2XANA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with amp pnp and ip5
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
435
structure length
414
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGSGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICKEELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDSEPSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase is a Distant Ipk Member with a Singular Inositide Binding Site for Axial 2-Oh Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 141
structure length 414
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xanA01
3UDSA 2XAMA 3UDZA 4AXDA 4AXFA 2XARA 2XANA 4AQKA 4AXCA 4AXEA 2XAOA 4LV7A 2XALA 3UDTA
chains in the Genus database with same CATH superfamily
3KMMA 2GFSA 3F3VA 3QYZA 4EKLA 5DEWA 1OPLA 3G0FA 5BUEA 2SRCA 4UWYA 4KBCA 3GQIA 4GKIA 4O84A 3G2FA 2J50A 3MY5A 4J53A 2EVAA 3E63A 2C0IA 2IPXA 5I9ZA 4DC2A 3RNYA 5M53A 1GY3A 2HZIA 1VYWA 4DEIA 4G3GA 4AOJA 3PRIA 1W0XC 1OBGA 4L3JA 4O0VA 2I0EA 4NJ3A 5IH4A 3R21A 3RHKA 3OXIA 4LUEA 4I4EA 2A1AB 1TKIA 2GNIA 2ONLC 4LOOA 5CEPA 1KV2A 2ACXA 1G8AA 3AMAA 4MYGA 4UX9A 4AAYA 2R3HA 5FTOA 4E5BA 5DLSA 1V0BA 5T3QA 3HMPA 2FSMX 2NRUA 3WE8A 4FV5A 3OEZA 5DIAA 3O7LB 4AX8A 4EZ7A 2HZ4A 3NUUA 3OP5A 3IW7A 1OIQA 3QC9A 2Q0NA 5CSXA 5KZIA 4YPSA 1NA7A 3VBYA 3V5JA 3NAXA 3UZPA 3COHA 4ZMFA 2XNNA 1A48A 3D0EA 5CENA 4YO6A 2XARA 5DGZA 1W84A 1XH6A 4LGGA 3ODZX 5BNJA 4BJJA 4RX5A 3E8DA 3HRFA 4DGLC 2C0OA 2W99B 2XH5A 2H96A 5IDPA 4ENXA 2PVYA 2X2KA 4FNZA 3KRLA 4IZAA 4LOPA 1XKKA 2VAGA 1W8CA 4P4CA 3ZLYA 4C38A 4NM3A 3U8WA 3E8NA 5EYMA 3KKVA 2W1FA 3MESA 4EH2A 2YDIA 3IQ7A 1DAWA 3Q5IA 1PXKA 4QP1A 5EQEA 5K5NA 3EHAA 4W4VA 4C59A 3DZOA 4M15A 5EG3A 3LQ5A 5IH5A 2JC6A 1Q3DA 4IB0A 2G2FA 1PHKA 3ZC6A 4ZLZA 5CEQA 2Z02A 2YFXA 5EW8A 3SRVB 5HI2A 5M4CA 2UZDA 3G5DA 4MAOA 3R9RA 4GVAA 4OBPA 4OTFA 3FSFA 4TL0A 2X9EA 1GIIA 2LAVA 3ZM4A 1CKJA 3OXTA 3E8CA 4ZZOA 5D11A 4GFOA 2OJFE 2QOOA 4GU9A 3WOWA 4DBXA 2YJRA 2XRUA 3BLQA 3DBQA 3KK8A 4CFFA 3P79A 3R7OA 5CAPA 3L9NA 3QQLA 3BCEA 3ZOSA 4AWIA 3G15A 3EN4A 4H39A 4LOQA 4D9TA 1YDSE 4EBVA 3HP5A 4GKHA 3CD8A 4FTTA 4O7SA 5AV0A 3LFCA 3SW7A 2OWBA 4GFMA 5HG7A 3F7WA 4BRXA 2WGJA 1ND4A 1LR4A 4K1BA 2JDTA 4BDEA 3FUPA 4G16A 5HESA 4PL4A 3U6IA 1H28A 4YR8A 4DITA 1H1PA 3DNDA 4EHEA 5AP7A 3QZGA 3Q4CA 2JDOA 4FZ6A 4LRKA 4UXQA 4X3FC 3DOGA 4BICA 3QGWA 2WU7A 4BCJA 4D1XA 4EWQA 5DA3A 3UP7A 2W9ZB 4A07A 5GIOE 1YVJA 1Q8ZA 1ZOEA 4MXOA 4DE4A 4GEOA 4EOLA 4BBFA 2CGXA 3UVPA 5LJJA 4U81A 2W1EA 3BQRA 3LCOA 3C4WA 1WBVA 4LUDA 3BPRA 2HENA 2YM3A 2QVSE 3C1XA 3ET7A 4YTHA 5HKMA 3UNJA 3W2RA 4I6QA 2VTNA 5FTGA 1KSWA 3BL7A 3QTQA 5ANIA 1OKYA 4OTDA 5H8BA 4DCAA 5KX8A 3QX4A 2P33A 4GU6A 5JKGA 4UWBA 1ZYCA 4FVPA 3MH2A 2WZJA 4F9CA 3NW6A 4R7IA 2XIXA 5JSMA 2PHKA 3OUKA 4FNXA 4TNBA 4RT7A 4CNHA 3G0EA 3K2LA 2X2LA 4MTAA 2J0LA 4KUJA 4ALUA 2CGUA 3RNIA 4LRMA 2KULA 4KS7A 4Z16A 3AD5A 4F7SA 4BIEA 2B52A 3KN5A 3A7HA 4FK6A 3IS5A 4L00A 2UZOA 3P7BA 2CMWA 4EK4A 4UY9A 1PXJA 5HX6A 3ODYX 2IVSA 5HG9A 3TV4A 3K54A 1NVQA 4BCIA 2GS2A 1YOMA 3EQDA 4IBMA 4I24A 4U97A 4GT5A 4W4YA 3QRIA 4ASEA 5C8KA 2PULA 3NVKI 2C6TA 3LJ0A 1PXLA 3QL8A 4E6QA 3F2RA 1URWA 5FLFA 2BDJA 3FQEA 3DFAA 2B54A 3TDVA 5CWZA 3R9OA 4ACCA 4GK3A 5CU0A 2G2IA 1KOAA 1R0EA 1GOLA 3IGOA 5J5SA 4Q9ZA 3Q6WA 3FLYA 5CU4A 3HMIA 3R8ZA 3C0GA 4R77A 3TV7A 3DAJA 5E8YA 3IGGA 2XEYA 2R3RA 2YN8A 1OKWA 1J3HA 4J71A 2PYWA 4B9DA 5A6OA 2OJGA 3AC8A 4TKSA 3BGZA 4FZDB 3CKXA 4HOKA 4C61A 2OFVA 2X8DA 4NFNA 3SG9A 3VQUA 3R02A 5J1VA 1XHAA 2PE0A 5HGIA 3ZFYA 4D0WA 4HYSA 3R2BA 4GV1A 3W0RA 4G3DA 4X2GA 3UQGA 3R1YA 5LVOA 3OTVA 5IU2A 3BX5A 5EHOA 4OLIA 2YM8A 4F7JA 1YKRA 3QTRA 4BF2A 2W5BA 1LEWA 4I6LA 4MD7E 3U55A 4DBNA 2W1IA 3UJGA 3PIYA 2XS0A 3EQGA 3QAME 5AMNA 3WF6A 3P23A 4YTIA 2OZOA 1OVEA 3GC0A 5KHXA 3TUDA 2WU6A 4F1OA 3OZ6A 3QF9A 4DHIB 2CLXA 2OIDA 5EM6A 3FXZA 1FBNA 1WVXA 5FXQA 4YZNA 3RALA 4DHZA 3R8MA 1OMWA 1PJKA 3TI1A 3H10A 1PF8A 2G15A 2BZKB 4QNYA 4W8DA 3SRVA 3RJCA 5JRQA 3F3TA 5GHVA 1MQ4A 3OWLA 4V05A 3FMMA 4Q2AA 3VBXA 2C5OA 2WOUA 4AAAA 3UOLA 4CZUA 4R3CA 2W4KA 4QMWA 3FSKA 4G2FA 3UMXA 5KCVA 2WOTA 3HMNA 2UW7A 4N57A 3B2WA 4IDVA 3WZUA 4QPAA 4CV9A 4I1ZA 2QOIA 4EYJA 4MWIA 5KMJA 2HELA 3WF5A 3COKA 4KKGA 1UU7A 5J95A 4GUEA 4LM5A 2WMRA 5HLPA 5TO8A 4QP8A 3TNHA 4HPTE 5IA4A 4U44A 3D5WA 3VBWA 4LQMA 5CEIA 4F9YA 2X6EA 2X2MA 1UV5A 4G5JA 4GG5A 4GFGA 2WMXA 5LVNA 3DXNA 4JBVA 5DEYA 4FG8A 4GS6A 5HIDA 3IPHA 5BUJA 3NEWA 3GNIB 3N9XA 4CLIA 5J9ZA 3PG3A 4E6DA 1OI9A 4KKHA 5LOHA 4B7TA 4DTKA 2YIQA 3U6JA 2DYLA 2XKDA 4JAIA 2RFDA 4GYGA 3CP9A 3ZRLA 4JRVA 3Q4ZA 4DFYA 4DEEA 2OW3A 3C4EA 4FT9A 4QEBA 4G9RA 2QU5A 2UZWE 3B8QA 3GU4A 3MFUA 4O82A 4U42A 4L53A 2JIVA 5A6NA 3ZO1A 4GT3A 5HVKA 3BBTB 4FYOA 4RFYA 4X2NA 3OG7A 5KMKA 4U7ZA 3R8UA 3MY1A 4V04A 5JFVA 4O0XA 5DT0A 2ZFYA 3VRZA 4E6CA 5HVYA 3GC7A 3BWFA 4D5HA 5FDXA 3W10A 5EKNA 1DI8A 2Y4IB 4CXAA 4EWHA 3F5GA 4Y72A 3QQFA 4IX5A 2CPKE 3R9NA 3IECA 4MEDA 3VJOA 5EOLA 2X6DA 3W32A 4P5QA 3EN5A 4TRLA 1VYZA 2QC6A 3LXNA 4O0SA 3GVUA 3Q4UA 5HTBA 5JFSA 1XWSA 1R1WA 4GJ2A 2W05A 2XJ0A 2YCQA 4K9YA 1BYGA 3W0NA 1SZMA 3AC3A 2WNTA 4C33A 5AUYA 4AW5A 