3N4VA

Apo aph(2")-iva form iii
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
298
structure length
298
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKAVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords APH(2'')-Id
publication title Crystal structure and kinetic mechanism of aminoglycoside phosphotransferase-2''-IVa.
pubmed doi rcsb
source organism Enterococcus casseliflavus
total genus 101
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3n4vA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3n4vA02
2UZNA 4FV8A 5F95A 3PG3A 3VW8A 2NNWB 3F2NA 4L8MA 2ITVA 4FTCA 3VBXA 5HTCA 3PJCA 4RX8A 3SVVA 5GIOE 1MRUA 3QYZA 4K8AA 4QRCA 2FYSA 2PZ5A 3WOWA 5CNNA 3D5VA 4R1VA 4XHKB 3MFTA 4U79A 3SA0A 4O81A 4FSTA 3HEGA 4BI2A 2JKOA 1X8BA 2OIQA 4FT3A 2R3FA 4RBLA 4EQCA 2CGUA 5CSVA 3IECA 4FV9A 3AG9A 4L3JA 3AOXA 1GIIA 2GHGA 2YAKA 4IVDA 4ZTMA 3I7BA 4EH4A 1UWJA 1M17A 4F7NA 3B8QA 4USFA 4MWIA 1T45A 2O65A 3EFLA 3H30A 1OMWA 4XRLA 3DA6A 1P4OA 4C59A 4CTCA 3BV2A 2UW7A 4YBJA 3Q53A 1PXKA 3AC4A 4L01A 4NYEA 5HE3A 5CANA 2ITTA 2WTKB 4YJPA 4IZAA 4BF2A 3RAKA 2HWPA 4Z16A 1J3HA 1I09A 5AV4A 3C0GA 1H08A 3P7BA 5CXHA 4RWLA 4AX8A 4DFXE 3QD3A 4ZLYA 4FSWA 4O0UA 4IZ5A 4LOPA 3FYKX 4CKJA 3DZOA 2YISA 4GU6A 4R7IA 4JI9A 4FKVA 4KKGA 2XF0A 4BCFA 1BL6A 4L67A 3MH0A 2UZUE 4CTBA 4EH8A 3E3PA 3O2MA 4U0IA 3DNEA 3UOLA 4MXYA 4Q9SA 3WZJA 2G9XA 3VJOA 4EK5A 4FTTA 4HNIA 3HMIA 3CC6A 2UZDA 3R21A 2PZYA 5EYKA 4CLIA 3U6IA 3TYKA 4TNBA 3TDWA 4CFVA 4X3JA 3VHEA 5LCJA 4GJ2A 4D4VA 4K0YA 3CJGA 4QO9A 2OI4X 1PYEA 2FB8A 3LXNA 4JR3A 3TNWA 3UPZA 4QYFA 5CSXA 1NVQA 4JX3A 4KIOA 3GU7A 2UW0A 2R0UA 5B0XA 3V5WA 4E5AX 2OJFE 4EEVA 3I0QA 3VUGA 2C3KA 2WFYA 4QTBA 4EONA 3AMYA 4ID7A 3VS1A 2C47A 1H1PA 2OXXA 2BHEA 2ZV9A 