2XANA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with amp pnp and ip5
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
435
structure length
414
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGSGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICKEELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDSEPSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase is a Distant Ipk Member with a Singular Inositide Binding Site for Axial 2-Oh Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 141
structure length 414
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xanA01
3UDTA 4AXEA 4AXDA 3UDSA 4AQKA 4AXCA 3UDZA 4AXFA 2XAMA 2XARA 2XAOA 2XALA 4LV7A 2XANA
chains in the Genus database with same CATH superfamily
3QXOA 4YP8A 2HZNA 4K9YA 4TYHB 3MFUA 5HD7A 4U41A 1H00A 3FLQA 3TM0A 2B0QA 3D5XA 4CMTA 3KCKA 3C4WA 1U59A 1BI7A 4O0RA 4F7SA 2RG6A 2UW0A 2VO0A 2OZAA 5DN3A 5AP4A 2RFNA 3UP7A 4RT7A 4BCOA 4ZMFA 2QHMA 2WMUA 4YJSA 4PL3A 1PXMA 1OL7A 4JG6A 4AOJA 5EQPA 3G90X 2Z60A 4Q5EA 3RJCA 5IH4A 4IM0A 4O2ZA 5DA3A 3MA3A 3IG7A 2OU7A 3A99A 2ITUA 4FNWA 4JVGA 1Z5MA 3G0FA 5EW3A 4DEDA 5AFVA 3DGKA 4M97A 4IAYA 2XYUA 2CSNA 4GK4A 3W16A 4FVQA 3PYYA 2WZJA 4C7TA 2VTNA 3PRFA 3VONA 3NNUA 4DG2E 4I5MA 1H0VA 1LEZA 4N70A 4K11A 3KY2A 1YOJA 1V0OA 5HEZA 2A1AB 4L7FA 5TKDA 2C5YA 4R5SA 2LAVA 3W8LA 3FKNA 2ETRA 2PK9A 3MY0A 4D4SA 3A7GA 3C4XA 5EDQA 4WKQA 3FL5A 3VUMA 3PXKA 1P2AA 2XIRA 4GT4A 4JX7A 3PJ8A 4H3QA 1VZOA 4PTGA 2P3GX 1YDSE 2VO6A 2ZFYA 2J9MA 3TNWA 2DWBA 5CXHA 4ZLZA 4H58A 2ESMA 3KULB 2PZIA 4X3JA 3FZ1A 3ZC5A 1S9IA 3H4JA 4ZSGA 3OD6X 5LWMA 5HO8A 4EYJA 3RAIA 3ZUUA 4LFIA 4YSJA 2V22A 2GNGA 4Z9LA 5LQFA 4G2FA 2YACA 2BDJA 4EBWA 3UG1A 3KMMA 3BWJA 1HOWA 3LJ0A 3TDWA 4FJVA 4IVCA 4ZXTA 5I9YA 4AXFA 5KMOA 4HZSA 2QG7A 2FA2A 2YIWA 3PVUA 3PPKA 4L8MA 1BL7A 2GHGA 4I6QA 3C4CA 2HXQA 2LGCA 3KFAA 4GIIA 4HYIA 4ANMA 2W9ZB 4RX8A 4JI9A 3D0EA 4C36A 2W5HA 4E6AA 1URWA 4ZIMA 2GQRA 4KABA 3QALE 4IFGA 4YJOA 3SAYA 3QUDA 4GK2A 3HV3A 4H1MA 5CSVA 2QLUA 4DT9A 4GKHA 3KRXA 2VTRA 4ZTSA 3F88A 4I21A 4FR4A 5ANDA 2CNVA 3S1HA 3W2SA 5EYMA 3B2WA 1ZZLA 1R1WA 4FNYA 1JQHA 3JPVA 4HJOA 5EKNA 2EB2A 4V04A 3AKJA 5DR6A 3TJCA 5IISA 3F3UA 3GC0A 4MKCA 4PP7A 3IS5A 3C4ZA 4LRMA 5IDNA 3FWQA 2QOHA 2OIQA 3CPCA 3UOJA 4F6SA 4RVKA 3E8DA 1W84A 2C6DA 2PHKA 2VZ6A 5AA8A 3DBDA 2ZB1A 4IAZA 5BMSA 3MH3A 3AGMA 4GL9A 4PDPA 1LR4A 4MWHA 4AXCA 5HLNA 2ETKA 5I0BA 5IQIA 3R2BA 4BDJA 3LIJA 3TKIA 4DA5A 5AAFA 4LUEA 4NL0A 2VU3A 3PFQA 1RE8A 4FKOA 4ZTNA 2YIXA 3IW8A 3Q60A 1KV2A 1PYEA 3HAVA 5BUJA 4QP2A 4WBOA 4XEYA 4GG7A 4TWPA 3OWJA 4E6DA 5CALA 4O0XA 4DFYA 3EQRA 5AP1A 2YERA 1E1VA 1W82A 4AN2A 2HY81 4TW9A 3RINA 4RRVA 5D12A 2ITXA 4X0MA 3N4UA 4G3EA 4ZAUA 5BNJA 3TKHA 4M8TA 4FK6A 5HVJA 2YCRA 5FXSA 3TIYA 1ZARA 2UW5A 3IW7A 3ORTA 3UDBA 4ITHA 2Y4IB 3BU5A 4CZUA 2CN5A 4OTWA 3QC4A 3ORZA 5HNBA 3FLYA 2BFYA 3HRFA 4KAOA 4J97A 5KZIA 1GZ8A 3W0QA 3FLNC 5EI6A 4DFXE 2WU6A 3DAJA 4RMZA 4AACA 2ZMCA 4ASDA 3NZ0A 4HCTA 2XIZA 1G3NA 4FKQA 4DEBA 3O50A 1X8BA 1XH4A 4NW6A 3SKCA 4FSQA 3PSBA 2FB8A 2ZOQA 5DFPA 2H34A 5JGBA 3II5A 3FPQA 4BZNA 1WAKA 4QEBA 3EKNA 3ZLYA 2W1GA 4JX3A 2NP8A 3I1AA 3VRYA 2B4SB 2UV2A 4WNKA 4DH5A 4ID7A 3BYMA 4BI1A 1W7HA 3PJ3A 5CAVA 2WELA 5HU3A 3O7LD 3HECA 3AQVA 2E2BA 4FKTA 3S95A 4BDHA 2W4JA 3F82A 4BIBA 3NEWA 2GDOA 2WMXA 4FUXA 5AUVA 1BLXA 2P55A 3PLAE 4I6FA 4E4NA 1LUFA 4PNIA 4C4EA 3ALNA 3QQUA 4RBLA 5FD2A 4CGAA 2GSFA 4ANQA 2PE1A 3OC1A 4X3FB 4GSBA 3QCQA 2ACXA 3CP9A 1W98A 2R3HA 2I6LA 3F5PA 2FVDA 5EM8A 3OT3A 4ACHA 3RMFA 2QVSE 1W8CA 4M14A 5AIKA 5L6PA 2PPQA 3IONA 3NYXA 4G9CA 4JDJA 4UN0C 3L1SA 2PZRA 1Q8WA 4FKJA 3LW0A 4K77A 3A4OX 5FRIA 3FDNA 3I5NA 4L00A 3T3VA 3IGOA 4BDGA 3D5VA 4IVAA 4MNEB 3RZBA 2WIHA 3BEAA 3U6HA 3FI3A 4IZ7A 4DYMA 4ZY5A 4FV2A 2BKKA 3BHHA 1UWHA 4FV5A 4XG9A 4AT5A 5A6OA 2W4KA 1XHAA 3U4WA 5JGAA 1REKA 4FTUA 2B54A 1Y6BA 3QRKA 5JQ8A 4C2WA 4A07A 3R7YA 4WOVA 4XG6A 3V3VA 2YWVA 3C51A 4XV2A 4FSTA 4AAYA 4F09A 1LP4A 4IANA 3OROA 3F66A 5BYLA 1UA2A 4FE2A 4ORKA 2CDZA 2B1PA 5IQFA 2PUUA 4WG5A 3BELA 3PPJA 2XBAA 4L42A 4TYJA 4NM7A 3Q5ZA 4M69B 3ACJA 2J5EA 1OIUA 4CKRA 1WBTA 4IB5A 4AGCA 4H36A 3I7CA 3A7HA 2BALA 2CLXA 2YABA 5L3AA 3Q4TA 3EB0A 4RGJA 3L8PA 3P5JC 2J0IA 4EH6A 4OTQA 2VNWA 1YXTA 4XNEA 4GRBA 3AC8A 2QKRA 5KKRC 3AC4A 4FTQA 3AC2A 2XKFA 4FTJA 2ITPA 5H9BA 3ORIA 3TTIA 2X81A 2OXXA 2YA9A 3RKBA 4I6LA 4CMOA 1H26A 1YXXA 3BKBA 4QMSA 3COMA 1QL6A 4Y8DA 3ZEWA 5ETCA 2EB3A 4U81A 4PMMA 2J0KA 4AZFA 3VHEA 3UBDA 3L9NA 2PVMA 4LUDA 4P7EA 1IA8A 5BQ0A 4IFCA 3JY9A 4F7NA 3RCDA 2UZVA 1DAWA 3UIXA 4CCBA 4FIGA 2XM8A 5A9UA 4EH5A 2BVAA 3BHVA 5CU2A 2CNUA 4DLIA 1MRUA 4A9RA 2VWBA 2F2UA 3F2NA 4BCFA 4AA5A 3ACKA 3C5IA 3QHRA 4FSMA 2XVDA 3ZM4A 4NTTA 2X8DA 4QMXA 3QKKA 3OWKA 2FSMX 1VYWA 1OKWA 3RNIA 4H3PA 4CKJA 3CGOA 2CLQA 3ZLSA 4F63A 3BYVA 3LM5A 3HAMA 3GNIB 5E4HA 1IAHA 3G15A 2GQSA 3TV6A 4IC8A 4O83A 3O23A 1ZY5A 3BQCA 2R3IA 3FMJA 4DEHA 3G5DA 3F61A 3QRUA 4FT7A 4C59A 3QZGA 2GQGA 4FSZA 5IA4A 2YZAA 3CD3A 1DI8A 1TKIA 3A2CA 2H96A 2VN9A 4WUAA 4KSPA 1UU9A 4CFFA 4FEWA 3QCXA 1OI9A 1JNKA 4S2ZA 3D4QA 2UZWE 4D2RA 1M14A 1ST0A 4FNXA 4XYFA 5BUIA 