4EC8A 4QMNA 1UNGA 2I1MA 4UZDA 2R2PA 2WQNA 3NUXA 2QKWB 2PSQA 2Q0BA 3A4OX 3BHTA 3MB7A 2W1HA 1P2AA 3HL7A 4XV2A 4DTAA 3BI6A 2WO6A 5HG5A 3R7EA 3OF0A 4A9YA 4MXXA 4MVFA 3A7JA 4EUTA 4FT7A 1ZZ2A 2H9VA 4AA5A 4CMOA 5JFWA 3PP0A 4E4XA 2GS7A 4E93A 3F2AA 5IUGA 5K4JA 3FMLA 4BCPA 4EHZA 1W98A 4QMXA 2F9GA 2ZDTA 2QCSA 3CE3A 3V8SA 4DEDA 3QTZA 4FT5A 4O7YA 5HX8A 4FL2A 4MBJA 4DEAA 4IWDA 1PY5A 4C62A 3PY0A 3WF9A 3W0QA 4EOJA 4E20A 3DLSA 4H58A 2UVXA 5FDPA 4YSJA 4ASXA 4BBMA 4EK5A 4X21A 2P3GX 3KXXA 2FYSA 2X8EA 3LCSA 2VWYA 1NXKA 3LXKA 4L7SA 4TN6A 4J99A 4BDFA 4NYEA 3A7FA 3W8LA 4AW1A 4QMSA 3MFSA 2W1GA 2XBAA 3ZDIA 5BVDA 2ERKA 4Y95A 2OKRA 4JAJA 5HE3A 3R6XA 1TQMA 3OY1A 3EMGA 4NU1A 4AU8A 3D15A 3OCTA 2YHVA 3PY3A 2WMWA 1A9UA 3EL8A 3SAYA 3SXSA 3V04A 4H3PA 2BVAA 5D7AA 4BDKA 4IJPA 5AP5A 4IH8A 4BDIA 2A2AA 1R39A 4JG7A 4YZ9A 2GPHA 3V5QA 5LVPA 1JAMA 2BHHA 4X0MA 3VJNA 2OK1A 4RC4A 4YHTA 5C8MA 3TKUA 2E2BA 2VTRA 4AXFA 5CF5A 2CKQA 3HA6A 4E26A 4AFJA 4D4YA 3DU8A 3ZUTA 4ASZA 3M1SA 3O8UA 3R8LA 3LFAA 3DA6A 4OTHA 1Z5MA 4I3ZA 2OFUA 3RPRA 4IIRA 3OMVA 3R9HA 3VRYA 4DA5A 3UIMA 2JBOA 4EUUA 2W0JA 3MTFA 3PE2A 4PUZA 4FEQA 1WAKA 3IONA 3L9PA 3Q96A 4PDYA 4W4WA 3W0SA 4E6AA 2W1DA 2HYYA 4F0GA 3A61A 3AC2A 3C4CA 4YC8A 3TJDA 4I5HA 4ALWA 2CKEA 4ZMEA 5JQ8A 3DQWA 5EDRA 3U9NA 3QQKA 1MRUA 2ETRA 3PYYA 1S9IA 2FGIA 3BHYA 3F3WA 4EQCA 4FSYA 4ZSEA 1OL7A 5DYJA 4EQUA 5JGDA 3D94A 3G9NA 3T9IA 4MQ2A 5GNKA 3PPKA 1O6YA 3NX8A 4RJ3A 3OT8A 4S34A 1UWJA 2W96B 3ZDUA 3V5LA 5IG1A 1YHWA 3VN9A 2OH0E 4XG2A 3OC1A 4O2PA 2A4LA 3E5AA 1GIJA 4AXAA 2ITQA 2CGWA 2XB7A 1JKKA 5EKOA 4PY1A 2YDKA 3PRFA 3KQ7A 3DBFA 4ITIA 4ERKA 3Q9XA 5E90A 2J5EA 1RE8A 3OCSA 5L6WL 4LMUA 2J6MA 1KE6A 4OTRA 5EQYA 3E62A 4XV9A 3QD0A 1FMKA 3QUDA 4IX4A 1H00A 4YJQA 4D55A 2PUUA 5FXSA 2YM7A 2WAJA 3R73A 3RZBA 4ANLA 1XQZA 3QRUA 4J98A 2CHLA 4O7WA 4QMTA 1WBWA 4JVGA 3H3CA 5EW3A 4BR3A 4FSTA 4HVDA 5LMKC 4O6EA 4C2VA 2R3KA 2WTJA 1ZMVA 1ZY5A 3NUNA 4M97A 4TY1A 4D2RA 4BCQA 3C13A 3VUHA 3GCSA 3F2NA 3KU2A 3EOCA 1OB3A 2J51A 2VD5A 4EOMA 4J8NA 5J8IA 4GMYA 2QLQA 3ZYAA 4FT0A 2E9VA 3QU0A 4QDEA 1B38A 4NW5A 3PPJA 5ETIA 2B53A 4YP8A 4IVBA 5B2MA 2VTJA 4YLKA 3CPCA 2B0QA 4UYAA 3ZM9A 5L2SA 3D14A 3G33A 1WBPA 4XG3A 5C1QB 3FJQE 4IANA 3R8PA 3HA8A 4C02A 4NK9A 4CT2A 3W18A 5JH6A 5FM2A 2GNGA 4I23A 4ZSAA 5AM6A 2O5KA 1H0WA 4E73A 3MN3A 2YITA 3QTSA 4DH3A 3UODA 4A9UA 2PUNA 2WTKB 4L3PA 2XK9A 4WIHA 4YJUA 3CQWA 4F9WA 2E9PA 2ETMA 3H9FA 3KXGA 4XH6A 3EN7A 5DRBA 5EFQA 2F2UA 4JXFA 5L8JA 2HWOA 4FV7A 5DFPA 2FO0A 2UZEA 4RJ8A 1FPUA 1G5SA 3PA3A 2RIOA 1IA9A 3PFQA 4WNKA 2EXCX 3OW4A 1YW2A 2WMTA 2BKZA 5KMOA 3F6XA 3DLZA 3OWPA 4BDHA 4U9AA 3IDPA 4FZFB 4G9CA 3QD3A 3DV3A 4AOIA 2PMIA 1YXSA 4K33A 1LEZA 4NTTA 4QMLA 3A8WA 4YSMA 3CY2A 3HRBA 4CQEA 5HG8A 2B4SB 3I0OA 4YUQA 4L44A 3CCNA 1JBPE 1PYXA 3LJ1A 3BLAA 3IK3A 2RFSA 5BX0A 2VTOA 3SOCA 3OFMA 3PVWA 3EKKA 3P5KA 3SLSA 2CN8A 3UG2A 2Y8OA 4X6QC 2O0UA 1M7NA 5HE2A 1Q8UA 2F7XE 3CJGA 2BAQA 1UKIA 2GMXA 5BPYA 4MD8E 4RWIA 4L3LA 3TCPA 4C3PA 3EJ1A 2QKRA 5HLWA 4FL1A 2FH9A 2XKCA 4NTSA 4K6ZA 3HKOA 3I6UA 3LLAA 2OBJA 4FEXA 3ANQA 3UTOA 4AN2A 3QC4A 4F99A 4QYGA 3ZUVA 1WBTA 4FTLA 2WIHA 5IQFA 3RHXA 5FBOA 2CKPA 2IWIA 5FP6A 5KMMA 3UVRA 4DH1A 1J7LA 3I0QA 4ZJVA 1JSTA 3KVXA 4KIOA 5AV3A 5E8WA 5EM5A 4AZSA 4DFUA 4KKEA 4OTWA 3I7CA 1U54B 3QWJA 3ENHA 3TUBA 1MP8A 2Z7QA 4N6YA 3ZTXA 5BYYA 4U8ZA 5HE0A 2OU7A 5LXMA 5BUIA 3DXQA 5CSHA 2CN5A 4FSUA 4RWJA 4IHPA 4KBAA 1JLUE 4QMVA 3PWDA 5KKRC 4FL3A 4JIKA 4PTCA 2WTCA 1JSVA 3F82A 4LRJA 2YABA 4DH5A 3TTJA 3FC1X 4FV0A 4QYYA 5EYDA 1XR1A 1VEBA 4XV1A 3D7TB 4U43A 1Z9XA 3HV6A 3F61A 2GHMA 4IZYA 1YI6A 1YOJA 2BTRA 3OVVA 4B99A 2GQGA 3CKWA 2PZ5A 4E4NA 2BFYA 1H24A 4FKJA 1APME 2PVFA 2XKEA 3UC4A 2B1PA 5CT0A 4Z55A 4XG4A 5HORA 4CFWA 1K2PA 2C6OA 2X81A 3V51A 4BDJA 1UKHA 4EKKA 5IA2A 5EI2A 3BL9A 1GZKA 4RJ6A 1PXIA 4X2FA 4FE2A 4DG2E 2C4GA 3QCQA 2QHMA 2RGPA 5E8ZA 3RM6A 3PVUA 2R9SA 2XANA 3IO7A 5D7VA 2EWAA 5CU2A 4RZVA 3RTPA 4KB8A 4MBLA 1KOBA 1PXNA 1E1VA 1MQBA 2JGZA 4QYEA 3LJ2A 4LL0A 5CU6A 3F7ZA 1GZ8A 2PY3A 1G3NA 3FY0A 3G9LX 5ETCA 4QQCA 4RRVA 3MB6A 1H0VA 2GHGA 2X1NA 3ULZA 4S32A 3QA0A 3EQRA 3QD2B 4OGRA 3TMOA 2PTKA 2X4FA 4MCVA 2IVVA 3EYGA 1GNGA 1GAGA 5F94A 2C3IB 2NYAA 3VS4A 2WQMA 2JKKA 2WFYA 4CKRA 3V5WA 3MA6A 4JDHA 2PVHA 1H4LA 4IFGA 3JUHA 5AUTA 3HECA 4NCTA 4XS2A 4NSTA 1OL2A 2Z7SA 5FG8A 4FBXA 4TYHA 4EJ7A 4LV5A 2JDVA 3QKLA 4AG8A 3NRMA 2BZHB 5EHLA 1OPJA 3FLQA 5LVLA 4P7EA 3ZU7A 3R63A 3I60A 3ZSHA 3Q6UA 3R04A 3ZXTA 2BFXA 3NS9A 2QONA 4RFZA 5DN3A 3OCBA 5HO7A 3C4FA 3COMA 3UGCA 2B9FA 3DNEA 1JSUA 2AYPA 3GC9A 4LDTA 2BR1A 3IKAA 4M0YA 4RWLA 4A4OA 3MPAA 2YM6A 3QUPA 4RIWB 2WMUA 3FQSA 3AOXA 4IAAA 2UW0A 3A4PA 3DY7A 5CQUA 5CY3A 2C6EA 2XBJA 5HCZA 3FKOA 3KB7A 3UZTA 4BCNA 5EHYA 3W33A 1ZYJA 1PXMA 2C5VA 3NNVA 4BI0A 1REJA 3ELJA 2HIWA 4AW2A 2BKKA 2BZJA 2KTYA 4ZJJA 3MFTA 2HY0A 4C4FA 2VRXA 4R1VA 4TTHB 2UZNA 2VO7A 3VWAA 4GRBA 5AV2A 1FQ1B 3WZDA 3MIAA 4XYFA 1P4OA 2ZJWA 3EN6A 4IC7A 4OUCA 2C5NA 3R7IA 1OITA 4AOTA 5CQWA 3UDBA 4QO9A 3FAAA 3PJ2A 3KN6A 5TOZA 5K4IA 4M67A 3LFNA 4IAZA 1HCLA 5DPVA 4O96A 5HBHA 4P90A 4FX3A 3A7GA 3EQPA 3M42A 4BDGA 2R3IA 1SVHA 3ERKA 4IM3A 