2GQM A;  2HLS A;  3FZ5 A;  3UMA A;  3VWV A;  3VI5 A;  2LNT A;  2B1K A;  4ML6 A;  3KJY A;  2L6D A;  4QQ7 A;  2H75 A;  3ZZX A;  4CW9 A;  3DKS A;  3EC3 A;  4Q5F A;  5CRD A;  2H19 A;  3FW2 A;  1THX A;  2MBT A;  5KN2 A;  3GKK A;  3R3E A;  5INY A;  4V1A p;  1T4Z A;  1XXU A;  5D9X A;  2H0H A;  2AUV A;  5F07 A;  5ECK B;  18GS A;  3KCM A;  3QFB C;  4XS1 A;  2YPM A;  2VL3 A;  3ZRD A;  1TK0 B;  4HOJ A;  1SK0 A;  1ML6 A;  2CV4 A;  3A2W A;  3GUR A;  2YAN A;  3TJB A;  2FWE A;  3VPQ A;  4HZ2 A;  1HYU A;  2V1M A;  1QMV A;  3RHC A;  1X0R A;  1EZK A;  3L9V A;  2F9S A;  1T7P B;  3F9U A;  2CVD A;  1JZD A;  1Y6E A;  4O32 A;  1G6Y A;  4IBP A;  5A4U A;  3UIW A;  2ZCT A;  3EMP A;  3BCK A;  3W8S A;  1TXX A;  1SKS B;  4K6X A;  2OAD A;  1K0O A;  4POB A;  4N0V A;  3TOT A;  1ZMA A;  2DJK A;  2VCW A;  3ERF A;  1HNA A;  4MDC A;  4ZL8 A;  1R5P A;  1FB0 A;  5CRE A;  2H0I A;  1J9B A;  3HDC A;  1X9M B;  2E0Q A;  1KNG A;  2L5O A;  1GNW A;  3Q18 A;  3JCM L;  2OA7 A;  2QSI A;  1ON4 A;  2GLR A;  1TI1 A;  2HSM A;  2GSQ A;  1GTB A;  1BX9 A;  4OWY A;  1TRS A;  1Z6M A;  3DVW A;  3CTG A;  1GSQ A;  1FO5 A;  2ON5 A;  3AY8 A;  5H5Q A;  3F4S A;  4WKW A;  2L5L A;  3HJO A;  4HQS A;  2IFQ A;  3HJP A;  3DXB A;  1GSE A;  3DD3 A;  16GS A;  1GSD A;  1Z6N A;  4HDE A;  1A8Y A;  3HKR A;  4XS4 A;  1AXD A;  2LRT A;  3CSH A;  1O8X A;  4ISD A;  1SJI A;  2MYG A;  5AN1 A;  1TJD A;  2HRF A;  3UAP A;  2PWJ A;  3NZN A;  3NIV A;  1KTE A;  2H6X A;  5DDL A;  3N5O A;  4N0Z A;  2HSM B;  2C0E A;  1PGT A;  2PUK C;  2YWN A;  3WT1 A;  5ECH B;  5KEJ A;  5ID2 A;  4KDU A;  3FZ9 A;  5DAL B;  1WOU A;  1WIK A;  2H76 A;  3FKF A;  2DML A;  3LFL A;  1FVK A;  1BYE A;  2RII A;  2H1B A;  2PN8 A;  7GSS A;  2HYX A;  5B7C A;  1AW9 A;  1YQ1 A;  2IFQ B;  4MP4 A;  2HZE B;  3HA9 A;  3DWV A;  1W89 A;  3HZ8 A;  2H66 A;  3I9V 2;  2VL2 C;  1LJR A;  5HFK A;  4TXO A;  3EVI A;  4XS4 B;  1GWC A;  2DJ3 A;  5ECP B;  1TOF A;  2P0G A;  2Z9S A;  1X5E A;  4WBJ A;  4CHS A;  2ALB A;  3J7Y k;  1W4V A;  2OKA A;  2F3M A;  1ERT A;  3WGD A;  5G1K A;  2VCQ A;  1MEK A;  3RPP A;  2VO4 A;  2K18 A;  2LTK A;  5ID2 B;  1URM A;  1MTC A;  4ILF A;  1X9W B;  3MAK A;  5JWR B;  1UA5 A;  2R5G A;  4WEY A;  2QKE A;  2H0G A;  3I43 A;  3QCP A;  2EIQ A;  3IV4 A;  5COH A;  2FY6 A;  2E7P A;  4TR1 A;  4NHZ A;  1O73 A;  4MJB A;  2DC5 A;  3M9K A;  4TXO B;  3TJG A;  5CNW A;  4O7H A;  4BVX B;  3EWL A;  3UL3 A;  4ECB A;  3VFI A;  2NVL A;  4MF7 A;  2DJ1 A;  1Z7P A;  2TRC P;  3BD2 A;  3A3T A;  4V2M A;  2OJL A;  5IPG A;  2C8U A;  2RLI A;  2I9H A;  2FGX A;  3UJ1 A;  4EC0 A;  6GSU A;  4GCI A;  1EV4 A;  1K0N A;  1FHE A;  1ABA A;  2CAQ A;  4KSO A;  2GZP A;  14GS A;  1TK8 B;  1CQG A;  4ZB9 A;  2LKU A;  1E6B A;  3DEX A;  4IJI A;  4TR1 B;  1VF2 A;  1OYJ A;  1AQX A;  1GTU A;  3KTL A;  2VD1 A;  1GUH A;  1AQV A;  1WMJ A;  2WGR A;  1I5G A;  1QUW A;  3FRC A;  1M0U A;  1FAA A;  2C80 A;  2IMF A;  1ZYQ B;  3M1G A;  3F4T A;  4YQM A;  2A2R A;  2GDR A;  3GL3 A;  3P8W A;  1XBS A;  1DE1 A;  1QXH A;  1CQH A;  3G9B A;  3GMF A;  1B4Q A;  1HQO A;  2C3N A;  2I1U A;  2OAC A;  4K7O A;  3ZIV A;  4EXJ A;  5IMV A;  1FOV A;  4XS6 A;  1QGV A;  3WYW A;  5B8B A;  2TRX A;  4IHU A;  2O85 A;  3ME7 A;  2XC2 A;  1HD2 A;  4TR3 A;  3HXS A;  4TR4 A;  5C04 A;  1T8E B;  2NBS A;  2N5B A;  1FW1 A;  5IIZ A;  1ERU A;  2XHF A;  5A5K A;  2H1G A;  2WDU A;  2LJR A;  3KEB A;  3ZIT A;  1I9D A;  5G2Z A;  2O7K A;  1SL0 B;  3RPN A;  3D4T A;  4WF4 A;  2QC7 A;  1GTA A;  4NV2 A;  1VF4 A;  1KBN A;  4ML1 A;  3ERG A;  2FWF A;  3EIN A;  1JHB A;  4OFN A;  1YZX A;  2L59 A;  2H70 A;  3QPM A;  1EOG A;  5LCZ A;  3E3E A;  1O7U A;  3UBK A;  4ZBD A;  2P31 A;  4MJA A;  4AJ7 A;  3IAM 2;  2CVK A;  1K0M A;  3CSI A;  2UZ8 A;  4USS A;  4DSR A;  2B5E A;  5AGY A;  4RQX A;  1H75 A;  4GSN A;  5GZZ B;  1USB A;  2IMI A;  2BTO T;  22GS A;  1U6T A;  3APS A;  3RBT A;  4KND A;  4TKY A;  2V6O A;  4X1U A;  3KH7 A;  5J4U A;  1BG5 A;  3PR8 A;  5CRW A;  2FD3 A;  5HFG A;  4KGI A;  3BBY A;  1OC3 A;  2OE3 A;  3GUS A;  2ON7 A;  3IBH A;  3GX0 A;  2K8V A;  5A4W A;  2C4J A;  5D73 A;  4ZL7 A;  2DLX A;  2K6V A;  2AHE A;  3ZMK A;  3ZL5 A;  2YWM A;  2WUL A;  4HJ2 A;  2C0D A;  2CT6 A;  4I97 A;  1TW9 A;  4YAV A;  3ZTL A;  1QQ2 A;  1SD8 A;  3H8Q A;  3SWL A;  1OVN A;  1SKW B;  2KP1 A;  5B6N A;  3GV1 A;  2YZH A;  1A0F A;  1WWJ A;  3DVX A;  1EOH A;  3IC4 A;  5HR0 A;  2L57 A;  3ZYW A;  2GTU A;  5L71 A;  1XVW A;  3R2Q A;  1GSU A;  1PQN A;  4FQU A;  1XVQ A;  3H93 A;  5J3R A;  1ILO A;  1OKT A;  4JR4 A;  4WXT A;  1E2Y A;  5IO0 A;  3D5J A;  