3N4VA

Apo aph(2")-iva form iii
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
298
structure length
298
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKAVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Crystal structure and kinetic mechanism of aminoglycoside phosphotransferase-2''-IVa.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Unknown function
total genus 101
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3n4vA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3n4vA02
2J7TA 4BYIA 3QWJA 5ETCA 5B0XA 2WTDA 5E4HA 3ROYA 1FMKA 2F2UA 3A2CA 3DDQA 4KABA 5AWMA 4X3FA 4NUSA 3R71A 2QKWB 4NL0A 1WBSA 4QP6A 3CBLA 3MH2A 3AMAA 4DEAA 2H96A 4V01A 4ALUA 4BIEA 3PVBA 1I09A 2V5QA 5D1JA 4RFZA 5KMMA 3GOKA 2XNBA 3BIZA 5JRQA 1JAMA 4AUAA 1U59A 5HX8A 1H27A 3ALNA 3QX2A 4OT6A 5L2SA 2JKQA 1XO2B 2WELA 2X2LA 5CZIA 5D9HA 5HCZA 2WKMA 4BI0A 1JKSA 1GZOA 3BYMA 4XG6A 5K5XA 1GIHA 3E88A 3L8XA 4F9AA 4M3QA 2VTSA 3QZFA 3LHJA 1GNGA 3MGYA 2ZB1A 4XRJA 5FXRA 3JVRA 1BKXA 3MTLA 3CSVA 4NTTA 3TJCA 4IZAA 2ZJWA 4QYEA 3UYSA 3DJ6A 2XNGA 3W2CA 4O7VA 3DLSA 4BBMA 4BZNA 2YISA 3H0ZA 2YWVA 4RC3A 5JGAA 2BAKA 4MHAA 1UV5A 3CJFA 2XYUA 1BI7A 4PMTA 4UY9A 4K33A 2R64A 4I0SA 4D2RA 3MI9A 2J9MA 4F64A 4DH3A 3AD5A 4W4WA 4EHVA 2X7OA 1GAGA 3F2RA 4NM0A 4TN6A 5EM8A 4DLJA 5LJJA 4FVRA 2CN5A 4FA2A 3TN8A 3U6HA 5HD7A 5BYYA 1CDKA 5AUUA 4CFVA 3EN7A 4D1SA 3H30A 3O51A 4I6FA 4DGOA 3CS9A 3DDPA 3E8CA 2XIKA 4IANA 3VS7A 4CTCA 2YEXA 3MSSA 3BE9A 2CKEA 3GFEA 3FZOA 3KRXA 5CXHA 2Z2WA 4EK3A 1OMWA 2C5NA 3BU5A 5KKRC 2QOKA 3SDJA 4ZP5A 5FDPA 3NLBA 3HRCA 4EOQA 3CEKA 5FTQA 5E8SA 5HICA 1MUOA 5HZNA 1OPLA 3QLFA 4OTWA 3BHVA 4TXCA 2VTAA 3LMGA 1IEPA 3NDMA 3M2WA 2BHEA 4AU8A 3V6SA 1NW1A 1PW2A 2UW7A 3MY5A 3RCDA 4LOQA 1MRVA 3GUBA 4Y73A 3MTFA 5I9UA 5LVPA 2PYWA 4FKGA 3LFAA 4RLLA 2G2FA 4HOKA 2OXXA 4Z16A 2VO3A 4LOOA 3GFWA 3RAWA 3B2TA 3D14A 4XX9A 1ZRZA 2X8IA 4EQUA 4QT1A 4IAKA 4FV4A 4RGJA 2ZMCA 4G17A 4AGDA 1V0OA 4CRSA 5ACBC 4EJ7A 2Z8CA 3DY7A 4RWIA 3GCVA 3RPRA 4QMPA 4ANMA 5IH6A 5BMMA 3FQSA 3QRUA 2BZHB 3NYOA 4IVAA 2VWYA 4L7SA 3GU5A 1NT2A 4I5PA 5HD4A 3QALE 3L8PA 1PXJA 4BR3A 3RNIA 2BKKA 4EUUA 3QCQA 4NIFB 3ORZA 5EYDA 4C3FA 3NNVA 4FR4A 2W17A 1WBNA 2CNVA 3JXWA 3KC3A 3VC4A 4IDTA 4U98A 3PXKA 4IM2A 4IH8A 1PRYA 1BI8A 5KO1A 3ZDUA 5M44A 3PE1A 3U4WA 3A62A 3OMVA 3GCSA 4R1YA 4G3CA 5IMXA 4AGUA 4DH5A 3UO5A 2XCKA 2VX1A 3I60A 5H8EA 5A9UA 5M4IA 4WG3A 3W10A 5CAVA 2O63A 1R78A 3KK9A 2AUHA 4HCTA 4JQEA 2QI8A 3NCZA 4GT5A 4TWPA 3SOCA 1ZYJA 2X7GA 2C3IB 4NTSA 4FEUA 2GS2A 4BCHA 3UPZA 4M7IA 2IZSA 2QO9A 3MDYA 3V5JA 1M2QA 5DG5A 2R4BA 4QO9A 4D5HA 4K11A 3TXOA 2Y0AA 1OI9A 4ANQA 2GDOA 2YITA 4FKJA 4X2FA 4E7WA 3II5A 2HWOA 4EKKA 4NM5A 2PVFA 3K5VA 4FIFA 2QR8A 4RLKA 4XG4A 5HVYA 4J8MA 3PXYA 4HYUA 5HHWA 2OZAA 2YM5A 3VHEA 2CKOA 4F4PA 3NW7A 4W8EA 2VZ6A 3F5UA 4F0IA 5CF5A 1ZMWA 1OPKA 4MNFA 4E6QA 2JDVA 1UKHA 4FZAB 3RAIA 4HW7A 3ZC5A 1J1CA 3RGFA 5BVOA 1O6KA 3C4XA 4QQ5A 4AOTA 4YBJA 2W1GA 5H8GA 3HMIA 3ZUVA 3ETAA 5M57A 3HL7A 1SMHA 2OGVA 4MXXA 3MB6A 4PF4A 1H1WA 4FYOA 3V01A 3LJ2A 3RWPA 2F7XE 5EDQA 5KBRA 5CSXA 1GJOA 4YJPA 4EK4A 2JFLA 1OITA 3OT8A 4CFWA 3F3TA 5CAQA 4QYGA 4ZS0A 4BGGA 1JOWB 3C1XA 4FKSA 4HVDA 1CM8A 1DAYA 3KXMA 4GUEA 3TV6A 3LIJA 3DQWA 4C38A 2GFCA 3QHWA 4KKHA 3TL8A 5J1WA 4O7SA 4YZCA 1XBCA 4E6CA 1PMUA 5GNKA 1K9AA 2C4GA 3W16A 4MEDA 1K2PA 3C7QA 4JDKA 4IE9A 3EKKA 1YW2A 4NCTC 1PKGA 3QUEA 3KL8A 4KNBA 2ONLA 3QF9A 2XBJA 5HU3A 4JG6A 3QHRA 5EI6A 3RVGA 3QCYA 2J51A 2VU3A 2DWBA 4GKHA 3EQIA 4I22A 2IPXA 4IMYA 4BCJA 5AIKA 4QQJA 4WUNA 2BPMA 5HE1A 5LCKA 4U94A 4L52A 3VS2A 2ZDTA 4HNFA 4E26A 3NNXA 4ASXA 1YWRA 5CI7A 4CQEA 4PMPA 2UZVA 2VWIA 3PPJA 3H9OA 3QBNA 2YIYA 3ZLXA 5F4NA 3O8PA 2I1MA 3ZBFA 3OWKA 4RBLA 4O0UA 2ETRA 2BALA 2CGWA 5EFQA 3ZO2A 4OTFA 5D7AA 3PA3A 5IEYA 3MJ2A 4DHFA 2XK3A 2IW9A 4XBUA 4FV5A 3Q3BA 5CX9A 1H1QA 4DCAA 4O0SA 1FPUA 3WBLA 3D0EA 2E9OA 3L9LA 4C4HA 1WBPA 2GQRA 3QQGA 4KIOA 3OBJA 3R28A 4RG0A 4M0YA 4U44A 4PDSA 3W1FA 3REPA 2C1AA 2WAJA 4QMYA 3EHAA 1PMNA 5CSHA 4Y46A 3N4VA 3SAYA 3JVSA 4JBVA 3D94A 3KRLA 4LV8A 4N4SA 4GK4A 4ZK5A 5B2LA 2B9HA 1DI9A 2OIBA 3OXZA 5CVGA 4AGCA 3QC4A 4BCOA 4UN0C 3E8NA 4WG4A 4YHTA 1JWHA 2HYYA 4QP4A 3F7ZA 3PXZA 4DG0E 2JFMA 5BVFA 3DNDA 4XJ0A 4Q2AA 4L6QA 2YCFA 5EKOA 5A4QA 5BVNA 5CSVA 4DG2E 5IA2A 4EC8A 5M55A 4MD7E 2J0MB 3IK3A 3Q2JA 3DKCA 2GHLA 1XH7A 4DT9A 4YC8A 4IB0A 4G3DA 3QC9A 4V0GB 3FZPA 1JKKA 2HAKA 3MN3A 4M67A 5EK7A 4OTDA 3KMMA 4ZTNA 3NUYA 2H34A 5E1SA 5C01A 1ZMVA 4Y5HA 1F3MC 1J1BA 1OUYA 3DAEA 5AA8A 3FY0A 4Q5HA 2JBPA 5DR9A 4FKPA 4U8ZA 3DOGA 4TYHA 4AG8A 1H0VA 3F5PA 2HZNA 5KZ0A 3RPVA 4MD9E 4CG8A 2XCHA 5BVWA 2B9JA 1UWJA 1A48A 5JFWA 4MWIA 4WA9A 3GCQA 4IVCA 5J7HA 2VWWA 5JFXA 2BAQA 3GU4A 4GS6A 3FI4A 4I6QA 2JEDA 3HDMA 4C34A 2RFSA 4AE6A 4ZSAA 4AN9A 4B7TA 4IJ9A 3KXNA 4ANSA 4O83A 2PVNA 5FXQA 2OJFE 2PUNA 2QOLA 2X39A 3Q9ZA 4FK3A 5BUIA 4TYJA 4OGRA 3TACA 4D58A 4EBWA 2RG5A 2CLQA 4M84A 4QTAA 5AAEA 3MVJA 3PRIA 4BDBA 4NT4A 2A1AB 4O0RA 3KXHA 3R9NA 3NRMA 4C3PA 2WMVA 3JPVA 4L45A 5E90A 1L3RE 3ZO4A 3KA0A 4FIJA 3CR0A 1H4LA 3G6HA 5E8WA 5EI8A 2LGCA 4GIHA 5HO8A 4CZTA 2WMTA 