3KXNA 4BTJA 2PUNA 2OI4X 3AKKA 4QYEA 4WNOA 3AMYA 1KE7A 4MNEA 4AG8A 2IZTA 4JJRA 4OBPA 4KBAA 4XP2A 4K6ZA 3PJ2A 2VGPA 1VYZA 1YI4A 1YVJA 4R78A 4EWQA 4YJRA 4YO4A 3WF8A 2VX0A 2XZSA 4TWOA 3G0EA 4EOIA 4Z16A 5JK3A 4UXQA 2VWVA 3F5XA 4A7CA 4EOQA 4ARKA 4FGRA 2C6EA 2UW7A 4I6HA 2HIWA 3AKLA 5LXMA 2VO3A 3PVGA 4R5YA 5LCKA 2JBOA 1KE6A 2HZIA 3GT8A 3V6SA 4FVPA 3AC1A 2R64A 3EQBA 3LQ3A 3QA0A 3QD4A 2UZOA 3EHAA 4O82A 4BDBA 4MUQA 2W1IA 4TYEA 4EZ7A 3VIDA 3FMEA 4CRSA 4CT1A 5KBQA 2JDOA 3SOAA 4PDSA 4GVJA 3WZUA 2NRUA 4B7TA 2HYYA 4BICA 5C26A 2Z2WA 4OTRA 2OWBA 5CU6A 1SMHA 3NYNA 3PZHA 3QCYA 5HKMA 4FZ6A 4NYEA 4QYFA 5CI6A 3R2YA 5HTCA 3IW6A 3Q6WA 3OHTA 3VUIA 3V04A 3OS3A 3R1NA 3SXRA 2BRBA 5AUUA 3D7ZA 5C01A 3HA6A 4TZRA 4C4GA 2GTNA 2BAQA 2Y4PA 4ZS0A 2J0MB 3NRMA 4WUNA 5HE1A 3NYVA 1PXOA 2NPQA 2OF4A 2WTCA 2F49A 2UZLA 3DZOA 3ERKA 3MFSA 4KINA 4CTBA 3P08A 4DHFA 3HUCA 4YJNA 4CLJA 2XKCA 5KX8A 2Z7RA 3QTSA 3IQ7A 3F3WA 2OJJA 3BGPA 2ZV9A 4O2PA 1Q97A 1MQ4A 4N6YA 3WILA 4EONA 4MD8E 4FA2A 1H28A 3VO3A 4I93A 3R8MA 1Y8YA 3NUPA 4MD9E 2QU5A 4MVFA 2WMBA 4RWJA 3CD8A 5CLPA 4QP9A 3WZEA 3P1AA 4FEUA 2EWAA 3ULIA 4FT9A 4N57A 2PSQA 3UODA 5AEPA 4APPA 1DI9A 2YM4A 2I0EA 1G8SA 2ZAZA 3BBTB 3G33A 3NNVA 2YIQA 5K5NA 4YZCA 4EZ5A 4CLIA 2GFCA 4UY9A 3NGAA 5AUXA 1QCFA 4RIXA 4UYNA 5KCVA 4J1RA 3MTLA 4GFGA 4XG8A 1Q3WA 5CX9A 3E3BX 2GS7A 2UW4A 5EG3A 5HE3A 2F7ZE 2XB7A 4K1BA 4FV7A 3CTJA 3GCQA 5HVYA 3MA6A 4QYYA 5FQDC 1OUKA 4U42A 4A9YA 4C4HA 4M12A 3UZRA 3BIZA 1L8TA 4TN6A 2PU8A 5J1WA 4QQJA 4YLJA 3BHUA 4D28A 3JUHA 4DG3E 2UZTA 4FSNA 4JR3A 1PXKA 4TWNA 2JDTA 3Q9YA 4KBCA 2QI8A 5E1SA 4EQMA 3G9NA 3AMAA 4W4YA 2RF9A 4PP9A 5DVRA 1P5EA 4R3RA 4JBOA 1J1BA 5L2SA 4PMSA 1STCE 3SHEA 4E4XA 2YCFA 4JLCA 5AUTA 3U55A 4DBNA 3MJ2A 4EHVA 5LARA 3L9MA 2XCKA 3JYAA 2YDIA 3LMHA 1TQIA 2VAGA 3LXKA 3QXPA 4X21A 5HCXA 3RI1A 4M84A 4XOYA 4ZOGA 3UIUA 4APCA 3SV0A 2H6DA 3UP2A 1R3CA 4QMNA 5IDPA 2CJMA 5DNRA 5FBOA 4O7RA 4JL9A 2V62A 5BYYA 3MS9A 4ACCA 3VUGA 3OCBA 4GCJA 2VUWA 1JVPP 4U5JA 3NUYA 3MY1A 4Q5HA 5FXQA 3E3PA 3SRVB 3ZH8A 4BCJA 5I5ZA 4C61A 4FIHA 2YM5A 4XLVA 4DEGA 1M52A 3EN9A 3UOKA 2QD9A 3BHYA 3MFTA 4OBOA 2HWPA 5CSWA 4FV6A 2OFVA 2BR1A 3DQWA 3HV5A 2C3IB 3QHWA 3HVCA 1OBDA 2YM6A 4NIFB 3TN8A 3GC9A 3TNQB 3PWDA 3ZFXA 2JD5A 4I94A 3BRBA 3H9RA 4HVIA 3KVXA 4GUEA 4LL0A 1GIHA 5CU0A 4MQ2A 4XBRA 4IX6A 4EK3A 3E7VA 4FTLA 2HXLA 3Q9XA 3NR9A 2DYLA 1BMKA 5HI2A 3QQJA 3C7QA 4TNBA 2B7AA 1PMVA 3ORMA 2BIYA 1A06A 4FSRA 4NH1A 3HMOA 4DE4A 4Z3VA 4JXFA 2HZ4A 5JFVA 3R28A 3ZZEA 1ZOHA 5DR2A 1V0BA 2B9IA 2PVHA 3UDTA 2YITA 1ZMUA 1FVRA 2PVFA 2QHNA 2WQNA 3R73A 1GZOA 3CJGA 5HE0A 2WNTA 3IGGA 2DS1A 3G9LX 4FTTA 1T46A 3OCSA 3GQLA 5B7VA 3NLBA 2PY3A 2YZLA 5JKGA 4RWIA 4E26A 5DPVA 5L8KA 4KS8A 1ERKA 3ZXZA 3I7BA 3LFEA 3WE4A 2ZV2A 5FP5A 4C0TA 4DINA 5M07A 4GU6A 4QMPA 3CQWA 2CKPA 1H1PA 2W06A 2VTTA 4LMNA 3D14A 3QD2B 3PVWA 3WIGA 3GU4A 3Q2JA 2BHHA 2AEGA 3K3IA 3ORKA 2X1NA 4HVGA 3D5UA 3ZSIA 4YZBA 4Y83A 4OGRA 4Q9SA 3RK5A 2BILB 4U6RA 4F6WA 1FVVA 4BC6A 3M2WA 1FMKA 5EYDA 3I5ZA 2F57A 4M0YA 3A4PA 4TL0A 1XR1A 1ND4A 2RG5A 3PUPA 3IPHA 4EKLA 2R5TA 4MNFA 2VWUA 4I24A 5CF8A 3N51A 5I9XA 4BBFA 3NX8A 3RPVA 3FLSA 3WF7A 1P14A 5HGIA 3V01A 3GI3A 4J52A 2PE0A 3MDYA 4ZLYA 1LEWA 5M53A 4AZSA 3QL8A 3T9TA 2BZJA 2Y0AA 2GPHA 5A4CA 3ORXA 2J4ZA 2C68A 4IDVA 4TRLA 5CVGA 2X4FA 2OJFE 3F2RA 1RJBA 4IWOA 4XCUA 5AWMA 4NT4A 1OM1A 4BGGA 3G6HA 5D41A 2R3QA 3IDPA 4DITA 3E93A 2J6MA 5D10A 2X7FA 4FYNA 4KSQA 3HMIA 2WMQA 4OTDA 4YHTA 4ACMA 3ATSA 3AD5A 3WOWA 4PF4A 1BYGA 5CF5A 4BYIA 3BLQA 3ENHA 3EQGA 4YZMA 1OPKA 5JN2A 4DAWA 3FXXA 4M67A 3VW8A 5J1VA 3C1XA 2RGPA 3A7FA 3UIMA 4BJJB 4FEXA 1B6CB 3U9NA 4KD1A 4ZSJA 3QTXA 2JIUA 4OLIA 4WNMA 4QP3A 3TTJA 4RSSA 4YPSA 1FINA 5CAUA 3VULA 4CFWA 1QMZA 5BVEA 5F1ZA 3GU7A 3W0PA 2C6TA 1ZRZA 4FL3A 4AAAA 4LOQA 1J7IA 4AOTA 5ANIA 3W8QA 2RFSA 3MH1A 1Q41A 4A4OA 4C3PA 1Y57A 4JBVA 3GCUA 4D9TA 2PL0A 4HPUE 4L52A 1YOLA 3LOKA 3Q9WA 3PPZA 4UWYA 5HX8A 1YXSA 3F3TA 3COIA 3O71A 5GJGA 1V1KA 3MFRA 4RJ4A 2PVRA 3NVMB 5B2MA 1GZNA 3E8EA 3POOA 5M51A 2VTHA 2GS2A 3EMGA 3QFVA 4IB1A 3OBJA 4U79A 4D4RA 3VBXA 4E4LA 3DBEA 4FIJA 3S2PA 4AT3A 5EQEA 4OTFA 5DH3A 1U54A 2WTDA 4KS7A 4G3CA 3QZIA 3B8RA 5HQ0A 5HG8A 4FEQA 2FSLX 4G17A 2QOCA 3D7TB 5TO8A 4BGQA 1URCA 4FSWA 4FZFB 3V5WA 3C4FA 4DH8A 1JKTA 2PMOX 4U43A 3THBA 1R0PA 5L2IA 5CAPA 4DGMA 4BY9E 3E8NA 4FX3A 5EHOA 3GQIA 3ORNA 3W2OA 4BF2A 5BVFA 2PVLA 1BKXA 2BIKB 3GCVA 3AD6A 4USFA 1W83A 4NFMA 4NU1A 1KE5A 4G34A 4UB7A 4YPDA 3T9IA 4CEGA 4QRCA 3DV3A 3F2AA 2WOUA 5IU2A 4GFOA 2J7TA 3GU8A 3NIEA 4G5PA 3SC1A 2YDJA 4ENXA 1A9UA 1Q3DA 3GC8A 4ANLA 3EFJA 3DT1A 4LRKA 3R1SA 4RZVA 5HBEA 3CC6A 2CGVA 2JKOA 3HV4A 4FSUA 2R9SA 4XOZA 3VF9A 4BCGA 3UNJA 4Y46A 2ONLC 5HCYA 5HCZA 2YM7A 3RGFA 3I0QA 4O96A 2ETMA 3LQ5A 4FOCA 5I9VA 3OWLA 4D5KA 2O64A 3TZ8A 4CV8A 1Q8YA 1FGIA 5LCJA 3M42A 1UVRA 5LMKA 5AIRA 4E4MA 1CKPA 3LFCA 2G01A 4H39A 4U40A 2CMWA 2JDVA 3TCPA 3ET7A 1BX6A 4AW2A 4L53A 4IVBA 3JR1A 5KE0A 1WBPA 1WFCA 4F7JA 5KKRB 2AC3A 3DNDA 4S34A 3VVHA 5CASA 1H07A 1MP8A 4QMQA 5IMEA 4A9SA 5EDPA 3F3ZA 5KMNA 4I3ZA 2PWLA 3W1FA 4EBVA 4ZZNA 3PG1A 3BQRA 3OTVA 5BVWA 3UYSA 3OUKA 3OMVA 2EVAA 