5IO2 A;  4PXO A;  5D93 A;  5HFI A;  3LXZ A;  1F2E A;  3UAR A;  2CVB A;  2H71 A;  4ZB6 A;  9GSS A;  2GQK A;  3QMX A;  6GSY A;  3M8N A;  1G6W A;  2HI7 A;  4K0G A;  2LST A;  2E2M A;  5D9W A;  4LL1 B;  2N5F A;  2VCT A;  4POK A;  4NWY A;  5DCG A;  2AAW A;  3QOU A;  4KA0 A;  4NPB A;  2GZZ A;  1T00 A;  4KCE A;  4MZW A;  2GT5 A;  3WD6 A;  1GLQ A;  2MZC A;  4KE3 A;  4BL7 A;  1YKA A;  2VLU A;  1PKZ A;  3FK8 A;  1R7H A;  1TTZ A;  4EL1 A;  1A8L A;  3HCZ A;  4OMV A;  3DYR A;  5KN1 A;  1M2D A;  12GS A;  2PPT A;  2LQO A;  4GXZ A;  1VF1 A;  2C1Y A;  2K9F A;  2JU5 A;  2J23 A;  4TW5 A;  3LJR A;  5HR1 A;  1V40 A;  2PBJ A;  1M9A A;  1XW6 A;  2GT6 A;  4N30 A;  1TRV A;  1EP8 A;  4AJ6 A;  1GP1 A;  3H4K A;  1AAZ A;  3O6T A;  4TXV A;  4MF5 A;  4EVM A;  2YJH A;  3BOA A;  2V2G A;  3F3Q A;  2MMO A;  2OBI A;  2IME A;  4G2E A;  4BL7 B;  3LQ7 A;  2B6M A;  2PGT A;  4HEA 2;  3FHK A;  1G7O A;  2H6Z A;  3GH6 A;  1WPI A;  3NOF A;  4JU5 A;  4F03 A;  5IM9 A;  1JLV A;  1KEB A;  1SYR A;  5IQY A;  3P7X A;  2OBK A; 
#chains in the Genus database with same CATH topology
 4X0X A;  2ZNM A;  4HSC X;  5A34 B;  2FCH A;  2NPB A;  4I5Q A;  2YZU A;  3GKM A;  3TDG A;  3VUR A;  4PNF A;  4MJC A;  4XHM A;  5ECO B;  3P2A A;  4IN0 A;  5B8A A;  4FO5 A;  1AIU A;  4XIH A;  3TKP A;  3EE2 A;  5ECQ B;  4FH8 A;  3QR6 A;  2EIR A;  2H73 A;  1FB6 A;  3DGQ A;  4O5R A;  3LYP A;  5H5R A;  1YKC A;  4KH7 A;  3RFR C;  2JZT A;  4RQR A;  2GZY A;  2EC4 A;  4LA1 A;  4WET A;  3KMO A;  1K0B A;  2IIY A;  1I1I P;  2PMT A;  1SD9 A;  3F0I A;  2HSN B;  1Z3E A;  4AKG A;  4PQ1 A;  3D6I A;  2V41 A;  5C00 A;  3BJ5 A;  1V98 A;  3KH9 A;  5AIX A;  2X8C A;  1Z7R A;  3HY2 A;  1V58 A;  3GSS A;  3E9J B;  2H74 A;  5D96 A;  1YJ6 A;  1BAY A;  1PKW A;  5ELA A;  5ECS A;  4ECC A;  5J4V A;  1TRW A;  2LJK A;  1SEN A;  2R2J A;  4I2U A;  2B5Y A;  4K2X A;  1XOB A;  2X8G A;  1ZOF A;  4AGS A;  2PER A;  4N10 A;  1R4W A;  3TRP A;  5IOX A;  2H1D A;  4GSS A;  3C1S A;  2BJX A;  3KXO A;  1SL1 B;  4JED A;  1J0F A;  1PSQ A;  20GS A;  5GSS A;  4EF0 A;  5BRT A;  1YEX A;  3VWX A;  5DBQ A;  2C0G A;  3DRN A;  2RM6 A;  1N8J A;  5DQY A;  3RHB A;  5JWQ B;  4NXI A;  1GSS A;  4WR5 A;  3QFA C;  4KAE A;  2AV4 A;  4ECJ A;  4G19 A;  2QA1 A;  2H30 A;  2GSR A;  5D9V A;  2CQ9 A;  4ZB8 A;  3GH9 A;  2PVQ A;  5DAK A;  4LLR A;  4MH2 A;  5J5N A;  2R6K A;  3CBU A;  3CQF A;  1PX6 A;  3LYK A;  1YDK A;  4LL4 B;  2HQT A;  1EEM A;  4W66 A;  2HRK A;  3V1W A;  2FHE A;  3S9F A;  1F37 A;  1X5D A;  3HD5 A;  2EIO A;  8GSS A;  1M99 A;  2O89 A;  5AIS A;  4K5S A;  4YQU A;  3FYG A;  2ES7 A;  4QL9 A;  1B9Y C;  4EKZ A;  4F0B A;  5KN0 A;  1PL1 A;  4KDX A;  1QK8 A;  10GS A;  3ERW A;  3IR4 A;  4HUA A;  4WBR D;  4MCU A;  1AC1 A;  1GTI A;  2VM2 A;  1X5C A;  3ZFL A;  4Z2U A;  5J47 A;  4X4J A;  4EUY A;  2GST A;  3PPU A;  4MPF A;  1H4O A;  1IYH A;  4EE0 A;  2R4V A;  3GA4 A;  3IOS A;  4PTS A;  4K2D A;  2FNO A;  2XPD A;  5DAK B;  3TJJ A;  3TRQ A;  3GHA A;  3EYT A;  4TN8 A;  1RW1 A;  4IKH A;  1ACV A;  3D21 A;  1NM3 A;  3GTU A;  4L8E A;  2R0C A;  4E68 A;  3UBL A;  1K3L A;  2HRK B;  1JZO A;  3TUE A;  3VK9 A;  3C73 A;  5EL8 A;  1QFN A;  1XW5 A;  1XFL A;  1DE2 A;  3WT2 A;  1PA3 A;  13GS A;  2KUC A;  3CRT A;  2FWH A;  3HVX A;  1G7E A;  1MDK A;  2FLS A;  1F9M A;  2H1A A;  1MD3 A;  1TDI A;  1K0A A;  1K0C A;  3SBC A;  4GQF A;  3ZIJ A;  5G5F A;  4YH2 A;  3FEU A;  5A1N A;  3LG6 A;  3QD9 A;  4KB3 A;  2PVO C;  4OCF A;  5DJL A;  1TU7 A;  2P5Q A;  2C0F A;  1WRY A;  4I2T A;  4IJ3 A;  3OR5 A;  5CO3 A;  3GTU B;  4EDY A;  1MD4 A;  1O8W A;  1TK5 B;  2WW0 A;  4IEL A;  2L6C A;  2F8F A;  4G01 A;  4Q5N A;  2WFC A;  2NTO A;  4FYC A;  2R37 A;  1NHY A;  2VCV A;  4P3Y B;  2O87 A;  2HRA A;  4K8M A;  1VRS D;  4BPY A;  4PUF C;  1S3C A;  1O85 A;  1M2A A;  3TRX A;  1RQM A;  2YWI A;  1C72 A;  1XWK A;  5J9C A;  3H1N A;  1B4P A;  1PX7 A;  2MMN A;  3QAG A;  4H86 A;  5A1N B;  2V32 A;  2CA8 A;  3UOM A;  3IXR A;  4GDF A;  4F0C A;  1XWA A;  3D4M A;  2XBQ A;  4I6X A;  5J9B A;  3TJF A;  1ZGN A;  5FWG A;  2GVP A;  4IP1 A;  3F6D A;  3EPT A;  1N2A A;  4PQI A;  4MH3 A;  4MMM A;  3HZ4 A;  4LMW A;  1B9X C;  3VLN A;  2A4V A;  3CSJ A;  1TRU A;  4HJM A;  2DMM A;  4KDY A;  2KOK A;  4HU7 A;  3RAZ A;  3RGB C;  1F3A A;  3KMN A;  3C1R A;  3LWA A;  2MBS A;  4J2F A;  2B5X A;  1TXU A;  3PIN A;  4AI6 A;  5CAX A;  1AUC A;  4MA9 A;  3TB2 A;  2KLX A;  5DQS A;  2L4C A;  4PNG A;  4J57 E;  3ZML A;  4JBB A;  1XZO A;  2IPA A;  3H79 A;  2VL9 A;  4IQA A;  4L0W A;  3A5W A;  1X9S B;  3UVH A;  4DVC A;  3PGT A;  5ECL