3W0NA 4USFA 4KRCA 3D4QA 1Y91A 2EB2A 1PYXA 1YOJA 5T6KA 2WMXA 4F7SA 2WQBA 4BHNA 2E9VA 3EN9A 5L8KA 2OK1A 5J9ZA 3FLNC 3R8UA 4CLJA 2C6EA 5JKGA 1Y57A 3UC4A 2F57A 4RVTA 4PP9A 1Q4LA 3BWJA 1UU9A 4GL9A 4QMLA 2Y6OA 2PTKA 3QZIA 4G34A 4MCVA 5I9YA 5I9ZA 4XG3A 4L46A 4RC2A 4JQ7A 3JR1A 4ASEA 5K4IA 1JVPP 4G3GA 3M42A 4PDOA 2VGOA 5EOLA 3GXLA 4JX7A 3D5VA 1UU7A 2C3KA 4CMUA 1JBPE 5HIDA 2WTKB 4D4RA 3PLAE 4X21A 3FXXA 5A14A 5EG3A 3BHUA 4CGAA 2AC3A 2H8HA 3DB6A 5LMKA 3FXZA 5KMNA 2IW6A 3E3BX 4QTCA 4TWOA 4JDHA 4U41A 2HENA 3LFQA 2PWLA 3U54A 3VBTA 3SOAA 2C68A 4YZMA 2ZM1A 2E9NA 2BIYA 2QQ7A 2XM8A 3IGOA 3NIEA 2YDJA 3UOJA 1FMOE 4WKQA 5KMLA 1UA2A 4X6RA 4KSPA 4D1XA 4RWJA 4YJUA 3SKCA 4MBJA 5CNOA 1BYGA 2BZKB 3F7WA 5KE0A 5CYIA 4KUJA 4M97A 1M7QA 3OVVA 5EKNA 4JOAA 4R7HA 2CHLA 5ICPA 4YC3A 4DBXA 4QP7A 2W96B 2ITQA 4OBOA 4FUXA 5DIAA 4H3QA 1W83A 3W2QA 4IW0A 2Y4IC 3DB8A 4RPVA 1Q24A 3V04A 2C5OA 4D55A 4E1ZA 1DS5A 4FOCA 3K3JA 4MF1A 5HLNA 1E9HA 1WBOA 4IAYA 1QPDA 3PVUA 4BYJA 4YSMA 4E6AA 3FZ1A 3QZGA 5CENA 1Q41A 4I20A 4AZFA 1JPAA 2PZPA 2AC5A 2A4LA 1VYZA 3GCUA 2X0GA 4ZMEA 3Q9YA 1IA9A 2R3RA 3PY1A 3EQHA 1QPCA 5L6WL 4C2WA 4O82A 1OUKA 1GZ8A 3B8RA 3RJCA 4ASZA 4FTTA 3DXNA 4GH2A 4YNOA 4AP7A 4K18A 4BTJA 3W0MA 2YJRA 4BDKA 1Y6AA 1P2AA 3OD6X 4J7BA 1YI4A 3CD8A 5ANIA 5EYCA 5HNGA 2RG6A 5LQFA 2OSCA 4RWKA 3TEIA 4P5ZA 5IEVA 3DV3A 3OEZA 1V0BA 3LFNA 4RIYB 1YOLA 4O7LA 4OTHA 5FGKA 3FI8A 1ZZ2A 4IB5A 4H1MA 3RWQA 1W82A 4AXAA 1L8TA 2C5XA 4YBKA 3THBA 1M14A 5TKDA 4S32A 3OHTA 1OPJA 3G6GA 2WMWA 4GK2A 4EOMA 3CCNA 5BPYA 5JT2A 2C0OA 5EYMA 2PVYA 3C4EA 2QOBA 3HGKA 3FMHA 5DE2A 4H36A 4DH7A 2VWZA 2GNGA 2C6MA 4L3LA 1YQJA 5EDRA 4BCNA 2B9FA 4DEEA 5EHLA 4FTLA 3ZFXA 4GVJA 3R2BA 2G1TA 4P90A 3QKLA 3RK9A 3LXNA 4QNAA 4CZUA 1SVGA 2HZ0A 3OXIA 4F7JA 4YO4A 3RK7A 4IX3A 5J9YA 5AAFA 3RTPA 5CWZA 3VS3A 2YIRA 4G5PA 1RDQE 4KKEA 1PXPA 3LE6A 4UWBA 3R8MA 2QOOA 4I5MA 4C4GA 2X8DA 2R3FA 3GI3A 2BKZA 3BHYA 3IW4A 5C1QB 3PLSA 2XK9A 3IW7A 3TNWA 2OXDA 2YCQA 1OL7A 3EKNA 3FYKX 4BDJA 4WSYA 1OKVA 2HK5A 1I44A 4WRGA 4W4YA 2BDJA 4R6VA 1OIYA 3UTOA 1TQPA 3N4TA 2Z7LA 4M13A 4BHZA 3S3IA 1UU3A 2YM4A 4GMYA 4E8AA 3E7OA 3CY2A 3EQBA 3R22A 3MFSA 3I0OA 2XIRA 3FKOA 2B53A 3K5UA 2VTHA 2W7XA 4X3FB 4QPSA 2GNLA 3WZJA 5A6OA 4ITHA 4GRBA 3ULZA 4EOKA 2W1DA 5M53A 1BL6A 1AQ1A 3POOA 5LMAA 3SXRA 4JDJA 4O84A 5HBJA 4XH6A 2QOHA 4EH9A 3PJCA 3F66A 4L42A 3KCKA 4MQ2A 4YLLA 4MXOA 3OFMA 3NEWA 4PP7A 2J0KA 1Q3WA 2IVUA 3FLWA 3F2NA 1H01A 3ROCA 1H25A 3TG1A 2O0UA 5DYJA 3R30A 3VWAA 4ZAUA 3R9DA 2IVTA 4CKRA 3HLLA 3JUHA 4LMUA 2C5VA 5E8YA 4RA5A 3V8WA 2OG8A 3QTRA 4FT7A 5IA3A 3G90X 2XMYA 1YDTE 3O8UA 2GQSA 4TNDA 3QD3A 3A7GA 2WU6A 4JBQA 3SLSA 3BPRA 3I5NA 1U5RA 3TDVA 5AV4A 3RALA 1BMKA 4CFUA 4OTQA 4JRNA 4MH7A 4GG5A 2WHBA 3L9PA 4QP3A 4R7IA 4A4OA 5ETFA 4B4LA 5CALA 2UZWE 3BGQA 5HKMA 2C1BA 3HV6A 2H9VA 3E93A 4M14A 2OBJA 4LUDA 4RFMA 4MBLA 3R7IA 5KHXA 3UNKA 3QLGA 4X2NA 3ORTA 4HYHA 2JIIA 4ACHA 1NVRA 2VO6A 4FBXA 4G9RA 4QMNA 3LQ3A 4B9DA 5M08A 4Y83A 4ZSJA 3OWPA 3FC1X 4PV0A 4FGRA 1LEZA 3OW3A 2GMXA 4EBVA 4O96A 2ITPA 2R0UA 2V0DA 5CT0A 5JEBA 4WT6A 1WZYA 4RIYA 5CVFA 3VNTA 3F69A 3F3VA 3R63A 4ACGA 3KULA 4S30A 3VUDA 1RQQA 5LVNA 4GUBA 3MFRA 4M68A 3P5KA 2WTIA 5CSWA 2J50A 3MB7A 5EOBA 4ENYA 3BQRA 4HJOA 4DFUA 5LVMA 3WIGA 1YHSA 2X1NA 3KVWA 4C0TA 3BHHA 5M51A 4UBAA 5KNJA 3DBDA 2XK7A 3VF9A 4C58A 2HOGA 3Q9XA 4MQ1A 5AP0A 2R3HA 3BU6A 3PWDA 4NFMA 1UNHA 2WOUA 4AX8A 5I0BA 3C51A 4YJRA 4O2PA 5IA4A 3P08A 4BICA 1WMKA 4FL2A 3ITZA 1FVVA 5CANA 3WOWA 4YURA 1P14A 5EM7A 4S34A 5TT7A 3ORKA 4ZS4A 2VRXA 3U9NA 4J96A 4YMJA 4F70A 1M2PA 3S4QA 4F0GA 3QD4A 4UWYA 3UZPA 4USDA 4YUQA 1KE7A 3W8QA 3BLRA 3TUCA 4U97A 5CEOA 1JSVA 4R3RA 1WBWA 2JDTA 3P4KA 3WF7A 2QR7A 1W7HA 1SNXA 1GZKA 2UZOA 1ND4A 3O7LD 4FZ7A 2OICA 4X6QC 3EN6A 5EDPA 2ITTA 3I7CA 3HV5A 1DAWA 3FI3A 3IDPA 4R3CA 1KE6A 3EQDA 3CY3A 4U6RA 5HG9A 5FDXA 3TV4A 4J99A 3FHIA 3UNJA 4DBNA 4G6LA 2W0JA 4UB7A 2XEZA 4QQTA 1QPJA 3BGPA 2J0JA 4R78A 2BFXA 5DNRA 2YFXA 2OF4A 3LCTA 4JAIA 5IQEA 4AF3A 5DN3A 1Q99A 2QG5A 3EN5A 2R2PA 3KFAA 4YP8A 1M52A 5BVEA 4YJNA 5CF4A 4U40A 4IAIA 1HCKA 1ZYDA 1G8AA 4XP3A 3S00A 3PSDA 3FL4A 3W0OA 4AS0A 2UZLA 3TTJA 3V3VA 2OXYA 5FEDA 4A4XA 5HORA 3EL8A 4L8MA 4I41A 4R7BA 4XOZA 2W1IA 4XOYA 2W4JA 3Q5ZA 5JMSA 1YXVA 2FA2A 2EWAA 2GHGA 3CKXA 3FZSA 4FG8A 1IAHA 1GOLA 3FQHA 4PDYA 5EH0A 3EJ1A 4H3BA 3RI1A 4ENXA 5IZFA 2R7BA 2ITOA 4D4YA 2X9EA 4O7OA 4YTIA 1ZYCA 4L68A 4RJ8A 3D83A 3E87A 2BIKB 1Z5MA 3C9WA 5CQWA 3T8OA 5AADA 4IWQA 4CKJA 3G33A 3TKUA 2HELA 2EUFB 2QO7A 2WMBA 5TOZA 4AZEA 2YA9A 3FLQA 4BTFA 4CG9A 4O7NA 3MH1A 3OUNB 4IAFA 4MXZA 3Q6UA 4RJ5A 3QGYA 5IUGA 3BWFA 3TYKA 3R8PA 3KRJA 2X7FA 4OUCA 3ZXTA 4DE4A 1TQMA 4D4SA 2OZAB 4BDGA 3DZQA 4QMWA 1ZLTA 5E7RA 3A61A 2XK6A 3R7OA 4AFEA 1ERKA 2VAGA 5CI6A 5E8TA 4JR7A 5C03A 2O5KA 2WGJA 3HRFA 3I79A 2R3NA 4JVGA 4LL0A 2CN8A 4EORA 3KXXA 4YZDA 2VO0A 4D0WA 4R5YA 3MPMA 4RC4A 3HECA 5AFVA 4GFMA 2ZYBA 2GQGA 2P2HA 5L3AA 4M15A 1O6YA 4RX7A 2CGXA 2WTJA 3LJ0A 3MH3A 3BZ3A 4FT3A 1NVQA 3A99A 5LMKC 3ZLYA 1QPEA 2RKUA 4A9UA 3ZDIA 4OBQA 4XLVA 4C02A 2CCIA 4O2ZA 2I6LA 2C5YA 2QU6A 3KQ7A 1OZ1A 2PPQA 4LV5A 4WD5A 