4FNWA 4YO4A 4JJRA 4MXAA 4JDJA 4BDCA 1ZLTA 2Y6OA 4PMMA 5ACKA 5CVFA 2GTMA 3BU3A 3N4UA 3JY0A 1W83A 2C5XA 5IDNA 5L3AA 3EN9A 3CGOA 3FHIA 4M0ZA 2VX0A 4BGGA 4EI4A 1ZWSA 4FTNA 2XEZA 4RMZA 2BHEA 4QQ5A 2CNQA 4L7FA 1YI4A 4O7TA 1OL6A 4Z3VA 5KZ0A 3I7BA 2XK3A 1T45A 3S1HA 4I6FA 3ZC5A 2YWPA 4BDDA 5E92A 1GIHA 2IZSA 4Q5HA 1IEPA 2LGCA 2NRYA 1AGWA 1ZMWA 3RGFA 4GT4A 3P0MA 1DAYA 3FDNA 4R6VA 3VUKA 2ZV9A 4TYGA 5AP4A 4XRLA 1H25A 2QG7A 4W8EA 4ASDA 1VJYA 2YCFA 5CVHA 1O6LA 2VGPA 1H08A 4WT6A 4EONA 4ZZNA 4JMQA 3MVLA 5KE0A 3Q53A 3QHWA 3EYHA 5C8NA 2BRMA 5C4KA 3VS1A 3OT3A 1URCA 3HV4A 3MPMA 2J90A 4BBEA 3ZBFA 3ORXA 3ORKA 3FY2A 1U54A 3BEGA 2XJ2A 1WMKA 3SD0A 4FG7A 3TTIA 5EOBA 1JVPP 2BPMA 4FVQA 4XCUA 4DLIA 1J1BA 3PY1A 2I6LA 3P5JC 3QZFA 3AT2A 4YZMA 1M52A 5DRDA 3UO6A 2J5FA 4DAWA 2F7EE 2OF4A 2PU8A 3FPMA 1H01A 1L8TA 1ZYSA 4DG3E 5HZNA 4FKQA 2E9UA 2JDSA 3GENA 1TQPA 5E7RA 4C4GA 4Y73A 4TXCA 4BZNA 2RG6A 3H4JA 3TDWA 2OZAB 1ZOGA 4QP9A 4EOQA 2WPAA 4HVSA 4F6SA 3FZ1A 5E8XA 4JL9A 4CLJA 1NY3A 4BCMA 3A62A 1Q8YA 3UG1A 3VW8A 4BY9E 4WUAA 4F63A 4O7NA 4A4LA 2OSCA 4YJRA 2J0MB 3QQHA 3U51A 4PMTA 3G6GA 1VR2A 2XK6A 2IW9A 5L2WA 3UIUA 4QDVA 1OUYA 4QMUA 1B39A 4U6RA 1VLRA 3VUDA 3D9VA 2P4IA 2YDJA 4CCBA 3LM0A 5I9XA 4O81A 5L8KA 4M13A 5HCXA 4O91A 3MJ1A 3NAYA 2AUHA 4H3BA 4FTQA 3OROA 4QYFA 3BYVA 4S31A 1WZYA 4RPVA 4D28A 3LIJA 3E3BX 1Q41A 4TWNA 3KXHA 5LARA 5D12A 3F9NA 4I41A 4K11A 3ZBXA 4AA4A 4DYMA 4K2RA 4NH1A 4Y83A 2VTPA 5T6KA 2E9NA 5JEBA 3UE4A 2WKMA 3NNWA 4I22A 5D41A 5LCJA 4ZTQA 4ZTLA 4KRCA 5F1ZA 5AEPA 3NPCA 2JLDA 4MXZA 4C2WA 5M57A 3CTQA 4KRDA 5K3YA 1FVRA 1GZOA 4QNAA 1FOTA 2CNUA 3FMNA 4G6NA 5FEQA 5AA9A 1Y8YA 3OY3A 3UC3A 4FYNA 4ZAUA 3AC5A 4YTFA 2ITYA 5C01A 5ANGA 4FSMA 1YDRE 3Q04A 3SOAA 1PMVA 4RIYB 1Q3WA 4QQTA 1UU8A 3FL4A 2VUWA 3DKFA 3AT4A 4BTKA 5CEMA 1JQHA 3F5PA 4XG8A 5B2LA 4QMOA 5GIPE 3QCYA 3ZZEA 3W0OA 4WOVA 3I5NA 3EL7A 3UNZA 4IVCA 4IAFA 4K77A 3SX9A 3IG7A 4JX3A 1YXUA 4X3FB 3W2CA 5AA8A 3E93A 4FEUA 3WARA 1YRPA 3Q4TA 2J7TA 1J7IA 3FLNC 4I20A 3II5A 4HYHA 2GQSA 2O2UA 3ZFXA 5F9EA 3WZEA 5J7HA 1IRKA 4QP3A 5EW9A 3GCQA 5E1SA 3CBLA 2OH4A 5GJFA 3UNKA 3FMHA 2YACA 2WTVA 3QUEA 2ITWA 4YNEA 4ZEGA 2OJJA 4U5JA 4WRSA 1YOLA 2PUIA 4GIIA 4ZXTA 4EH9A 2R3NA 4J96A 3KFAA 1XO2B 3D2KA 4YTCA 2R3GA 4AP7A 2EB2A 1UNHA 5A4CA 2VV9A 2NO3A 2G2HA 3ETAA 2XIZA 4L52A 4HVHA 1PKDA 4I6BA 1Q4LA 4QMPA 2YZLA 3MDYA 5AADA 2XZSA 4F09A 4J95A 5L6PA 3S0OA 3PSCA 4QT1A 4AN3A 4H36A 4E4MA 3FL5A 3I79A 4HW7A 4ZY6A 3TUCA 1O9UA 5B0XA 4JNWA 5IQAA 3UO5A 2FA2A 3P08A 1U46A 5IMXA 5EDPA 4U3ZA 5KMNA 5E8UA 3GT8A 2UZBA 4FIIA 2PUPA 4FKLA 3KF7A 3HUCA 2GHLA 2VN9A 2YIXA 3ID6C 3PSBA 2PVMA 3UVQA 3VUIA 4DH7A 4JQEA 3D83A 3S4QA 5AP1A 2R3JA 1MUOA 3UDSA 2XM8A 4F70A 4FNYA 1BLXA 5K9IA 4FV2A 3JR1A 5FD2A 4AE9A 2XF0A 3FZPA 1WCCA 2GCDA 4MH7A 3HVCA 1V1KA 4RX7A 5JGBA 2V5QA 2ONLA 3R1QA 4PDSA 4K18A 3ZUUA 2YCSA 4BHNA 3BU5A 4MWHA 4R1YA 4D5KA 4FKUA 2YM5A 3EFWA 3HLLA 4MKCA 3HAMA 3KCFA 2QOKA 4WSYA 4RLKA 3ROYA 3VS5A 1FGIA 1FVTA 2YJSA 3O51A 1VZOA 4UALA 2R5TA 4XX9A 4RFMA 4A7CA 4TYJA 3KF4A 4BYIA 2ZOQA 3LZBA 5I0BA 2GS6A 3RK9A 4FTMA 4FVRA 3RPYA 4BCGA 2XNEA 5C26A 1GZNA 3SA0A 5EH0A 2DQ7X 3MIYA 4F7LA 5CVGA 1LP4A 3R7VA 3RWQA 5AUUA 3DS6A 3MSSA 1P4FA 3C4XA 2FSOX 3OTUA 5LWMA 1P5EA 3MYGA 5JK3A 4XP0A 3Q9WA 3PDTA 3LCDA 3LVPA 3LOKA 3BE9A 3QBNA 3PLSA 4FSRA 3O96A 4FGRA 3SC1A 1REKA 4ID7A 3U9CA 2XNBA 4G1WA 3PJ1A 3ITZA 3VQHA 4A4XA 4EOIA 3KXNA 2Z8CA 3KMUA 5IUIA 4UZHA 2G01A 4CG8A 1IG1A 3PA4A 4X7QA 4G3EA 4KA3A 2VNWA 4G3FA 2YCRA 3DK3A 4J8MA 4ANMA 2HOGA 3ZZWA 4FKVA 4HVGA 1MRVA 4HYIA 2R3FA 1FVVA 1WBNA 2XCKA 4O86A 4PX6A 4ZIMA 4AZWA 3TIYA 2J2IB 4EQMA 2UW5A 4DEGA 5HBJA 2PMOX 4MD9E 4X2JA 2HW7A 5BMSA 4I0RA 4MNEB 3QKKA 3FPQA 3FMKA 3R9DA 3S2PA 4WBOA 3V8WA 1CSNA 4F65A 4CV8A 2XUUA 5EK7A 3DZQA 4QMQA 1LUFA 2PE2A 3NW5A 2BAKA 3PFYA 4Z7HA 2XIRA 4IAYA 3GP0A 4MBIA 3ZEWA 4DDGA 4F78A 4PRJA 2EXMA 3WIGA 2BDWA 4YZBA 3KMWA 2JFLA 4KSQA 2XVDA 2XMYA 3GCUA 3QTUA 5IQEA 2PZYA 3AC4A 3ACJA 4DFLA 5B2KA 2I0VA 3CC6A 3Q9ZA 5C27A 3MH3A 5TR6A 2XYNA 5M08A 2QR7A 3CLYA 3ZLSA 4R7HA 4X6RA 3BE2A 4ZY5A 2PWLA 4FTJA 4RIYA 4PMPA 4AA0A 2I0YA 1V0OA 2ERZE 3RAHA 3S95A 3VBVA 2B9IA 4OR5A 2C6LA 1PXPA 4II5A 4AXEA 2VTQA 1SVEA 1IASA 4JR7A 4BYJA 3NYXA 4DT8A 3SKCA 2F57A 4V01A 4O0RA 3ZO4A 2QI8A 3LCKA 3OOGA 3ZO2A 4CZTA 4CEGA 3KXMA 4BB4A 3LMHA 3O17A 4O6LA 4BI2A 3GCPA 3Q60A 3OBJA 1OKVA 2AC3A 4WRGA 5DBXA 3ZMMA 2GNJA 2W7XA 4QPSA 4EH7A 3IW4A 2WMQA 4P2KA 2E9OA 4Q5EA 4QTBA 5J9LA 4HGLA 2WXVA 3TG1A 3L8SA 4RC2A 1FINA 1BI7A 5JZJA 4CTCA 4ZTNA 2IZRA 2YWVA 4RZWA 4AGUA 5IA0A 1WBSA 2ZM1A 3UIBA 4EZ3A 3TJCA 4E1ZA 4NM7A 3GU5A 4R78A 5FQDC 3FE3A 4O22A 3HX4A 4HGEA 3OD6X 4IAKA 5HCYA 3DJ7A 4R5YA 4C3FA 3NUYA 1IAJA 3PA5A 4I93A 2QOFA 4DFZE 1YXVA 2Y9QA 2IW8A 1PW2A 5M56A 3DJ6A 2PK9A 5M4UA 3DDQA 3O71A 2BTSA 4LYNA 3BV2A 3PXKA 4O7VA 1QL6A 3VBQA 2HW6A 3FI2A 4FSNA 4JBOA 4XP2A 4DCEA 1H1RA 5FP5A 2A0CX 4TZRA 4NJDA 3W16A 4EHVA 2ZV8A 2RG5A 4FMQA 5CS6A 4FG9A 3Q32A 2Y6MA 4N70A 2RFEA 1K3AA 4L46A 1KWPA 5DI1A 2GNFA 1OIUA 2W9FB 3VO3A 3VUMA 4BGQA 1BUHA 4EK6A 5CAVA 3LPBA 2IVTA 5ICPA 3MGYA 2X39A 5AV1A 3VF8A 3MFRA 3GXLA 3KRJA 4G17A 4MUQA 4YJPA 