3MVJA 4AQKA 2C3JA 4MWIA 4QQCA 5HBJA 3UQCA 3HUBA 4YLKA 2YJSA 2XNEA 2XK3A 3FZRA 4RWLA 4CZTA 5HG9A 5JFXA 2BZKB 4M13A 4L3LA 1VEBA 1XMLA 4GUBA 4O27B 3GBZA 4AUAA 1W0XC 2UZBA 4BI0A 4IZYA 4NK9A 3EN7A 4WBBB 4I0SA 4EHEA 3OW3A 3QQKA 4PMTA 3R8LA 3D9VA 3QA8A 4LOPA 3VWAA 3ZLXA 2IVSA 4EH2A 2IWIA 3QKMA 4KIPA 3V8TA 3AGLA 5EYKA 4C3RA 4IX3A 3SXFA 3HZTA 2W9FB 4FTNA 4BRXA 4HW7A 5AAGA 1ZYDA 4BCIA 1JSUA 3VS5A 2W5AA 3TJDA 1WZYA 3GEQA 1B39A 5FP6A 4E6CA 5AADA 4F9CA 5AP5A 4AN9A 3I60A 3ZBXA 5FLFA 3BL9A 4X6RA 3Q53A 2BMCA 1M2PA 1ZXEA 4DDIA 3AC3A 1PKDA 5J9LA 4XUFA 3AG9A 2XK4A 3ANQA 3EOCA 3OBGA 3D7TA 3QTWA 4FV9A 3H9FA 3JXWA 2IZUA 4HYSA 4NUSA 5FTQA 5BPYA 4TYHA 2HOGA 3LLAA 1S9JA 2IN6A 3BX5A 3NUXA 3PY0A 4G16A 5IH6A 2ITOA 4EJ7A 5I9ZA 2R3GA 4QMTA 2PULA 2NRYA 2BUJA 2C1BA 3WYXA 4KIQA 4GMYA 4CV9A 2Z7SA 4U80A 5M4IA 1O6YA 3QF9A 4II5A 2BROA 5B0XA 3PRIA 4DH7A 4J96A 1UV5A 1GY3A 3CY2A 4RQKA 3QUPA 4JDKA 5AJQA 3ZSHA 2XAMA 3VBTA 3QTRA 5J9YA 2AYPA 4R77A 5K5XA 4X6QC 3OTUA 1BI8A 3QQFA 5HIEA 2CNQA 3PJ1A 4O0SA 5LVLA 2C6IA 4BCNA 5A4TA 2E9UA 3QWJA 3CTHA 1PXPA 4JRNA 2QR8A 4L3PA 4F0GA 2Z7QA 3CJFA 4BZOA 5HIBA 3IDCA 2R3RA 2A27A 3EIDA 3OP5A 4U97A 3MPMA 3W0MA 4C4JA 2QCSA 3UVQA 2W5BA 1TQMA 3FMKA 3GVUA 3VS7A 2VWYA 3JS2A 4DLJA 2QOBA 3VUDA 4F9WA 4AZVA 4O0UA 2PZYA 4E5WA 3R30A 5H8GA 3OW4A 3NW5A 5GIOE 4FV3A 5AP3A 5CT7A 4IC7A 4AU8A 1JBPE 3R1QA 3LLTA 4MXXA 3FXWA 2UZUE 3Q3BA 3UO5A 4EEVA 3U4UA 3BI6A 5AV1A 4J8MA 3EFWA 3AT4A 1JAMA 2EXMA 3DKFA 3OCTA 5TOZA 1Q24A 1YXVA 5CT0A 3SGCA 4E7WA 4TY1A 3EQPA 3LPBA 2R3JA 3GCSA 4O0VA 2OH4A 4YU2A 3KULA 3QRJA 3WZDA 4UV0A 3ZMMA 3ZSGA 3C9WA 3QRTA 2SRCA 5CU4A 4EH9A 2VGOA 4QPAA 4DFLA 3V5JA 3HA8A 4IB0A 3RM6A 2PTKA 4QP8A 3WARA 4IJPA 4ONAA 3MH2A 4TPTA 5G1XA 4KKHA 4QMLA 4KRDA 4CG8A 2OXYA 3DKGA 3KQ7A 4D0XA 1NW1A 5M08A 2X0GA 1HCLA 4OT6A 4DDGA 4O7WA 4NKAA 4Q9ZA 4C58A 3KB7A 3WYYA 1RW8A 2GFSA 5EQYA 4C35A 2BRMA 3R6XA 4PY1A 2QOIA 2YM8A 3ALOA 4ZTHA 2WIPA 4PUZA 4HYUA 4QNYA 3VBWA 2R4BA 4F78A 2J51A 3FKLA 4P2KA 4GH2A 5DBXA 2PYWA 3MH0A 4ACDA 3PA4A 3CBLA 4W4XA 4YR8A 5JFSA 4HVDA 3GENA 3R0TA 3HRCA 3R04A 3PA5A 4J8NA 2VNYA 3AC5A 4AFEA 4EWHA 4EOMA 4DN5A 3UTOA 4E73A 3AD4A 4HGSA 4DC2A 1AQ1A 3OXTA 4QP6A 2DUVA 2IG7A 3OVVA 1FBNA 1OKYA 2HCKA 3CGFA 4O38A 3DU8A 5M55A 4CRLA 3U6IA 3C13A 4UZDA 4YTHA 1QPJA 3VC4A 1HCKA 3E88A 3CCNA 5J5SA 2WMRA 2CPKE 3F9NA 2VTMA 3MW1A 4YBKA 1F0QA 2PUPA 1B38A 2HWOA 1I44A 2ZDUA 2X7OA 2YIRA 3KRRA 4I4FA 4I4EA 3DFCB 5C1QB 2YJRA 3CKWA 2C30A 4ACGA 4U9AA 2JIVA 4V0GB 4WRSA 2B9FA 2GMXA 3HYHA 2ITZA 4JDHA 4NCTA 5HE2A 3RAHA 2QO2A 1JWHA 4LG4A 3FY2A 2VV9A 2CN8A 4NJ3A 3C4EA 4S30A 5E8TA 2ZM3A 2YFXA 4ZK5A 2UZEA 1H0WA 2IW6A 3F5UA 4XV3A 3ZDIA 4L68A 5EYCA 3PP1A 5IZFA 4DH1A 4R7HA 1DS5A 3M11A 1QPCA 2QOFA 1JLUE 3CSVA 4I5CA 3TL8A 2R0UA 4BTFA 4IEBA 5M4UA 1SZMA 3FQHA 4MCVA 3V51A 1WCCA 5CNNA 4JNWA 4ITIA 2C6KA 5J95A 4Y85A 4EL9A 5AX9A 4DHZA 5BYZA 4IM3A 4YSMA 5HTBA 3HP5A 5AV4A 3NS9A 4FGBA 4QO9A 5CEKA 2P0CA 3QQGA 3QTQA 2VWWA 3PXRA 4HPTE 5I4NA 3RHXA 4WG4A 4IM2A 4R6VA 2PVKA 4J53A 3PXZA 5L6WL 4HNIA 4JDIA 4WIHA 4XP3A 3FPMA 4R3PA 2CGXA 5FEEA 4XHKB 3W10A 3U87A 3SA0A 3R9DA 3ZRLA 4RX5A 2E9PA 4RJ6A 5DWRA 2BKZA 3DJ5A 3K5VA 2R2PA 3EN6A 3VUHA 4BZDA 3HLLA 5DRDA 2ITYA 4NM3A 4BDEA 3NWWA 3FLWA 3PE1A 2JKQA 5A3XA 1FQ1B 3D94A 4V01A 2Y6OA 3WF5A 3KKVA 3TDVA 2WEVA 3RCJA 3P5KA 2ZV7A 4MQ1A 3A7JA 4RVLA 5IA2A 3BV2A 1KOAA 4LOOA 2WQBA 2FSOX 2W1CA 3I4BA 4I5PA 4ERWA 4JAJA 4NSTA 5CI7A 4GYGA 3TYKA 2X9EA 4IX5A 1ZYCA 2Z8CA 4BCKA 5B2LA 2CKEA 4GVAA 2O8YA 3DDPA 4K2RA 5HBHA 3ZXTA 1ZAOA 3ODZX 5C03A 3HV6A 4BDKA 4FTMA 5CEQA 4PX6A 3Q2MA 1J3HA 4X3FA 2YM3A 3EQDA 4O7ZA 1JKKA 3KU2A 3ZO3A 2E9NA 3RNYA 5K4JA 1QPEA 3TMOA 3UNKA 4O7VA 3T8OA 2OG8A 3WI6A 4XG7A 4K33A 2W17A 3UOLA 5D1JA 3LCOA 3WBLA 4BIDA 5CF4A 5K9IA 1L3RE 2BFXA 1YOMA 1YI3A 3Q5IA 2IW9A 4E6QA 5HLWA 5ICPA 2KTYA 5KMLA 3OEZA 3PSCA 5C8KA 3GU6A 4A06A 3DK6A 4FOBA 4KNBA 2ZM1A 2UW9A 4H1JA 4OTHA 1PYXA 1SYKA 3A8WA 2WMSA 3O51A 4X2NA 5IPJA 5KUPA 4EOSA 3VNTA 3TNPC 4U3ZA 3ZRKA 5LMAA 4ZLOA 3KF7A 2F4JA 3R7VA 4FODA 4CFXA 3SQQA 5LVOA 4R1YA 1KE9A 3GOPA 4MF1A 4YZNA 3OOMA 3VS4A 2B9HA 4AE6A 5FGKA 5A14A 1U46A 4FKSA 3NUNA 3PIZA 3EFLA 1XBBA 3MY5A 5T68A 3TUCA 2I40A 2J0LA 2P2HA 2GCDA 4S33A 5I9WA 4XH6A 4HYHA 3L9PA 1Y6AA 4EOKA 4ANSA 5BVNA 5GJDA 4IWPA 4F65A 3F69A 5A4EA 3DB6A 4YBJA 3W2PA 2W99B 5IQEA 1REJA 3ZYAA 3ORPA 4BI2A 5M44A 2V7AA 3FZSA 2BRNA 4XS2A 1WVYA 2Z7LA 5CY3A 4EZ3A 4BYJA 4HOKA 1OKZA 2ZMDA 3QBNA 4FV1A 5CEPA 4E20A 4FV4A 2BAJA 5J87A 3TNIA 4M15A 4LRJA 4DEAA 3ZO1A 2X7GA 4EHGA 3A60A 2C6MA 2OIDA 4O7YA 4UWCA 4ENYA 4W8EA 4F9AA 4I41A 3R9HA 4FKGA 4GYIA 4KWPA 1U5QA 4JAIA 4RIOA 3K3JA 4L01A 3RWQA 4O84A 2VWXA 3BYOA 4AOIA 5AP6A 2OH0E 2WMWA 3IECA 4R7IA 4G6OA 4QP1A 4XRLA 5HNGA 2A19B 4FIIA 5IQBA 4DG0E 3HP2A 4RJ8A 1OL2A 3KC3A 2QKWB 4U0IA 1YWVA 3FV8A 4MXAA 2WHBA 4F9YA 1OGYA 4EHZA 3Q04A 5A6NA 1IA9A 2VTIA 5CU3A 4ZTMA 4BGHA 3DAEA 2UVZA 4Z7HA 4YJUA 4A9TA 4I6BA 3R9OA 3N4VA 4UZHA 4OT5A 4QMMA 2C0TA 3QRIA 4WHZA 3OWPA 4IVDA 3O2MA 4FBXA 4P4CA 5BUEA 4BB4A 2AC5A 4TT7A 4IJ9A 5AV2A 2XIYA 1PMEA 5IUGA 3ULZA 4FKLA 3NAXA 4L3JA 4EK6A 2PZPA 3DK3A 4Y5HA 5EI2A 1GAGA 3FJQE 