1OIQA 3VHKA 5IF1A 4XBRA 3ALOA 4YJQA 3U4UA 3QTUA 3A8WA 3KCFA 2C6KA 4RWLA 3ZU7A 4BDIA 4TKSA 4BB4A 4ANBA 5IEXA 4F9YA 3PDTA 3UVPA 3PSBA 4KSQA 4C4JA 3PP0A 4FOBA 4Q9SA 1KSWA 4XLIA 3LFBA 4UWCA 4BI2A 1EH4A 4RX9A 5IUIA 2Q83A 5JZNA 3UQGA 2PMOX 4KIQA 3G9LX 2IO6A 2IVSA 5L2WA 4IHPA 1LR4A 3PPKA 3KN6A 1ZY5A 2NNWB 2C69A 4AN2A 4EHZA 4EONA 1ZOGA 4XEYA 5KUPA 4DEBA 4KD1A 2YAAA 1HOWA 5L8JA 1Q8UA 2NP8A 4XHKB 4EK5A 4CFMA 3TNPC 3BEAA 4FODA 5B7VA 3G5DA 3HVCA 3ODYX 4MAOA 5E91A 5HBEA 3VBVA 4ZOGA 3ZSGA 1VEBA 5DH3A 2PVRA 5M56A 3AC1A 2DUVA 2B7AA 4N70A 3TIZA 3KK8A 4GCJA 4QYYA 5AEPA 4FTIA 4LQMA 4F6SA 2OFUA 4BIDA 5CU2A 3VS0A 4F63A 4WIHA 4ZTHA 4F99A 3U87A 3FZRA 4HZRA 4HVSA 2XRUA 3UZTA 3I7BA 3ATTA 3F5GA 1OL6A 1YWNA 2X4FA 4IWDA 5AUYA 3MVLA 4FKWA 4FEQA 2XEYA 3COKA 5ANDA 4O0WA 3PVGA 5FP6A 4OTIA 3ZH8A 4WNKA 1XKKA 3I81A 3RZBA 4AW5A 3BHTA 2F7ZE 3COMA 3G51A 3NUUA 4J98A 4QP8A 1IG1A 5EM6A 3ZCLA 4LRMA 3B2WA 3O96A 3RPYA 3HMOA 5A4EA 2OO8X 4K9YA 2WQMA 2ZM4A 4FTRA 3MY0A 3RM7A 4FSZA 4HGEA 4EUTA 3UZRA 2FYSA 3DFCB 2X9FA 4FUYA 3NMUF 2W4OA 4RVMA 3MS9A 4D5KA 2UZUE 1UVRA 3P7BA 3LJ1A 4FTKA 3MFUA 4FG9A 3LW0A 3Q2MA 4K77A 1XH5A 4FK6A 4QMUA 4BDAA 2JD5A 1YXXA 2HCKA 3AD6A 4ZLYA 3PJ2A 4EI4A 2BCJA 4CMOA 3RHXA 3CGFA 2ETMA 2REIA 3NAYA 4PL3A 3QYWA 4O86A 3GOPA 3QQLA 1OBDA 3TT0A 4O7RA 1DI8A 2XH5A 4DH1A 4WOVA 4ORKA 5FLFA 4TYHB 3MFTA 4WBOA 2JIVA 4YJTA 3C4WA 3FEGA 2G15A 4BGQA 3MVMA 3HEGA 4AQCA 4HPUE 3H0YA 4YPDA 4FGBA 4ID7A 4O7WA 4F9WA 2WTKC 4FV7A 4BCIA 4IZ5A 4EH2A 4G6OA 4I24A 5D41A 1Q8YA 3OTUA 2VTOA 5F95A 4DYMA 3R01A 4FSNA 4IEBA 3SHEA 2QC6A 4OR5A 1REJA 2WTVA 3FLYA 1A06A 2Y8OA 1NA7A 1R0PA 5DEYA 4EZ3A 1ZWSA 2XM9A 1R0EA 3P1AA 3AQVA 4XCUA 3VQHA 5AP5A 5HI2A 4YGAA 3LXPA 4PL5A 3FKLA 2XB7A 3HMMA 3K54A 2UVXA 2W5HA 3ZO1A 3QKMA 1Q8WA 2G9XA 4Y85A 3NUNA 4ZTRA 3PUPA 3GBZA 2WFYA 2VGPA 4F6UA 4HVIA 3NW5A 2SRCA 2VO7A 3D2KA 4L3PA 4MYGA 5DOSA 2F7EE 5JRSA 3CTHA 1W98A 3VUGA 3DNEA 4I21A 4RSSA 3V5QA 3MA3A 4AA5A 3QYZA 2QO2A 4TW9A 5HEZA 2WNTA 4LGGA 4EWHA 5C4LA 1FQ1B 3E7VA 4XG2A 3C0IA 5HCYA 5KX8A 3Q96A 4RVLA 2C3JA 2X4ZA 5A6NA 3Q4TA 3HZTA 2A19B 4FVQA 4WNOA 4ZTLA 5KMOA 1UWHA 4R5SA 5HX6A 1YXTA 4GFGA 5HLPA 5BVDA 2EB3A 3UMWA 1PJKA 5GJGA 5IISA 4XS2A 3AC5A 3S95A 4BDDA 5DT4A 1B39A 3FWQA 3AG9A 5DRDA 3NCGA 1F0QA 3OCTA 3Q4CA 5AV3A 2J5EA 5CXZA 5LVOA 5M4CA 3EZVA 3EIDA 2VWXA 3QRIA 1PF8A 3FXWA 3G15A 2Y6MA 1YVJA 5JK3A 4QMOA 4PRJA 1JQHA 4FSYA 1YI6A 1Z9XA 2CJMA 2CDZA 5BNJA 3FC2A 3CTJA 4IIRA 2XNEA 4DEGA 2PY3A 1XBAA 1U5QA 2WIHA 3DAJA 4GV1A 4KBKA 4XV3A 3TKHA 5C8KA 4AW2A 2PUUA 3GQIA 2W4KA 3W55A 4PX6A 2J6MA 3QD0A 3WF9A 3IW5A 3QTSA 4B99A 5E9EA 2EVAA 4DINA 3UIMA 1W0XC 2O8YA 3H4JA 5IQIA 2HW6A 3CIKA 5T3QA 5BYLA 2R5TA 3M1SA 3R00A 4E5BA 3NIZA 4FZ6A 1WFCA 1G5SA 1KE9A 2P2IA 2VN9A 1H1PA 1AD5A 3H3CA 4IAZA 4WBBB 5HIEA 4FSRA 4ZY6A 1JKLA 3DBEA 3EFKA 3OUKA 5E1EA 3BGZA 3G0FA 3R83A 3UGCA 2WQOA 4EWQA 1FBNA 3HUBA 5K5NA 4HGSA 4EH6A 4IFCA 4FSQA 4W4VA 4LMNA 4ZZMA 3W2RA 3FMNA 4E20A 4EH4A 2BRNA 4D9TA 1ZXEA 3MA6A 4FTAA 4HNIA 1H07A 2RFDA 3MESA 4IM0A 5LOHA 4ZMFA 3TM0A 1WBVA 5IH5A 3QQFA 2ZMDA 1GY3A 3QRTA 4FTUA 3TV7A 3WILA 4BCQA 2UW6A 5HNBA 1XH8A 2W1HA 3UOHA 3AT3A 4W8DA 2C6DA 1Q8ZA 2PUIA 3KXZA 5LXMA 5EHOA 1SVEA 3L8SA 2VNWA 2CGUA 3QQJA 2XA4A 1TKIA 1Y8GA 2PVJA 2VTTA 3PE2A 3PVWA 3TWJA 1IASA 5DR2A 2J90A 2B4SB 4I5HA 3UG1A 2UW5A 3COHA 3NGAA 3VRZA 1U54A 4P7EA 3ZONA 3K2LA 2PE0A 5AP2A 3R7UA 3WF5A 5JZJA 2GTMA 3EFWA 4X3FC 5IQCA 5LWNA 1BX6A 4RZWA 4NFNA 5CAPA 1OECA 5A3XA 3I1AA 1KE8A 2PVKA 5DT0A 4AZTA 4N6ZA 4NWMA 1H0WA 1ZY4A 5AP3A 2WMRA 4CT2A 4PL4A 5JH6A 5HO7A 4C35A 4YJVA 3LQ8A 3LM5A 2OJIA 3OOGA 2QHMA 3QTXA 4F9CA 4FV6A 5HG7A 3ODZX 5C4KA 3LCDA 3BYUA 4BN1A 4QQCA 3OS3A 4CCBA 1YHWA 3FLZA 2VUWA 3ZS5A 5H9BA 2HWPA 3E64A 4BGHA 5KZIA 4USEA 5KMJA 4FNWA 4XG8A 4NK9A 4PMMA 2JAVA 3SG9A 2ZV7A 2OIQA 1J7LA 3QX4A 3R8VA 3TDWA 3LMHA 4QYFA 5M06A 2XJ1A 1XH6A 3O50A 5E8UA 3TCPA 5HU9A 4WZYA 5J8IA 2ITYA 3COIA 3QQHA 4P4CA 4U3YA 3N4UA 1CKIA 2QODA 3UVQA 3VW8A 4B8LA 4EC9A 1M7NA 4R3PA 3RP9A 4O6EA 3AC2A 1PXNA 3DFAA 3ZEPA 4H3PA 4M0ZA 2J4ZA 1ZZLA 1IA8A 3SX9A 4C59A 2E2BA 3F6XA 5HQ0A 3P23A 4J1RA 2XNOA 3LAUA 3IOKA 4JJRA 3R9RA 4L44A 1Q62A 2QU5A 4U3ZA 4YHFA 2HXLA 5DPVA 1BUHA 3C13A 4QTBA 4W4XA 4G3EA 3UO4A 4D9UA 2QNJA 3NW6A 4N57A 3UOLA 4C4EA 5M07A 2JDRA 2RGPA 4C2VA 4U79A 3D7TA 2R3PA 4KAOA 3S0OA 5CU0A 3D5UA 5EI2A 4O6LA 3OCBA 4NW5A 3P78A 4KIPA 4V05A 2YM3A 3UG2A 5TO8A 2XF0A 1B6CB 1OL2A 4PWNA 4AGWA 3ENHA 5I4NA 4JT3A 1O6LA 4UEUA 3F3WA 5CU4A 4O81A 5EYKA 1QL6A 3TZ9A 4YJOA 3UYTA 4HVGA 2UVZA 1LP4A 4KA3A 1JKTA 2I40A 4RVKA 4H05A 4NKSA 1H00A 2BRMA 3DLZA 3LM0A 3QU0A 4O7TA 4PDPA 3OCGA 4D4VA 4QMVA 2VX0A 3DXQA 4FIIA 4ZTSA 3AXWA 4Z7HA 3KY2A 4TYIA 3GT8A 3ZRMA 4A4LA 4AT4A 2YZLA 4C3RA 4EOLA 2YIWA 4EQCA 3VQUA 4I92A 3CD3A 4CMTA 3DBCA 4XUFA 4XNEA 3F3UA 3MBLA 4TYGA 2WQEA 4IWOA 3WYYA 4EOOA 2ITXA 3PIZA 4Q5EA 4U7ZA 3Q5IA 4XYFA 3JS2A 3EZRA 4F1OA 5FBOA 2CLXA 3I4BA 4FV2A 4LRKA 3ORIA 3S1HA 3QXOA 2G01A 5AA9A 5HESA 2JKOA 2V62A 3TNIA 4RIOA 2OWBA 4R77A 1IR3A 5AUXA 1J7UA 1X8BA 4O0XA 4TL0A 3FYJX 4N6YA 4NYEA 1QCFA 3ZSHA 3GP0A 2IZRA 4F65A 3GENA 4YTCA 4I6BA 