3HDNA 1AQ1A 3CTJA 4WA9A 2ZB1A 1BI8A 1Y91A 3EQFA 5ANDA 5DWRA 5DH3A 3QTWA 2WTIA 3FI8A 3QTIA 3UYTA 4CKJA 4USDA 4S2ZA 5EDQA 1I09A 1G8KA 4GG7A 3MY0A 3EWHA 3VONA 4XOYA 2IG7A 2XK7A 4PDPA 5E4HA 3TN8A 3AKLA 4C4JA 2V0DA 3TACA 4DFXE 4EJNA 4BN1A 3UZRA 2ITUA 4GH2A 3AQVA 5CZIA 3ZCLA 1ZAOA 4ORKA 4QP4A 2NP8A 3EQCA 2VX1A 3TT0A 3ML1A 5FBNC 3REPA 1PXOA 3Q2JA 4C3RA 4KBKA 4WNOA 1XBAA 1BL7A 4BCFA 5KO1A 4NM5A 3RAIA 2YZAA 4ERWA 5GJGA 3A60A 1R0PA 4DGGA 4UEUA 2YM4A 4RBLA 5A14A 3ZHPC 2OG8A 4ACMA 5HD4A 3R83A 2V7AA 5ITAA 4D1SA 5A9UA 2BIYA 4DGNA 1RJBA 3V6SA 3NGAA 5LMBA 1QPEA 3PXQA 2R3MA 2R7BA 3QQGA 2CLQA 2XNMA 2P55A 4LI5A 1YI3A 4FIFA 3EIDA 5FEDA 3S3IA 3ZFMA 5HEZA 3D2IA 3U87A 3C0IA 4AN9A 4M69B 3NZ0A 1IAHA 2BZIB 4E7WA 2JD5A 3MPTA 2REIA 4C35A 4EH4A 2R0IA 3BLHA 1UA2A 3G90X 5AP6A 4WO5A 5E9EA 5I9UA 1Q24A 4OTGA 3BGQA 5CXHA 2HZNA 5AX9A 5M4FA 4CFVA 3Q3BA 3Q52A 3ANRA 3VS2A 3ACKA 3E87A 4MNEA 4TWOA 3VHKA 3GOPA 1I44A 4YJVA 3F88A 5CLPA 3BRBA 1UVRA 3MBLA 5FGKA 1G8JA 2PMNX 3DB6A 4G6LA 4IB3A 2OIQA 3NMUF 4IM2A 1KE7A 3EZVA 4KSPA 3KRXA 3A8XA 3KCKA 4PQNA 5BQ0A 4DEHA 3NIEA 5KBQA 4IADA 3ZRMA 2VWVA 4MXYA 2ITNA 3LM5A 4JQ7A 1TFFA 1QPJA 4WNMA 4WNPA 1ZYDA 4AUAA 1ZMUA 4UN0C 3F66A 3F69A 5A4QA 2QOBA 3UPZA 4FKGA 4RJ7A 5AUZA 4NKSA 3IDBA 5BYZA 3CY3A 2WQOA 3BYOA 4FJVA 1M2RA 5AV4A 2C68A 4MX9A 3K5VA 3BEAA 4LV7A 5I5ZA 4LMNA 4LGHA 3VVHA 3SG8A 3HUBA 5CT7A 2XIYA 4EORA 4XG7A 2BRGA 3E3PA 4C34A 4S33A 1YHVA 2VTIA 3MI9A 1CTPE 2UUEA 2JBPA 2ZMCA 3LAUA 2UVYA 4YURA 4L43A 2DS1A 3FKLA 3DBDA 4IZ5A 4NIFB 3SVVA 1JKTA 4GCJA 3PXFA 4FSZA 2OJ9A 2JIUA 3NYNA 2BRBA 2UW4A 1QMZA 2WMBA 2X0GA 3EQBA 1CKPA 3HEGA 4IEBA 3TZ7A 5M07A 4XLIA 2I0HA 4U41A 1OKZA 3JS2A 3QXPA 4NWMA 4QMMA 2J0KA 4PTEA 2PL0A 1H1QA 1OGYA 3FWQA 4AXCA 2NPQA 2V22A 4RWKA 3ATSA 5HLNA 1JKLA 3AG9A 4ZSJA 2IW6A 4AQKA 3IOPA 3UQFA 2J4ZA 3R1SA 4ZK5A 4YC6A 1SVGA 5LMAA 4XHKB 4JLCA 4L9IA 4FC0A 4ANSA 4YJTA 2A27A 3M11A 3ORPA 4FKRA 2R64A 4RA4A 3NVMB 2JFMA 5HNBA 4AT5A 5CAOA 4YJOA 4KIPA 5IA3A 4PV0A 2O3PA 3O8PA 4QTCA 1Y8GA 3HYHA 5BVEA 3TKIA 4AACA 4FIEA 5CF4A 2J0JA 4FV4A 5EQPA 3R7UA 3TYKA 2IO6A 4FV8A 4XMOA 5EM8A 3SQQA 3TZ8A 3UYSA 3PVBA 4RX8A 5DHJA 3A99A 4FKIA 3O8TA 4W4XA 2VWXA 1T46A 3NNXA 4F08A 3V8TA 2GTNA 2HCKA 1Q97A 5JRSA 3VHEA 4APPA 2CKOA 4RQKA 4YZDA 2OXYA 4F7NA 5AFVA 5I9YA 2W1ZA 4KWPA 3VF9A 4ZJIA 4WHZA 4RVLA 2XRWA 3U4WA 3CTHA 5IQGA 4JR3A 3OWKA 2C0TA 3WZJA 4XNEA 5HTCA 3T3VA 4HJOA 1BKXA 3CQUA 3WYXA 4BTFA 3JPVA 3UOHA 4CFXA 2YAAA 1S9JA 2VTMA 3F5XA 3R30A 1SMHA 4TPTA 1NT2A 4AZEA 3CEKA 2RKUA 3O23A 2W17A 5CALA 4FGBA 3GUBA 4LL5A 4ZP5A 1UU3A 3NWWA 5HD7A 3PXYA 3RPOA 1QPDA 4BTMA 1R78A 3QQJA 3PE1A 3FLZA 2FSTX 4ANBA 3FLWA 2R3QA 3DTWA 4KINA 3BHHA 4UWCA 1IR3A 2BROA 5DR2A 4L67A 3UIXA 4WG3A 5AP0A 2HXQA 3BQCA 3PJ8A 5EM7A 4R7BA 3TNIA 3NFGB 3KK9A 4RVTA 4ENYA 3QZHA 4I5PA 2C47A 2V55A 1YXTA 3DK6A 3VC4A 1Y6BA 2XNPA 2GQRA 3EB0A 4E5WA 4I5CA 4M3QA 3NYOA 3ORIA 2NNWB 2P2IA 2PVNA 3QLGA 4HZSA 2QOQA 3Q5ZA 4O7LA 3SXRA 4ALVA 5IISA 4RLLA 2P0CA 3VIDA 5F4NA 3E88A 4RGJA 2PVJA 3QCXA 1KE9A 2QHNA 3AKKA 1SNXA 5KKRB 3GI3A 3TNQB 3VNTA 4EL9A 5G6VA 3TEIA 3W2QA 4G31A 2O64A 4OTQA 4Y5HA 1XH8A 1ERKA 3ALNA 1OBDA 4IZ7A 4J1RA 2QOHA 2PZPA 4DG0E 3PG1A 4D4SA 4B4LA 3PLAE 4C36A 3OOMA 5IQDA 4FIGA 2OJIA 2QG5A 3HGKA 4ZLOA 5E91A 3ZO3A 3ORNA 4XG9A 2C3KA 3OCGA 2Z2WA 5A4TA 3G51A 4JBPA 3DJ5A 3FZTA 1Q99A 3OHTA 1JKSA 2XNGA 4CG9A 1GJOA 1XMMA 2VNYA 3FI4A 5D1JA 2UV2A 3KRWA 1M17A 2BALA 3HMMA 3K3IA 5AP3A 3MA3A 3O5AA 4RJ5A 4U40A 1Y57A 1NVSA 3UBDA 1W82A 4QYHA 5CSVA 2XJ1A 5F95A 4AF3A 4DTBA 4RIXB 2QODA 3FZSA 5E8VA 5HNGA 4HVIA 3NUAA 1E9HA 4FTRA 2I7QA 1KE5A 3OBGA 5CI7A 4IB5A 2Y4PA 5AM7A 5IMEA 3TWJA 3HZTA 1U5RA 2C5YA 2QO7A 3QHRA 4B8LA 3H9OA 3P9JA 2QQ7A 1DS5A 4F6WA 3LFEA 1PMEA 2AEGA 2WIPA 3R28A 4TYIA 4RIOA 5D10A 4IC8A 1WVWA 2F2CB 3CJFA 3UMWA 3DBCA 4KAOA 3VS0A 4NKAA 4PP7A 5IZFA 4TNDA 2C1BA 4BDBA 3EZRA 3L9LA 4KIQA 3HRCA 5BVNA 4DINA 3N4TA 2QLUA 1ZY4A 3SXFA 5LMKA 3V6RA 1SNUA 1BX6A 5C4LA 4RJ4A 3AGMA 3MH0A 5KHWA 3FC2A 4Y5QA 4UBAA 3WF7A 1B6CB 1F5QA 4FKTA 3ZSGA 2ITVA 3KXZA 3C0HA 3LFDA 5FXRA 3P1AA 5IPJA 3CGFA 4FKPA 3JYAA 3QYWA 3BIZA 2B9HA 3DT1A 1PKGA 4F0FA 1CM8A 1Z57A 4O38A 5CTPA 3P78A 3IW6A 3KA0A 3RI1A 3QFVA 5ETFA 3TM0A 3TZ9A 4I94A 4FTUA 5AAFA 3L8PA 3DXPA 5JZNA 4BCOA 3AXWA 3RAKA 2VTHA 4YBJA 5C9CA 4EOSA 3ORZA 3GBZA 5KBRA 1FGKA 1OZ1A 2C6KA 2BRNA 2H8HA 2H34A 4DF3A 4HZRA 1NVRA 4U79A 3D7TA 3IW5A 4OW8A 2XALA 3HV5A 3K5UA 3LXLA 3MVHA 4DLJA 4AZTA 4BZOA 4O21A 3DKGA 4CMTA 1QCFA 3I6WA 4I0TA 1CMKE 3UP2A 4FZAB 4WG4A 3W2OA 2XCHA 4KS8A 4ZY4A 2PVLA 4EOOA 3P7CA 2BAJA 2HWPA 2GU8A 4FKOA 2WEIA 4FODA 1DM2A 2HXLA 3AMBA 2PZRA 3KGAA 4QMZA 2OF2A 3R7YA 2RFNA 2O65A 4FSQA 3PJ3A 4D0XA 4DFBA 2YEXA 4FTOA 4IVDA 4E8AA 3T8OA 2RF9A 4MF1A 3LCTA 2YA9A 3I1AA 5T68A 4K8AA 3TZMA 3PWYA 3BKBA 1U4DA 3SDJA 3FXXA 4BIDA 4H1JA 4D58A 3WIKA 1G8SA 2R3OA 4JG6A 4JG8A 3DKCA 4MQ1A 5CYIA 4C37A 3OUNB 2PVRA 4BGHA 4HCTA 3JVSA 3RVGA 5DR6A 5CAUA 4ACGA 3DTCA 4J52A 2C3LA 4JX7A 1H1SA 4UV0A 3QRTA 2UZLA 2HAKA 3TNWA 4BZDA 3DK7A 3BGPA 4PP9A 2O8YA 5BVFA 4FV6A 5KUPA 2R3PA 4IACA 3QZIA 4EH3A 4FZ7A 2PZIA 3FMEA 3F3UA 2OXXA 1H27A 3ALOA 5A4LA 2G9XA 