1K3AA 3ZC6A 4EOOA 4PDOA 2EU9A 3QQLA 2BZHB 5CVFA 3TT0A 5AX3A 2O65A 3BBWA 1M17A 4M7IA 4PDYA 1OITA 3DA6A 4XRJA 4USEA 1R39A 3AXWA 3D15A 3QUEA 4FICA 1WBVA 2XK9A 3QZHA 3QGWA 5FUTA 3UO6A 2XK6A 5K4IA 5EDRA 3H3CA 4J99A 3NCZA 2C0OA 4R1VA 4EOLA 5HD4A 3FC1X 1PXIA 4QOXA 4FV0A 2XNNA 2XMYA 4MX9A 4IQ6A 2GNJA 2OICA 3JY0A 3FE3A 3QLFA 4FUYA 2R3FA 4RZWA 2VD5A 4OBQA 4P90A 3LXLA 4RIYB 1YW2A 3COKA 3A62A 2C6LA 4JG8A 2R3OA 3QCSA 5CSHA 5FM3A 3UVPA 3PG3A 2XM9A 3OUNB 2QOLA 2J5FA 4Y5QA 5D9HA 1BUHA 3RPYA 5AUZA 3TUBA 3UGCA 2ERZE 5KMKA 1SVEA 5CEIA 4A4XA 4LMUA 5CQWA 4BTMA 3MIAA 2UZNA 2RFEA 2XNGA 4F6UA 4O6LA 5E8VA 3FC2A 2Y6MA 4FKPA 4ZY6A 1PMUA 3V8WA 2WTIA 4BCHA 3AT2A 4KBKA 3RPOA 4DF3A 4O0YA 4Y95A 3GUBA 3ZFYA 4AGUA 4EC9A 4XG3A 2JITA 1DM2A 3CLYA 5M4CA 3NUUA 3CIKA 2WMAA 5DEYA 4DHIB 5M09A 1RQQA 2W0JA 1H1QA 1YDRE 3POZA 1UU8A 2YISA 5GJFA 3V8SA 3ITZA 2Y7JA 4N6ZA 1NT2A 4DTKA 3UQFA 4Q2AA 5AM6A 4IWDA 3CY3A 3AT3A 4XBUA 4CQEA 3PE2A 3F3VA 4RX7A 5ACBC 4BTKA 2XNBA 3U8WA 4FI1A 4FTRA 5HLPA 5EI8A 2WMVA 3F5GA 2EUFB 1KSWA 4FG7A 3VS0A 3DPKA 3LCTA 4NM0A 4L7SA 3L9LA 3I81A 4IE9A 4WD5A 3NMUF 3MB7A 1G8AA 2Y9QA 2BDFA 3R01A 3M1SA 4LDTA 5DI1A 3O8TA 3UJGA 1FMOE 3QQHA 3GGFA 4RPVA 1J1CA 2HZ0A 4ZTQA 4ZSEA 3QZFA 4RLKA 3FHIA 3QD3A 3UQGA 2WTWA 3KL8A 4UEUA 2OF2A 2JLDA 2ITTA 2R3MA 1ZYLA 4IMYA 5JRQA 4TWCA 4EYMA 3MESA 1SNUA 1WMKA 3A7IA 3SOCA 4O7SA 4GK3A 2HELA 4HCUA 1WVWA 5IA5A 4ASXA 4W4WA 3FZTA 4J95A 4QDVA 2X4ZA 4CT2A 3UC4A 2WTJA 4NTSA 4QMOA 4U3YA 5JSMA 4YURA 4NKSA 3U6JA 4O6EA 1OL6A 1UKHA 2QC6A 3E7OA 2ZDTA 5D7AA 3E87A 3KRWA 4MXOA 4QYGA 2C47A 4LV5A 1IAJA 1CKJA 4FZAB 3WF9A 3QTZA 5CZIA 4AA4A 3QAME 4D1ZA 2I0VA 5KMJA 3BLRA 4TKSA 2WTKC 3DS6A 2XJ1A 4YNEA 5FEQA 2VRXA 4O86A 3RK9A 3GOKA 4ALWA 1GJOA 3FSFA 5IG1A 4XG2A 4BDCA 1CMKE 1O6KA 2WAJA 3LXNA 1ZLTA 3CPBA 1PXNA 2OZAB 3SRVA 3VS2A 1ZY4A 3ZONA 4GT5A 2R3KA 4FZDB 2XH5A 4YTCA 1R78A 4RC2A 5LVMA 4QNAA 3QU0A 1OIYA 4HCVA 4YHJA 3V5PA 2G2HA 4QQTA 3ZM9A 3FYKX 4RVTA 1NY3A 3BYUA 4JMQA 5LJJA 2WTVA 3P4KA 5CVHA 5E8WA 3GP0A 1NA7A 1GIJA 1OPJA 1NVRA 3FUPA 3MBLA 4Y72A 4TYGA 4XG4A 3C5UA 4Z7GA 3NW6A 3U9CA 4X2JA 2PMNX 3N4TA 2ZJWA 4S32A 5CAOA 1NVSA 1G8JA 1YHVA 3HMNA 2QO9A 3D5WA 1Q5KA 2WGJA 3QX2A 1UKIA 3R63A 3ZEPA 2G15A 2QOKA 3ID6C 4QMZA 2H8HA 3ZCLA 2ITVA 4M68A 3ZUTA 4BN1A 3R7OA 5AM7A 1YHSA 3NW7A 4AS0A 5IA3A 3TNHA 3DBCA 4AXAA 4X2GA 3HRBA 3P79A 1O6LA 3OOGA 4FV8A 4K8AA 3CR0A 5E91A 4AP7A 4EK8A 2VTLA 5CF6A 3ELJA 4X2FA 5C27A 2BRGA 2JDSA 4QP7A 4EH3A 3V5QA 3MYGA 2O5KA 4QQ5A 4U45A 1OL1A 4UBAA 5CZHA 1K2PA 4O7NA 1O9UA 1NVQA 3IW5A 3R1YA 4X7QA 2G2IA 5E9EA 5B2KA 5JRSA 4D4YA 1OUYA 4ZY4A 5HIDA 1JSVA 3KXXA 1H1RA 3QTIA 4EI4A 3GXLA 2C3KA 3EN4A 3KXZA 1PW2A 4F64A 4FMQA 1Q61A 4FKUA 3DKOA 2WOTA 3GC7A 2GS6A 3GU5A 5JMSA 2GNLA 3KF4A 4EH7A 2VTSA 2I1MA 1Q4LA 3ANRA 4GIHA 3ZO4A 4B8LA 5HORA 1V0PA 3LJ2A 1Y91A 3JVRA 3QD0A 1OPLA 3BV3A 4FTIA 4HVSA 3FAAA 2R3PA 1KUTA 5A4QA 5F20A 1M2RA 4RA4A 1IRKA 2V5QA 1RDQE 2C5OA 1VJYA 3CXWA 3DBFA 3HEGA 5JZNA 1ZOGA 5ITAA 4MYGA 2XARA 4EJNA 3EYHA 3OT8A 5DE2A 3ZLWA 5A4LA 3I0OA 4C4FA 4QTBA 2BPMA 5IMXA 5IA1A 4HNFA 3FZPA 1AD5A 3FMDA 1OIRA 4BKJA 5L2TA 5JEBA 2O0UA 4HVHA 3ENMA 4G31A 3UZTA 3W2CA 4E1ZA 2YWPA 3S3IA 4CD0A 1OMWA 3EQHA 3W32A 5L8JA 4CVAA 2JAVA 2XKDA 3IK3A 2XEYA 3PFYA 3VS6A 1TQPA 2JIIA 3VAPA 4AW1A 4U8ZA 3DLSA 4KRCA 4UYAA 5AAEA 1YXUA 2XJ2A 2B9JA 3QYWA 4BHZA 2W96B 3FMHA 3VBVA 2NO3A 4XV9A 4LGHA 4YTIA 3W55A 4L6QA 3KXMA 1H1WA 3UZPA 4BCMA 4FT3A 4BDIA 5EM6A 4DHJA 4BJJA 2C5NA 3O5AA 4FKWA 3LXPA 5EH0A 4KKEA 1IEPA 3CEKA 3HGKA 3R7UA 4JQ7A 2YAAA 2W1HA 2YDKA 4O7TA 3LFSA 2FO0A 5FBNC 3RAKA 2WEIA 3JVSA 5LMBA 4HGEA 1KOBA 5TT7A 4W8DA 3QKLA 2A0CX 3EQCA 3FI8A 1MQBA 3VBYA 4PL5A 2ZM4A 4B9DA 4MK0A 2Q83A 3DKCA 4WT6A 4YJTA 3R21A 3TG1A 5D7VA 3EZRA 2BTSA 4AZEA 3DLZA 3EZVA 3ODYX 3FQEA 1PHKA 2QOOA 4F7LA 3W18A 3VN9A 2F7XE 2HW6A 3O17A 3UIBA 4EUUA 1OBGA 4N0SA 2W05A 4XX9A 2V0DA 3HKOA 4KIOA 3IKAA 5EHLA 3TV7A 2WFYA 4EK4A 4FSYA 5C8MA 2ITWA 2RL5A 5IQGA 2QU6A 4ZS4A 3PY3A 1TVOA 5TR6A 3TZMA 2W7XA 4CNHA 5F9EA 1CDKA 3EYGA 3SXSA 1KWPA 4WO5A 3WZJA 5IH5A 3FKOA 3OY3A 5JH6A 2OKRA 5IEYA 3LMIA 5A54A 3KREA 3ZO2A 5HU9A 1Q62A 1MRYA 2H9VA 4AF3A 4JS8A 3BZ3A 4WA9A 4DBXA 2WD1A 4MTAA 2RKUA 3DTCA 4V05A 2BHEA 3RPSA 5DRBA 4MEDA 3R9RA 4AE9A 5JQ5A 5E8XA 2UUEA 1PRYA 2GU8A 1YRPA 4L67A 4NWMA 2ZYBA 4BDAA 2UW3A 3RM7A 4U44A 3PDTA 3RP9A 3KN5A 5BVDA 3PP0A 1CM8A 2RFDA 1UU7A 1XJDA 5KZ0A 3LFDA 5ANJA 5E8ZA 4PTEA 4DCAA 4HGLA 4Z55A 3QYZA 3N9XA 2XS0A 2GNIA 1A48A 1XWSA 4YHFA 2J0JA 2PZ5A 3NAYA 2C0IA 3LFNA 4AQCA 5C4KA 2WO6A 4JR7A 3NNWA 1KV1A 3LKMA 3R8VA 2PVJA 5ETIA 1G8KA 3KK9A 4EH4A 4AZTA 2WMTA 3LFAA 5IQCA 1NXKA 4DTBA 3P7CA 2JBPA 3HNGA 3H9OA 1Q8TA 1VLRA 4KUJA 1DAYA 2O63A 2V7OA 4I20A 4M0ZA 3EKKA 3UVRA 3VJNA 3R71A 4L43A 1SVGA 5C8NA 4FIFA 5CQUA 4JQEA 1U5RA 3KVWA 4USDA 4FIEA 3EL8A 3HMPA 3NPCA 3Q6UA 3DXPA 4G1WA 3LVPA 2C4GA 3QGYA 4HGTA 3FYJX 3NFFB 3TACA 4EK5A 3KK8A 1WBWA 2W1ZA 3FI2A 4CG9A 5AV3A 2HW7A 3NYOA 5GNKA 5C4LA 5ANEA 4O22A 5DEWA 2X39A 3T3UA 3LZBA 3W0NA 1CTPE 3C50A 3SLSA 3AMBA 3VJOA 3BEGA 2OO8X 1ZMWA 4GKIA 4X2KA 5DT0A 3NCGA 4XJ0A 3PWYA 2GHLA 3Q9ZA 3R02A 3DY7A 4B8MA 2PMIA 3GFEA 