3CBLA 3ZRMA 3U4UA 1WFCA 2HAKA 3OOMA 2Z7LA 2Z7RA 2ZMDA 3LQ8A 3UZTA 4IJPA 4GEOA 1V0OA 1YDRE 2PE1A 2XK4A 3BLRA 2CCIA 1KOAA 3QD0A 4X3FA 1WVYA 5CEIA 1OECA 4WNOA 2VX1A 4IW0A 2YM6A 5IA2A 2QOIA 5F20A 5LXMA 1MP8A 3K5VA 2QC6A 3KFAA 5HCZA 3NYVA 4XG2A 4I4EA 4P7EA 4QYEA 1BLXA 5A4LA 4M8TA 4MX9A 5CEKA 2V7AA 5J87A 5EW3A 2PUUA 1G8AA 3DKGA 4E6CA 4MXAA 1OKWA 2W1ZA 2OU7A 5HG5A 3MH2A 4RVMA 3D7TA 1YDTE 2PY3A 4IFGA 3PZHA 3NGAA 3F61A 5IUIA 3BCEA 1F5QA 4JL9A 3ZXTA 4DBXA 2JBOA 2BZJA 4HNFA 4DTKA 3VQUA 4BDAA 3B2WA 4FIEA 4LGHA 4IWPA 1ZXEA 2ZM4A 3PXKA 4PMSA 4XP2A 3ULIA 2E9NA 4AOJA 4EUTA 5IQFA 4NW5A 4E7WA 3CTQA 3V8SA 3OCTA 5ANOA 4EUUA 3TCPA 4OTQA 2W1HA 4EJ7A 2HXLA 5HLPA 4JAIA 5HG7A 4X2KA 3DBFA 3A62A 2Y4PA 5BYYA 1PY5A 2CKEA 2WELA 4I4FA 4PP7A 4GUBA 3EJ1A 3ZO2A 4JDHA 5KMKA 2ACXA 2W1DA 4AZSA 2BTRA 4OTIA 3V3VA 3I6WA 3QTZA 4IB3A 5T6KA 4RVKA 3MTFA 4S32A 3F5XA 2X6DA 4R5SA 1J7UA 1YW2A 4FE2A 2Z7QA 3O96A 5HIDA 3RTPA 1M7QA 3AC2A 3IDPA 4FV3A 3KL8A 3FLZA 4TXCA 3R1QA 2WKMA 4TYHA 4ACDA 5E8TA 3TT0A 1YWRA 3Q04A 4MWHA 5E8YA 1XQZA 2BZIB 3ZBFA 2BDWA 5HE1A 4U6RA 4KKEA 5AV0A 1JOWB 2VZ6A 5GJFA 3PXRA 3HAMA 3GU5A 3NYXA 1OL5A 1KUTA 5DT0A 5JN2A 4D55A 5CU4A 4BCOA 4H3QA 4TYIA 5HCYA 3O7LD 1PXOA 3RCJA 4WHZA 5DN3A 4X0MA 2XBAA 4DCEA 3C51A 4BDIA 4KAOA 5E90A 5JEBA 5BYLA 1ZY5A 4O0YA 3HMNA 2WMBA 4H05A 5BVDA 4ZZNA 2C5XA 1U4DA 2A19B 2VTRA 5DPVA 4LRKA 2IW9A 4R3PA 5C1QB 1R3CA 4A4OA 3DV3A 3DZQA 2RG6A 4MNEA 2WD1A 4NFNA 2CHLA 5AP3A 1XH5A 4QYGA 2YACA 2QKWB 3F3VA 5DGZA 4I1ZA 2Y7JA 2JGZA 4AQCA 4D5KA 1O9UA 3ORMA 2CGWA 2CNVA 3LFCA 2OG8A 3NEWA 3BYOA 2HZ4A 5EI8A 3RAHA 3W8QA 4BZDA 4C37A 5KKRB 4I0TA 1PF8A 2Y4IC 1XH6A 5JRSA 4CFMA 1ATPE 3PA5A 3PLSA 3W2CA 3DXQA 3CY2A 3QXOA 2B54A 2FSOX 3FDNA 1B6CB 3Q96A 2W06A 3H9FA 2OZAA 4RA5A 3L9NA 