4N4SA 2XAOA 3GCVA 4JQ8A 2AC5A 3GU6A 4OT6A 2Z7RA 4RQVA 4D1ZA 1P14A 4EOKA 4I4FA 1CDKA 3OWJA 5CASA 4PTGA 2B9JA 2GSFA 3AMYA 3QLFA 2B7AA 5IUHA 2JKQA 2Z60A 3UOKA 1JNKA 2C1AA 2UW8A 3ZONA 2XIKA 3HP2A 1Q8TA 3PPZA 2W5AA 3LFSA 5KNJA 3A2CA 4PL5A 4RIWA 2IZTA 5BYLA 3VS3A 5H2UA 3U6HA 2XM9A 2VWUA 4GW8A 3P7AA 4V0GB 3QGYA 4HYUA 3VS7A 5IEVA 3R00A 2YIWA 1XH9A 3DFCB 3HV7A 3I4BA 5AUVA 2XYUA 1M7QA 3V5PA 1Q5KA 1FMOE 3BBWA 4MXCA 5D9HA 3FZRA 4L68A 2GNHA 4A9SA 4IMYA 3WE4A 3QTXA 4DDIA 1SYKA 2ITZA 4YC3A 3WYYA 4I92A 1JWHA 3RAWA 4IB1A 4H1MA 4A9RA 2PE1A 2OGVA 5H8EA 5AUXA 3RP9A 5M06A 5AJQA 2YERA 3ZRKA 3AC1A 4JBQA 4KD1A 3F5UA 3ULIA 3UQCA 2ZM3A 3D5UA 3FXWA 3AKJA 1XJDA 4X2KA 4YBKA 2WQEA 2WMSA 4AFEA 3JVRA 4NFMA 2Z7LA 3BU6A 4QRCA 2I40A 3FYJX 4R3RA 3RK7A 4EH6A 1XMLA 3OW3A 4FOBA 3DPKA 3TKHA 5ACBC 4RIXA 4PDOA 2ITXA 3EH9A 3P4KA 4AGDA 3F3ZA 4JI9A 4IW0A 3RPSA 4AGCA 3FEGA 4JDKA 3MH1A 2GNLA 2BUJA 4F9AA 1DI9A 1X8BA 4EZ5A 5CANA 3DAEA 3EQHA 3N51A 4ITHA 4FUYA 4FEVA 5H3QA 1YWNA 2JITA 4YPDA 3V5TA 3ZSIA 2X7OA 4ZTRA 4ZLYA 3SHEA 2VO0A 1XBCA 2VWWA 4GIHA 2CDZA 3B8RA 4F1TA 1YWRA 4USEA 3H0YA 1OGUA 3QWKA 3PJCA 3HNGA 4JIAA 4XEYA 3DAKA 3IDCA 4RA5A 3TXOA 4YJNA 1F0QA 2EU9A 4L42A 2Y4IC 2CCIA 3CS9A 3TL8A 1ZOHA 4BCHA 4F64A 4NW6A 3CPBA 2F49A 4AZFA 3BWJA 5CX9A 3NLBA 4PNIA 5GJDA 2ZVAA 2WMVA 3D4QA 1JPAA 3GQLA 4WUNA 4CTBA 2R4BA 3R22A 1F3MC 5M4IA 4PF4A 2BILB 3C4ZA 1YWVA 3FBVA 2ZMDA 4GVJA 4QTDA 4IE9A 4EC9A 4YLLA 4EYMA 3ORLA 4BTJA 2CCHA 3EFKA 4F1MA 5DE2A 4ONAA 2C3JA 5FUTA 4IWQA 4XUFA 4QMYA 3E92A 1BL6A 3QRJA 3LHJA 2XNOA 2VWIA 5AWMA 4CT1A 2Y0AA 4YGAA 4ACHA 4U80A 2IN6A 3IOKA 4APCA 3UOJA 4G6OA 5B7VA 3W1FA 3R0TA 3L9MA 2OZAA 4FUXA 2UW3A 5AAGA 4JS8A 4C0TA 3AT3A 1ZYLA 4JDIA 1WBOA 4A9TA 1ZRZA 5DVRA 4FK3A 5FRIA 4L8MA 5IQBA 2C6IA 3G6HA 4XRJA 1H07A 2QU6A 4HCUA 3VAPA 4EK3A 2F7ZE 2UZVA 3CSVA 3A7IA 2W4JA 4I21A 5J87A 3PXZA 3NUPA 3I5ZA 2JKOA 4J7BA 4L45A 4RVMA 5L6OA 4FOCA 5ETAA 4ZS4A 1HOWA 4I6HA 2QR8A 5HBEA 1WFCA 4DHJA 4PMSA 4S30A 3ZXZA 4AT3A 3MJ2A 5L8LA 2PMLX 2ZV2A 2H6DA 4WKQA 4FEWA 4YU2A 2JIIA 3GFWA 4H05A 4CFUA 4DT9A 4FA2A 4ZOGA 5G1XA 2R0UA 4CGAA 1TQIA 2X4ZA 5FEEA 1SM2A 3NIZA 3LXPA 3L1SA 3DBEA 1OM1A 3ZLWA 5JQ5A 4Y46A 3GU8A 4NM0A 2V7OA 4YHJA 4D2SA 4G3CA 3C5UA 3EKNA 2VTTA 2X9FA 2HZ0A 4ACDA 4RC3A 5I9WA 3LQ3A 4B0GA 4PWNA 4E4LA 5ANEA 1V0PA 3BHUA 4GK4A 2QURA 4QP2A 5AIRA 2C6MA 2WB8A 4U3YA 3UDTA 5JMSA 3NNUA 4OBOA 2C69A 2UZUE 2ZB0A 3BHVA 4FTAA 4QP7A 2R3LA 4UXLA 4N0SA 4V0GA 4XJ0A 5DR9A 4DHFA 3D7ZA 4IVAA 4DN5A 3I81A 5HNIX 3KREA 2JKMA 4XLVA 3MTLA 1LPUA 2XP2A 5ANOA 3E7OA 5JN2A 5BVOA 3GOKA 3QRKA 1RQQA 4TWCA 1PYEA 2OICA 4EOPA 4FT3A 4QTEA 5C03A 5IQHA 4M84A 4RVKA 3MS9A 3RCJA 2WTWA 5J1WA 5GINE 3CIKA 4ZZMA 4JOAA 2UW6A 2ZM4A 3BYMA 2W4OA 3PSDA 1U5QA 4X3FA 4NZWB 2QNJA 5EYKA 3RMFA 4HNFA 4HPUE 5E1EA 3CQEA 3RKBA 3AD6A 3COIA 2PVKA 4J97A 1J1CA 3UO4A 4M8TA 1H8FA 5TT7A 1UWHA 3RINA 2EUFB 3W2PA 4C58A 3UPXA 3ORMA 3NCGA 1PMNA 4U45A 1IA8A 4D9UA 4F0IA 5EI8A 1ZXEA 4CCUA 4DH8A 2P2HA 4HGTA 4CRLA 4FIJA 5H8GA 2ETKA 5CXZA 3LMIA 2X8IA 1Q62A 3E8EA 4GK2A 3DB8A 1KV1A 2VO3A 3QA8A 3E7VA 5DT3A 5CU3A 4IX3A 3WI6A 4YJSA 4M14A 2HK5A 4NCTC 2JAMA 1WVYA 1XH5A 4FIHA 1U59A 3SW4A 3NFFB 1RDQE 2QO9A 4AGWA 4CSVA 3PUPA 3QXOA 3HMOA 3SV0A 3W8QA 4LFIA 4BCKA 2QO2A 4F9BA 2VWBA 3OXZA 1ZZLA 4JRNA 3RWPA 2BIKB 3L8VA 3W2SA 3ZLXA 1KUTA 2QOLA 3O2MA 1PRYA 4FI1A 4L01A 4GL9A 4ZSGA 4M12A 2ESMA 1M14A 3POZA 4R3PA 4X3JA 4CFMA 2ITPA 4DGOA 3C9WA 5HQ0A 3MW1A 3VS6A 5A54A 1J7UA 3RM7A 3UDZA 4XBRA 2XK4A 4O0WA 5CNOA 4CD0A 5AUWA 4EK8A 5IQIA 5DOSA 4D4VA 4I5MA 4IWOA 1AD5A 2GFCA 2DUVA 3KC3A 5FTQA 4Z9LA 3QX2A 3H0ZA 5A46A 4GSBA 3PUFC 4G34A 4BVUA 1ATPE 1NW1A 4FR4A 4MK0A 3HDMA 3ZH8A 5KMIA 2BRHA 4L6QA 4BKJA 1RW8A 2Q83A 2OI4X 3FI3A 4XV3A 2CSNA 5CEKA 5K5XA 4FTKA 2WTKC 2W06A 2ZV7A 2IJMA 3PXRA 4WBBB 3NDMA 4O0UA 4BDAA 4HNIA 4EHGA 4F6UA 3MWUA 2V62A 3NYVA 4KABA 4O2ZA 3VW6A 3T9TA 3AGLA 4FTCA 3ZEPA 4ARKA 4CKIA 3FLSA 4JT3A 3C50A 5HO8A 3JXWA 5BMMA 5DNRA 1Q61A 3ZS5A 3VULA 2OO8X 2J9MA 3QKMA 3GU7A 4AE6A 4BC6A 2OIBA 4CVAA 3MVJA 1Q8WA 5IF1A 5TKDA 3PVGA 3NW7A 3ORTA 4F4PA 4RSSA 2IVUA 4P5ZA 3EFJA 4H3QA 4IFCA 2XK8A 5CSWA 2F4JA 3LE6A 3QQUA 4CMUA 3U4UA 2WTDA 3M2WA 2X7FA 4FV3A 4B8MA 1H1WA 4BI1A 5LWNA 3PIZA 4N6ZA 3C51A 1STCE 2WHBA 3HAVA 5L2TA 4DGMA 5H9BA 2EB3A 5LQFA 2VTAA 2PPQA 5LVMA 3GFEA 4CRSA 3FQHA 2VWZA 1EH4A 5IQCA 4KNBA 1J91A 3KULB 3KEXA 3PZHA 5CNNA 5DT4A 2XKFA 4TYHB 3DCVA 2FUMA 4LV8A 4TW9A 5JFXA 3FMDA 3VBTA 4G5PA 4Z7GA 2C30A 4Y8DA 2JAVA 4AQCA 5A3XA 5A4EA 4NL0A 4C4EA 2WELA 2OLCA 2J0IA 1ST4A 4A06A 5JT2A 5E8SA 2YIRA 3DGKA 3R8VA 3IW8A 2X7GA 4C4HA 3D5XA 4O0TA 3VUGA 1XH7A 4XOZA 3W0PA 5AX3A 4U0IA 3H30A 4O0YA 1XH4A 3LFQA 5CSPA 5F20A 3TNPC 4PNKA 1OPKA 3BV3A 3D5VA 3LW0A 5IEXA 3LKMA 2C6DA 3LLTA 3QCSA 4ZS0A 1UU9A 4GYIA 3C7QA 3TV6A 4EH8A 5AP2A 4WD5A 3R2YA 1E1XA 5L2IA 3DKOA 4LG4A 4IX6A 2BMCA 3RK5A 4USFA 3ROCA 5HIBA 4K0YA 2ZDUA 3PZEA 2G1TA 3RCDA 5HHWA 2VX3A 1M2PA 5CI6A 2VU3A 4YHFA 3CR0A 4TYEA 4DFNA 3LMGA 4IQ6A 3O7LD 4M7IA 1ST0A 4NUSA 5DG5A 4MNFA 1TVOA 4HGSA 2BCJA 3GGFA 4AXDA 2O63A 5LCKA 1YDTE 4AW0A 5EI6A 3FMJA 1L3RE 2QOCA 4EEVA 5M51A 1O6KA 4FTIA 4IJ9A 4BJJB 