3P7AA 5M4FA 1JKSA 5IEVA 4ZEGA 2JEDA 3NIZA 4YZ9A 4ERKA 3R83A 4D4VA 2BZIB 4DFBA 1WBSA 2IZRA 5IEXA 4F1TA 3TXOA 2R3LA 4D0WA 5LMKC 3A8XA 3EFKA 3NNXA 4C37A 2J2IB 3GCPA 2RIOA 2QG5A 3O7LB 4FTAA 5CTPA 4AXDA 4F08A 4FKIA 5H3QA 1J7UA 2ITQA 4B99A 4YC8A 1U4DA 5AP0A 3PXYA 5FTGA 5KMMA 5FDXA 5IA0A 1ZZ2A 3PXFA 3R22A 4J7BA 4O81A 5EM5A 4R3CA 3RAWA 4EUTA 3PUFC 5KBRA 1KE8A 4ZTLA 1WBNA 1APME 5M06A 4GV1A 2XRUA 3KA0A 4L9IA 5EOLA 5L2WA 1XMMA 4BR3A 1SM2A 2YCSA 4CXAA 1OL5A 4JT3A 4RG0A 4YC3A 4I92A 4PNKA 1IG1A 3LJ1A 4DGGA 3COHA 3HMMA 1GNGA 4RVMA 3L8SA 4YUQA 4Y73A 4BBEA 5ETFA 4IH8A 5IQDA 1OGUA 2VX3A 3D83A 1I09A 4KB8A 4QDEA 5E92A 5E8UA 2PUIA 3VRZA 3DB8A 2HENA 4GW8A 4KA3A 3MB6A 3CQUA 2YN8A 2ZB0A 3VS3A 2CCIA 2WB8A 4OW8A 3BL7A 5AUYA 4FKVA 5L6OA 3PZEA 3I6UA 2CKQA 3F7WA 4RA5A 4TYIA 4JG7A 1OKVA 2IJMA 1Q8UA 3H30A 4UX9A 5CYIA 4ANBA 3F6XA 2OJIA 4EC8A 5KNJA 3LCSA 2F9GA 5ANGA 4ALVA 3I79A 2A4LA 2J90A 2XRWA 3TEIA 4RC3A 5EKOA 3LFFA 5LWNA 4MXYA 3TUDA 4C02A 4IADA 2OK1A 4AZWA 2P4IA 3CE3A 3DBQA 3PVBA 3UDZA 3O8PA 2F7EE 3PIYA 3GFWA 4WG3A 5KHWA 3W0RA 1OB3A 3C0HA 1J91A 2QOQA 3MVLA 1H24A 3OXIA 3SDJA 4AWIA 4E5AX 4G6NA 4RC4A 2VTAA 3RHKA 4A4LA 2C6OA 3E8CA 5IUIA 4EH8A 2R7BA 3B8QA 4I23A 3TKUA 3ZHPC 4UWBA 4AW0A 4I22A 1T45A 5HNIX 2YAKA 4JQ8A 3BGZA 4G6LA 3GB2A 4ZMEA 3O0GA 3W33A 5CANA 3C0GA 3V6RA 4CFNA 1GOLA 4RFMA 3KGAA 4MXCA 4B4LA 4IZAA 4PWNA 3W0SA 3BPRA 4FC0A 2QO7A 2PMLX 3DTWA 3BGQA 3UG2A 4DTAA 1OZ1A 3UC3A 2C3LA 3W2RA 2VWIA 1ZYJA 3MSSA 2W4OA 3P9JA 4RJ7A 1E1XA 1Y8GA 3RK7A 5LOHA 4IHPA 5KO1A 1QPDA 3L8VA 4FT5A 2UZDA 1H08A 2XF0A 4GS6A 4BCPA 3AOXA 3IW4A 4LYNA 4UALA 5HESA 2XNMA 5I9UA 5C9CA 4F1MA 5D11A 3SG8A 3E92A 3D2IA 5CWZA 2FSTX 1R0EA 3P0MA 4EKKA 2I0HA 4TTHB 3UMXA 5T3QA 5BV3A 1H8FA 3LMGA 2OFUA 4W4VA 2CCHA 2QNJA 3ORLA 2JC6A 4IB3A 3EQIA 4IZ5A 4F9BA 4P5ZA 2W1DA 3EJ1A 3LE6A 3PIXA 3UPZA 1FVTA 4ALUA 5L8LA 3PA3A 3R7IA 4AFJA 1LPUA 1XH8A 4R7BA 1JOWB 1M7NA 3NUSA 4PV0A 5EW9A 3ZBFA 4RQVA 1XH7A 1ST4A 2IVUA 4QTEA 5IQHA 5F95A 2NNWB 3TWJA 4F70A 4RJ5A 5BX0A 3HL7A 2O2UA 3TIZA 4D5HA 3ZUVA 5HHWA 4C38A 3O8UA 2GHMA 4U7ZA 5M57A 4MBIA 1SNXA 2X2KA 3H10A 3OY1A 4H05A 2FYSA 5FTOA 3HDNA 4PTCA 5LVPA 1Q8ZA 2I0YA 4JBPA 1PJKA 3UPXA 3VHKA 2C1AA 5EFQA 4ZSAA 4YJQA 1XH6A 3SW7A 1J7LA 3G51A 5HO7A 4FVRA 4C33A 4F1OA 3LCDA 5EW8A 4CMUA 2VTPA 4RIXB 1OVEA 4V0GA 4LI5A 4FG9A 3CKXA 2WTKB 4FTCA 4XMOA 4XV1A 4FK3A 4YZDA 3FQSA 4TXCA 3BLHA 1JSTA 3MIYA 5GHVA 3FY0A 3UNZA 1XKKA 4A9UA 4CFUA 2VTQA 4IAAA 1YHWA 3DCVA 2P2IA 3QX4A 2WXVA 3ZZWA 5J9ZA 2G2FA 4CCUA 5ACKA 1IASA 3HV7A 3LCKA 4D1SA 2YEXA 5BVOA 5E7RA 3R9NA 4GJ3A 2CHLA 2X2LA 4QMVA 3QTUA 4IWQA 3R8PA 1PKGA 3KXGA 3P78A 2IPXA 1H1SA 2CKOA 5E8YA 5AP7A 4QTCA 3R7EA 5JZJA 1JKLA 2IZSA 2XUUA 2J50A 4C2VA 1WBOA 3PTGA 4G5JA 5EK7A 2IO6A 3UOHA 3CTQA 5AMNA 3K54A 4IACA 4G3DA 4ZZOA 4NCTC 2WQOA 3DJ6A 3LQ8A 5H8EA 3SVVA 2XCHA 3FLZA 2Q0NA 5DOSA 5E1EA 4PQNA 5J8IA 4DT8A 1ZYSA 2Q0BA 3KMUA 4NW5A 2UVYA 4WRGA 2KULA 2JFLA 3R8UA 5HG5A 5DLSA 2UVXA 2IW8A 3DFAA 3UE4A 4FEVA 4ITJA 3WIKA 3CQEA 3MVMA 4GJ2A 4OTGA 4YNOA 4AW5A 4M3QA 5EOBA 2G9XA 4OTIA 1PY5A 3DXNA 2NYAA 4JIKA 4DH3A 4EOPA 4KKGA 4RFZA 2R0IA 4H3BA 1UNHA 5CSPA 2Y4IC 2B55A 2ERKA 3QLGA 5DT4A 2OIBA 1E9HA 4YTFA 4G3FA 3WF6A 2YHVA 3CS9A 3FSKA 4AGDA 1MRVA 4EQCA 4PMPA 4O0TA 1SVHA 4B6LA 2B53A 4FYOA 4O0WA 5ETAA 3TI1A 2YCQA 3FMMA 5AA9A 4PL4A 3S4QA 4L45A 4D2SA 3MVHA 2OBJA 3H0ZA 5FXRA 4IDTA 5G6VA 5HZNA 4L44A 3U51A 4NM5A 3S0OA 3EWHA 4G3GA 1FGKA 4DGOA 4GU9A 1PXJA 1TFFA 2WU7A 3ZRMA 4QMUA 4RIWB 2XIKA 3BCEA 2VTJA 4LV8A 4YC6A 3PLSA 4ZP5A 5A46A 1GIIA 1PF8A 2X8EA 4EORA 2JKKA 4FNZA 5BVKA 3G6GA 4ZTRA 4EOJA 3OG7A 5ANOA 4QP4A 3BWFA 5JFWA 4QMYA 2XBJA 3FXZA 1YWNA 2WKMA 2XK8A 3IOPA 3MJ1A 3V5TA 2WPAA 1BL6A 2VWZA 4IX4A 2OXDA 5E8SA 4ZJJA 2XAOA 3LAUA 1UNGA 4LL5A 4X3FC 3P86A 5DG5A 4BVUA 4IAFA 5GINE 1EH4A 1G5SA 2WQMA 3REPA 4AGWA 2C5XA 4TNDA 3NVKI 4JBQA 2X9FA 4DGNA 2PVNA 1YDTE 3BU6A 5ANKA 1UU3A 1JPAA 4FZ7A 2VTOA 5KHXA 2OJGA 3ZS5A 3SG9A 3OCGA 3ZFMA 4XP0A 2JGZA 3KCFA 3OF0A 4JIAA 3MN3A 3OXZA 2PVYA 5AV0A 2QQ7A 4GT3A 3BYSA 4OR5A 3VS1A 4BDDA 4WSYA 4BDFA 3OFMA 5CEMA 2GNHA 4LV7A 2XA4A 3DJ7A 3EH9A 2BAKA 4RWKA 2A2AA 3VQHA 4CFVA 1M2QA 3KMWA 3DNEA 4GG5A 2XKEA 3RVGA 2XJ0A 4NFNA 1ATPE 5CSXA 1WVXA 3A61A 5FM2A 5HX6A 4JRVA 3EL7A 3Q4UA 3E5AA 2Z02A 3W0OA 2BRHA 2Y8OA 1ZMVA 3ZTXA 2UW8A 4ZSLA 4I1ZA 5K3YA 2BTRA 3DOGA 3RPRA 2XEZA 3MWUA 3PY1A 3Q4ZA 3O96A 4OUCA 4RJ3A 5F94A 2I7QA 4ZJIA 5HVKA 5M56A 2EXCX 3L8XA 1F5QA 1K9AA 3PXQA 2OGVA 2C69A 1YQJA 1PXLA 3FEGA 3IOKA 4ASZA 4QT1A 1XBCA 3F7ZA 5H8BA 3VQUA 3UYTA 2UW6A 3SD0A 2ZV8A 4I5HA 2XALA 2FGIA 4N4SA 1FOTA 4NJDA 3KRLA 3FMNA 5CS6A 2XNPA 5CAQA 2E9VA 2W1FA 2FUMA 3DZQA 4FG8A 3OZ6A 4E93A 4FL1A 4FTOA 2XK7A 3S00A 5DHJA 1YI6A 5HG7A 4C4IA 2GNFA 3BU3A 4E5BA 2QODA 3D2KA 3Q4CA 1OIQA 1Q99A 5GIPE 3B2TA 1VR2A 4LGGA 4IBMA 1H27A 3KIOC 1IR3A 5DR9A 5T6KA 2X6EA 3LHJA 4O91A 2W1EA 5AP2A 2O3PA 4AXEA 1YWRA 2JDRA 1CSNA 3ROCA 2G1TA 4I0RA 4O21A 4YJPA 3DQXA 3TZ9A 3Q96A 4D58A 4DEIA 4P5QA 4RIWA 2QONA 3MI9A 5DT3A 4WNPA 4PRJA 4IAKA 1ZOEA 3P7BA 1H01A 2DQ7X 5H2UA 4LQMA 3R00A 1GZKA 3TZ7A 3W2QA 4J98A 3QWKA 3ATTA 3WZKA 3MPTA 5FDPA 3VW6A 3ZOSA 