4JG7A 2VTLA 3WF8A 3WF6A 1J7LA 1O6YA 1PJKA 3R7EA 3OT3A 2G15A 3FKLA 2Z60A 3MVJA 2E9PA 1HOWA 2CN8A 2E9OA 2PMIA 4JG8A 4BB4A 2WQMA 1W98A 3CTHA 3SAYA 5JFSA 1MRVA 3BHTA 2W05A 5KZIA 4FV6A 4A4LA 4BVUA 3MS9A 4BIDA 4ZLOA 2C3LA 1WZYA 5ETIA 3CEKA 4QMLA 3OWKA 2A27A 3WF7A 4PX6A 5J1WA 4CFUA 2CN5A 5HVKA 2YCRA 3OUKA 2JKKA 3A4PA 4AXAA 2XUUA 4IWQA 2JIVA 3LCOA 3FL4A 1JVPP 3TNPC 2ZYBA 4X2NA 2YERA 4OT6A 1URCA 2ETMA 2XRUA 4X3FB 5KUPA 3C4CA 2RIOA 4NJ3A 3TDVA 2GU8A 5KBRA 3A8XA 3COKA 3FV8A 3RK9A 4RRVA 3W10A 1SMHA 3W0SA 2EUFB 3SG9A 4C4IA 1JKTA 1OBGA 4MQ2A 3TV6A 1CMKE 4HVHA 5ANJA 5KMLA 5L8JA 3JUHA 2IN6A 4O7TA 4BHNA 3KXNA 3I4BA 2OIDA 2A1AB 3R0TA 1ZWSA 1YXXA 4S33A 3VVHA 4J52A 4MXCA 4BKJA 5BVNA 3W0MA 1U59A 3IONA 2B9JA 1SNXA 4NM3A 2XS0A 3RPOA 4H1JA 4IM3A 3VHKA 5ICPA 3CGFA 2X6EA 3UOJA 4EOKA 3FEGA 4APCA 3D7TB 2YM3A 5H3QA 3UIUA 4G3DA 4DLJA 3F3ZA 3TXOA 4BZOA 1YXSA 1BL7A 4W4VA 3VNTA 5C03A 4E5WA 2W17A 4L3LA 5AUZA 4K9YA 3W55A 4PWNA 4UWCA 5AP2A 2PZIA 4TY1A 5JFWA 1FVRA 1KV1A 3EQCA 4FG7A 2VV9A 5CVHA 5HO8A 4DH1A 3DBCA 5HESA 5JGDA 4U98A 3MW1A 5FD2A 4IANA 1URWA 3BYSA 5M4UA 1YI4A 5EDPA 3NIEA 5CI6A 5E8SA 4RLKA 4IADA 4YGAA 1WVWA 5E1SA 3ID6C 4PDYA 4O0SA 4XV3A 5FP5A 2ZVAA 4YR8A 5CAOA 2VTNA 3UOHA 3VN9A 5JGBA 3E92A 4F6WA 3MB7A 4JG6A 4Y72A 3EYGA 3MYGA 4GYGA 4CFNA 3BWJA 3I6UA 5EOLA 4ZTRA 3SX9A 3PLAE 3TKUA 1BKXA 4JQ8A 4L00A 1QPCA 3BU3A 5JRQA 4I93A 2ZM3A 3UVQA 1LEWA 2H6DA 3QGWA 1PXNA 3RPSA 3F7WA 3LAUA 1Q41A 4AFEA 3G15A 3ANQA 3C9WA 4WD5A 3E64A 1BI8A 3T9IA 2PZPA 1VR2A 4U94A 4DEBA 3KEXA 2O64A 2RKUA 2X4ZA 4TYHB 2F9GA 5DE2A 1Y6AA 4H36A 3VS7A 2AYPA 2VTJA 3PY1A 2JKMA 2C5YA 4KA3A 4XLIA 4MBIA 4QTEA 5IEXA 2ITOA 3PVWA 2VWIA 3KCKA 3G9NA 4WG4A 3DJ7A 3V01A 4HZSA 4N6ZA 2OJGA 2PVJA 4ZP5A 2P4IA 2WQBA 3QCYA 4CRLA 5HBJA 