3WILA 2QD9A 1R3CA 3GEQA 2OXDA 2W1CA 2UW9A 3FYKX 3JY9A 3R1NA 3FV8A 3NR9A 4CFNA 3CXWA 5HVJA 4FV9A 3BLRA 5J9YA 5M44A 4UYNA 2FB8A 1OL1A 3THBA 3NCZA 3QD4A 3B2TA 3OEFX 3V01A 1CKIA 2ZYBA 4ZSLA 3S00A 4TT7A 3H9RA 4YLJA 5CAQA 3C5IA 3EFLA 2WMAA 3Q9YA 4AT4A 1KE8A 3R71A 3KIOC 5HU3A 4ITJA 5FM3A 5I9VA 5CF6A 4QP6A 1OIRA 2JEDA 2XAMA 3DQXA 3U54A 3FKNA 5BVKA 3GC8A 2ITOA 4TWPA 4YZCA 1W7HA 1H26A 3OS3A 5BVWA 4M68A 4QTAA 2FSLX 3T3UA 5EYCA 4HCVA 4IAIA 2UZTA 4ZTHA 4Y85A 4YNOA 5M55A 3DDPA 4E5AX 3NUSA 1YHSA 4AS0A 2ITTA 5HIEA 1YXXA 3W0MA 3KL8A 2CJMA 2ZAZA 4O7RA 2RL5A 2VZ6A 5BV3A 3WZKA 3CD3A 4GUBA 5I4NA 4O83A 5IEYA 4FICA 4ANQA 4ZTSA 4IDTA 1JOWB 4IWPA 5KMLA 3W55A 5CEOA 3EQIA 3O50A 1MRYA 3K3JA 4NT4A 4MHAA 4AZVA 4Q9SA 5HE1A 4DEBA 2VTLA 3BYSA 4O27B 1OL5A 2W5HA 5AIKA 4BHZA 5IA1A 3L8XA 2CGVA 4XBUA 3E64A 3GB2A 3Q2MA 3BELA 2VGOA 2BDFA 2HY81 2WEVA 1A06A 2VTSA 2YAKA 3WBLA 4ZTMA 5IA5A 1BMKA 3POOA 3LFBA 4PL3A 4XP3A 5JGAA 3KY2A 3V3VA 4YMJA 5ANKA 3ENMA 3BZ3A 1OUKA 2A19B 3KRRA 4FKSA 4FKWA 5HU9A 1K9AA 1UNLA 2GDOA 3BYUA 5CZHA 1XBBA 3MV5A 2DWBA 3PP1A 4FV1A 5CF8A 4C4IA 5ANJA 2XA4A 2YIYA 3HV3A 3AD4A 5AAEA 2VO6A 2UVZA 1PMUA 4GJ3A 3PIXA 3PTGA 4OBQA 1ZARA 1M2QA 2B55A 4IM0A 4QOXA 2CNVA 4RX9A 4C7TA 4EH5A 2YISA 3NSZA 3FZOA 4B6LA 3ATTA 5IH6A 1OECA 4BIBA 3LQ8A 3MVMA 4I0SA 3N4VA 4EBWA 2WQBA 4OTIA 3O0GA 5E8TA 3SGCA 4OT5A 2Y7JA 3RPVA 4UB7A 4D4RA 1HCKA 1OIYA 1Y6AA 2WD1A 4QQJA 2JDRA 3FHRA 4FSWA 3R01A 4WG5A 5HICA 3WF8A 1QPCA 3QALE 3KVWA 4O7ZA 4XG6A 4R5SA 2IZUA 5M09A 5TF9A 2FVDA 3P86A 4RG0A 1YQJA 3KULA 2R7IA 3LFFA 3TIZA
chains in the Genus database with same CATH topology
3KMMA 2GFSA 3F3VA 3QYZA 4EKLA 5DEWA 1OPLA 3G0FA 5BUEA 2SRCA 4UWYA 4KBCA 3GQIA 4GKIA 4O84A 3G2FA 2J50A 3MY5A 4J53A 2EVAA 3E63A 2C0IA 2IPXA 5I9ZA 4DC2A 3RNYA 5M53A 1GY3A 2HZIA 1VYWA 4DEIA 4G3GA 4AOJA 3PRIA 1W0XC 1OBGA 4L3JA 4O0VA 2I0EA 4NJ3A 5IH4A 3R21A 3RHKA 3OXIA 4LUEA 4I4EA 2A1AB 1TKIA 2GNIA 2ONLC 4LOOA 5CEPA 1KV2A 2ACXA 1G8AA 3AMAA 4MYGA 4UX9A 4AAYA 2R3HA 5FTOA 4E5BA 5DLSA 1V0BA 5T3QA 3HMPA 2FSMX 2NRUA 3WE8A 4FV5A 3OEZA 5DIAA 3O7LB 4AX8A 4EZ7A 2HZ4A 3NUUA 3OP5A 3IW7A 1OIQA 3QC9A 2Q0NA 5CSXA 5KZIA 4YPSA 1NA7A 3VBYA 3V5JA 3NAXA 3UZPA 3COHA 4ZMFA 2XNNA 1A48A 3D0EA 5CENA 4YO6A 2XARA 5DGZA 1W84A 1XH6A 4LGGA 3ODZX 5BNJA 4BJJA 4RX5A 3E8DA 3HRFA 4DGLC 2C0OA 2W99B 2XH5A 2H96A 5IDPA 4ENXA 2PVYA 2X2KA 4FNZA 3KRLA 4IZAA 4LOPA 1XKKA 2VAGA 1W8CA 4P4CA 3ZLYA 4C38A 4NM3A 3U8WA 3E8NA 5EYMA 3KKVA 2W1FA 3MESA 4EH2A 2YDIA 3IQ7A 1DAWA 3Q5IA 1PXKA 4QP1A 5EQEA 5K5NA 3EHAA 4W4VA 4C59A 3DZOA 4M15A 5EG3A 3LQ5A 5IH5A 2JC6A 1Q3DA 4IB0A 2G2FA 1PHKA 3ZC6A 4ZLZA 5CEQA 2Z02A 2YFXA 5EW8A 3SRVB 5HI2A 5M4CA 2UZDA 3G5DA 4MAOA 3R9RA 4GVAA 4OBPA 4OTFA 3FSFA 4TL0A 2X9EA 1GIIA 2LAVA 3ZM4A 1CKJA 3OXTA 3E8CA 4ZZOA 5D11A 4GFOA 2OJFE 2QOOA 4GU9A 3WOWA 4DBXA 2YJRA 2XRUA 3BLQA 3DBQA 3KK8A 4CFFA 3P79A 3R7OA 5CAPA 3L9NA 3QQLA 3BCEA 3ZOSA 4AWIA 3G15A 3EN4A 4H39A 4LOQA 4D9TA 1YDSE 4EBVA 3HP5A 4GKHA 3CD8A 4FTTA 4O7SA 5AV0A 3LFCA 3SW7A 2OWBA 4GFMA 5HG7A 3F7WA 4BRXA 2WGJA 1ND4A 1LR4A 4K1BA 2JDTA 4BDEA 3FUPA 4G16A 5HESA 4PL4A 3U6IA 1H28A 4YR8A 4DITA 1H1PA 3DNDA 4EHEA 5AP7A 3QZGA 3Q4CA 2JDOA 4FZ6A 4LRKA 4UXQA 4X3FC 3DOGA 4BICA 3QGWA 2WU7A 4BCJA 4D1XA 4EWQA 5DA3A 3UP7A 2W9ZB 4A07A 5GIOE 1YVJA 1Q8ZA 1ZOEA 4MXOA 4DE4A 4GEOA 4EOLA 4BBFA 2CGXA 3UVPA 5LJJA 4U81A 2W1EA 3BQRA 3LCOA 3C4WA 1WBVA 4LUDA 3BPRA 2HENA 2YM3A 2QVSE 3C1XA 3ET7A 4YTHA 5HKMA 3UNJA 3W2RA 4I6QA 2VTNA 5FTGA 1KSWA 3BL7A 3QTQA 5ANIA 1OKYA 4OTDA 5H8BA 4DCAA 5KX8A 3QX4A 2P33A 4GU6A 5JKGA 4UWBA 1ZYCA 4FVPA 3MH2A 2WZJA 4F9CA 3NW6A 4R7IA 2XIXA 5JSMA 2PHKA 3OUKA 4FNXA 4TNBA 4RT7A 4CNHA 3G0EA 3K2LA 2X2LA 4MTAA 2J0LA 4KUJA 4ALUA 2CGUA 3RNIA 4LRMA 2KULA 4KS7A 4Z16A 3AD5A 4F7SA 4BIEA 2B52A 3KN5A 3A7HA 4FK6A 3IS5A 4L00A 2UZOA 3P7BA 2CMWA 4EK4A 4UY9A 1PXJA 5HX6A 3ODYX 2IVSA 5HG9A 3TV4A 3K54A 1NVQA 4BCIA 2GS2A 1YOMA 3EQDA 4IBMA 4I24A 4U97A 4GT5A 4W4YA 3QRIA 4ASEA 5C8KA 2PULA 3NVKI 2C6TA 3LJ0A 1PXLA 3QL8A 4E6QA 3F2RA 1URWA 5FLFA 2BDJA 3FQEA 3DFAA 2B54A 3TDVA 5CWZA 3R9OA 4ACCA 4GK3A 5CU0A 2G2IA 1KOAA 1R0EA 1GOLA 3IGOA 5J5SA 4Q9ZA 3Q6WA 3FLYA 5CU4A 3HMIA 3R8ZA 3C0GA 4R77A 3TV7A 3DAJA 5E8YA 3IGGA 2XEYA 2R3RA 2YN8A 1OKWA 1J3HA 4J71A 2PYWA 4B9DA 5A6OA 2OJGA 3AC8A 4TKSA 3BGZA 4FZDB 3CKXA 4HOKA 4C61A 2OFVA 2X8DA 4NFNA 3SG9A 3VQUA 3R02A 5J1VA 1XHAA 2PE0A 5HGIA 3ZFYA 4D0WA 4HYSA 3R2BA 4GV1A 3W0RA 4G3DA 4X2GA 3UQGA 3R1YA 5LVOA 3OTVA 5IU2A 3BX5A 5EHOA 4OLIA 2YM8A 4F7JA 1YKRA 3QTRA 4BF2A 2W5BA 1LEWA 4I6LA 4MD7E 3U55A 4DBNA 2W1IA 3UJGA 3PIYA 2XS0A 3EQGA 3QAME 5AMNA 3WF6A 3P23A 4YTIA 2OZOA 1OVEA 3GC0A 5KHXA 3TUDA 2WU6A 4F1OA 3OZ6A 3QF9A 4DHIB 2CLXA 2OIDA 5EM6A 3FXZA 1FBNA 1WVXA 5FXQA 4YZNA 3RALA 4DHZA 3R8MA 1OMWA 1PJKA 3TI1A 3H10A 1PF8A 2G15A 2BZKB 4QNYA 4W8DA 3SRVA 3RJCA 5JRQA 3F3TA 5GHVA 1MQ4A 3OWLA 4V05A 3FMMA 4Q2AA 3VBXA 2C5OA 2WOUA 4AAAA 3UOLA 4CZUA 4R3CA 2W4KA 4QMWA 3FSKA 4G2FA 3UMXA 5KCVA 2WOTA 3HMNA 2UW7A 4N57A 3B2WA 4IDVA 3WZUA 4QPAA 4CV9A 4I1ZA 2QOIA 4EYJA 4MWIA 5KMJA 2HELA 3WF5A 3COKA 4KKGA 1UU7A 5J95A 4GUEA 4LM5A 2WMRA 5HLPA 5TO8A 4QP8A 