3R02A 3BKBA 3OCSA 3KREA 4IC8A 4L7FA 2GFSA 5CAUA 4PUZA 2WTWA 4GU9A 3O7LB 2C0IA 5DLSA 3R7YA 4BDHA 3NSZA 2GHMA 2IN6A 2PZ5A 4QP2A 3LVPA 4L43A 5AP7A 3GEQA 3KULB 3ZEWA 4G31A 2X6EA 3SVVA 4PQNA 4QPAA 2YAKA 3WZUA 4Z7GA 3GGFA 2DS1A 5KMIA 3MV5A 4IM3A 2HW7A 5AX9A 2QOIA 2NPQA 4QTDA 2RL5A 1XH4A 5CT7A 3KB7A 2ZOQA 4RT7A 4I1ZA 3EFLA 2ZV9A 3E92A 3EN4A 3OZ6A 2PMIA 3IGGA 3LXKA 2PVMA 3A7IA 1H24A 4I0TA 4QRCA 4UXLA 2O65A 3CTQA 2X6DA 3F2AA 3IG7A 3VS4A 3V8SA 5AJQA 3HUCA 5AUVA 2GS7A 3IW8A 4GFOA 4YJSA 4FEWA 5HE3A 3W8LA 4Z3VA 3BX5A 2LAVA 5ANJA 3FUPA 3ZO3A 4DN5A 5IUHA 3H9RA 3HAMA 3PXRA 2WXVA 1KOBA 2PZIA 4KRDA 4Y5QA 3PZEA 3UMXA 4JIAA 3ZRLA 3TKIA 1AGWA 3UVRA 2I0HA 4ZLZA 4CXAA 4TYEA 5JFSA 4F9BA 4OTGA 2VTIA 4I3ZA 4D0XA 4FKQA 3RPSA 4BKJA 5LVLA 3UBDA 1XBBA 4DEDA 3ORMA 5CS6A 1GIIA 5JQ8A 4TT7A 5CQUA 5JQ5A 2OFVA 5ANKA 4TZRA 2JBOA 4APCA 4D28A 3CC6A 4Y72A 1QMZA 5F9EA 1URWA 1FINA 3AT2A 5AUTA 4LYNA 2WOTA 5CEQA 2W06A 1CSNA 3HV7A 2XVDA 4G6NA 3PY0A 3HA8A 2X8EA 4O21A 1KWPA 5I9WA 2CGVA 3CLYA 2JKMA 4BCPA 4C33A 4RIXB 3U55A 4CV9A 1Q97A 3BEGA 4II5A 2P33A 3AT4A 4A9TA 4KBAA 5KCVA 4FVPA 4BRXA 2Z60A 4G3FA 2GNHA 1PYEA 4HYIA 4B6LA 4BZDA 4KWPA 3G9NA 3MIAA 4WHZA 4ZIMA 2RF9A 4GG7A 4CVAA 3VBXA 4ARKA 1JSUA 4G9CA 1ZOEA 1O9UA 3OW4A 3W18A 3VUIA 4RJ7A 3FL5A 3AOXA 2ZAZA 3N9XA 3HYHA 3RPOA 2W5AA 3KN5A 4LGHA 3OY3A 2J0LA 4X7QA 1URCA 5CEKA 4E4XA 5H8BA 4RA4A 2ONLC 4FIHA 5E92A 4TWCA 4ZY5A 4E4NA 3FBVA 3KVXA 3PIXA 2IG7A 3LQ5A 4UV0A 5AP1A 3D15A 3R8ZA 3HMPA 2KTYA 1Q5KA 3NVKI 4G1WA 4UZHA 2W5BA 4ZTQA 3L8VA 4X0MA 4DEHA 4CKIA 4MNEA 3L1SA 1PMVA 4P2KA 4CEGA 3WZKA 3CQWA 1YDRE 3EYHA 3Q52A 3ZBXA 2IZTA 5CEIA 3NR9A 4DH8A 5D11A 4MXYA 2B0QA 4K2RA 2YABA 3UJGA 1R39A 4GU6A 4EOJA 3U8WA 4JR3A 5CLPA 2Y7JA 5DHJA 3P0MA 5BVKA 3OF0A 4IACA 3R1QA 3SD0A 2YZAA 1STCE 3NUXA 2CSNA 3I5ZA 2BRHA 3HA6A 4NZWB 2YM7A 3NZ0A 4J52A 2XZSA 4J53A 2I0VA 4IJPA 3UO6A 2VTRA 4FKIA 3G0EA 3SV0A 3ZC6A 2CCHA 4EHEA 1XJDA 2WZJA 3ORNA 5AM6A 4YHJA 3DCVA 2JLDA 5C8NA 4MD8E 1J7IA 2XUUA 4FZDB 4JX3A 4FTCA 2VTNA 5I9VA 4X2GA 2B52A 3DBFA 5LARA 3QUPA 4WG5A 4FG7A 4QMQA 5BUJA 1YHVA 4GVAA 2OJGA 5HE2A 2DYLA 4FV9A 3C4CA 4IFGA 2JDOA 1YKRA 4IVDA 4KKGA 4NW6A 4Z9LA 3ID6C 3K3IA 4G2FA 1REKA 2ITWA 2PMNX 1UU8A 4JG7A 3R7VA 3ORXA 3BBWA 3TZ8A 4L53A 3FY2A 4IDVA 4FMQA 2YN8A 4KS7A 5EQYA 4F0FA 1OKZA 4RJ3A 1H8FA 4E93A 2NRYA 2XJ2A 3HP2A 1PY5A 2ESMA 3UPXA 5CEPA 5HBHA 5A54A 3GCPA 4FSMA 3GU6A 3ZFMA 5M09A 1ATPE 4AACA 3FHRA 5GHVA 4FIGA 4OLIA 4HCUA 3PP1A 2I7QA 3RINA 4DITA 2UZTA 4RIXA 1Q61A 3NAXA 3QL8A 5C8MA 5FEQA 5IQDA 2V7OA 3E8EA 5K4JA 4ZXTA 2B55A 4XV9A 4R1VA 3FV8A 5CEMA 3QGWA 3ZSIA 4UYAA 2Y9QA 2YDKA 1JNKA 5E8ZA 4MBIA 5HTBA 3TJDA 1M17A 3EQCA 4JLCA 1ZAOA 4FT5A 1MRYA 2KULA 2VX3A 3ORLA 3ZFYA 2UV2A 3DTCA 3MW1A 3UDBA 4FNYA 4JDIA 4L67A 3Q60A 5HVKA 3R9HA 3KEXA 1KV1A 3FMMA 3P7AA 2VTLA 2YM6A 2UW9A 3WE4A 4QMZA 4Y95A 3A8XA 3FMKA 4DGLC 4S33A 1E1VA 1KE5A 3TIYA 4DTKA 1H1SA 4RX8A 3PPZA 3P79A 2UW0A 4FEXA 3TNQB 4U42A 4LG4A 4RJ4A 4F08A 5F1ZA 3UQCA 4E4MA 3V5WA 2FH9A 3ORPA 4C4FA 4I5CA 2W9ZB 3P86A 5FM2A 3A7FA 4M69B 4ZJVA 5CU6A 3HP5A 4YC6A 2O2UA 2OZOA 2WPAA 2F9GA 4CNHA 5A4CA 2QURA 4KINA 3HAVA 4PMSA 1RE8A 3BLHA 4JS8A 4FZFB 5CF8A 2QG7A 4O0VA 3LLAA 3SXSA 3U6JA 2OI4X 1FGIA 4V04A 3CPCA 1OGUA 2BRGA 2CNQA 4K0YA 2RFEA 4LI5A 4M12A 3PZHA 4DT8A 2XNNA 5AM7A 3LKMA 3UP7A 1H28A 2YACA 2WMUA 1YRPA 4RRVA 3W2PA 4C62A 1V1KA 3HDNA 5AUWA 5AUZA 2W05A 1Z57A 5FM3A 4FL3A 1WVYA 2QOCA 2UVYA 4JBPA 4U9AA 3H9FA 4O91A 3F82A 3OY1A 3P7CA 1FVTA 5D10A 5EQPA 2UZEA 5FQDC 1OVEA 3OOMA 4FV3A 4OBPA 1R3CA 5CU3A 2R3LA 2J5FA 3O2MA 3VS1A 1CKPA 3DBQA 3AGLA 4FE2A 4A9SA 4F7NA 3Q4ZA 2P55A 3FQEA 3PRFA 3NX8A 2QVSE 1R1WA 4BI1A 4HGLA 3ZZEA 3DQXA 3NVMB 3D5WA 3UOKA 2VV9A 3SA0A 3EH9A 4RIWA 3DZOA 4FYNA 2FB8A 2EXMA 3UE4A 5DFPA 2JKKA 1ZYSA 3PY3A 3D9VA 3NWWA 4ZTMA 3FSKA 2P0CA 3DJ5A 4YO6A 4CSVA 3QRJA 5KBQA 4FL1A 3IQ7A 1W84A 3DTWA 3CJGA 2WB8A 3JY0A 2HXQA 2VWVA 3DK3A 3SC1A 2W1FA 2ZVAA 4O7YA 5IDPA 4PTGA 1PXOA 3EB0A 2AYPA 3R9OA 2FSTX 4AE9A 2JAMA 3IECA 4FC0A 4DFXE 5IQGA 2X81A 5GJFA 3VUMA 2Z02A 4DFBA 5HVJA 3UC3A 4CLIA 4E4LA 3IS5A 4XRLA 4B8MA 3HKOA 1P4OA 2CKPA 4CFXA 3WARA 1S9IA 3DJ7A 4IQ6A 3U9CA 4YZNA 2JIUA 3ZLSA 4ACCA 2WEVA 3DK7A 3W0SA 3V5TA 3D5XA 5ANGA 4BDEA 2HIWA 2G2IA 2BZJA 2VNYA 5EW8A 2UW3A 5CY3A 5L2IA 5HCXA 4CTBA 2R0IA 2E9UA 4FTMA 2VD5A 4MTAA 4M8TA 1FOTA 4MXCA 3BCEA 4XMOA 2GNJA 5EQEA 2FO0A 3VAPA 3T3VA 5LCJA 3ATSA 2PUPA 2WO6A 2JGZA 4FSTA 3MY1A 2XIZA 4KB8A 4OTRA 3UIUA 3ZTXA 2NRUA 3FMEA 2XIXA 2OH0E 4FKRA 5AV2A 4DG3E 4AZVA 3V6RA 2XNPA 3DXPA 2WU7A 5DI1A 1YXSA 3C4ZA 3HMNA 3I6UA 4IBMA 3BYVA 2F49A 5DT3A 3CPBA 4FI1A 5I5ZA 5J1VA 2FSLX 2ITZA 3BE2A 4CFFA 1PXIA 1LPUA 1TVOA 3PXFA 3DK6A 3QTQA 3VF8A 3UIBA 3ZMMA 3MVHA 2UZNA 4FKOA 3TUDA 2BTSA 1IAJA 3A60A 4A06A 4NSTA 3JY9A 3PG1A 2QLQA 3DKOA 3ZUTA 2XNMA 4C36A 1Q3DA 4P5QA 3GU8A 5TF9A 4J97A 4AA0A 5FTOA 2OJJA 5K3YA 4AOJA 1IRKA 2XP2A 5L6PA 3ZM4A 3FKNA 3R1YA 5ACKA 4X2KA 1T45A 2XKEA 5HE0A 3QCSA 4H58A 2ZDUA 4RJ6A 4CRLA 4F7LA 1U54B 5DGZA 4DCEA 2BDFA 3F3ZA 1B38A 1BLXA 4NH1A 3ET7A 3ZZWA 5HTCA 4ZY4A 2QONA 4Q9ZA 5DVRA 4IB1A 1WAKA 2RFNA 4F1TA 2R3GA 5L6OA 