B;  3W6G A;  1SL2 B;  2FA4 A;  3GFK A;  2RM5 A;  4G0I A;  5BMU A;  1WJK A;  4K1F A;  1ZYE A;  1XOA A;  4GWR A;  3E0U A;  4DSS A;  4BWS A;  5IOW A;  3LGC A;  1ZCP A;  4MNN A;  3ZFB A;  4MK3 A;  2IWT A;  3KD0 A;  4X43 A;  3F3R A;  1U3I A;  1T3B A;  4NAX A;  2KHP A;  1Z5Y E;  4CDO A;  1U3A A;  2CZ2 A;  1FOH A;  4XCS A;  4OFT A;  1M9B A;  2DIZ A;  1AQW A;  11GS A;  3TKS C;  3Q19 A;  2IJY A;  1J08 A;  1UN2 A;  2WCI A;  3KP8 A;  4PUR A;  5G5E A;  1TKD B;  2YWO A;  3APO A;  4F82 A;  3GIX A;  3KZQ A;  5DJM A;  4CY6 A;  5BMU B;  5HR3 A;  2LEG A;  2B1L A;  4DSS B;  5JCU A;  3I69 A;  4HS1 A;  4Q5R A;  1ZZY A;  5EVO A;  2JZR A;  3CMI A;  6GSV A;  4MAB A;  4HU9 A;  4K9Z A;  1GUL A;  4BWQ A;  5E59 A;  5F06 A;  2DSA A;  2AJQ B;  4L5O A;  1B48 A;  5FHI A;  3HVS A;  3TJK A;  1VGL A;  4OD7 A;  3W8J A;  2FUG 2;  5B6M A;  4K7I A;  4K7N A;  2VAF A;  2GGT A;  1M2B A;  1UC7 A;  4YAP A;  2YV7 A;  2E2G A;  1OKD A;  2XPE A;  4MF6 A;  1S3A A;  2LV3 A;  5JCW A;  1S3D A;  1XG8 A;  3GN3 A;  4RUV A;  3IPZ A;  4XRA A;  3FR3 A;  4F2I A;  4POM A;  1R5A A;  4BIK A;  4QL7 A;  3IK9 A;  1SK2 A;  4FYB A;  2N5A A;  1Y1U A;  1THO A;  3MNG A;  1XCC A;  5IMD A;  1YY7 A;  1SU9 A;  4V1A g;  4G0L A;  4WF5 A;  3TGZ A;  5AIV A;  4FXY P;  4PHZ C;  2GS3 A;  2JSY A;  6GSW A;  3MWH A;  3Q74 A;  3O76 A;  3EUR A;  3RDW A;  4BVY A;  2WVX B;  2CAI A;  3GRX A;  4L5L A;  4IGJ A;  5ELG A;  4KCA A;  2M80 A;  2JSZ A;  4IP6 A;  1JLW A;  4TRX A;  1SKR B;  2HRN A;  3L78 A;  2EFC A;  1V2A A;  3FR6 A;  1BG1 A;  4OO5 A;  2VL2 A;  4XTS A;  1FVJ A;  1RK4 A;  2XBI A;  1OE7 A;  1EP7 A;  4OFM A;  5IMA A;  3HYP A;  1ERW A;  3ZRE A;  3CWG A;  4K0N A;  4MPG A;  1O6J A;  1ST9 A;  1XWG A;  5G1L A;  4KW6 A;  4E8H A;  4PQH A;  2DIY A;  4LMV A;  2WJU A;  3ME8 A;  1B8X A;  4ECI A;  4BVY B;  1GUM A;  1OC8 A;  4RI7 A;  2WB9 A;  1PRX A;  3PH9 A;  3APQ A;  5EY6 A;  3IRA A;  5CRH A;  4TVE A;  1R26 A;  2VLV A;  2WVZ A;  4GRF A;  1A24 A;  4GQC A;  4XRD A;  2NDO A;  2YJ7 A;  2JAD A;  2HE3 A;  4JR6 A;  1K0D A;  3FR9 A;  5ECM B;  5LD0 A;  3VWU A;  5IMC A;  3MIX A;  2YN1 A;  3FY7 A;  19GS A;  4ICY A;  1PMT A;  5DAL A;  2VOC A;  1F3B A;  1TU8 A;  3KP9 A;  3KIJ A;  2TIR A;  4ZXG A;  2VM1 A;  4O5Q A;  1S3R A;  1BED A;  4KX4 A;  1SYX A;  2IMD A;  3L9U A;  5GAP D;  4WR4 A;  4G0K A;  2I3Y A;  2WW1 A;  4EDZ A;  2HZE A;  2YNX A;  4YKG A;  4POL A;  4Q5Q A;  1YEP A;  1A2J A;  5IMF A;  2F51 A;  2VIM A;  4OO4 A;  4KUN A;  4J56 E;  4KSM A;  2RUE A;  1U88 A;  1EWX A;  5J4Y A;  3ZLP A;  2WW2 A;  1YF1 A;  2VLT A;  4ZIL A;  3FMW A;  1DUG A;  1HNC A;  3M3M A;  2YCD A;  2H01 A;  2PU9 C;  3CTF A;  3WGE A;  1F6M C;  1DSB A;  1T4Y A;  5IMZ A;  4NV5 A;  2M72 A;  3LXT A;  1U87 A;  2K8S A;  4O5U A;  2C3Q A;  2AYT A;  2H6Y A;  3KTB A;  3G7Y A;  5H5S A;  2X64 A;  1OE8 A;  1MDJ A;  6GST A;  1WP0 A;  1GL8 A;  3O3T A;  3IC8 A;  2ZUP A;  3IHG A;  2V6K A;  3F8U A;  2MMA A;  1WE0 A;  3GKX A;  2MMZ A;  4JE1 A;  2HT9 A;  4PGT A;  2FA8 A;  1SJ6 A;  2JAC A;  4BVX A;  4MZB A;  4AKH A;  3ZVJ D;  3VWW A;  5FT3 A;  4G9H A;  4IW9 A;  3DML A;  5HR2 A;  1NSW A;  3HVV A;  3IK7 A;  2YP6 A;  1XWC A;  2FWG A;  1LBK A;  3ED3 A;  1A2L A;  3C8E A;  2L4Q A;  4PUA A;  3G7J A;  2CX3 A;  1GLP A;  5DVB A;  3C71 A;  3N9J A;  1LU4 A;  2R0G A;  3EU4 A;  4L0U A;  4ID0 A;  2LJA A;  5G31 A;  4V2N A;  4EO3 A;  5DCH A;  2LRN A;  4HQZ A;  1GNE A;  3GKN A;  5CYY A;  5EPF A;  2X99 A;  5CRG A;  4MLY A;  3U6V A;  5JCG A;  3HVN A;  3IA1 A;  5GST A;  2JZS A;  2B3S A;  1Q4J A;  2EFH A;  2AB6 A;  2I81 A;  5ECR B;  1JFU A;  2VCX A;  5JWO B;  3MDK A;  2I4A A;  3F4R A;  2O8V B;  5E4W A;  3FZ4 A;  2H72 A;  2QGV A;  1TI3 A;  3QDN A;  2LRC A;  3D22 A;  3UEM A;  3FZA A;  2R3X A;  1A23 A;  1VF3 A;  1EEJ A;  5F0G A;  1GUK A;  1JZR A;  2CZ3 A;  4N11 A;  3TCO A;  1YF0 A;  2BMX A;  4GF0 A;  17GS A;  3TOU A;  3GYK A;  3VPT A;  2WVY A;  4HI7 A;  1A2M A;  3L9S A;  2GSS A;  1OC9 A;  4MJE A;  4FIW A;  2H8L A;  4YQV A;  2B7J A;  4JZQ A;  2GQL A;  1PD2 1;  3CXG A;  4AJ8 A;  3P90 A;  3C7M A;  1K3O A;  3HHV A;  2C3T A;  2OE0 A;  3L0H A;  3LEF A;  2A2S A;  5ECN B;  3GX8 A;  3CRU A;  4D73 A;  2G2Q A;  4HZ4 A;  2G0F A;  3GNJ A;  4I8B A;  3TU3 B;  1MDI A;  3CYN A;  4ZL9 A;  4BA7 A;  5ABR A;  1GH2 A;  3EMX A;  5J41 A;  1OC9 B;  2LS5 A;  5F8B A;  4TR0 A;  4AKI A;  4MZC A;  4FYU A;  1PN9 A;  5CP1 A;  3F6F A;  1UVZ A;  4DEJ A;  2KP2 A;  2OE1 A;  2WZ9 A;  5KN3 A;  5D8I A;  5A4V A;  3GST A;  2EFE A;  3KGK A;  2JL4 A;  3TKS A;  3LSZ A;  1SJZ A;  5D9T A;  4GTU A;  5F05 A;  3EU3 