4GK3A 1RQQA 2QOHA 4IDTA 5E8XA 2KTYA 2BMCA 2VRXA 4ASEA 4QMSA 4ZLZA 2YFXA 3GCVA 3LMHA 4FTNA 3DT1A 4DTAA 4OTWA 3UYSA 5DNRA 5IQEA 1XWSA 3UYTA 4F9AA 4YTFA 3OUNB 1QL6A 2BCJA 4JNWA 2IVSA 3SW4A 3MY1A 1Q62A 1W84A 1YWNA 2C6MA 3V5LA 4UN0C 2R64A 4PTGA 4RX5A 5EQPA 2WTKC 3CY3A 4MNEB 3RHKA 2C1AA 3UGCA 4D0XA 2IO6A 3OP5A 2PUIA 3POOA 4H3PA 5LMAA 1F0QA 3QL8A 3SG8A 3UVPA 2WZJA 3CGOA 3P7CA 1XH9A 4BGGA 2F2CB 2OICA 3DNDA 2JDVA 4WBBB 3JVSA 5G6VA 2G2FA 2R3OA 5HVJA 3SOCA 2F7ZE 3ZZWA 4ANLA 4DEEA 3I7CA 2ZB0A 3LFDA 4DFUA 4JLCA 4I6BA 1Q97A 3V51A 3PSCA 2QO2A 4ANBA 5HNGA 1JBPE 5JGAA 2C5VA 4FR4A 2VO3A 4FYNA 4D0WA 5IDPA 4MK0A 3U51A 2OZAB 3CKXA 1WBPA 4KWPA 3UOKA 3E7VA 3P1AA 1CKPA 4NCTC 3Q4UA 1AGWA 4YJVA 2XKEA 2R3LA 1H1QA 2UV2A 2C6DA 4BIEA 2EXMA 2FSTX 4DH5A 4TL0A 5CI7A 2JC6A 1K9AA 1PMNA 2WQOA 3BQRA 3D9VA 3ETAA 4G3GA 1R0PA 3LCTA 3EWHA 4PL3A 3JY9A 4CFWA 4HGEA 3ALNA 1OL6A 3JS2A 3WZEA 4QMYA 4R3RA 4RA4A 2YZAA 3CKWA 5IQBA 3QRIA 4QT1A 3FPQA 3VUDA 4XV9A 4BI1A 4DA5A 3ALOA 3FZ1A 4XS2A 1G5SA 1KSWA 3QUPA 3ZO1A 4FSUA 2G01A 4EKLA 1QPDA 5FDPA 3EN5A 5KE0A 5CSWA 3ZLWA 5M09A 4XP0A 4M15A 2W99B 1W8CA 3FI4A 5GJDA 3RINA 4V0GB 3ZMMA 2BPMA 2PMOX 2YM5A 2DUVA 3LFBA 1Q8YA 1Q99A 1OGUA 1WVXA 3QQUA 3QU0A 3I81A 4RC3A 4C3PA 3TACA 3EQBA 2XIZA 3R1NA 1E9HA 4E5BA 2E9VA 2HXQA 3LJ1A 5I9ZA 3ORZA 3OOGA 4L68A 3OY3A 4OBQA 4D2RA 4QQTA 3LCDA 3DK6A 4FNZA 4KUJA 3R7UA 4FA2A 3F7ZA 4H39A 2QOLA 3CS9A 3UC4A 2A4LA 3Q2MA 1GZKA 5IPJA 2I0EA 3LM0A 1KOBA 2ITUA 4IZ7A 1VJYA 5E9EA 4R7BA 5AUYA 3ENMA 1ZYJA 2UW5A 2ITNA 3RPRA 4F7SA 4F4PA 4YJOA 5HI2A 3NVMB 3WE8A 4ZK5A 3W1FA 2XEZA 3WZDA 3AD4A 3FXWA 4U44A 2XM9A 4F9BA 2XJ0A 2YDIA 3PPKA 1BYGA 5AP0A 3F66A 3LOKA 4JVGA 4KBKA 4ACGA 4AN2A 2PVFA 2UW9A 4YPSA 5M4FA 2P2HA 2PULA 3DK3A 4TYEA 2QG7A 3FMEA 