3PJ8A 2IVVA 2WD1A 1OKYA 3SG8A 4FKVA 3TUBA 4C7TA 3O17A 4ACMA 3A7HA 1OL1A 3ENMA 1LUFA 1OIRA 4MK0A 3QKKA 4EQMA 4IC7A 2QHNA 1W8CA 2UW8A 4RQKA 4AAAA 2OU7A 3CP9A 4FKLA 1XR1A 3VS6A 4DTBA 2OKRA 2NO3A 3RKBA 1FGKA 2YJSA 2GNIA 3BQCA 2C0TA 2XKFA 3OXTA 2QCSA 3R2YA 3PG3A 2PZYA 3MPAA 2OLCA 3F61A 1OB3A 2O64A 2XK4A 5B2MA 4APPA 3FJQE 4J95A 5C27A 3EYGA 4DFZE 4EH7A 4EYJA 5IG1A 5A4LA 2F4JA 3CGOA 2R3JA 3LCSA 1BL7A 2VWBA 3GVUA 2YWPA 1UNGA 3LFSA 5AP6A 1P4FA 3E8DA 5DRBA 2FSOX 4DGMA 2P3GX 2C3LA 3HNGA 4OW8A 3KGAA 4I23A 2C6TA 2ITUA 4PTEA 3MJ1A 2XJ0A 1CMKE 4K6ZA 2B1PA 4BF2A 4F09A 2PU8A 2O3PA 3AMBA 3LFCA 3ZRKA 3QCXA 2QKRA 4GYGA 3QFVA 2GTNA 4I4FA 3LCKA 4G16A 2HZIA 4CV8A 1VZOA 3NUPA 3V8TA 5IQHA 3C5IA 2IW8A 4EOIA 4ZLOA 2GCDA 4UX9A 3D7TB 5DA3A 4ZZNA 3D7ZA 1XHAA 3LOKA 4GJ2A 5IA1A 3GQLA 3QD2B 1XH9A 2XKDA 3HX4A 3W2OA 4TY1A 4JRVA 3Q53A 2P4IA 3WZEA 5KHWA 4ZSEA 3OROA 3OP5A 4S2ZA 3R73A 4AT5A 3DA6A 4IAAA 4E73A 4DLIA 3FDNA 4GJ3A 4MXAA 5ITAA 3W0RA 3DKFA 4YZ9A 4FEVA 2XS0A 3DAKA 4ZSLA 3OBGA 2C6OA 4PY1A 4QMSA 4I6HA 4DAWA 4PNKA 4CD0A 4BY9E 4RFYA 3OC1A 2ERKA 4YU2A 4IX5A 4AT3A 1F5QA 1KUTA 2JC6A 3DGKA 3KF4A 3FPMA 3KXGA 3U51A 2UW4A 2G2HA 4IWPA 1GZNA 1V0PA 5AIRA 3E5AA 4PNIA 5KKRB 4U81A 5CZHA 3CQEA 1M2RA 5EW9A 2CKQA 5M4FA 4F6WA 3AGMA 4AA4A 3UIXA 4QP1A 4RQVA 2QOQA 3GC0A 3PYYA 4GSBA 3OT3A 4JIKA 4HCVA 4QTEA 5GINE 1P5EA 2Q0NA 3Q6WA 1PXLA 1YOMA 3VUHA 2BROA 4AN3A 3EQGA 3T9IA 1WVXA 4DFYA 3SXFA 3IW6A 1JSTA 3R6XA 3NUAA 3SW4A 4U80A 3KF7A 2PE2A 4Z55A 5J9LA 3IKAA 2PL0A 2BILB 3MH0A 4LM5A 3SW7A 4FV0A 4LOPA 3QA8A 5DEWA 3ZXZA 3JYAA 3RM6A 4ANLA 5IMEA 4O7PA 4K1BA 4TTHB 3QXPA 4H39A 2J2IB 3AD4A 3QTIA 2HY81 4WNPA 3VN9A 3ACKA 4X2JA 3FSFA 5F94A 3MPTA 3LCOA 5DWRA 4EYMA 1MRUA 4BCMA 4EH5A 3NYXA 4GW8A 3VUKA 3FE3A 2F2CB 5FP5A 3UODA 3ZUUA 3P9JA 4ERWA 1K3AA 3V5LA 4BVUA 1NVSA 1T46A 3R21A 4Y8DA 5FTGA 4WO5A 5EM5A 4I0RA 2VWUA 4BIBA 5DBXA 2I0YA 5CSPA 3RAHA 4AZWA 2HZ4A 3L9MA 5DR6A 1PXMA 3UP2A 4EKLA 3QWKA 4EZ5A 3QTZA 5ANOA 3Q4UA 3VBYA 2R3OA 2J0IA 2ETKA 2CNUA 2PULA 3NUSA 1DM2A 4FIEA 4JXFA 3L9NA 3QQKA 4O27B 5JGBA 3BBTB 4YNEA 4XV1A 4UZDA 5G1XA 5G6VA 3VBWA 4NM3A 3FI2A 5AP4A 3AC8A 3C4FA 2BRBA 4DF3A 1RJBA 5BQ0A 3LFFA 3T3UA 4O22A 3R0TA 3MIYA 1NXKA 2X2MA 3DS6A 5IU2A 2XYNA 4E5WA 5A4TA 4XP0A 4BDCA 4U5JA 2W9FB 4H1JA 2OJ9A 2FVDA 4O0TA 4QYHA 2GSFA 2R9SA 4MWHA 4HVHA 4YLKA 5FUTA 3NNWA 4JL9A 2A27A 4U0IA 3FMDA 4BCFA 4NU1A 5D12A 4FKUA 3OG7A 2E9PA 3VIDA 2WIPA 4CFNA 2XIYA 2BDWA 2C6LA 3AC3A 3CQUA 3EQFA 1GIJA 3TZ7A 2BTRA 1VJYA 4S31A 2GPHA 1YWVA 3FAAA 1TQIA 2YHVA 4GKIA 4EZ7A 5IH4A 4NJDA 4YTHA 2XKCA 5HNIX 4FSWA 5GJDA 4JQ8A 3T9TA 3RHKA 3PFQA 4GIIA 1OKWA 5AMNA 1ZMUA 2ZB0A 4EK8A 1FVRA 3DPKA 3ANQA 1LEWA 5C26A 2WQNA 3BU3A 1MP8A 3C0HA 1PKDA 4QMXA 5J87A 3FPQA 5T68A 4DGNA 4IX6A 3GC8A 3FMJA 2V22A 4KBCA 4ZEGA 4L9IA 4TPTA 3MWUA 1PHKA 4IX4A 3OWJA 1ZOHA 4YPSA 4FTOA 3U6IA 2R3QA 4GK3A 5KMKA 4ITJA 3BI6A 3F88A 3PTGA 4GT4A 2BHHA 4WNMA 5FBNC 3VO3A 1RW8A 4HZSA 4A9RA 2EU9A 4ERKA 2PVLA 3C5UA 4EK6A 3WE8A 3VULA 2OW3A 4O38A 2IJMA 4A07A 3VJNA 3FLSA 3UQFA 2QOFA 4JG8A 2VTQA 3PSCA 4XG7A 3WI6A 2ITNA 5ANEA 1UKIA 5BMSA 2PK9A 5D7VA 2YIQA 4HYSA 3NYVA 5FG8A 5BUEA 3WIKA 2YDIA 1OBGA 3FMLA 5CTPA 3V5PA 3ELJA 3LZBA 4L01A 3BV2A 3D2IA 4HGTA 4D1ZA 2BVAA 5I9XA 2WEIA 4QNYA 3LXLA 4AW1A 4FSUA 4MNEB 4ALWA 3MYGA 4IZ7A 3AC4A 4JNWA 4LFIA 3W32A 3WF8A 1PXKA 4GEOA 2PHKA 2OF2A 2R3MA 4WUAA 4DEIA 4A7CA 3BYOA 4LRJA 4EH3A 3EQRA 4ZJJA 4ITIA 3LFDA 5HGIA 1SYKA 1H26A 4NJ3A 4V0GA 2BAJA 5HG8A 4HPTE 2XRWA 3G2FA 2EXCX 4TRLA 5H3QA 2WMSA 5LWMA 2UZDA 4ACDA 1SNUA 3PA4A 2PZRA 3RMFA 1CKJA 4E6DA 3GU7A 4I93A 2YCSA 3ZYAA 5JN2A 3OEFX 3SGCA 2FUMA 2H6DA 3AMYA 3W33A 4FT0A 2YIXA 3EFJA 3HRBA 1JLUE 3ZLWA 2VTPA 3KKVA 5IDNA 4JAJA 2WMQA 4BBEA 1YI3A 3VW6A 2VTMA 4BCKA 3C0GA 3FZTA 4BDFA 5HLWA 3LMIA 3QRKA 3QTWA 3HV3A 1H08A 5EHYA 4L00A 3B8QA 5IQFA 1UNLA 3I6WA 4AOIA 3H10A 3KMWA 4TNBA 4EH8A 2IZUA 2BR1A 2Z7QA 2QLUA 4OT5A 5J95A 2R7IA 4FV1A 3ERKA 3GC9A 3PA5A 1SVHA 4E5AX 5K9IA 3Q04A 3E62A 4AZSA 5IA5A 2W1CA 1H1RA 4D2SA 3DU8A 4K8AA 2PVHA 3TNHA 4GYIA 4NKAA 5L8LA 4G5JA 3W0PA 1G8SA 2ZM3A 3VS5A 5ETAA 1PMEA 1J91A 1MQ4A 3DT1A 4DFLA 3E3PA 1SM2A 4CCUA 3WYXA 3HV4A 4GT3A 3ZHPC 4B0GA 4BCGA 3F9NA 3S2PA 1VR2A 5C9CA 4ZJIA 3I0QA 4FICA 5ETIA 3ANRA 3PXQA 2R3IA 5E8VA 1VYWA 1WVWA 2YM8A 3F5XA 4LUEA 3IDCA 3QA0A 5CVHA 5L2TA 3EL7A 4LL5A 2PMLX 4U43A 3RAKA 3EMGA 5H2UA 3A4PA 3KMUA 4MVFA 2ZV2A 2Q0BA 4WRSA 2B54A 2BUJA 2YCRA 4ZZOA 5IPJA 3SQQA 3Q32A 3SRVB 3IO7A 1Y6BA 1APME 4BBFA 2C30A 3VBQA 1SZMA 2V7AA 4BTKA 5AAGA 3UNZA 5CASA 4FTJA 4ONAA 4XP2A 1XQZA 4FNZA 4EOSA 5CAOA 5HG5A 5JSMA 3PJ1A 2WTCA 3O8TA 3QZHA 2Y4PA 3M11A 4XG9A 2ZV8A 3W2SA 2W1EA 2W1ZA 2CMWA 2WMAA 5CNNA 3R8LA 3ACJA 3R04A 4O0YA 4EOPA 4J8NA 4QMMA 2W99B 3BLQA 2YERA 4QP9A 5FXSA 4EL9A 4NCTA 1XWSA 1S9JA 2Z7RA 4JI9A 3R1NA 2ITVA 1CTPE 3KU2A 1U46A 2JDSA 4RMZA 4UYNA 1OM1A 3LFEA 4IZYA 4QOXA 3O0GA 2A0CX 5FEEA 1Q8TA 4RZVA 5IQBA 3EQPA 3BELA 4UXQA 4X3JA 1A9UA 5AX3A 4ALVA 4CT1A 5BX0A 4IADA 5LMBA 4FNXA 4XV2A 4ASDA 5F20A 2I0EA 2OH4A 3PWYA 3QQUA 4FTQA 4KS8A 5FRIA 4TWNA 3ZOSA 4DGGA 2ERZE 5A46A 3GB2A 3V51A 2GS6A 3VVHA 5E8XA 