4DFUA 5EM7A 3UDSA 4DCEA 4MH7A 4MD7E 4D55A 5IUHA 2E9OA 5CNOA 4F99A 3LM0A 2ONLA 4S31A 3FL4A 3BHTA 4EQUA 2OLCA 3MPAA 1U54B 2CGWA 4QYHA 1AGWA 3BE2A 4L46A 4K18A 4FKRA 2ZVAA 5TF9A 3MGYA 2QR7A 3BLAA 2WQEA 3FZOA 4CTCA 5JT2A 2REIA 3IO7A 2IVTA 4RLLA 4YGAA 4BHNA 4GEOA 3OEFX 4RIYA 3HX4A 4C34A 2X8IA 1YKRA 2JKMA 5J7HA 2R7IA 2OW3A 4RFYA 4MBLA 2XNOA 3SX9A 5HICA 1OECA 3NSZA 2VX1A 4I0TA 4J71A 2X2MA 2OZOA 4D9UA 3EN5A 3EQFA 2HY0A 4DFZE 5FG8A 2YIYA 5F4NA 3E63A 1XQZA 1P4OA 2FH9A 2OJ9A 2XP2A 3FI4A 3DDQA 1XH9A 3NFGB 3UO4A 4AA0A 3HDMA 3I6WA 3MV5A 3NUAA 4NZWB 3U54A 3E62A 3E64A 5CXZA 5IF1A 2HK5A 5AUWA 3H0YA 1Z57A 5LVNA 3PSDA 1XO2B 5DGZA 1M7QA 2QLQA 2X6DA 4IIRA 5E90A 4DFNA 5CEOA 2HAKA 3C0IA 4MHAA 1F3MC 3P23A 5JGDA 3G2FA 4BIEA 2V55A 3DK7A 2R3NA 4K0YA 2IVVA 3QC9A 3UMWA 4XLIA 1UWJA 4B0GA 5IQAA 2VO7A 1CKIA 4MXZA 3DXQA 1PMNA 2QURA 4ASEA 4AT4A 1FPUA 4E8AA 3PJCA 5DIAA 3RALA 4LM5A 4RX9A 3ROYA 4CFMA 3KRJA 5KMIA 4O7LA 5EHYA 5FEDA 3BE9A 4QPSA 4F0IA 4YMJA 4FL2A 4FTKA 4HZRA 4F0FA 2XIXA 1MUOA 1H25A 2P33A 3LFQA 3LFBA 4YO6A 2CGUA 3V5LA 4F4PA 2AUHA 4BBMA 3K5UA 4BCQA 4MAOA 3ML1A 4AN3A 4FT0A 4DGLC 3NDMA 4IAIA 3ETAA 1Z9XA 3Q32A 2XANA 2GTMA 2JFMA 3K2LA 4MBJA 4YLLA 4DEEA 3RTPA 5CENA 1ZWSA 3FBVA 3Q52A 3SW4A 3VBQA 3VF8A 4G9RA 2BCJA 1XBAA 2BDWA 2C5VA 2XYNA 2PE2A 4D1XA 2F2CB 3VUKA 1P4FA 2JAMA 4JOAA 4ZZMA 3RWPA 4ZJVA 3KXHA 4C62A 4IW0A 3FHRA 2B52A 3KEXA 1H4LA 4QMWA 1UNLA 3WE8A 3ZU7A 4QTDA 3IDBA 4GFMA 5DYJA 2OSCA 3FMLA 4QTAA 3TV4A 2ITNA 4CSVA 3DAKA 4YJVA 3R8ZA 5BMMA 4UXLA 3KN6A 3ZDUA 4AX8A 3MTFA 4CKIA 1XH5A 4C3FA
chains in the Genus database with same CATH topology
3QXOA 4YP8A 2HZNA 4K9YA 4TYHB 3MFUA 5HD7A 4U41A 1H00A 3FLQA 3TM0A 2B0QA 3D5XA 4CMTA 3KCKA 3C4WA 1U59A 1BI7A 4O0RA 4F7SA 2RG6A 2UW0A 2VO0A 2OZAA 5DN3A 5AP4A 2RFNA 3UP7A 4RT7A 4BCOA 4ZMFA 2QHMA 2WMUA 4YJSA 4PL3A 1PXMA 1OL7A 4JG6A 4AOJA 5EQPA 3G90X 2Z60A 4Q5EA 3RJCA 5IH4A 4IM0A 4O2ZA 5DA3A 3MA3A 3IG7A 2OU7A 3A99A 2ITUA 4FNWA 4JVGA 1Z5MA 3G0FA 5EW3A 4DEDA 5AFVA 3DGKA 4M97A 4IAYA 2XYUA 2CSNA 4GK4A 3W16A 4FVQA 3PYYA 2WZJA 4C7TA 2VTNA 3PRFA 3VONA 3NNUA 4DG2E 4I5MA 1H0VA 1LEZA 4N70A 4K11A 3KY2A 1YOJA 1V0OA 5HEZA 2A1AB 4L7FA 5TKDA 2C5YA 4R5SA 2LAVA 3W8LA 3FKNA 2ETRA 2PK9A 3MY0A 4D4SA 3A7GA 3C4XA 5EDQA 4WKQA 3FL5A 3VUMA 3PXKA 1P2AA 2XIRA 4GT4A 4JX7A 3PJ8A 4H3QA 1VZOA 4PTGA 2P3GX 1YDSE 2VO6A 2ZFYA 2J9MA 3TNWA 2DWBA 5CXHA 4ZLZA 4H58A 2ESMA 3KULB 2PZIA 4X3JA 3FZ1A 3ZC5A 1S9IA 3H4JA 4ZSGA 3OD6X 5LWMA 5HO8A 4EYJA 3RAIA 3ZUUA 4LFIA 4YSJA 2V22A 2GNGA 4Z9LA 5LQFA 4G2FA 2YACA 2BDJA 4EBWA 3UG1A 3KMMA 3BWJA 1HOWA 3LJ0A 3TDWA 4FJVA 4IVCA 4ZXTA 5I9YA 4AXFA 5KMOA 4HZSA 2QG7A 2FA2A 2YIWA 3PVUA 3PPKA 4L8MA 1BL7A 2GHGA 4I6QA 3C4CA 2HXQA 2LGCA 3KFAA 4GIIA 4HYIA 4ANMA 2W9ZB 4RX8A 4JI9A 3D0EA 4C36A 2W5HA 4E6AA 1URWA 4ZIMA 2GQRA 4KABA 3QALE 4IFGA 4YJOA 3SAYA 3QUDA 4GK2A 3HV3A 4H1MA 5CSVA 2QLUA 4DT9A 4GKHA 3KRXA 2VTRA 4ZTSA 3F88A 4I21A 4FR4A 5ANDA 2CNVA 3S1HA 3W2SA 5EYMA 3B2WA 1ZZLA 1R1WA 4FNYA 1JQHA 3JPVA 4HJOA 5EKNA 2EB2A 4V04A 3AKJA 5DR6A 3TJCA 5IISA 3F3UA 3GC0A 4MKCA 4PP7A 3IS5A 3C4ZA 4LRMA 5IDNA 3FWQA 2QOHA 2OIQA 3CPCA 3UOJA 4F6SA 4RVKA 3E8DA 1W84A 2C6DA 2PHKA 2VZ6A 5AA8A 3DBDA 2ZB1A 4IAZA 5BMSA 3MH3A 3AGMA 4GL9A 4PDPA 1LR4A 4MWHA 4AXCA 5HLNA 2ETKA 5I0BA 5IQIA 3R2BA 4BDJA 3LIJA 3TKIA 4DA5A 5AAFA 4LUEA 4NL0A 2VU3A 3PFQA 1RE8A 4FKOA 4ZTNA 2YIXA 3IW8A 3Q60A 1KV2A 1PYEA 3HAVA 5BUJA 4QP2A 4WBOA 4XEYA 4GG7A 4TWPA 3OWJA 4E6DA 5CALA 4O0XA 4DFYA 3EQRA 5AP1A 2YERA 1E1VA 1W82A 4AN2A 2HY81 4TW9A 3RINA 4RRVA 5D12A 2ITXA 4X0MA 3N4UA 4G3EA 4ZAUA 5BNJA 3TKHA 4M8TA 4FK6A 5HVJA 2YCRA 5FXSA 3TIYA 1ZARA 2UW5A 3IW7A 3ORTA 3UDBA 4ITHA 2Y4IB 3BU5A 4CZUA 2CN5A 4OTWA 3QC4A 3ORZA 5HNBA 3FLYA 2BFYA 3HRFA 4KAOA 4J97A 5KZIA 1GZ8A 3W0QA 3FLNC 5EI6A 4DFXE 2WU6A 3DAJA 4RMZA 4AACA 2ZMCA 4ASDA 3NZ0A 4HCTA 2XIZA 1G3NA 4FKQA 4DEBA 3O50A 1X8BA 1XH4A 4NW6A 3SKCA 4FSQA 3PSBA 2FB8A 2ZOQA 5DFPA 2H34A 5JGBA 3II5A 3FPQA 4BZNA 1WAKA 4QEBA 3EKNA 3ZLYA 2W1GA 4JX3A 2NP8A 3I1AA 3VRYA 2B4SB 2UV2A 4WNKA 4DH5A 4ID7A 3BYMA 4BI1A 1W7HA 3PJ3A 5CAVA 2WELA 5HU3A 3O7LD 3HECA 3AQVA 2E2BA 4FKTA 3S95A 4BDHA 2W4JA 3F82A 4BIBA 3NEWA 2GDOA 2WMXA 4FUXA 5AUVA 1BLXA 2P55A 3PLAE 4I6FA 4E4NA 1LUFA 4PNIA 4C4EA 3ALNA 3QQUA 4RBLA 5FD2A 4CGAA 2GSFA 4ANQA 2PE1A 3OC1A 4X3FB 4GSBA 3QCQA 2ACXA 3CP9A 1W98A 2R3HA 2I6LA 3F5PA 2FVDA 5EM8A 3OT3A 4ACHA 3RMFA 2QVSE 1W8CA 4M14A 5AIKA 5L6PA 2PPQA 3IONA 3NYXA 4G9CA 4JDJA 4UN0C 3L1SA 2PZRA 1Q8WA 4FKJA 3LW0A 4K77A 3A4OX 5FRIA 3FDNA 3I5NA 4L00A 3T3VA 3IGOA 4BDGA 3D5VA 4IVAA 4MNEB 3RZBA 2WIHA 3BEAA 3U6HA 3FI3A 4IZ7A 4DYMA 4ZY5A 4FV2A 2BKKA 3BHHA 1UWHA 4FV5A 4XG9A 4AT5A 5A6OA 2W4KA 1XHAA 3U4WA 5JGAA 1REKA 4FTUA 2B54A 1Y6BA 3QRKA 5JQ8A 4C2WA 4A07A 3R7YA 4WOVA 4XG6A 3V3VA 2YWVA 3C51A 4XV2A 4FSTA 4AAYA 4F09A 1LP4A 4IANA 3OROA 3F66A 5BYLA 1UA2A 4FE2A 4ORKA 2CDZA 2B1PA 5IQFA 2PUUA 4WG5A 3BELA 3PPJA 2XBAA 4L42A 4TYJA 4NM7A 3Q5ZA 4M69B 3ACJA 2J5EA 1OIUA 4CKRA 1WBTA 4IB5A 4AGCA 4H36A 3I7CA 3A7HA 2BALA 2CLXA 2YABA 5L3AA 3Q4TA 3EB0A 4RGJA 3L8PA 3P5JC 2J0IA 4EH6A 4OTQA 2VNWA 1YXTA 4XNEA 4GRBA 3AC8A 2QKRA 