A;  4Z7X A;  3TKR A;  4D73 B;  1M3J A;  3K8N A;  4F9Z A;  2YV9 A;  3M0F A;  2M46 A;  5KOX A;  2DBC A;  2HNL A;  2WRT A;  1SVL A;  1XIY A;  4AF2 A;  4IQ1 A;  2DJ2 A;  1HNB A;  2IN3 A;  3TKS E;  3A2X A;  4ULX A;  5G30 A;  2VD0 A;  1NW2 A;  3KM6 A;  4OCE A;  4TOP A;  2D2Z A;  3US3 A;  1BQ7 A;  2F8A A;  2REM A;  5GAN D;  3G7I A;  4EIP A;  6GSX A;  1BJX A;  2X8H A;  1EGO A;  4ACS A;  1JZW A;  5ENU A;  5LNK e;  2IMK A;  4O92 A;  4RI6 A;  1M3I A;  1NHO A;  2EFD A;  1GRX A;  1GSY A;  3I6A A;  4IS0 A;  5IPH A;  4E8E A;  1EV9 A;  1O81 A;  1N25 A;  3A2V A;  2IL3 A;  2DJJ A;  1Z9H A;  3MSZ A;  2HXK A;  1M7T A;  1ZL9 A;  2HZF A;  2WS2 A;  1FG4 A;  3UVT A;  1XPV A;  2LUS A;  2WZS A;  1TP9 A;  1ERV A;  1V9W A;  3MYD A;  1EGR A;  1YVL A;  4YKF A;  2LNS A;  3U5R E;  4GLT A;  1IYI A;  5ECI B;  1T1V A;  3GL5 A;  6GSS A;  3TKQ A;  2VUP A;  4JRR A;  1K3Y A;  1SK1 A;  3LOR A;  4IVF A;  3VI7 A;  3ZVJ A;  1V57 A;  3M9J A;  3IAS 2;  4QMK A;  1XW9 A;  4KF9 A;  2HSY A;  3IE3 A;  3HJM A;  4G10 A;  4ZBA A;  2LQQ A;  2P5R A;  4PX1 A;  1DBY A;  1XWB A;  4NHW A;  4ZIJ A;  2DJ0 A;  2VCZ A;  5HQP A;  4V2L A;  3L4N A;  3IHQ A;  4ZBB A;  3J7Y b;  2R0P A;  2J9H A;  3WGX A;  2CX4 A;  2YOI A;  3IDV A;  4GST A;  2B7K A;  2HSH A;  4NMU A;  1PL2 A;  2RUF A;  4DSQ A;  3BCI A;  3QAW A;  3D0Z A;  1Q98 A;  3F63 A;  1GSF A;  3DIE A;  1A0R P;  3ISO A;  3Q6O A;  4A5P A;  3QAV A;  1G0T A;  1OAZ A;  1Y25 A;  2HFD A;  2GQM A;  2HLS A;  3FZ5 A;  3UMA A;  3VWV A;  3VI5 A;  2LNT A;  2B1K A;  4ML6 A;  3KJY A;  2L6D A;  4QQ7 A;  2H75 A;  3ZZX A;  4CW9 A;  3DKS A;  3EC3 A;  4Q5F A;  5CRD A;  5J40 A;  2H19 A;  3FW2 A;  1THX A;  2MBT A;  5KN2 A;  4Z2T A;  3GKK A;  3R3E A;  4N3Z A;  5INY A;  4V1A p;  1T4Z A;  1XXU A;  5D9X A;  2H0H A;  2H1L A;  2AUV A;  5F07 A;  5ECK B;  18GS A;  3KCM A;  3QFB C;  4XS1 A;  2YPM A;  2VL3 A;  3ZRD A;  1TK0 B;  4HOJ A;  1SK0 A;  1ML6 A;  2CV4 A;  3A2W A;  3GUR A;  2YAN A;  3TJB A;  2FWE A;  5A34 A;  3VPQ A;  4HZ2 A;  1HYU A;  2V1M A;  1QMV A;  3RHC A;  1X0R A;  1EZK A;  3L9V A;  2F9S A;  1T7P B;  3F9U A;  2CVD A;  1JZD A;  1Y6E A;  4O32 A;  1G6Y A;  4IBP A;  5A4U A;  3UIW A;  4EIQ A;  2ZCT A;  3EMP A;  3BCK A;  3W8S A;  1TXX A;  1SKS B;  4K6X A;  2OAD A;  1K0O A;  4POB A;  4N0V A;  3TOT A;  3CHX C;  1ZMA A;  2DJK A;  4PI0 C;  2VCW A;  3ERF A;  1HNA A;  4MDC A;  4ZL8 A;  2O3E A;  1R5P A;  1FB0 A;  5CRE A;  2H0I A;  1J9B A;  3HDC A;  1X9M B;  2E0Q A;  1KNG A;  2L5O A;  1GNW A;  3Q18 A;  3JCM L;  2OA7 A;  2QSI A;  1ON4 A;  2GLR A;  1TI1 A;  2HSM A;  2GSQ A;  1GTB A;  1BX9 A;  4OWY A;  1TRS A;  1Z6M A;  3DVW A;  3CTG A;  1GSQ A;  1FO5 A;  2ON5 A;  3AY8 A;  5H5Q A;  3F4S A;  1PFO A;  4WKW A;  2L5L A;  3HJO A;  4HQS A;  2IFQ A;  3HJP A;  3DXB A;  1GSE A;  3DD3 A;  16GS A;  1GSD A;  1Z6N A;  4HDE A;  2DKH A;  1A8Y A;  3HKR A;  4XS4 A;  1AXD A;  2LRT A;  3CSH A;  1O8X A;  4ISD A;  1SJI A;  2MYG A;  5AN1 A;  1TJD A;  1S4B P;  2HRF A;  3UAP A;  2PWJ A;  3NZN A;  3NIV A;  1KTE A;  2H6X A;  5DDL A;  3N5O A;  4N0Z A;  2HSM B;  2C0E A;  1PGT A;  2PUK C;  2YWN A;  3WT1 A;  5ECH B;  5KEJ A;  5ID2 A;  4KDU A;  3FZ9 A;  5DAL B;  1WOU A;  1WIK A;  2H76 A;  3FKF A;  2DML A;  3LFL A;  1FVK A;  1BYE A;  2RII A;  2H1B A;  2PN8 A;  7GSS A;  2HYX A;  5B7C A;  1AW9 A;  1YQ1 A;  2IFQ B;  4MP4 A;  2HZE B;  3HA9 A;  3DWV A;  1W89 A;  3HZ8 A;  2H66 A;  3I9V 2;  2VL2 C;  1LJR A;  5HFK A;  4TXO A;  3EVI A;  4XS4 B;  1GWC A;  2DJ3 A;  5ECP B;  1TOF A;  2P0G A;  2Z9S A;  1X5E A;  4WBJ A;  4CHS A;  2ALB A;  3J7Y k;  1W4V A;  2OKA A;  2F3M A;  1ERT A;  3WGD A;  5G1K A;  2VCQ A;  1MEK A;  3RPP A;  2VO4 A;  2K18 A;  2LTK A;  5ID2 B;  4Z2R A;  1URM A;  1MTC A;  4ILF A;  1X9W B;  3MAK A;  5JWR B;  1UA5 A;  2R5G A;  4WEY A;  2QKE A;  2H0G A;  3I43 A;  3QCP A;  5A5H A;  2EIQ A;  3IV4 A;  5COH A;  2FY6 A;  2E7P A;  4TR1 A;  4NHZ A;  1O73 A;  4MJB A;  2DC5 A;  3HMJ G;  3M9K A;  4TXO B;  3TJG A;  5CNW A;  4O7H A;  4BVX B;  3EWL A;  3UL3 A;  4ECB A;  3VFI A;  2NVL A;  4MF7 A;  3A5I A;  2DJ1 A;  1Z7P A;  2TRC P;  3BD2 A;  3A3T A;  4V2M A;  2OJL A;  5IPG A;  2C8U A;  2WW3 A;  2RLI A;  2I9H A;  2FGX A;  3UJ1 A;  5KOW A;  4EC0 A;  6GSU A;  4GCI A;  1EV4 A;  1K0N A;  1FHE A;  1ABA A;  2CAQ A;  4KSO A;  2GZP A;  5A5H B;  14GS A;  1TK8 B;  1CQG A;  4ZB9 A;  2LKU A;  1E6B A;  3DEX A;  4IJI A;  4TR1 B;  1VF2 A;  1OYJ A;  1ZYN A;  1AQX A;  1GTU A;  3KTL A;  2VD1 A;  1GUH A;  1AQV A;  1WMJ A;  2WGR A;  1I5G A;  1QUW A;  3FRC A;  1M0U A;  1FAA A;  2C80 A;  2IMF A;  