3TNHA 4HPTE 5IA4A 4U44A 3D5WA 3VBWA 4LQMA 5CEIA 4F9YA 2X6EA 2X2MA 1UV5A 4G5JA 4GG5A 4GFGA 2WMXA 5LVNA 3DXNA 4JBVA 5DEYA 4FG8A 4GS6A 5HIDA 3IPHA 5BUJA 3NEWA 3GNIB 3N9XA 4CLIA 5J9ZA 3PG3A 4E6DA 1OI9A 4KKHA 5LOHA 4B7TA 4DTKA 2YIQA 3U6JA 2DYLA 2XKDA 4JAIA 2RFDA 4GYGA 3CP9A 3ZRLA 4JRVA 3Q4ZA 4DFYA 4DEEA 2OW3A 3C4EA 4FT9A 4QEBA 4G9RA 2QU5A 2UZWE 3B8QA 3GU4A 3MFUA 4O82A 4U42A 4L53A 2JIVA 5A6NA 3ZO1A 4GT3A 5HVKA 3BBTB 4FYOA 4RFYA 4X2NA 3OG7A 5KMKA 4U7ZA 3R8UA 3MY1A 4V04A 5JFVA 4O0XA 5DT0A 2ZFYA 3VRZA 4E6CA 5HVYA 3GC7A 3BWFA 4D5HA 5FDXA 3W10A 5EKNA 1DI8A 2Y4IB 4CXAA 4EWHA 3F5GA 4Y72A 3QQFA 4IX5A 2CPKE 3R9NA 3IECA 4MEDA 3VJOA 5EOLA 2X6DA 3W32A 4P5QA 3EN5A 4TRLA 1VYZA 2QC6A 3LXNA 4O0SA 3GVUA 3Q4UA 5HTBA 5JFSA 1XWSA 1R1WA 4GJ2A 2W05A 2XJ0A 2YCQA 4K9YA 1BYGA 3W0NA 1SZMA 3AC3A 2WNTA 4C33A 5AUYA 4AW5A 4EC8A 4QMNA 1UNGA 2I1MA 4UZDA 2R2PA 2WQNA 3NUXA 2QKWB 2PSQA 2Q0BA 3A4OX 3BHTA 3MB7A 2W1HA 1P2AA 3HL7A 4XV2A 4DTAA 3BI6A 2WO6A 5HG5A 3R7EA 3OF0A 4A9YA 4MXXA 4MVFA 3A7JA 4EUTA 4FT7A 1ZZ2A 2H9VA 4AA5A 4CMOA 5JFWA 3PP0A 4E4XA 2GS7A 4E93A 3F2AA 5IUGA 5K4JA 3FMLA 4BCPA 4EHZA 1W98A 4QMXA 2F9GA 2ZDTA 2QCSA 3CE3A 3V8SA 4DEDA 3QTZA 4FT5A 4O7YA 5HX8A 4FL2A 4MBJA 4DEAA 4IWDA 1PY5A 4C62A 3PY0A 3WF9A 3W0QA 4EOJA 4E20A 3DLSA 4H58A 2UVXA 5FDPA 4YSJA 4ASXA 4BBMA 4EK5A 4X21A 2P3GX 3KXXA 2FYSA 2X8EA 3LCSA 2VWYA 1NXKA 3LXKA 4L7SA 4TN6A 4J99A 4BDFA 4NYEA 3A7FA 3W8LA 4AW1A 4QMSA 3MFSA 2W1GA 2XBAA 3ZDIA 5BVDA 2ERKA 4Y95A 2OKRA 4JAJA 5HE3A 3R6XA 1TQMA 3OY1A 3EMGA 4NU1A 4AU8A 3D15A 3OCTA 2YHVA 3PY3A 2WMWA 1A9UA 3EL8A 3SAYA 3SXSA 3V04A 4H3PA 2BVAA 5D7AA 4BDKA 4IJPA 5AP5A 4IH8A 4BDIA 2A2AA 1R39A 4JG7A 4YZ9A 2GPHA 3V5QA 5LVPA 1JAMA 2BHHA 4X0MA 3VJNA 2OK1A 4RC4A 4YHTA 5C8MA 3TKUA 2E2BA 2VTRA 4AXFA 5CF5A 2CKQA 3HA6A 4E26A 4AFJA 4D4YA 3DU8A 3ZUTA 4ASZA 3M1SA 3O8UA 3R8LA 3LFAA 3DA6A 4OTHA 1Z5MA 4I3ZA 2OFUA 3RPRA 4IIRA 3OMVA 3R9HA 3VRYA 4DA5A 3UIMA 2JBOA 4EUUA 2W0JA 3MTFA 3PE2A 4PUZA 4FEQA 1WAKA 3IONA 3L9PA 3Q96A 4PDYA 4W4WA 3W0SA 4E6AA 2W1DA 2HYYA 4F0GA 3A61A 3AC2A 3C4CA 4YC8A 3TJDA 4I5HA 4ALWA 2CKEA 4ZMEA 5JQ8A 3DQWA 5EDRA 3U9NA 3QQKA 1MRUA 2ETRA 3PYYA 1S9IA 2FGIA 3BHYA 3F3WA 4EQCA 4FSYA 4ZSEA 1OL7A 5DYJA 4EQUA 5JGDA 3D94A 3G9NA 3T9IA 4MQ2A 5GNKA 3PPKA 1O6YA 3NX8A 4RJ3A 3OT8A 4S34A 1UWJA 2W96B 3ZDUA 3V5LA 5IG1A 1YHWA 3VN9A 2OH0E 4XG2A 3OC1A 4O2PA 2A4LA 3E5AA 1GIJA 4AXAA 2ITQA 2CGWA 2XB7A 1JKKA 5EKOA 4PY1A 2YDKA 3PRFA 3KQ7A 3DBFA 4ITIA 4ERKA 3Q9XA 5E90A 2J5EA 1RE8A 3OCSA 5L6WL 4LMUA 2J6MA 1KE6A 4OTRA 5EQYA 3E62A 4XV9A 3QD0A 1FMKA 3QUDA 4IX4A 1H00A 4YJQA 4D55A 2PUUA 5FXSA 2YM7A 2WAJA 3R73A 3RZBA 4ANLA 1XQZA 3QRUA 4J98A 2CHLA 4O7WA 4QMTA 1WBWA 4JVGA 3H3CA 5EW3A 4BR3A 4FSTA 4HVDA 5LMKC 4O6EA 4C2VA 2R3KA 2WTJA 1ZMVA 1ZY5A 3NUNA 4M97A 4TY1A 4D2RA 4BCQA 3C13A 3VUHA 3GCSA 3F2NA 3KU2A 3EOCA 1OB3A 2J51A 2VD5A 4EOMA 4J8NA 5J8IA 4GMYA 2QLQA 3ZYAA 4FT0A 2E9VA 3QU0A 4QDEA 1B38A 4NW5A 3PPJA 5ETIA 2B53A 4YP8A 4IVBA 5B2MA 2VTJA 4YLKA 3CPCA 2B0QA 4UYAA 3ZM9A 5L2SA 3D14A 3G33A 1WBPA 4XG3A 5C1QB 3FJQE 4IANA 3R8PA 3HA8A 4C02A 4NK9A 4CT2A 3W18A 5JH6A 5FM2A 2GNGA 4I23A 4ZSAA 5AM6A 2O5KA 1H0WA 4E73A 3MN3A 2YITA 3QTSA 4DH3A 3UODA 4A9UA 2PUNA 2WTKB 4L3PA 2XK9A 4WIHA 4YJUA 3CQWA 4F9WA 2E9PA 2ETMA 3H9FA 3KXGA 4XH6A 3EN7A 5DRBA 5EFQA 2F2UA 4JXFA 5L8JA 2HWOA 4FV7A 5DFPA 2FO0A 2UZEA 4RJ8A 1FPUA 1G5SA 3PA3A 2RIOA 1IA9A 3PFQA 4WNKA 2EXCX 3OW4A 1YW2A 2WMTA 2BKZA 5KMOA 3F6XA 3DLZA 3OWPA 4BDHA 4U9AA 3IDPA 4FZFB 4G9CA 3QD3A 3DV3A 4AOIA 2PMIA 1YXSA 4K33A 1LEZA 4NTTA 4QMLA 3A8WA 4YSMA 3CY2A 3HRBA 4CQEA 5HG8A 2B4SB 3I0OA 4YUQA 4L44A 3CCNA 1JBPE 1PYXA 3LJ1A 3BLAA 3IK3A 2RFSA 5BX0A 2VTOA 3SOCA 3OFMA 3PVWA 3EKKA 3P5KA 3SLSA 2CN8A 3UG2A 2Y8OA 4X6QC 2O0UA 1M7NA 5HE2A 1Q8UA 2F7XE 3CJGA 2BAQA 1UKIA 2GMXA 5BPYA 4MD8E 4RWIA 4L3LA 3TCPA 4C3PA 3EJ1A 2QKRA 5HLWA 4FL1A 2FH9A 2XKCA 4NTSA 4K6ZA 3HKOA 3I6UA 3LLAA 2OBJA 4FEXA 3ANQA 3UTOA 4AN2A 3QC4A 4F99A 4QYGA 3ZUVA 1WBTA 4FTLA 2WIHA 5IQFA 3RHXA 5FBOA 2CKPA 2IWIA 5FP6A 5KMMA 3UVRA 4DH1A 1J7LA 3I0QA 4ZJVA 1JSTA 3KVXA 4KIOA 5AV3A 5E8WA 5EM5A 4AZSA 4DFUA 4KKEA 4OTWA 3I7CA 1U54B 3QWJA 3ENHA 3TUBA 1MP8A 2Z7QA 4N6YA 3ZTXA 5BYYA 4U8ZA 5HE0A 2OU7A 5LXMA 5BUIA 3DXQA 5CSHA 2CN5A 4FSUA 4RWJA 4IHPA 4KBAA 1JLUE 4QMVA 3PWDA 5KKRC 4FL3A 4JIKA 4PTCA 2WTCA 1JSVA 3F82A 4LRJA 2YABA 4DH5A 3TTJA 3FC1X 4FV0A 4QYYA 5EYDA 1XR1A 1VEBA 4XV1A 3D7TB 4U43A 1Z9XA 3HV6A 3F61A 2GHMA 4IZYA 1YI6A 1YOJA 2BTRA 3OVVA 4B99A 2GQGA 3CKWA 2PZ5A 4E4NA 2BFYA 1H24A 4FKJA 1APME 2PVFA 2XKEA 3UC4A 2B1PA 5CT0A 4Z55A 4XG4A 5HORA 4CFWA 1K2PA 2C6OA 2X81A 3V51A 4BDJA 1UKHA 4EKKA 5IA2A 5EI2A 3BL9A 1GZKA 4RJ6A 1PXIA 4X2FA 4FE2A 4DG2E 2C4GA 3QCQA 2QHMA 2RGPA 5E8ZA 3RM6A 3PVUA 2R9SA 2XANA 3IO7A 5D7VA 2EWAA 5CU2A 4RZVA 3RTPA 4KB8A 4MBLA 1KOBA 1PXNA 1E1VA 1MQBA 2JGZA 4QYEA 3LJ2A 4LL0A 5CU6A 3F7ZA 1GZ8A 2PY3A 1G3NA 3FY0A 3G9LX 5ETCA 4QQCA 4RRVA 3MB6A 1H0VA 2GHGA 2X1NA 3ULZA 4S32A 3QA0A 3EQRA 3QD2B 4OGRA 3TMOA 2PTKA 2X4FA 4MCVA 2IVVA 3EYGA 1GNGA 1GAGA 5F94A 2C3IB 2NYAA 3VS4A 2WQMA 2JKKA 2WFYA 4CKRA 3V5WA 3MA6A 4JDHA 2PVHA 1H4LA 4IFGA 3JUHA 5AUTA 3HECA 