5KKRC 3AC4A 4FTQA 3AC2A 2XKFA 4FTJA 2ITPA 5H9BA 3ORIA 3TTIA 2X81A 2OXXA 2YA9A 3RKBA 4I6LA 4CMOA 1H26A 1YXXA 3BKBA 4QMSA 3COMA 1QL6A 4Y8DA 3ZEWA 5ETCA 2EB3A 4U81A 4PMMA 2J0KA 4AZFA 3VHEA 3UBDA 3L9NA 2PVMA 4LUDA 4P7EA 1IA8A 5BQ0A 4IFCA 3JY9A 4F7NA 3RCDA 2UZVA 1DAWA 3UIXA 4CCBA 4FIGA 2XM8A 5A9UA 4EH5A 2BVAA 3BHVA 5CU2A 2CNUA 4DLIA 1MRUA 4A9RA 2VWBA 2F2UA 3F2NA 4BCFA 4AA5A 3ACKA 3C5IA 3QHRA 4FSMA 2XVDA 3ZM4A 4NTTA 2X8DA 4QMXA 3QKKA 3OWKA 2FSMX 1VYWA 1OKWA 3RNIA 4H3PA 4CKJA 3CGOA 2CLQA 3ZLSA 4F63A 3BYVA 3LM5A 3HAMA 3GNIB 5E4HA 1IAHA 3G15A 2GQSA 3TV6A 4IC8A 4O83A 3O23A 1ZY5A 3BQCA 2R3IA 3FMJA 4DEHA 3G5DA 3F61A 3QRUA 4FT7A 4C59A 3QZGA 2GQGA 4FSZA 5IA4A 2YZAA 3CD3A 1DI8A 1TKIA 3A2CA 2H96A 2VN9A 4WUAA 4KSPA 1UU9A 4CFFA 4FEWA 3QCXA 1OI9A 1JNKA 4S2ZA 3D4QA 2UZWE 4D2RA 1M14A 1ST0A 4FNXA 4XYFA 5BUIA 3KXNA 4BTJA 2PUNA 2OI4X 3AKKA 4QYEA 4WNOA 3AMYA 1KE7A 4MNEA 4AG8A 2IZTA 4JJRA 4OBPA 4KBAA 4XP2A 4K6ZA 3PJ2A 2VGPA 1VYZA 1YI4A 1YVJA 4R78A 4EWQA 4YJRA 4YO4A 3WF8A 2VX0A 2XZSA 4TWOA 3G0EA 4EOIA 4Z16A 5JK3A 4UXQA 2VWVA 3F5XA 4A7CA 4EOQA 4ARKA 4FGRA 2C6EA 2UW7A 4I6HA 2HIWA 3AKLA 5LXMA 2VO3A 3PVGA 4R5YA 5LCKA 2JBOA 1KE6A 2HZIA 3GT8A 3V6SA 4FVPA 3AC1A 2R64A 3EQBA 3LQ3A 3QA0A 3QD4A 2UZOA 3EHAA 4O82A 4BDBA 4MUQA 2W1IA 4TYEA 4EZ7A 3VIDA 3FMEA 4CRSA 4CT1A 5KBQA 2JDOA 3SOAA 4PDSA 4GVJA 3WZUA 2NRUA 4B7TA 2HYYA 4BICA 5C26A 2Z2WA 4OTRA 2OWBA 5CU6A 1SMHA 3NYNA 3PZHA 3QCYA 5HKMA 4FZ6A 4NYEA 4QYFA 5CI6A 3R2YA 5HTCA 3IW6A 3Q6WA 3OHTA 3VUIA 3V04A 3OS3A 3R1NA 3SXRA 2BRBA 5AUUA 3D7ZA 5C01A 3HA6A 4TZRA 4C4GA 2GTNA 2BAQA 2Y4PA 4ZS0A 2J0MB 3NRMA 4WUNA 5HE1A 3NYVA 1PXOA 2NPQA 2OF4A 2WTCA 2F49A 2UZLA 3DZOA 3ERKA 3MFSA 4KINA 4CTBA 3P08A 4DHFA 3HUCA 4YJNA 4CLJA 2XKCA 5KX8A 2Z7RA 3QTSA 3IQ7A 3F3WA 2OJJA 3BGPA 2ZV9A 4O2PA 1Q97A 1MQ4A 4N6YA 3WILA 4EONA 4MD8E 4FA2A 1H28A 3VO3A 4I93A 3R8MA 1Y8YA 3NUPA 4MD9E 2QU5A 4MVFA 2WMBA 4RWJA 3CD8A 5CLPA 4QP9A 3WZEA 3P1AA 4FEUA 2EWAA 3ULIA 4FT9A 4N57A 2PSQA 3UODA 5AEPA 4APPA 1DI9A 2YM4A 2I0EA 1G8SA 2ZAZA 3BBTB 3G33A 3NNVA 2YIQA 5K5NA 4YZCA 4EZ5A 4CLIA 2GFCA 4UY9A 3NGAA 5AUXA 1QCFA 4RIXA 4UYNA 5KCVA 4J1RA 3MTLA 4GFGA 4XG8A 1Q3WA 5CX9A 3E3BX 2GS7A 2UW4A 5EG3A 5HE3A 2F7ZE 2XB7A 4K1BA 4FV7A 3CTJA 3GCQA 5HVYA 3MA6A 4QYYA 5FQDC 1OUKA 4U42A 4A9YA 4C4HA 4M12A 3UZRA 3BIZA 1L8TA 4TN6A 2PU8A 5J1WA 4QQJA 4YLJA 3BHUA 4D28A 3JUHA 4DG3E 2UZTA 4FSNA 4JR3A 1PXKA 4TWNA 2JDTA 3Q9YA 4KBCA 2QI8A 5E1SA 4EQMA 3G9NA 3AMAA 4W4YA 2RF9A 4PP9A 5DVRA 1P5EA 4R3RA 4JBOA 1J1BA 5L2SA 4PMSA 1STCE 3SHEA 4E4XA 2YCFA 4JLCA 5AUTA 3U55A 4DBNA 3MJ2A 4EHVA 5LARA 3L9MA 2XCKA 3JYAA 2YDIA 3LMHA 1TQIA 2VAGA 3LXKA 3QXPA 4X21A 5HCXA 3RI1A 4M84A 4XOYA 4ZOGA 3UIUA 4APCA 3SV0A 2H6DA 3UP2A 1R3CA 4QMNA 5IDPA 2CJMA 5DNRA 5FBOA 4O7RA 4JL9A 2V62A 5BYYA 3MS9A 4ACCA 3VUGA 3OCBA 4GCJA 2VUWA 1JVPP 4U5JA 3NUYA 3MY1A 4Q5HA 5FXQA 3E3PA 3SRVB 3ZH8A 4BCJA 5I5ZA 4C61A 4FIHA 2YM5A 4XLVA 4DEGA 1M52A 3EN9A 3UOKA 2QD9A 3BHYA 3MFTA 4OBOA 2HWPA 5CSWA 4FV6A 2OFVA 2BR1A 3DQWA 3HV5A 2C3IB 3QHWA 3HVCA 1OBDA 2YM6A 4NIFB 3TN8A 3GC9A 3TNQB 3PWDA 3ZFXA 2JD5A 4I94A 3BRBA 3H9RA 4HVIA 3KVXA 4GUEA 4LL0A 1GIHA 5CU0A 4MQ2A 4XBRA 4IX6A 4EK3A 3E7VA 4FTLA 2HXLA 3Q9XA 3NR9A 2DYLA 1BMKA 5HI2A 3QQJA 3C7QA 4TNBA 2B7AA 1PMVA 3ORMA 2BIYA 1A06A 4FSRA 4NH1A 3HMOA 4DE4A 4Z3VA 4JXFA 2HZ4A 5JFVA 3R28A 3ZZEA 1ZOHA 5DR2A 1V0BA 2B9IA 2PVHA 3UDTA 2YITA 1ZMUA 1FVRA 2PVFA 2QHNA 2WQNA 3R73A 1GZOA 3CJGA 5HE0A 2WNTA 3IGGA 2DS1A 3G9LX 4FTTA 1T46A 3OCSA 3GQLA 5B7VA 3NLBA 2PY3A 2YZLA 5JKGA 4RWIA 4E26A 5DPVA 5L8KA 4KS8A 1ERKA 3ZXZA 3I7BA 3LFEA 3WE4A 2ZV2A 5FP5A 4C0TA 4DINA 5M07A 4GU6A 4QMPA 3CQWA 2CKPA 1H1PA 2W06A 2VTTA 4LMNA 3D14A 3QD2B 3PVWA 3WIGA 3GU4A 3Q2JA 2BHHA 2AEGA 3K3IA 3ORKA 2X1NA 4HVGA 3D5UA 3ZSIA 4YZBA 4Y83A 4OGRA 4Q9SA 3RK5A 2BILB 4U6RA 4F6WA 1FVVA 4BC6A 3M2WA 1FMKA 5EYDA 3I5ZA 2F57A 4M0YA 3A4PA 4TL0A 1XR1A 1ND4A 2RG5A 3PUPA 3IPHA 4EKLA 2R5TA 4MNFA 2VWUA 4I24A 5CF8A 3N51A 5I9XA 4BBFA 3NX8A 3RPVA 3FLSA 3WF7A 1P14A 5HGIA 3V01A 3GI3A 4J52A 2PE0A 3MDYA 4ZLYA 1LEWA 5M53A 4AZSA 3QL8A 3T9TA 2BZJA 2Y0AA 2GPHA 5A4CA 3ORXA 2J4ZA 2C68A 4IDVA 4TRLA 5CVGA 2X4FA 2OJFE 3F2RA 1RJBA 4IWOA 4XCUA 5AWMA 4NT4A 1OM1A 4BGGA 3G6HA 5D41A 2R3QA 3IDPA 4DITA 3E93A 2J6MA 5D10A 2X7FA 4FYNA 4KSQA 3HMIA 2WMQA 4OTDA 4YHTA 4ACMA 3ATSA 3AD5A 3WOWA 4PF4A 1BYGA 5CF5A 4BYIA 3BLQA 3ENHA 3EQGA 4YZMA 1OPKA 5JN2A 4DAWA 3FXXA 4M67A 3VW8A 5J1VA 3C1XA 2RGPA 3A7FA 3UIMA 4BJJB 4FEXA 1B6CB 3U9NA 4KD1A 4ZSJA 3QTXA 2JIUA 4OLIA 4WNMA 4QP3A 3TTJA 4RSSA 4YPSA 1FINA 5CAUA 3VULA 4CFWA 1QMZA 5BVEA 5F1ZA 3GU7A 3W0PA 2C6TA 1ZRZA 4FL3A 4AAAA 4LOQA 1J7IA 4AOTA 5ANIA 3W8QA 2RFSA 3MH1A 1Q41A 4A4OA 4C3PA 1Y57A 4JBVA 3GCUA 4D9TA 2PL0A 4HPUE 4L52A 1YOLA 3LOKA 3Q9WA 3PPZA 4UWYA 5HX8A 1YXSA 3F3TA 3COIA 3O71A 5GJGA 1V1KA 3MFRA 4RJ4A 2PVRA 3NVMB 5B2MA 1GZNA 3E8EA 3POOA 5M51A 2VTHA 2GS2A 3EMGA 3QFVA 4IB1A 3OBJA 4U79A 4D4RA 3VBXA 4E4LA 3DBEA 4FIJA 3S2PA 4AT3A 5EQEA 4OTFA 5DH3A 1U54A 2WTDA 4KS7A 4G3CA 3QZIA 3B8RA 5HQ0A 5HG8A 4FEQA 2FSLX 4G17A 2QOCA 3D7TB 5TO8A 4BGQA 1URCA 4FSWA 4FZFB 3V5WA 3C4FA 4DH8A 1JKTA 2PMOX 4U43A 