5AV1A 5M4UA 1U4DA 2ACXA 3TTIA 4YR8A 4FX3A 1KV2A 5AV0A 2A2AA 4RX5A 3R7EA 3RCJA 4L3JA 3CXWA 4DFNA 4FKTA 3W0QA 4EEVA 5B2KA 3WF6A 2IWIA 1ZARA 2GU8A 3IONA 2C6IA 1HCLA 3BRBA 3IDBA 3IOPA 1YXUA 4U45A 3IPHA 4DC2A 4A9YA 3NPCA 4F1MA 3KRWA 3Q9WA 4FV8A 3ULIA 3EOCA 3TI1A 4FTNA 5J5SA 1WCCA 5BYZA 4C61A 4C37A 4AWIA 3LLTA 2QD9A 3N51A 4JBOA 2HY0A 2PSQA 5FD2A 1Y8YA 2BZIB 4C4IA 1NY3A 2GNFA 2OIDA 3A4OX 3OWLA 4DTAA 4EHGA 3NNUA 2CPKE 3POZA 2V55A 3EWHA 4AFJA 3C50A 5IQAA 3ZM9A 3GNIB 4I94A 2BMCA 4BC6A 4MKCA 3PJ3A 5EW3A 4AW0A 4PTCA 2C47A 4BTMA 1YDSE 3KRRA 5GIPE 3GC7A 4O7ZA 1E1XA 4RIWB 4YTFA 5TR6A 3NS9A 4QMTA 3BV3A 3TZMA 1J3HA 2FGIA 2Y4IB 3NYNA 3QUDA 3E63A 5JFVA 3QAME 1G3NA 2UZBA 5JGDA 4NM7A 2X2KA 3DKGA 2RIOA 4I4EA 2BFYA 4EJNA 2PE1A 4J71A 3LPBA 2B9IA 3RK5A 3VJOA 4IB3A 3OTVA 3CE3A 3PIYA 1WBTA 2XBAA 4FT9A 4ZSGA 4YLJA 3O23A 2DQ7X 2JITA 4DA5A 4UALA 4BZOA 1OL5A 2UUEA 2Z7SA 4MX9A 1MQBA 4YZBA 2XK8A 3R1SA 5IA0A 4IVBA 1OIUA 2FSMX 5CF6A 3A7JA 3SRVA 5HIBA 2R3KA 3CKWA 3BYSA 4N0SA 3VRYA 3O71A 4YSJA 2VTJA 3WZDA 1KOAA 5GIOE
chains in the Genus database with same CATH superfamily
2J7TA 4BYIA 3QWJA 5ETCA 5B0XA 2WTDA 5E4HA 3ROYA 1FMKA 2F2UA 3A2CA 1VLRA 3DDQA 4KABA 5AWMA 4X3FA 4NUSA 4DDGA 3R71A 2QKWB 4NL0A 1WBSA 4QP6A 3CBLA 3MH2A 3AMAA 4DEAA 2H96A 4V01A 4ALUA 4BIEA 3PVBA 1I09A 2V5QA 5D1JA 4RFZA 5KMMA 3GOKA 2XNBA 3BIZA 4AXFA 5JRQA 1JAMA 4AUAA 1U59A 5HX8A 1H27A 3ALNA 3QX2A 4OT6A 5L2SA 2JKQA 1XO2B 2WELA 2X2LA 5CZIA 5D9HA 5HCZA 2WKMA 4BI0A 1JKSA 1GZOA 3BYMA 4XG6A 5K5XA 1GIHA 3E88A 3L8XA 4F9AA 4M3QA 2VTSA 3QZFA 3LHJA 1GNGA 3MGYA 2ZB1A 4XRJA 5FXRA 3JVRA 1BKXA 3MTLA 3CSVA 4NTTA 3TJCA 4IZAA 2ZJWA 4QYEA 3UYSA 3DJ6A 2XNGA 3W2CA 4O7VA 3DLSA 4BBMA 4BZNA 2YISA 3H0ZA 2YWVA 4RC3A 5JGAA 2BAKA 4MHAA 1UV5A 3CJFA 2XYUA 1BI7A 4PMTA 4UY9A 4K33A 2R64A 4I0SA 4D2RA 3MI9A 2J9MA 4F64A 4DH3A 3AD5A 4W4WA 4EHVA 2X7OA 1GAGA 3F2RA 4NM0A 4TN6A 5EM8A 4DLJA 5LJJA 4FVRA 2CN5A 4FA2A 3TN8A 3U6HA 5HD7A 5BYYA 1CDKA 5AUUA 4CFVA 3EN7A 4D1SA 3H30A 3O51A 4I6FA 4DGOA 3CS9A 3DDPA 3E8CA 2XIKA 4IANA 3VS7A 4CTCA 2YEXA 3MSSA 3BE9A 2CKEA 3GFEA 3FZOA 3KRXA 5CXHA 2Z2WA 4EK3A 1OMWA 2C5NA 3BU5A 5KKRC 2QOKA 3SDJA 4ZP5A 5FDPA 3NLBA 3HRCA 4EOQA 3CEKA 5FTQA 5E8SA 5HICA 1MUOA 5HZNA 1OPLA 3QLFA 4OTWA 3BHVA 4TXCA 2VTAA 3LMGA 1IEPA 3NDMA 3M2WA 2BHEA 4AU8A 3V6SA 1NW1A 1PW2A 2UW7A 3MY5A 3RCDA 4LOQA 1MRVA 4DDIA 3GUBA 4Y73A 3MTFA 5I9UA 5LVPA 2PYWA 4FKGA 3LFAA 4RLLA 2G2FA 4HOKA 2OXXA 4Z16A 2VO3A 4LOOA 3GFWA 3RAWA 3B2TA 3D14A 4XX9A 1ZRZA 2X8IA 4EQUA 4QT1A 4IAKA 4FV4A 4RGJA 2ZMCA 4G17A 4AGDA 1V0OA 4CRSA 5ACBC 4EJ7A 2Z8CA 3DY7A 4RWIA 3GCVA 3RPRA 4QMPA 4ANMA 5IH6A 5BMMA 3FQSA 3QRUA 2BZHB 3NYOA 4IVAA 2VWYA 4L7SA 3GU5A 1NT2A 4I5PA 5HD4A 3QALE 3L8PA 1PXJA 4BR3A 3RNIA 2BKKA 4EUUA 3QCQA 4NIFB 3ORZA 5EYDA 4C3FA 3NNVA 4FR4A 2W17A 1WBNA 2CNVA 3JXWA 3KC3A 3VC4A 4IDTA 4U98A 3PXKA 4IM2A 4IH8A 1PRYA 1BI8A 5KO1A 3ZDUA 5M44A 3PE1A 3U4WA 3A62A 3OMVA 3GCSA 4R1YA 4G3CA 5IMXA 4AGUA 4DH5A 3UO5A 2XCKA 2VX1A 3I60A 5H8EA 5A9UA 5M4IA 4WG3A 3W10A 5CAVA 2O63A 1R78A 3KK9A 2AUHA 4HCTA 4JQEA 2QI8A 3NCZA 4GT5A 4TWPA 3SOCA 1ZYJA 2X7GA 2C3IB 4NTSA 4FEUA 2GS2A 4BCHA 3UPZA 4M7IA 2IZSA 2QO9A 3MDYA 3V5JA 1M2QA 5DG5A 2R4BA 4QO9A 4D5HA 4K11A 3TXOA 2Y0AA 1OI9A 4ANQA 2GDOA 2YITA 4FKJA 4X2FA 4E7WA 3II5A 2HWOA 4EKKA 4NM5A 2PVFA 3K5VA 4FIFA 2QR8A 4RLKA 4XG4A 5HVYA 4J8MA 3PXYA 4HYUA 5HHWA 2OZAA 2YM5A 3VHEA 2CKOA 4F4PA 3NW7A 4W8EA 2VZ6A 3F5UA 4F0IA 5CF5A 1ZMWA 1OPKA 4MNFA 4E6QA 2JDVA 1UKHA 4FZAB 3RAIA 4HW7A 3ZC5A 1J1CA 3RGFA 5BVOA 1O6KA 3C4XA 4QQ5A 4AOTA 4YBJA 2W1GA 5H8GA 3HMIA 3ZUVA 3ETAA 5M57A 3HL7A 1SMHA 2OGVA 4MXXA 3MB6A 4PF4A 1H1WA 4FYOA 3V01A 3LJ2A 3RWPA 2F7XE 5EDQA 5KBRA 5CSXA 1GJOA 4YJPA 4EK4A 2JFLA 1OITA 3OT8A 4CFWA 3F3TA 5CAQA 4QYGA 4ZS0A 4BGGA 1JOWB 3C1XA 4FKSA 4HVDA 1CM8A 1DAYA 3KXMA 4GUEA 3TV6A 3LIJA 3DQWA 4C38A 2GFCA 3QHWA 4KKHA 3TL8A 5J1WA 4O7SA 4YZCA 1XBCA 4E6CA 1PMUA 5GNKA 1K9AA 2C4GA 3W16A 4MEDA 1K2PA 3C7QA 4JDKA 4IE9A 3EKKA 1YW2A 4NCTC 1PKGA 3QUEA 3KL8A 4KNBA 2ONLA 3QF9A 2XBJA 5HU3A 4JG6A 3QHRA 5EI6A 3RVGA 3QCYA 2J51A 2VU3A 2DWBA 4GKHA 3EQIA 4I22A 2IPXA 4IMYA 4BCJA 5AIKA 4QQJA 4WUNA 2BPMA 5HE1A 5LCKA 4U94A 4L52A 3VS2A 2ZDTA 4HNFA 4E26A 3NNXA 4ASXA 1YWRA 5CI7A 4CQEA 4PMPA 2UZVA 2VWIA 3PPJA 3H9OA 3QBNA 2YIYA 3ZLXA 5F4NA 3O8PA 2I1MA 3ZBFA 3OWKA 4RBLA 4O0UA 2ETRA 2BALA 2CGWA 5EFQA 3ZO2A 4OTFA 4LDTA 5D7AA 3PA3A 1OGYA 3MJ2A 5IEYA 4DHFA 2XK3A 2IW9A 4XBUA 4FV5A 3Q3BA 5CX9A 1H1QA 4DCAA 4O0SA 1FPUA 3WBLA 3D0EA 2E9OA 3L9LA 4C4HA 1WBPA 2GQRA 3QQGA 4KIOA 3OBJA 3R28A 4RG0A 4M0YA 4U44A 4PDSA 3W1FA 3REPA 2C1AA 2WAJA 4QMYA 3EHAA 1PMNA 5CSHA 4Y46A 3N4VA 3SAYA 3JVSA 4JBVA 3D94A 3KRLA 4LV8A 4N4SA 4GK4A 4ZK5A 5B2LA 2B9HA 1DI9A 2OIBA 3OXZA 5CVGA 4AGCA 3QC4A 4BCOA 4UN0C 3E8NA 4WG4A 4YHTA 1JWHA 2HYYA 4QP4A 3F7ZA 3PXZA 4DG0E 2JFMA 5BVFA 3DNDA 4XJ0A 4Q2AA 4L6QA 2YCFA 5EKOA 5A4QA 5BVNA 5CSVA 4DG2E 5IA2A 4EC8A 5M55A 4MD7E 2J0MB 3IK3A 3Q2JA 3DKCA 3RNYA 2GHLA 1XH7A 4DT9A 4YC8A 4IB0A 4G3DA 3QC9A 4V0GB 3FZPA 1JKKA 2HAKA 3MN3A 4M67A 5EK7A 4OTDA 3KMMA 4ZTNA 3NUYA 2H34A 5E1SA 5C01A 1ZMVA 4Y5HA 