1ZYQ B;  3M1G A;  3F4T A;  4YQM A;  4AKX B;  2A2R A;  2GDR A;  3GL3 A;  3P8W A;  1XBS A;  1DE1 A;  1QXH A;  1CQH A;  3G9B A;  3GMF A;  1B4Q A;  1HQO A;  2C3N A;  2I1U A;  2OAC A;  4K7O A;  3ZIV A;  4EXJ A;  1ZYP A;  5IMV A;  1FOV A;  4XS6 A;  1QGV A;  3WYW A;  5B8B A;  2TRX A;  4IHU A;  2O85 A;  3ME7 A;  2XC2 A;  1HD2 A;  4TR3 A;  3HXS A;  4TR4 A;  5C04 A;  1T8E B;  2NBS A;  2N5B A;  1FW1 A;  5IIZ A;  1ERU A;  2XHF A;  5A5K A;  2H1G A;  2WDU A;  2LJR A;  3KEB A;  3ZIT A;  4PI2 C;  1I9D A;  5G2Z A;  2O7K A;  1SL0 B;  3RPN A;  3D4T A;  4WF4 A;  2QC7 A;  1GTA A;  4NV2 A;  1VF4 A;  1KBN A;  4ML1 A;  3ERG A;  2FWF A;  3EIN A;  1JHB A;  2O36 A;  4OFN A;  1YZX A;  2L59 A;  2H70 A;  3QPM A;  1EOG A;  5LCZ A;  3E3E A;  1O7U A;  3UBK A;  4ZBD A;  2P31 A;  4MJA A;  4AJ7 A;  3IAM 2;  2CVK A;  1K0M A;  3CSI A;  2UZ8 A;  4USS A;  4DSR A;  2B5E A;  5AGY A;  4K5R A;  4RQX A;  1SVM A;  1H75 A;  4GSN A;  5GZZ B;  1USB A;  2IMI A;  4CY8 A;  2BTO T;  22GS A;  1U6T A;  3APS A;  3RBT A;  4KND A;  4TKY A;  2V6O A;  4X1U A;  3KH7 A;  5J4U A;  1BG5 A;  3PR8 A;  2QA2 A;  5CRW A;  2FD3 A;  5HFG A;  4KGI A;  3BBY A;  4ZB7 A;  1OC3 A;  2OE3 A;  3GUS A;  2X4A A;  2ON7 A;  3IBH A;  3GX0 A;  2K8V A;  5A4W A;  2C4J A;  5D73 A;  4ZL7 A;  2DLX A;  2K6V A;  2A2P A;  2AHE A;  2VKZ G;  3ZMK A;  3ZL5 A;  2YWM A;  2WUL A;  4HJ2 A;  2C0D A;  2CT6 A;  4I97 A;  1TW9 A;  4YAV A;  3ZTL A;  1QQ2 A;  1SD8 A;  3H8Q A;  3SWL A;  1OVN A;  1SKW B;  2KP1 A;  5B6N A;  3GV1 A;  2YZH A;  1A0F A;  1WWJ A;  3DVX A;  1EOH A;  3IC4 A;  5HR0 A;  2L57 A;  3ZYW A;  2A4H A;  2GTU A;  5L71 A;  1XVW A;  3R2Q A;  1GSU A;  1PQN A;  4FQU A;  1XVQ A;  3H93 A;  5J3R A;  1ILO A;  2X49 A;  1OKT A;  4JR4 A;  4WXT A;  1E2Y A;  5IO0 A;  3D5J A;  5IO2 A;  4PXO A;  5D93 A;  2UV8 G;  5HFI A;  3LXZ A;  1F2E A;  3UAR A;  2CVB A;  2H71 A;  4ZB6 A;  9GSS A;  2GQK A;  3QMX A;  6GSY A;  3M8N A;  1G6W A;  2HI7 A;  4K0G A;  2LST A;  2E2M A;  5D9W A;  4LL1 B;  1BF5 A;  2N5F A;  2VCT A;  4POK A;  4NWY A;  5DCG A;  2WVX A;  2AAW A;  3QOU A;  4KA0 A;  4NPB A;  2GZZ A;  1T00 A;  4KCE A;  4MZW A;  2GT5 A;  3WD6 A;  1PN0 A;  1GLQ A;  2MZC A;  4KE3 A;  4BL7 A;  1YKA A;  2VLU A;  2O5V A;  1PKZ A;  3FK8 A;  1R7H A;  1TTZ A;  4EL1 A;  1A8L A;  3HCZ A;  4OMV A;  3DYR A;  5KN1 A;  1M2D A;  12GS A;  2DKI A;  2PPT A;  2LQO A;  4GXZ A;  1VF1 A;  2C1Y A;  2K9F A;  2JU5 A;  2J23 A;  4TW5 A;  3LJR A;  5HR1 A;  1V40 A;  2PBJ A;  1M9A A;  1SVO A;  1XW6 A;  2GT6 A;  2OT3 A;  4N30 A;  1TRV A;  1EP8 A;  4AJ6 A;  1GP1 A;  3H4K A;  1AAZ A;  3O6T A;  4TXV A;  4MF5 A;  4EVM A;  2YJH A;  3BOA A;  2V2G A;  3F3Q A;  2MMO A;  2OBI A;  2IME A;  4G2E A;  4BL7 B;  1YEW C;  3LW9 A;  3LQ7 A;  2B6M A;  2PGT A;  4HEA 2;  3FHK A;  1G7O A;  2H6Z A;  3GH6 A;  1WPI A;  3NOF A;  4JU5 A;  2HSN A;  4F03 A;  5IM9 A;  1JLV A;  1KEB A;  1SYR A;  5IQY A;  3P7X A;  2OBK A; 
#chains in the Genus database with same CATH homology
 4X0X A;  2ZNM A;  5A34 B;  2FCH A;  2NPB A;  4I5Q A;  2YZU A;  3GKM A;  3TDG A;  3VUR A;  4PNF A;  4MJC A;  4XHM A;  5ECO B;  3P2A A;  4IN0 A;  5B8A A;  4FO5 A;  1AIU A;  4XIH A;  3TKP A;  3EE2 A;  5ECQ B;  4FH8 A;  3QR6 A;  2EIR A;  2H73 A;  1FB6 A;  3DGQ A;  4O5R A;  3LYP A;  5H5R A;  1YKC A;  4KH7 A;  2JZT A;  4RQR A;  2GZY A;  2EC4 A;  4LA1 A;  4WET A;  3KMO A;  1K0B A;  2IIY A;  3F0I A;  2PMT A;  1SD9 A;  2HSN B;  1Z3E A;  4AKG A;  4PQ1 A;  3D6I A;  2V41 A;  5C00 A;  3BJ5 A;  1V98 A;  3KH9 A;  5AIX A;  2X8C A;  1Z7R A;  3HY2 A;  1V58 A;  3GSS A;  3E9J B;  2H74 A;  5D96 A;  1YJ6 A;  1BAY A;  1PKW A;  5ELA A;  5ECS A;  4ECC A;  5J4V A;  1TRW A;  2LJK A;  1SEN A;  2R2J A;  4I2U A;  2B5Y A;  4K2X A;  1XOB A;  2X8G A;  1ZOF A;  4AGS A;  2PER A;  4N10 A;  1R4W A;  3TRP A;  5IOX A;  2H1D A;  4GSS A;  3C1S A;  2BJX A;  3KXO A;  1SL1 B;  4JED A;  1J0F A;  1PSQ A;  20GS A;  5GSS A;  4EF0 A;  5BRT A;  1YEX A;  3VWX A;  5DBQ A;  2C0G A;  3DRN A;  2RM6 A;  1N8J A;  5DQY A;  3RHB A;  5JWQ B;  4NXI A;  1GSS A;  4WR5 A;  3QFA C;  4KAE A;  2AV4 A;  4ECJ A;  4G19 A;  2QA1 A;  2H30 A;  2GSR A;  5D9V A;  2CQ9 A;  4ZB8 A;  3GH9 A;  2PVQ A;  5DAK A;  4LLR A;  4MH2 A;  5J5N A;  2R6K A;  3CBU A;  1PX6 A;  3LYK A;  1YDK A;  4LL4 B;  2HQT A;  1EEM A;  4W66 A;  2HRK A;  3V1W A;  2FHE A;  3S9F A;  1F37 A;  1X5D A;  3HD5 A;  2EIO A;  8GSS A;  1M99 A;  2O89 A;  5AIS A;  4K5S A;  4YQU A;  3FYG A;  2ES7 A;  4QL9 A;  1B9Y C;  4EKZ A;  4F0B A;  5KN0 A;  1PL1 A;  4KDX A;  1QK8 A;  10GS A;  3ERW A;  3IR4 A;  4HUA A;  4WBR D;  