3THBA 1R0PA 5L2IA 5CAPA 4DGMA 4BY9E 3E8NA 4FX3A 5EHOA 3GQIA 3ORNA 3W2OA 4BF2A 5BVFA 2PVLA 1BKXA 2BIKB 3GCVA 3AD6A 4USFA 1W83A 4NFMA 4NU1A 1KE5A 4G34A 4UB7A 4YPDA 3T9IA 4CEGA 4QRCA 3DV3A 3F2AA 2WOUA 5IU2A 4GFOA 2J7TA 3GU8A 3NIEA 4G5PA 3SC1A 2YDJA 4ENXA 1A9UA 1Q3DA 3GC8A 4ANLA 3EFJA 3DT1A 4LRKA 3R1SA 4RZVA 5HBEA 3CC6A 2CGVA 2JKOA 3HV4A 4FSUA 2R9SA 4XOZA 3VF9A 4BCGA 3UNJA 4Y46A 2ONLC 5HCYA 5HCZA 2YM7A 3RGFA 3I0QA 4O96A 2ETMA 3LQ5A 4FOCA 5I9VA 3OWLA 4D5KA 2O64A 3TZ8A 4CV8A 1Q8YA 1FGIA 5LCJA 3M42A 1UVRA 5LMKA 5AIRA 4E4MA 1CKPA 3LFCA 2G01A 4H39A 4U40A 2CMWA 2JDVA 3TCPA 3ET7A 1BX6A 4AW2A 4L53A 4IVBA 3JR1A 5KE0A 1WBPA 1WFCA 4F7JA 5KKRB 2AC3A 3DNDA 4S34A 3VVHA 5CASA 1H07A 1MP8A 4QMQA 5IMEA 4A9SA 5EDPA 3F3ZA 5KMNA 4I3ZA 2PWLA 3W1FA 4EBVA 4ZZNA 3PG1A 3BQRA 3OTVA 5BVWA 3UYSA 3OUKA 3OMVA 2EVAA 3MVJA 4AQKA 2C3JA 4MWIA 4QQCA 5HBJA 3UQCA 3HUBA 4YLKA 2YJSA 2XNEA 2XK3A 3FZRA 4RWLA 4CZTA 5HG9A 5JFXA 2BZKB 4M13A 4L3LA 1VEBA 1XMLA 4GUBA 4O27B 3GBZA 4AUAA 1W0XC 2UZBA 4BI0A 4IZYA 4NK9A 3EN7A 4WBBB 4I0SA 4EHEA 3OW3A 3QQKA 4PMTA 3R8LA 3D9VA 3QA8A 4LOPA 3VWAA 3ZLXA 2IVSA 4EH2A 2IWIA 3QKMA 4KIPA 3V8TA 3AGLA 5EYKA 4C3RA 4IX3A 3SXFA 3HZTA 2W9FB 4FTNA 4BRXA 4HW7A 5AAGA 1ZYDA 4BCIA 1JSUA 3VS5A 2W5AA 3TJDA 1WZYA 3GEQA 1B39A 5FP6A 4E6CA 5AADA 4F9CA 5AP5A 4AN9A 3I60A 3ZBXA 5FLFA 3BL9A 4X6RA 3Q53A 2BMCA 1M2PA 1ZXEA 4DDIA 3AC3A 1PKDA 5J9LA 4XUFA 3AG9A 2XK4A 3ANQA 3EOCA 3OBGA 3D7TA 3QTWA 4FV9A 3H9FA 3JXWA 2IZUA 4HYSA 4NUSA 5FTQA 5BPYA 4TYHA 2HOGA 3LLAA 1S9JA 2IN6A 3BX5A 3NUXA 3PY0A 4G16A 5IH6A 2ITOA 4EJ7A 5I9ZA 2R3GA 4QMTA 2PULA 2NRYA 2BUJA 2C1BA 3WYXA 4KIQA 4GMYA 4CV9A 2Z7SA 4U80A 5M4IA 1O6YA 3QF9A 4II5A 2BROA 5B0XA 3PRIA 4DH7A 4J96A 1UV5A 1GY3A 3CY2A 4RQKA 3QUPA 4JDKA 5AJQA 3ZSHA 2XAMA 3VBTA 3QTRA 5J9YA 2AYPA 4R77A 5K5XA 4X6QC 3OTUA 1BI8A 3QQFA 5HIEA 2CNQA 3PJ1A 4O0SA 5LVLA 2C6IA 4BCNA 5A4TA 2E9UA 3QWJA 3CTHA 1PXPA 4JRNA 2QR8A 4L3PA 4F0GA 2Z7QA 3CJFA 4BZOA 5HIBA 3IDCA 2R3RA 2A27A 3EIDA 3OP5A 4U97A 3MPMA 3W0MA 4C4JA 2QCSA 3UVQA 2W5BA 1TQMA 3FMKA 3GVUA 3VS7A 2VWYA 3JS2A 4DLJA 2QOBA 3VUDA 4F9WA 4AZVA 4O0UA 2PZYA 4E5WA 3R30A 5H8GA 3OW4A 3NW5A 5GIOE 4FV3A 5AP3A 5CT7A 4IC7A 4AU8A 1JBPE 3R1QA 3LLTA 4MXXA 3FXWA 2UZUE 3Q3BA 3UO5A 4EEVA 3U4UA 3BI6A 5AV1A 4J8MA 3EFWA 3AT4A 1JAMA 2EXMA 3DKFA 3OCTA 5TOZA 1Q24A 1YXVA 5CT0A 3SGCA 4E7WA 4TY1A 3EQPA 3LPBA 2R3JA 3GCSA 4O0VA 2OH4A 4YU2A 3KULA 3QRJA 3WZDA 4UV0A 3ZMMA 3ZSGA 3C9WA 3QRTA 2SRCA 5CU4A 4EH9A 2VGOA 4QPAA 4DFLA 3V5JA 3HA8A 4IB0A 3RM6A 2PTKA 4QP8A 3WARA 4IJPA 4ONAA 3MH2A 4TPTA 5G1XA 4KKHA 4QMLA 4KRDA 4CG8A 2OXYA 3DKGA 3KQ7A 4D0XA 1NW1A 5M08A 2X0GA 1HCLA 4OT6A 4DDGA 4O7WA 4NKAA 4Q9ZA 4C58A 3KB7A 3WYYA 1RW8A 2GFSA 5EQYA 4C35A 2BRMA 3R6XA 4PY1A 2QOIA 2YM8A 3ALOA 4ZTHA 2WIPA 4PUZA 4HYUA 4QNYA 3VBWA 2R4BA 4F78A 2J51A 3FKLA 4P2KA 4GH2A 5DBXA 2PYWA 3MH0A 4ACDA 3PA4A 3CBLA 4W4XA 4YR8A 5JFSA 4HVDA 3GENA 3R0TA 3HRCA 3R04A 3PA5A 4J8NA 2VNYA 3AC5A 4AFEA 4EWHA 4EOMA 4DN5A 3UTOA 4E73A 3AD4A 4HGSA 4DC2A 1AQ1A 3OXTA 4QP6A 2DUVA 2IG7A 3OVVA 1FBNA 1OKYA 2HCKA 3CGFA 4O38A 3DU8A 5M55A 4CRLA 3U6IA 3C13A 4UZDA 4YTHA 1QPJA 3VC4A 1HCKA 3E88A 3CCNA 5J5SA 2WMRA 2CPKE 3F9NA 2VTMA 3MW1A 4YBKA 1F0QA 2PUPA 1B38A 2HWOA 1I44A 2ZDUA 2X7OA 2YIRA 3KRRA 4I4FA 4I4EA 3DFCB 5C1QB 2YJRA 3CKWA 2C30A 4ACGA 4U9AA 2JIVA 4V0GB 4WRSA 2B9FA 2GMXA 3HYHA 2ITZA 4JDHA 4NCTA 5HE2A 3RAHA 2QO2A 1JWHA 4LG4A 3FY2A 2VV9A 2CN8A 4NJ3A 3C4EA 4S30A 5E8TA 2ZM3A 2YFXA 4ZK5A 2UZEA 1H0WA 2IW6A 3F5UA 4XV3A 3ZDIA 4L68A 5EYCA 3PP1A 5IZFA 4DH1A 4R7HA 1DS5A 3M11A 1QPCA 2QOFA 1JLUE 3CSVA 4I5CA 3TL8A 2R0UA 4BTFA 4IEBA 5M4UA 1SZMA 3FQHA 4MCVA 3V51A 1WCCA 5CNNA 4JNWA 4ITIA 2C6KA 5J95A 4Y85A 4EL9A 5AX9A 4DHZA 5BYZA 4IM3A 4YSMA 5HTBA 3HP5A 5AV4A 3NS9A 4FGBA 4QO9A 5CEKA 2P0CA 3QQGA 3QTQA 2VWWA 3PXRA 4HPTE 5I4NA 3RHXA 4WG4A 4IM2A 4R6VA 2PVKA 4J53A 3PXZA 5L6WL 4HNIA 4JDIA 4WIHA 4XP3A 3FPMA 4R3PA 2CGXA 5FEEA 4XHKB 3W10A 3U87A 3SA0A 3R9DA 3ZRLA 4RX5A 2E9PA 4RJ6A 5DWRA 2BKZA 3DJ5A 3K5VA 2R2PA 3EN6A 3VUHA 4BZDA 3HLLA 5DRDA 2ITYA 4NM3A 4BDEA 3NWWA 3FLWA 3PE1A 2JKQA 5A3XA 1FQ1B 3D94A 4V01A 2Y6OA 3WF5A 3KKVA 3TDVA 2WEVA 3RCJA 3P5KA 2ZV7A 4MQ1A 3A7JA 4RVLA 5IA2A 3BV2A 1KOAA 4LOOA 2WQBA 2FSOX 2W1CA 3I4BA 4I5PA 4ERWA 4JAJA 4NSTA 5CI7A 4GYGA 3TYKA 2X9EA 4IX5A 1ZYCA 2Z8CA 4BCKA 5B2LA 2CKEA 4GVAA 2O8YA 3DDPA 4K2RA 5HBHA 3ZXTA 1ZAOA 3ODZX 5C03A 3HV6A 4BDKA 4FTMA 5CEQA 4PX6A 3Q2MA 1J3HA 4X3FA 2YM3A 3EQDA 4O7ZA 1JKKA 3KU2A 3ZO3A 2E9NA 3RNYA 5K4JA 1QPEA 3TMOA 3UNKA 4O7VA 3T8OA 2OG8A 3WI6A 4XG7A 4K33A 2W17A 3UOLA 5D1JA 3LCOA 3WBLA 4BIDA 5CF4A 5K9IA 1L3RE 2BFXA 1YOMA 1YI3A 3Q5IA 2IW9A 4E6QA 5HLWA 5ICPA 2KTYA 5KMLA 3OEZA 3PSCA 5C8KA 3GU6A 4A06A 3DK6A 4FOBA 4KNBA 2ZM1A 2UW9A 4H1JA 4OTHA 1PYXA 1SYKA 3A8WA 2WMSA 3O51A 4X2NA 5IPJA 5KUPA 4EOSA 3VNTA 3TNPC 4U3ZA 3ZRKA 5LMAA 4ZLOA 3KF7A 2F4JA 3R7VA 4FODA 4CFXA 3SQQA 5LVOA 4R1YA 1KE9A 3GOPA 4MF1A 4YZNA 3OOMA 3VS4A 2B9HA 4AE6A 5FGKA 5A14A 1U46A 4FKSA 3NUNA 3PIZA 3EFLA 1XBBA 3MY5A 5T68A 3TUCA 2I40A 2J0LA 2P2HA 2GCDA 4S33A 5I9WA 4XH6A 4HYHA 3L9PA 1Y6AA 4EOKA 4ANSA 5BVNA 5GJDA 4IWPA 4F65A 3F69A