1F3MC 1J1BA 1OUYA 3DAEA 5AA8A 3FY0A 4Q5HA 2JBPA 5DR9A 4FKPA 4U8ZA 3DOGA 4TYHA 4AG8A 1H0VA 3F5PA 2HZNA 5KZ0A 3RPVA 4MD9E 4CG8A 2XCHA 5BVWA 2B9JA 1UWJA 1A48A 5JFWA 4MWIA 4WA9A 3GCQA 4IVCA 5J7HA 2VWWA 5JFXA 2BAQA 3GU4A 4GS6A 3FI4A 4I6QA 2JEDA 3HDMA 4C34A 2RFSA 4AE6A 4ZSAA 4AN9A 4B7TA 4IJ9A 3KXNA 4ANSA 4O83A 2PVNA 5FXQA 2OJFE 2PUNA 2QOLA 2X39A 3Q9ZA 4FK3A 5BUIA 4TYJA 4OGRA 3TACA 4D58A 4EBWA 2RG5A 2CLQA 4M84A 4QTAA 5AAEA 3MVJA 3PRIA 4BDBA 4NT4A 2A1AB 4O0RA 3KXHA 3R9NA 3NRMA 4C3PA 2WMVA 3JPVA 4L45A 5E90A 1L3RE 3ZO4A 3KA0A 4FIJA 4DHJA 3CR0A 1H4LA 3G6HA 5E8WA 5EI8A 2LGCA 4GIHA 3PFYA 5HO8A 4CZTA 2WMTA 3W0NA 4USFA 4KRCA 3D4QA 1Y91A 2EB2A 1PYXA 1YOJA 5T6KA 2WMXA 4F7SA 2WQBA 4BHNA 2E9VA 3EN9A 5L8KA 2OK1A 5J9ZA 3FLNC 3R8UA 4CLJA 2C6EA 5JKGA 1Y57A 3UC4A 2F57A 4RVTA 4PP9A 1Q4LA 3BWJA 1UU9A 4GL9A 4QMLA 2Y6OA 2PTKA 3QZIA 4G34A 4MCVA 5I9YA 5I9ZA 4XG3A 4L46A 4RC2A 4JQ7A 3JR1A 4ASEA 5K4IA 1JVPP 4G3GA 3M42A 4PDOA 2VGOA 5EOLA 3GXLA 4JX7A 3D5VA 1UU7A 2C3KA 4CMUA 1JBPE 5HIDA 2WTKB 4D4RA 3PLAE 4X21A 3FXXA 5A14A 5EG3A 3BHUA 4CGAA 2AC3A 2H8HA 3DB6A 4BJJB 5LMKA 3FXZA 5KMNA 2IW6A 3E3BX 4QTCA 4TWOA 4JDHA 4U41A 2HENA 3LFQA 2PWLA 3U54A 3VBTA 3SOAA 2C68A 3UDTA 4YZMA 2ZM1A 2E9NA 2XM8A 2BIYA 2QQ7A 3IGOA 3NIEA 2YDJA 3UOJA 1FMOE 4WKQA 5KMLA 1UA2A 4X6RA 4KSPA 4D1XA 4RWJA 4YJUA 3SKCA 4MBJA 5CNOA 1BYGA 2BZKB 3F7WA 5KE0A 5CYIA 4KUJA 4M97A 1M7QA 3OVVA 5EKNA 4JOAA 4R7HA 2CHLA 5ICPA 4YC3A 4DBXA 4QP7A 2W96B 2ITQA 4OBOA 4FUXA 5DIAA 4H3QA 1W83A 3W2QA 4IW0A 2Y4IC 3DB8A 4RPVA 1Q24A 3V04A 2C5OA 4D55A 4E1ZA 1DS5A 4FOCA 3K3JA 4MF1A 5HLNA 1E9HA 1WBOA 4IAYA 1QPDA 3PVUA 4BYJA 4YSMA 1G8JA 3PUFC 4E6AA 3FZ1A 3QZGA 5CENA 1Q41A 4I20A 4AZFA 1JPAA 2PZPA 2AC5A 2A4LA 1VYZA 3GCUA 2X0GA 4ZMEA 3Q9YA 1TFFA 1IA9A 2R3RA 3PY1A 3EQHA 1QPCA 5L6WL 4C2WA 4O82A 1OUKA 1GZ8A 3B8RA 3RJCA 4ASZA 4FTTA 3DXNA 4GH2A 4YNOA 3W0MA 4K18A 4AP7A 4BTJA 2YJRA 4BDKA 1Y6AA 1P2AA 3OD6X 4J7BA 1YI4A 3CD8A 5ANIA 5EYCA 5HNGA 2RG6A 5LQFA 2OSCA 4RWKA 3TEIA 4P5ZA 5IEVA 3DV3A 3OEZA 1V0BA 3LFNA 4RIYB 1YOLA 4O7LA 4OTHA 5FGKA 3FI8A 1ZZ2A 4IB5A 4H1MA 3RWQA 1W82A 4AXAA 1L8TA 2C5XA 4YBKA 3THBA 1M14A 5TKDA 4S32A 3OHTA 1OPJA 3G6GA 2WMWA 4GK2A 4EOMA 3CCNA 5BPYA 5JT2A 2C0OA 5EYMA 2PVYA 3C4EA 2QOBA 3HGKA 3FMHA 5DE2A 4H36A 4DH7A 2VWZA 2GNGA 2C6MA 4L3LA 1YQJA 5EDRA 4BCNA 2B9FA 4DEEA 5EHLA 4FTLA 3ZFXA 4GVJA 3R2BA 2G1TA 4P90A 3QKLA 3RK9A 3LXNA 4QNAA 4CZUA 1SVGA 2HZ0A 3OXIA 4AXDA 4F7JA 3RK7A 4YO4A 4IX3A 5J9YA 5AAFA 3RTPA 5CWZA 3VS3A 2YIRA 4G5PA 1RDQE 4KKEA 1PXPA 3LE6A 4UWBA 3R8MA 2QOOA 4I5MA 4C4GA 2X8DA 2R3FA 3GI3A 2BKZA 3BHYA 3IW4A 5C1QB 3PLSA 2XK9A 3IW7A 3TNWA 2OXDA 2YCQA 1OL7A 3EKNA 3FYKX 4BDJA 4WSYA 1OKVA 2HK5A 1I44A 4WRGA 4W4YA 2BDJA 4R6VA 1OIYA 3UTOA 1TQPA 3N4TA 2Z7LA 4M13A 4BHZA 3S3IA 1UU3A 2YM4A 4GMYA 4E8AA 3E7OA 4BJJA 3CY2A 3EQBA 3R22A 3MFSA 3I0OA 2XIRA 3FKOA 2B53A 3K5UA 2VTHA 2W7XA 4X3FB 4QPSA 2GNLA 3WZJA 5A6OA 4ITHA 4GRBA 3ULZA 4EOKA 2W1DA 5M53A 1BL6A 1AQ1A 3P5JC 3POOA 5LMAA 3SXRA 4JDJA 4O84A 5HBJA 4XH6A 2QOHA 4EH9A 3PJCA 3F66A 4L42A 3KCKA 4MQ2A 4YLLA 4MXOA 3OFMA 3NEWA 4PP7A 2J0KA 1Q3WA 2IVUA 3FLWA 3F2NA 1H01A 3ROCA 1H25A 3TG1A 2O0UA 5DYJA 3R30A 3VWAA 4ZAUA 3R9DA 2IVTA 4CKRA 3HLLA 3JUHA 4LMUA 2C5VA 5E8YA 4RA5A 3V8WA 2OG8A 3QTRA 4FT7A 5IA3A 3G90X 2XMYA 1YDTE 3O8UA 2GQSA 4TNDA 3QD3A 3A7GA 2WU6A 4JBQA 3SLSA 3BPRA 3I5NA 1U5RA 3TDVA 5AV4A 3RALA 1BMKA 4CFUA 4OTQA 4JRNA 4MH7A 4GG5A 2WHBA 3L9PA 4QP3A 3AKKA 4R7IA 4A4OA 5ETFA 4B4LA 5CALA 2UZWE 3BGQA 5HKMA 2C1BA 3HV6A 2H9VA 3E93A 4M14A 2OBJA 4LUDA 4RFMA 4MBLA 3R7IA 5KHXA 3UNKA 3QLGA 4X2NA 3ORTA 4HYHA 2JIIA 4ACHA 1NVRA 2VO6A 4FBXA 4G9RA 4QMNA 3LQ3A 4B9DA 5M08A 4Y83A 4ZSJA 3OWPA 3FC1X 4PV0A 4FGRA 1LEZA 3OW3A 2GMXA 4EBVA 4O96A 2ITPA 2R0UA 2V0DA 5CT0A 5JEBA 4WT6A 1WZYA 2AEGA 4RIYA 5CVFA 3VNTA 3F69A 3F3VA 3R63A 4ACGA 3KULA 4S30A 3VUDA 1RQQA 3TMOA 4GUBA 3MFRA 4M68A 5LVNA 3P5KA 2WTIA 5CSWA 2J50A 3MB7A 5EOBA 4ENYA 3BQRA 4HJOA 4DFUA 5LVMA 3WIGA 1YHSA 2X1NA 3KVWA 4C0TA 3BHHA 5M51A 4UBAA 5KNJA 3DBDA 2XK7A 3VF9A 4C58A 2HOGA 3Q9XA 4MQ1A 5AP0A 2R3HA 3BU6A 3PWDA 4NFMA 1UNHA 2WOUA 4AX8A 5I0BA 3C51A 4YJRA 4O2PA 5IA4A 3P08A 4BICA 1WMKA 4FL2A 3ITZA 1FVVA 5CANA 3WOWA 4YURA 1P14A 5EM7A 4S34A 5TT7A 3ORKA 4ZS4A 2VRXA 3U9NA 4J96A 4YMJA 4F70A 1M2PA 3S4QA 4F0GA 3QD4A 4UWYA 3UZPA 4USDA 4YUQA 1KE7A 3W8QA 3BLRA 3TUCA 4U97A 5CEOA 1JSVA 4R3RA 1WBWA 2JDTA 3P4KA 3WF7A 2QR7A 1W7HA 1SNXA 1GZKA 2UZOA 1ND4A 3O7LD 4FZ7A 2OICA 4X6QC 3EN6A 5EDPA 2ITTA 3I7CA 3HV5A 1DAWA 3FI3A 3IDPA 4R3CA 1KE6A 3EQDA 3CY3A 4U6RA 5HG9A 5FDXA 3TV4A 4J99A 3FHIA 3UNJA 4DBNA 4G6LA 2W0JA 4UB7A 2XEZA 4QQTA 1QPJA 3BGPA 2J0JA 4R78A 2BFXA 5DNRA 2YFXA 2OF4A 3LCTA 4JAIA 5IQEA 4AF3A 5DN3A 1Q99A 2QG5A 3EN5A 2R2PA 3KFAA 4YP8A 1M52A 5BVEA 4YJNA 5CF4A 4U40A 4IAIA 4DHZA 1HCKA 1ZYDA 1G8AA 4XP3A 3S00A 3PSDA 3FL4A 3W0OA 4AS0A 2UZLA 3TTJA 3V3VA 2OXYA 5FEDA 4A4XA 5HORA 3EL8A 4L8MA 4I41A 4R7BA 4XOZA 2W1IA 4XOYA 2W4JA 3Q5ZA 5JMSA 1YXVA 2FA2A 2EWAA 2GHGA 3CKXA 3FZSA 4FG8A 1IAHA 1GOLA 3FQHA 4PDYA 5EH0A 3EJ1A 4H3BA 3RI1A 4ENXA 5IZFA 2R7BA 2ITOA 4D4YA 2X9EA 4O7OA 4YTIA 1ZYCA 