4MCU A;  1AC1 A;  1GTI A;  2VM2 A;  1X5C A;  3ZFL A;  4Z2U A;  5J47 A;  4X4J A;  4EUY A;  2GST A;  3PPU A;  4MPF A;  1H4O A;  1IYH A;  4EE0 A;  2R4V A;  3GA4 A;  3IOS A;  4PTS A;  4K2D A;  2FNO A;  2XPD A;  5DAK B;  3TJJ A;  3TRQ A;  3GHA A;  3EYT A;  4TN8 A;  1RW1 A;  4IKH A;  1ACV A;  3D21 A;  1NM3 A;  3GTU A;  4L8E A;  2R0C A;  4E68 A;  3UBL A;  1K3L A;  2HRK B;  1JZO A;  3TUE A;  3VK9 A;  3C73 A;  5EL8 A;  1QFN A;  1XW5 A;  1XFL A;  1DE2 A;  3WT2 A;  1PA3 A;  13GS A;  2KUC A;  3CRT A;  2FWH A;  3HVX A;  1G7E A;  1MDK A;  2FLS A;  1F9M A;  2H1A A;  1MD3 A;  1TDI A;  1K0A A;  1K0C A;  3SBC A;  4GQF A;  3ZIJ A;  5G5F A;  4YH2 A;  3FEU A;  5A1N A;  3LG6 A;  3QD9 A;  4KB3 A;  2PVO C;  4OCF A;  5DJL A;  1TU7 A;  2P5Q A;  2C0F A;  1WRY A;  4I2T A;  4IJ3 A;  3OR5 A;  5CO3 A;  3GTU B;  4EDY A;  1MD4 A;  1O8W A;  1TK5 B;  4IEL A;  2L6C A;  2F8F A;  4G01 A;  4Q5N A;  2WFC A;  2NTO A;  4FYC A;  2R37 A;  1NHY A;  2VCV A;  4P3Y B;  2O87 A;  2HRA A;  4K8M A;  1VRS D;  4BPY A;  4PUF C;  1S3C A;  1O85 A;  1M2A A;  3TRX A;  1RQM A;  2YWI A;  1C72 A;  1XWK A;  5J9C A;  3H1N A;  1B4P A;  1PX7 A;  2MMN A;  3QAG A;  4H86 A;  5A1N B;  2V32 A;  2CA8 A;  3UOM A;  3IXR A;  4GDF A;  4F0C A;  1XWA A;  3D4M A;  2XBQ A;  4I6X A;  5J9B A;  3TJF A;  1ZGN A;  5FWG A;  2GVP A;  4IP1 A;  3F6D A;  3EPT A;  1N2A A;  4PQI A;  4MH3 A;  4MMM A;  3HZ4 A;  4LMW A;  1B9X C;  3VLN A;  2A4V A;  3CSJ A;  1TRU A;  4HJM A;  2DMM A;  4KDY A;  2KOK A;  4HU7 A;  3RAZ A;  1F3A A;  3KMN A;  3C1R A;  3LWA A;  2MBS A;  4J2F A;  2B5X A;  1TXU A;  3PIN A;  4AI6 A;  5CAX A;  1AUC A;  4MA9 A;  3TB2 A;  2KLX A;  5DQS A;  2L4C A;  4PNG A;  4J57 E;  3ZML A;  4JBB A;  1XZO A;  2IPA A;  3H79 A;  2VL9 A;  4IQA A;  4L0W A;  3A5W A;  1X9S B;  3UVH A;  4DVC A;  3PGT A;  5ECL B;  3W6G A;  1SL2 B;  2FA4 A;  3GFK A;  2RM5 A;  4G0I A;  5BMU A;  1WJK A;  4K1F A;  1ZYE A;  1XOA A;  4GWR A;  3E0U A;  4DSS A;  4BWS A;  5IOW A;  3LGC A;  1ZCP A;  4MNN A;  3ZFB A;  4MK3 A;  2IWT A;  3KD0 A;  4X43 A;  3F3R A;  1U3I A;  1T3B A;  4NAX A;  2KHP A;  1Z5Y E;  4CDO A;  1U3A A;  2CZ2 A;  1FOH A;  4XCS A;  4OFT A;  1M9B A;  2DIZ A;  1AQW A;  11GS A;  3TKS C;  3Q19 A;  2IJY A;  1J08 A;  1UN2 A;  2WCI A;  3KP8 A;  4PUR A;  5G5E A;  1TKD B;  2YWO A;  3APO A;  4F82 A;  3GIX A;  3KZQ A;  5DJM A;  4CY6 A;  5BMU B;  5HR3 A;  2LEG A;  2B1L A;  4DSS B;  5JCU A;  3I69 A;  4HS1 A;  4Q5R A;  1ZZY A;  5EVO A;  2JZR A;  3CMI A;  6GSV A;  4MAB A;  4HU9 A;  4K9Z A;  1GUL A;  4BWQ A;  5E59 A;  5F06 A;  2DSA A;  2AJQ B;  4L5O A;  1B48 A;  5FHI A;  3HVS A;  3TJK A;  1VGL A;  4OD7 A;  3W8J A;  2FUG 2;  5B6M A;  4K7I A;  4K7N A;  2VAF A;  2GGT A;  1M2B A;  1UC7 A;  4YAP A;  2YV7 A;  2E2G A;  1OKD A;  2XPE A;  4MF6 A;  1S3A A;  2LV3 A;  5JCW A;  1S3D A;  3GN3 A;  4RUV A;  3IPZ A;  4XRA A;  3FR3 A;  4F2I A;  4POM A;  1R5A A;  4QL7 A;  3IK9 A;  1SK2 A;  4FYB A;  2N5A A;  1Y1U A;  1THO A;  3MNG A;  1XCC A;  5IMD A;  1YY7 A;  1SU9 A;  4V1A g;  4G0L A;  4WF5 A;  3TGZ A;  5AIV A;  2GS3 A;  2JSY A;  6GSW A;  3MWH A;  3Q74 A;  3O76 A;  3EUR A;  3RDW A;  4BVY A;  2CAI A;  3GRX A;  4L5L A;  4IGJ A;  5ELG A;  4KCA A;  2M80 A;  2JSZ A;  4IP6 A;  1JLW A;  4TRX A;  1SKR B;  2HRN A;  3L78 A;  2EFC A;  1V2A A;  3FR6 A;  1BG1 A;  4OO5 A;  2VL2 A;  4XTS A;  1FVJ A;  1RK4 A;  2XBI A;  1OE7 A;  1EP7 A;  4OFM A;  5IMA A;  3HYP A;  1ERW A;  3ZRE A;  3CWG A;  4K0N A;  4MPG A;  1O6J A;  1ST9 A;  1XWG A;  5G1L A;  4KW6 A;  4E8H A;  4PQH A;  2DIY A;  4LMV A;  2WJU A;  3ME8 A;  1B8X A;  4ECI A;  4BVY B;  1GUM A;  1OC8 A;  4RI7 A;  2WB9 A;  1PRX A;  3PH9 A;  3APQ A;  5EY6 A;  3IRA A;  5CRH A;  4TVE A;  1R26 A;  2VLV A;  4GRF A;  1A24 A;  4GQC A;  4XRD A;  2NDO A;  2YJ7 A;  2JAD A;  2HE3 A;  4JR6 A;  1K0D A;  3FR9 A;  5ECM B;  5LD0 A;  3VWU A;  5IMC A;  3MIX A;  2YN1 A;  3FY7 A;  19GS A;  4ICY A;  1PMT A;  5DAL A;  2VOC A;  1F3B A;  3KP9 A;  1TU8 A;  3KIJ A;  2TIR A;  4ZXG A;  2VM1 A;  4O5Q A;  1BED A;  4KX4 A;  1SYX A;  2IMD A;  3L9U A;  5GAP D;  4WR4 A;  4G0K A;  2I3Y A;  4EDZ A;  2HZE A;  2YNX A;  4YKG A;  4POL A;  4Q5Q A;  1YEP A;  1A2J A;  5IMF A;  2F51 A;  2VIM A;  4OO4 A;  4KUN A;  4J56 E;  4KSM A;  2RUE A;  1U88 A;  1EWX A;  5J4Y A;  3ZLP A;  1YF1 A;  2VLT A;  4ZIL A;  3FMW A;  1DUG A;  1HNC A;  3M3M A;  2YCD A;  2H01 A;  2PU9 C;  3CTF A;  3WGE A;  1F6M C;  1DSB A;  1T4Y A;  5IMZ A;  4NV5 A;  2M72 A;  3LXT A;  1U87 A;  2K8S A;  4O5U A;  2C3Q A;  2AYT A;  2H6Y A;  3KTB A;  3G7Y A;  5H5S A;  2X64 A;  1OE8 A;  