4NCTA 4XS2A 4NSTA 1OL2A 2Z7SA 5FG8A 4FBXA 4TYHA 4EJ7A 4LV5A 2JDVA 3QKLA 4AG8A 3NRMA 2BZHB 5EHLA 1OPJA 3FLQA 5LVLA 4P7EA 3ZU7A 3R63A 3I60A 3ZSHA 3Q6UA 3R04A 3ZXTA 2BFXA 3NS9A 2QONA 4RFZA 5DN3A 3OCBA 5HO7A 3C4FA 3COMA 3UGCA 2B9FA 3DNEA 1JSUA 2AYPA 3GC9A 4LDTA 2BR1A 3IKAA 4M0YA 4RWLA 4A4OA 3MPAA 2YM6A 3QUPA 4RIWB 2WMUA 3FQSA 3AOXA 4IAAA 2UW0A 3A4PA 3DY7A 5CQUA 5CY3A 2C6EA 2XBJA 5HCZA 3FKOA 3KB7A 3UZTA 4BCNA 5EHYA 3W33A 1ZYJA 1PXMA 2C5VA 3NNVA 4BI0A 1REJA 3ELJA 2HIWA 4AW2A 2BKKA 2BZJA 2KTYA 4ZJJA 3MFTA 2HY0A 4C4FA 2VRXA 4R1VA 4TTHB 2UZNA 2VO7A 3VWAA 4GRBA 5AV2A 1FQ1B 3WZDA 3MIAA 4XYFA 1P4OA 2ZJWA 3EN6A 4IC7A 4OUCA 2C5NA 3R7IA 1OITA 4AOTA 5CQWA 3UDBA 4QO9A 3FAAA 3PJ2A 3KN6A 5TOZA 5K4IA 4M67A 3LFNA 4IAZA 1HCLA 5DPVA 4O96A 5HBHA 4P90A 4FX3A 3A7GA 3EQPA 3M42A 4BDGA 2R3IA 1SVHA 3ERKA 4IM3A 4FNWA 4YO4A 4JJRA 4MXAA 4JDJA 4BDCA 1ZLTA 2Y6OA 4PMMA 5ACKA 5CVFA 2GTMA 3BU3A 3N4UA 3JY0A 1W83A 2C5XA 5IDNA 5L3AA 3EN9A 3CGOA 3FHIA 4M0ZA 2VX0A 4BGGA 4EI4A 1ZWSA 4FTNA 2XEZA 4RMZA 2BHEA 4QQ5A 2CNQA 4L7FA 1YI4A 4O7TA 1OL6A 4Z3VA 5KZ0A 3I7BA 2XK3A 1T45A 3S1HA 4I6FA 3ZC5A 2YWPA 4BDDA 5E92A 1GIHA 2IZSA 4Q5HA 1IEPA 2LGCA 2NRYA 1AGWA 1ZMWA 3RGFA 4GT4A 3P0MA 1DAYA 3FDNA 4R6VA 3VUKA 2ZV9A 4TYGA 5AP4A 4XRLA 1H25A 2QG7A 4W8EA 4ASDA 1VJYA 2YCFA 5CVHA 1O6LA 2VGPA 1H08A 4WT6A 4EONA 4ZZNA 4JMQA 3MVLA 5KE0A 3Q53A 3QHWA 3EYHA 5C8NA 2BRMA 5C4KA 3VS1A 3OT3A 1URCA 3HV4A 3MPMA 2J90A 4BBEA 3ZBFA 3ORXA 3ORKA 3FY2A 1U54A 3BEGA 2XJ2A 1WMKA 3SD0A 4FG7A 3TTIA 5EOBA 1JVPP 2BPMA 4FVQA 4XCUA 4DLIA 1J1BA 3PY1A 2I6LA 3P5JC 3QZFA 3AT2A 4YZMA 1M52A 5DRDA 3UO6A 2J5FA 4DAWA 2F7EE 2OF4A 2PU8A 3FPMA 1H01A 1L8TA 1ZYSA 4DG3E 5HZNA 4FKQA 2E9UA 2JDSA 3GENA 1TQPA 5E7RA 4C4GA 4Y73A 4TXCA 4BZNA 2RG6A 3H4JA 3TDWA 2OZAB 1ZOGA 4QP9A 4EOQA 2WPAA 4HVSA 4F6SA 3FZ1A 5E8XA 4JL9A 4CLJA 1NY3A 4BCMA 3A62A 1Q8YA 3UG1A 3VW8A 4BY9E 4WUAA 4F63A 4O7NA 4A4LA 2OSCA 4YJRA 2J0MB 3QQHA 3U51A 4PMTA 3G6GA 1VR2A 2XK6A 2IW9A 5L2WA 3UIUA 4QDVA 1OUYA 4QMUA 1B39A 4U6RA 1VLRA 3VUDA 3D9VA 2P4IA 2YDJA 4CCBA 3LM0A 5I9XA 4O81A 5L8KA 4M13A 5HCXA 4O91A 3MJ1A 3NAYA 2AUHA 4H3BA 4FTQA 3OROA 4QYFA 3BYVA 4S31A 1WZYA 4RPVA 4D28A 3LIJA 3E3BX 1Q41A 4TWNA 3KXHA 5LARA 5D12A 3F9NA 4I41A 4K11A 3ZBXA 4AA4A 4DYMA 4K2RA 4NH1A 4Y83A 2VTPA 5T6KA 2E9NA 5JEBA 3UE4A 2WKMA 3NNWA 4I22A 5D41A 5LCJA 4ZTQA 4ZTLA 4KRCA 5F1ZA 5AEPA 3NPCA 2JLDA 4MXZA 4C2WA 5M57A 3CTQA 4KRDA 5K3YA 1FVRA 1GZOA 4QNAA 1FOTA 2CNUA 3FMNA 4G6NA 5FEQA 5AA9A 1Y8YA 3OY3A 3UC3A 4FYNA 4ZAUA 3AC5A 4YTFA 2ITYA 5C01A 5ANGA 4FSMA 1YDRE 3Q04A 3SOAA 1PMVA 4RIYB 1Q3WA 4QQTA 1UU8A 3FL4A 2VUWA 3DKFA 3AT4A 4BTKA 5CEMA 1JQHA 3F5PA 4XG8A 5B2LA 4QMOA 5GIPE 3QCYA 3ZZEA 3W0OA 4WOVA 3I5NA 3EL7A 3UNZA 4IVCA 4IAFA 4K77A 3SX9A 3IG7A 4JX3A 1YXUA 4X3FB 3W2CA 5AA8A 3E93A 4FEUA 3WARA 1YRPA 3Q4TA 2J7TA 1J7IA 3FLNC 4I20A 3II5A 4HYHA 2GQSA 2O2UA 3ZFXA 5F9EA 3WZEA 5J7HA 1IRKA 4QP3A 5EW9A 3GCQA 5E1SA 3CBLA 2OH4A 5GJFA 3UNKA 3FMHA 2YACA 2WTVA 3QUEA 2ITWA 4YNEA 4ZEGA 2OJJA 4U5JA 4WRSA 1YOLA 2PUIA 4GIIA 4ZXTA 4EH9A 2R3NA 4J96A 3KFAA 1XO2B 3D2KA 4YTCA 2R3GA 4AP7A 2EB2A 1UNHA 5A4CA 2VV9A 2NO3A 2G2HA 3ETAA 2XIZA 4L52A 4HVHA 1PKDA 4I6BA 1Q4LA 4QMPA 2YZLA 3MDYA 5AADA 2XZSA 4F09A 4J95A 5L6PA 3S0OA 3PSCA 4QT1A 4AN3A 4H36A 4E4MA 3FL5A 3I79A 4HW7A 4ZY6A 3TUCA 1O9UA 5B0XA 4JNWA 5IQAA 3UO5A 2FA2A 3P08A 1U46A 5IMXA 5EDPA 4U3ZA 5KMNA 5E8UA 3GT8A 2UZBA 4FIIA 2PUPA 4FKLA 3KF7A 3HUCA 2GHLA 2VN9A 2YIXA 3ID6C 3PSBA 2PVMA 3UVQA 3VUIA 4DH7A 4JQEA 3D83A 3S4QA 5AP1A 2R3JA 1MUOA 3UDSA 2XM8A 4F70A 4FNYA 1BLXA 5K9IA 4FV2A 3JR1A 5FD2A 4AE9A 2XF0A 3FZPA 1WCCA 2GCDA 4MH7A 3HVCA 1V1KA 4RX7A 5JGBA 2V5QA 2ONLA 3R1QA 4PDSA 4K18A 3ZUUA 2YCSA 4BHNA 3BU5A 4MWHA 4R1YA 4D5KA 4FKUA 2YM5A 3EFWA 3HLLA 4MKCA 3HAMA 3KCFA 2QOKA 4WSYA 4RLKA 3ROYA 3VS5A 1FGIA 1FVTA 2YJSA 3O51A 1VZOA 4UALA 2R5TA 4XX9A 4RFMA 4A7CA 4TYJA 3KF4A 4BYIA 2ZOQA 3LZBA 5I0BA 2GS6A 3RK9A 4FTMA 4FVRA 3RPYA 4BCGA 2XNEA 5C26A 1GZNA 3SA0A 5EH0A 2DQ7X 3MIYA 4F7LA 5CVGA 1LP4A 3R7VA 3RWQA 5AUUA 3DS6A 3MSSA 1P4FA 3C4XA 2FSOX 3OTUA 5LWMA 1P5EA 3MYGA 5JK3A 4XP0A 3Q9WA 3PDTA 3LCDA 3LVPA 3LOKA 3BE9A 3QBNA 3PLSA 4FSRA 3O96A 4FGRA 3SC1A 1REKA 4ID7A 3U9CA 2XNBA 4G1WA 3PJ1A 3ITZA 3VQHA 4A4XA 4EOIA 3KXNA 2Z8CA 3KMUA 5IUIA 4UZHA 2G01A 4CG8A 1IG1A 3PA4A 4X7QA 4G3EA 4KA3A 2VNWA 4G3FA 2YCRA 3DK3A 4J8MA 4ANMA 2HOGA 3ZZWA 4FKVA 4HVGA 1MRVA 4HYIA 2R3FA 1FVVA 1WBNA 2XCKA 4O86A 4PX6A 4ZIMA 4AZWA 3TIYA 2J2IB 4EQMA 2UW5A 4DEGA 5HBJA 2PMOX 4MD9E 4X2JA 2HW7A 5BMSA 4I0RA 4MNEB 3QKKA 3FPQA 3FMKA 3R9DA 3S2PA 4WBOA 3V8WA 1CSNA 4F65A 4CV8A 2XUUA 5EK7A 3DZQA 4QMQA 1LUFA 2PE2A 3NW5A 2BAKA 3PFYA 4Z7HA 2XIRA 4IAYA 3GP0A 4MBIA 3ZEWA 4DDGA 4F78A 4PRJA 2EXMA 3WIGA 2BDWA 4YZBA 3KMWA 2JFLA 4KSQA 2XVDA 2XMYA 3GCUA 3QTUA 5IQEA 2PZYA 3AC4A 3ACJA 4DFLA 5B2KA 2I0VA 3CC6A 3Q9ZA 5C27A 3MH3A 5TR6A 2XYNA 5M08A 2QR7A 3CLYA 3ZLSA 4R7HA 4X6RA 3BE2A 4ZY5A 2PWLA 4FTJA 4RIYA 4PMPA 4AA0A 2I0YA 1V0OA 2ERZE 3RAHA 3S95A 3VBVA 2B9IA 4OR5A 2C6LA 1PXPA 4II5A 4AXEA 2VTQA 1SVEA 1IASA 4JR7A 4BYJA 3NYXA 4DT8A 3SKCA 2F57A 4V01A 4O0RA 3ZO4A 2QI8A 3LCKA 3OOGA 3ZO2A 4CZTA