4L68A 4RJ8A 3D83A 3E87A 2BIKB 1Z5MA 3C9WA 5CQWA 3T8OA 5AADA 4IWQA 4CKJA 3G33A 3TKUA 2HELA 2EUFB 2QO7A 2WMBA 5TOZA 4AZEA 2YA9A 3FLQA 4BTFA 4CG9A 4O7NA 3MH1A 3OUNB 4IAFA 4MXZA 3Q6UA 4RJ5A 3QGYA 3TYKA 3BWFA 5IUGA 3R8PA 3KRJA 2X7FA 4OUCA 3ZXTA 4DE4A 1TQMA 4D4SA 2OZAB 4BDGA 3DZQA 4QMWA 1ZLTA 5E7RA 3A61A 2XK6A 3R7OA 4AAYA 4AFEA 1ERKA 2VAGA 5CI6A 5E8TA 4JR7A 5C03A 2O5KA 2WGJA 3HRFA 3I79A 2R3NA 4JVGA 4LL0A 2CN8A 4EORA 3KXXA 4YZDA 2VO0A 4D0WA 4R5YA 3MPMA 4RC4A 3HECA 5AFVA 4GFMA 2ZYBA 2GQGA 2P2HA 5L3AA 4M15A 1O6YA 4RX7A 2CGXA 2WTJA 3LJ0A 3MH3A 3BZ3A 4FT3A 3NFGB 1NVQA 3A99A 5LMKC 3ZLYA 1QPEA 2RKUA 4A9UA 3ZDIA 4OBQA 4XLVA 4C02A 2CCIA 4O2ZA 2I6LA 2C5YA 2QU6A 3KQ7A 1OZ1A 2PPQA 4LV5A 4WD5A 1OIQA 3VHKA 5IF1A 4XBRA 3ALOA 4YJQA 3U4UA 3QTUA 3A8WA 3KCFA 2C6KA 4RWLA 3ZU7A 4BDIA 4TKSA 4BB4A 4ANBA 5IEXA 4F9YA 3PDTA 3UVPA 3PSBA 4KSQA 4C4JA 3PP0A 4FOBA 4Q9SA 1KSWA 4XLIA 3LFBA 4UWCA 4BI2A 1EH4A 4RX9A 5IUIA 2Q83A 5JZNA 3UQGA 2PMOX 4KIQA 3G9LX 2IO6A 2IVSA 5L2WA 4IHPA 1LR4A 3PPKA 3KN6A 1ZY5A 2NNWB 2C69A 4AN2A 4EHZA 4EONA 1ZOGA 4XEYA 5KUPA 4DEBA 4KD1A 2YAAA 1HOWA 5L8JA 1Q8UA 2NP8A 4XHKB 4EK5A 4CFMA 3TNPC 3BEAA 4FODA 5B7VA 3G5DA 3HVCA 3ODYX 4MAOA 5E91A 5HBEA 3VBVA 4ZOGA 3ZSGA 1VEBA 5DH3A 2PVRA 5M56A 3AC1A 2DUVA 2B7AA 4N70A 3TIZA 3KK8A 4GCJA 4QYYA 5AEPA 4FTIA 4LQMA 4F6SA 2OFUA 4BIDA 5CU2A 3VS0A 4F63A 4WIHA 4ZTHA 4F99A 3U87A 3FZRA 4HZRA 4LV7A 4HVSA 2XRUA 3UZTA 3I7BA 3ATTA 3F5GA 1OL6A 1YWNA 2X4FA 4IWDA 5AUYA 3MVLA 4FKWA 4FEQA 2XEYA 3COKA 5ANDA 4O0WA 3PVGA 5FP6A 4OTIA 3ZH8A 4WNKA 1XKKA 3I81A 3RZBA 4AW5A 3BHTA 2F7ZE 3COMA 3G51A 3NUUA 4J98A 4QP8A 1IG1A 5EM6A 3ZCLA 4LRMA 3B2WA 3O96A 3RPYA 3HMOA 5A4EA 2OO8X 4K9YA 2WQMA 2ZM4A 4FTRA 3MY0A 3RM7A 4FSZA 4HGEA 4EUTA 3UZRA 2FYSA 3DFCB 2X9FA 4FUYA 3NMUF 2W4OA 4RVMA 3MS9A 4D5KA 2UZUE 1UVRA 3P7BA 3LJ1A 4FTKA 3MFUA 4FG9A 3LW0A 3Q2MA 4K77A 1XH5A 4FK6A 4QMUA 4BDAA 2JD5A 1YXXA 2HCKA 3AD6A 4ZLYA 3PJ2A 4EI4A 2BCJA 4DHIB 4CMOA 3RHXA 3CGFA 2ETMA 2REIA 3NAYA 4PL3A 3QYWA 4O86A 3GOPA 3QQLA 1OBDA 3TT0A 4O7RA 1DI8A 2XH5A 4DH1A 4WOVA 4ORKA 5FLFA 4TYHB 3MFTA 4WBOA 2JIVA 4YJTA 3C4WA 3FEGA 2G15A 4BGQA 3MVMA 3HEGA 3ML1A 4HPUE 3H0YA 4YPDA 4AQCA 4FGBA 4ID7A 4O7WA 4F9WA 2WTKC 4FV7A 4BCIA 4IZ5A 4EH2A 4G6OA 4I24A 5D41A 1Q8YA 3OTUA 2VTOA 5F95A 4DYMA 3R01A 4FSNA 4IEBA 3SHEA 2QC6A 4OR5A 1REJA 2WTVA 3FLYA 1A06A 2Y8OA 1NA7A 1R0PA 5DEYA 4EZ3A 1ZWSA 2XM9A 1R0EA 3P1AA 3AQVA 4XCUA 3VQHA 5AP5A 5HI2A 4YGAA 3LXPA 4PL5A 3FKLA 2XB7A 3HMMA 3K54A 2UVXA 2W5HA 3ZO1A 3AKJA 3QKMA 1Q8WA 2G9XA 4Y85A 3NUNA 4ZTRA 3PUPA 3GBZA 2WFYA 2VGPA 4F6UA 4HVIA 3NW5A 2SRCA 2VO7A 3D2KA 4L3PA 4MYGA 5DOSA 2F7EE 5JRSA 3CTHA 1W98A 3VUGA 3DNEA 4I21A 4RSSA 3V5QA 3MA3A 4AA5A 3QYZA 2QO2A 4TW9A 5HEZA 2WNTA 4LGGA 4EWHA 5C4LA 1FQ1B 3E7VA 2XAMA 4XG2A 3C0IA 5HCYA 5KX8A 3Q96A 4RVLA 2C3JA 2X4ZA 5A6NA 3Q4TA 3HZTA 2A19B 4FVQA 4WNOA 4ZTLA 5KMOA 1UWHA 4R5SA 5HX6A 1YXTA 4GFGA 5HLPA 5BVDA 2EB3A 3UMWA 1PJKA 5GJGA 5IISA 4XS2A 3AC5A 3S95A 4BDDA 5DT4A 1B39A 3FWQA 3AG9A 5DRDA 3NCGA 1F0QA 3OCTA 3Q4CA 5AV3A 2J5EA 5CXZA 5LVOA 5M4CA 3EZVA 3EIDA 2VWXA 3QRIA 1PF8A 3FXWA 3G15A 2Y6MA 1YVJA 5JK3A 4QMOA 4PRJA 1JQHA 4FSYA 1YI6A 1Z9XA 2CJMA 2CDZA 5BNJA 3FC2A 3CTJA 4IIRA 2XNEA 4DEGA 2PY3A 1XBAA 1U5QA 2WIHA 3DAJA 4GV1A 4KBKA 4XV3A 3TKHA 5C8KA 4AW2A 2PUUA 3GQIA 2W4KA 3W55A 4PX6A 2J6MA 3QD0A 3WF9A 3IW5A 3QTSA 4B99A 5E9EA 2EVAA 4DINA 3UIMA 1W0XC 2O8YA 3H4JA 5IQIA 2HW6A 3CIKA 5T3QA 5BYLA 2R5TA 3M1SA 3R00A 4E5BA 3NIZA 4FZ6A 1WFCA 1G5SA 1KE9A 2P2IA 2VN9A 1H1PA 1AD5A 3H3CA 4IAZA 4WBBB 5HIEA 4FSRA 4ZY6A 1JKLA 3DBEA 3EFKA 3OUKA 5E1EA 3BGZA 3G0FA 4QDVA 3R83A 3UGCA 2WQOA 4EWQA 1FBNA 3HUBA 1ZYLA 5K5NA 4HGSA 4EH6A 4IFCA 4FSQA 4W4VA 4LMNA 4ZZMA 3W2RA 3FMNA 4E20A 4EH4A 2BRNA 4D9TA 1ZXEA 3MA6A 4FTAA 4HNIA 1H07A 2RFDA 3MESA 4IM0A 5LOHA 4ZMFA 3TM0A 1WBVA 5IH5A 3QQFA 2ZMDA 1GY3A 3QRTA 4FTUA 3TV7A 3WILA 4BCQA 2UW6A 5HNBA 1XH8A 2W1HA 3UOHA 3AT3A 4W8DA 2C6DA 1Q8ZA 2PUIA 3KXZA 5LXMA 5EHOA 1SVEA 3L8SA 2VNWA 2CGUA 3QQJA 2XA4A 1TKIA 1Y8GA 2PVJA 2VTTA 3PE2A 3PVWA 3TWJA 1IASA 5DR2A 2J90A 2B4SB 4I5HA 3UG1A 2UW5A 3COHA 3NGAA 3VRZA 1U54A 4P7EA 3ZONA 3K2LA 2PE0A 5AP2A 3R7UA 3WF5A 5JZJA 2GTMA 3EFWA 4X3FC 5IQCA 5LWNA 1BX6A 4RZWA 4NFNA 5CAPA 1OECA 5A3XA 3I1AA 1KE8A 2PVKA 5DT0A 4AZTA 4N6ZA 4NWMA 1H0WA 1ZY4A 5AP3A 2WMRA 4CT2A 4PL4A 5JH6A 5HO7A 4C35A 4YJVA 3LQ8A 3LM5A 2OJIA 3OOGA 2QHMA 3QTXA 4F9CA 4FV6A 5HG7A 3ODZX 5C4KA 3LCDA 3BYUA 4BN1A 4QQCA 3OS3A 4CCBA 1YHWA 3FLZA 2VUWA 3ZS5A 5H9BA 2HWPA 3E64A 4BGHA 5KZIA 4USEA 5KMJA 4FNWA 4XG8A 4NK9A 4PMMA 2JAVA 3SG9A 2ZV7A 2OIQA 1J7LA 3QX4A 3R8VA 3TDWA 3LMHA 4QYFA 5M06A 2XJ1A 1XH6A 3O50A 5E8UA 3TCPA 5HU9A 4WZYA 5J8IA 2ITYA 3COIA 3QQHA 4P4CA 4U3YA 3N4UA 1CKIA 2QODA 3UVQA 3VW8A 4B8LA 4EC9A 1M7NA 4R3PA 3RP9A 4O6EA 3AC2A 1PXNA 3DFAA 3ZEPA 4H3PA 4M0ZA 2J4ZA 1ZZLA 1IA8A 3SX9A 4C59A 2E2BA 3F6XA 5HQ0A 3P23A 4J1RA 2XNOA 3LAUA 3IOKA 4JJRA 3R9RA 4L44A 1Q62A 2QU5A 4U3ZA 4YHFA 2HXLA 5DPVA 1BUHA 3C13A 4QTBA 4W4XA 4FJVA 4G3EA 3UO4A 4D9UA 2QNJA 3NW6A 4N57A 3UOLA 4C4EA 5M07A 2JDRA 2RGPA 4C2VA 4U79A 3D7TA 2R3PA 4KAOA 3S0OA 5CU0A 3D5UA