1MDJ A;  6GST A;  1WP0 A;  1GL8 A;  3O3T A;  3IC8 A;  2ZUP A;  3IHG A;  2V6K A;  3F8U A;  2MMA A;  1WE0 A;  3GKX A;  2MMZ A;  4JE1 A;  2HT9 A;  4PGT A;  2FA8 A;  1SJ6 A;  2JAC A;  4BVX A;  4MZB A;  4AKH A;  3ZVJ D;  3VWW A;  5FT3 A;  4G9H A;  4IW9 A;  3DML A;  5HR2 A;  1NSW A;  3HVV A;  3IK7 A;  2YP6 A;  1XWC A;  2FWG A;  1LBK A;  3ED3 A;  1A2L A;  3C8E A;  2L4Q A;  4PUA A;  3G7J A;  2CX3 A;  1GLP A;  5DVB A;  3C71 A;  3N9J A;  1LU4 A;  2R0G A;  3EU4 A;  4L0U A;  4ID0 A;  2LJA A;  5G31 A;  4V2N A;  4EO3 A;  5DCH A;  2LRN A;  4HQZ A;  1GNE A;  3GKN A;  5CYY A;  5EPF A;  2X99 A;  5CRG A;  4MLY A;  3U6V A;  5JCG A;  3IA1 A;  5GST A;  2JZS A;  2B3S A;  1Q4J A;  2EFH A;  2AB6 A;  2I81 A;  5ECR B;  1JFU A;  2VCX A;  5JWO B;  3MDK A;  2I4A A;  3F4R A;  2O8V B;  5E4W A;  3FZ4 A;  2H72 A;  2QGV A;  1TI3 A;  3QDN A;  2LRC A;  3D22 A;  3UEM A;  3FZA A;  2R3X A;  1A23 A;  1VF3 A;  1EEJ A;  5F0G A;  1GUK A;  1JZR A;  2CZ3 A;  4N11 A;  3TCO A;  1YF0 A;  2BMX A;  4GF0 A;  17GS A;  3TOU A;  3GYK A;  3VPT A;  4HI7 A;  1A2M A;  3L9S A;  2GSS A;  1OC9 A;  4MJE A;  4FIW A;  2H8L A;  4YQV A;  2B7J A;  4JZQ A;  2GQL A;  1PD2 1;  3CXG A;  4AJ8 A;  3P90 A;  3C7M A;  1K3O A;  3HHV A;  2C3T A;  2OE0 A;  3L0H A;  3LEF A;  2A2S A;  5ECN B;  3GX8 A;  3CRU A;  4D73 A;  2G2Q A;  4HZ4 A;  2G0F A;  3GNJ A;  4I8B A;  3TU3 B;  1MDI A;  3CYN A;  4ZL9 A;  4BA7 A;  5ABR A;  1GH2 A;  3EMX A;  5J41 A;  1OC9 B;  2LS5 A;  5F8B A;  4TR0 A;  4AKI A;  4MZC A;  4FYU A;  1PN9 A;  5CP1 A;  3F6F A;  1UVZ A;  4DEJ A;  2KP2 A;  2OE1 A;  2WZ9 A;  5KN3 A;  5D8I A;  5A4V A;  3GST A;  2EFE A;  3KGK A;  2JL4 A;  3TKS A;  3LSZ A;  1SJZ A;  5D9T A;  4GTU A;  5F05 A;  3EU3 A;  4Z7X A;  3TKR A;  4D73 B;  3K8N A;  4F9Z A;  2YV9 A;  3M0F A;  2M46 A;  5KOX A;  2DBC A;  2HNL A;  2WRT A;  1SVL A;  1XIY A;  4AF2 A;  4IQ1 A;  2DJ2 A;  1HNB A;  2IN3 A;  3TKS E;  3A2X A;  4ULX A;  5G30 A;  2VD0 A;  1NW2 A;  3KM6 A;  4OCE A;  4TOP A;  2D2Z A;  3US3 A;  1BQ7 A;  2F8A A;  2REM A;  5GAN D;  3G7I A;  4EIP A;  6GSX A;  1BJX A;  2X8H A;  1EGO A;  4ACS A;  1JZW A;  5ENU A;  5LNK e;  2IMK A;  4O92 A;  4RI6 A;  1NHO A;  2EFD A;  1GRX A;  1GSY A;  3I6A A;  4IS0 A;  5IPH A;  4E8E A;  1EV9 A;  1O81 A;  1N25 A;  3A2V A;  2IL3 A;  2DJJ A;  1Z9H A;  3MSZ A;  2HXK A;  1M7T A;  1ZL9 A;  2HZF A;  2WS2 A;  1FG4 A;  3UVT A;  1XPV A;  2LUS A;  1TP9 A;  1ERV A;  1V9W A;  3MYD A;  1EGR A;  1YVL A;  4YKF A;  2LNS A;  3U5R E;  4GLT A;  1IYI A;  5ECI B;  1T1V A;  3GL5 A;  6GSS A;  3TKQ A;  2VUP A;  4JRR A;  1K3Y A;  1SK1 A;  3LOR A;  4IVF A;  3VI7 A;  3ZVJ A;  1V57 A;  3M9J A;  3IAS 2;  4QMK A;  1XW9 A;  4KF9 A;  2HSY A;  3IE3 A;  3HJM A;  4G10 A;  4ZBA A;  2LQQ A;  2P5R A;  4PX1 A;  1DBY A;  1XWB A;  4NHW A;  4ZIJ A;  2DJ0 A;  2VCZ A;  5HQP A;  4V2L A;  3L4N A;  3IHQ A;  4ZBB A;  3J7Y b;  2R0P A;  2J9H A;  3WGX A;  2CX4 A;  2YOI A;  3IDV A;  4GST A;  2B7K A;  2HSH A;  4NMU A;  1PL2 A;  2RUF A;  4DSQ A;  3BCI A;  3QAW A;  3D0Z A;  1Q98 A;  3F63 A;  1GSF A;  3DIE A;  1A0R P;  3ISO A;  3Q6O A;  4A5P A;  3QAV A;  1G0T A;  1OAZ A;  1Y25 A;  2HFD A;  2GQM A;  2HLS A;  3FZ5 A;  3UMA A;  3VWV A;  3VI5 A;  2LNT A;  2B1K A;  4ML6 A;  3KJY A;  2L6D A;  4QQ7 A;  2H75 A;  3ZZX A;  4CW9 A;  3DKS A;  3EC3 A;  4Q5F A;  5CRD A;  5J40 A;  2H19 A;  3FW2 A;  1THX A;  2MBT A;  5KN2 A;  4Z2T A;  3GKK A;  3R3E A;  4N3Z A;  5INY A;  4V1A p;  1T4Z A;  1XXU A;  5D9X A;  2H0H A;  2H1L A;  2AUV A;  5F07 A;  5ECK B;  18GS A;  3KCM A;  3QFB C;  4XS1 A;  2YPM A;  2VL3 A;  3ZRD A;  1TK0 B;  4HOJ A;  1SK0 A;  1ML6 A;  2CV4 A;  3A2W A;  3GUR A;  2YAN A;  3TJB A;  2FWE A;  5A34 A;  3VPQ A;  4HZ2 A;  1HYU A;  2V1M A;  1QMV A;  3RHC A;  1X0R A;  1EZK A;  3L9V A;  2F9S A;  1T7P B;  3F9U A;  2CVD A;  1JZD A;  1Y6E A;  4O32 A;  1G6Y A;  4IBP A;  5A4U A;  3UIW A;  4EIQ A;  2ZCT A;  3EMP A;  3BCK A;  3W8S A;  1TXX A;  1SKS B;  4K6X A;  2OAD A;  1K0O A;  4POB A;  4N0V A;  3TOT A;  1ZMA A;  2DJK A;  2VCW A;  3ERF A;  1HNA A;  4MDC A;  4ZL8 A;  1R5P A;  1FB0 A;  5CRE A;  2H0I A;  1J9B A;  3HDC A;  1X9M B;  2E0Q A;  1KNG A;  2L5O A;  1GNW A;  3Q18 A;  3JCM L;  2OA7 A;  2QSI A;  1ON4 A;  2GLR A;  1TI1 A;  2HSM A;  2GSQ A;  1GTB A;  1BX9 A;  4OWY A;  1TRS A;  1Z6M A;  3DVW A;  3CTG A;  1GSQ A;  1FO5 A;  2ON5 A;  3AY8 A;  5H5Q A;  3F4S A;  4WKW A;  2L5L A;  3HJO A;  4HQS A;  2IFQ A;  3HJP A;  3DXB A;  1GSE A;  3DD3 A;  16GS A;  1GSD A;  1Z6N A;  4HDE A;  2DKH A;  1A8Y A;  3HKR A;  4XS4 A;  1AXD A;  2LRT A;  3CSH A;  1O8X A;  4ISD A;  1SJI A;  2MYG A;  5AN1 A;  1TJD A;  2HRF A;  3UAP A;  2PWJ A;  3NZN A;  3NIV A;  1KTE A;  2H6X A;  5DDL A;  3N5O A;  4N0Z A;  2HSM B;  2C0E A;  1PGT A;  2PUK C;  2YWN A;  3WT1 A;  5ECH B;  5KEJ A;  5ID2 A;  4KDU A;  3FZ9 A;  5DAL B;  1WOU A;  1WIK A;  2H76 A;  3FKF A;  2DML A;  3LFL A;  1FVK A;  1BYE A;  2RII A;  2H1B A;  2PN8 A;  7GSS A;  2HYX A;  5B7C A;  1AW9 A;  1YQ1 A;  2IFQ B;  4MP4 A;  2HZE B;  3HA9 A;  3DWV A;  1W89 A;  3HZ8 A;  2H66 A;  3I9V 2;  2VL2 C;  1LJR A;  5HFK A;  4TXO A;  3EVI A;  4XS4 B;  1GWC A;  2DJ3 A;  5ECP B;  1TOF A;  2P0G A;  2Z9S A;  1X5E A;  4WBJ A;  4CHS A;  2ALB A;  3J7Y k;  1W4V A;  2OKA A;  2F3M A;  1ERT A;  3WGD A;  5G1K A;  2VCQ A;  1MEK A;  3RPP A;  2VO4 A;  2K18 A;  2LTK A;  5ID2 B;  4Z2R A;  1URM A;  1MTC A;  4ILF A;  1X9W B;  3MAK A;  5JWR B;  1UA5 A;  2R5G A;  4WEY A;  2QKE A;  2H0G A;  3I43 A;  3QCP A;  5A5H A;  2EIQ A;  3IV4 A;  5COH A;  2FY6 A;  2E7P A;  4TR1 A;  4NHZ A;  1O73 A;  4MJB A;  2DC5 A;  3HMJ G;  3M9K A;  4TXO B;  3TJG A;  5CNW A;  4O7H A;  4BVX B;  3EWL A;  3UL3 A;  4ECB A;  3VFI A;  2NVL A;  4MF7 A;  3A5I A;  2DJ1 A;  1Z7P A;  2TRC P;  3BD2 A;  3A3T A;  4V2M A;  2OJL A;  5IPG A;  2C8U A;  2RLI A;  2I9H A;  2FGX A;  3UJ1 A;  5KOW A;  4EC0 A;  6GSU A;  4GCI A;  1EV4 A;  1K0N A;  1FHE A;  1ABA A;  2CAQ A;  4KSO A;  2GZP A;  5A5H B;  14GS A;  1TK8 B;  1CQG A;  4ZB9 A;  2LKU A;  1E6B A;  3DEX A;  4IJI A;  4TR1 B;  1VF2 A;  1OYJ A;  1ZYN A;  1AQX A;  1GTU A;  3KTL A;  2VD1 A;  1GUH A;  1AQV A;  1WMJ A;  2WGR A;  1I5G A;  1QUW A;  3FRC A;  1M0U A;  1FAA A;  2C80 A;  2IMF A;  1ZYQ B;  3M1G A;  3F4T A;  4YQM A;  4AKX B;  2A2R A;  2GDR A;  3GL3 A;  3P8W A;  1XBS A;  1DE1 A;  1QXH A;  1CQH A;  3G9B A;  3GMF A;  1B4Q A;  1HQO A;  2C3N A;  2I1U A;  2OAC A;  4K7O A;  3ZIV A;  4EXJ A;  1ZYP A;  5IMV A;  1FOV A;  4XS6 A;  1QGV A;  3WYW A;  5B8B A;  2TRX A;  4IHU A;  2O85 A;  3ME7 A;  2XC2 A;  1HD2 A;  4TR3 A;  3HXS A;  4TR4 A;  5C04 A;  1T8E B;  2NBS A;  2N5B A;  1FW1 A;  5IIZ A;  1ERU A;  2XHF A;  5A5K A;  2H1G A;  2WDU A;  2LJR A;  3KEB A;  3ZIT A;  1I9D A;  5G2Z A;  2O7K A;  1SL0 B;  3RPN A;  3D4T A;  4WF4 A;  2QC7 A;  1GTA A;  4NV2 A;  1VF4 A;  1KBN A;  4ML1 A;  3ERG A;  2FWF A;  3EIN A;  1JHB A;  4OFN A;  1YZX A;  2L59 A;  2H70 A;  3QPM A;  1EOG A;  5LCZ A;  3E3E A;  1O7U A;  3UBK A;  4ZBD A;  2P31 A;  4MJA A;  4AJ7 A;  3IAM 2;  2CVK A;  1K0M A;  3CSI A;  2UZ8 A;  4USS A;  4DSR A;  2B5E A;  5AGY A;  4K5R A;  4RQX A;  1SVM A;  1H75 A;  4GSN A;  5GZZ B;  1USB A;  2IMI A;  4CY8 A;  2BTO T;  22GS A;  1U6T A;  3APS A;  3RBT A;  4KND A;  4TKY A;  2V6O A;  4X1U A;  3KH7 A;  5J4U A;  1BG5 A;  3PR8 A;  2QA2 A;  5CRW A;  2FD3 A;  5HFG A;  4KGI A;  3BBY A;  4ZB7 A;  1OC3 A;  2OE3 A;  3GUS A;  2X4A A;  2ON7 A;  3IBH A;  3GX0 A;  2K8V A;  5A4W A;  2C4J A;  5D73 A;  4ZL7 A;  2DLX A;  2K6V A;  2A2P A;  2AHE A;  2VKZ G;  3ZMK A;  3ZL5 A;  2YWM A;  2WUL A;  4HJ2 A;  2C0D A;  2CT6 A;  4I97 A;  1TW9 A;  4YAV A;  3ZTL A;  1QQ2 A;  1SD8 A;  3H8Q A;  3SWL A;  1OVN A;  1SKW B;  2KP1 A;  5B6N A;  3GV1 A;  2YZH A;  1A0F A;  1WWJ A;  3DVX A;  1EOH A;  3IC4 A;  5HR0 A;  2L57 A;  3ZYW A;  2A4H A;  2GTU A;  5L71 A;  1XVW A;  3R2Q A;  1GSU A;  1PQN A;  4FQU A;  1XVQ A;  3H93 A;  5J3R A;  1ILO A;  2X49 A;  1OKT A;  4JR4 A;  4WXT A;  1E2Y A;  5IO0 A;  3D5J A;  5IO2 A;  4PXO A;  5D93 A;  2UV8 G;  5HFI A;  3LXZ A;  1F2E A;  3UAR A;  2CVB A;  2H71 A;  4ZB6 A;  9GSS A;  2GQK A;  3QMX A;  6GSY A;  3M8N A;  1G6W A;  2HI7 A;  4K0G A;  2LST A;  2E2M A;  5D9W A;  4LL1 B;  1BF5 A;  2N5F A;  2VCT A;  4POK A;  4NWY A;  5DCG A;  2AAW A;  3QOU A;  4KA0 A;  4NPB A;  2GZZ A;  1T00 A;  4KCE A;  4MZW A;  2GT5 A;  3WD6 A;  1PN0 A;  1GLQ A;  2MZC A;  4KE3 A;  4BL7 A;  1YKA A;  2VLU A;  2O5V A;  1PKZ A;  3FK8 A;  1R7H A;  1TTZ A;  4EL1 A;  1A8L A;  3HCZ A;  4OMV A;  3DYR A;  5KN1 A;  1M2D A;  12GS A;  2DKI A;  2PPT A;  2LQO A;  4GXZ A;  1VF1 A;  2C1Y A;  2K9F A;  2JU5 A;  2J23 A;  4TW5 A;  3LJR A;  5HR1 A;  1V40 A;  2PBJ A;  1M9A A;  1SVO A;  1XW6 A;  2GT6 A;  2OT3 A;  4N30 A;  1TRV A;  1EP8 A;  4AJ6 A;  1GP1 A;  3H4K A;  1AAZ A;  3O6T A;  4TXV A;  4MF5 A;  4EVM A;  2YJH A;  3BOA A;  2V2G A;  3F3Q A;  2MMO A;  2OBI A;  2IME A;  4G2E A;  4BL7 B;  3LW9 A;  3LQ7 A;  2B6M A;  2PGT A;  4HEA 2;  3FHK A;  1G7O A;  2H6Z A;  3GH6 A;  1WPI A;  3NOF A;  4JU5 A;  2HSN A;  4F03 A;  5IM9 A;  1JLV A;  1KEB A;  1SYR A;  5IQY A;  3P7X A;  2OBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...