4RIOA 4N4SA 4DHFA 5JMSA 1JSVA 5FM3A 4NSTA 3OXTA 2ZDTA 4YTIA 4KSQA 3V6SA 4LOOA 2VTQA 5HIEA 2PK9A 4U81A 1PHKA 4U3ZA 3FY2A 4O7RA 3BHVA 3UMWA 4E4LA 3LQ5A 3PG1A 4LI5A 2IW6A 2YIYA 4O7PA 1PXPA 5CQUA 5FQDC 3IDCA 4RG0A 4NZWB 3NNXA 4RQKA 5CLPA 3T8OA 4EOLA 2UUEA 4W4XA 5DOSA 5DRBA 4IC8A 3WE4A 4YLJA 1FPUA 5CAVA 1B38A 3F2RA 3QZHA 5C27A 4MD8E 4NT4A 4J99A 4C58A 5AADA 2X4FA 4F9YA 3U4WA 2EB3A 1KWPA 3D0EA 4I6FA 2RG5A 3BI6A 5DRDA 3PJ1A 1OITA 3FMLA 4FTQA 1LEZA 1RE8A 3NCGA 1OKYA 3FSKA 3G51A 3GI3A 4PF4A 5BVFA 5CZHA 2SRCA 3L8SA 4I0RA 3C50A 3OROA 1VZOA 4WZYA 2V0DA 2W1FA 2JIUA 3RKBA 2OGVA 4IX5A 4MTAA 3LFFA 4NKSA 3TKIA 4W4YA 3KF4A 4HGTA 3WF5A 4FIHA 3R30A 4I5PA 3UC3A 4OTDA 4FUYA 1JSTA 4I3ZA 3V8TA 1OUKA 2QOCA 3IG7A 4JR7A 1T46A 3WILA 4RIYA 3QLFA 3A7JA 2X81A 5LMKC 3FLWA 4O7VA 4OBOA 2WEIA 1LP4A 4HYSA 5KKRC 1Y91A 2V7OA 1Z5MA 4EYMA 5AFVA 2W4OA 1YHWA 4F1TA 4ASXA 4U80A 3VS2A 4EK3A 3AD5A 4EZ7A 2QODA 3FMKA 3QTXA 4EQMA 2F7XE 2XNMA 4JBOA 1HCKA 3CXWA 3I79A 4AA0A 2C6IA 4F1OA 1WBWA 2JDRA 4FOBA 2EU9A 3C7QA 3HA8A 4RC2A 3PA4A 3LXKA 3SKCA 3NW6A 5F1ZA 2VWUA 3MVMA 1BMKA 4FEVA 5D7AA 5AEPA 4C2WA 3MA3A 5A4EA 3TTIA 2HENA 3S1HA 3N9XA 4YJQA 4EHZA 3KXHA 3FY0A 4DFZE 3R1SA 4D5HA 3M11A 3TUCA 1Q4LA 2GNIA 2HK5A 2WMWA 3FZRA 5LWMA 4ZEGA 1JKKA 1ND4A 4AG8A 4DFYA 4E1ZA 4BN1A 3TUBA 3ZEPA 3EL8A 3GC7A 5L8KA 3Q52A 2ETKA 2XIXA 3H10A 2GNJA 4RVTA 3CSVA 4DH7A 2W5HA 2H9VA 3O17A 2IJMA 1G3NA 4J71A 2J90A 2FSLX 2VTHA 5CF5A 2B9IA 4AA4A 3QD2B 3LLTA 4IM2A 4X3FC 3QBNA 3PDTA 3Q4ZA 4U9AA 4BGHA 2WTJA 5AP7A 3GXLA 3EFWA 1SZMA 5FRIA 3MFUA 3BU5A 4AN3A 3E93A 1IAHA 4P4CA 4XX9A 3O8UA 2QCSA 4FSNA 1XR1A 2F49A 4JQ7A 4KNBA 4P5QA 3SRVA 4AT4A 5FM2A 1YKRA 1OIYA 4QP7A 1KE5A 4CG8A 5IF1A 4D58A 3OD6X 4ERWA 2RFDA 5KMOA 5H8BA 3DCVA 3EIDA 2G1TA 2XJ2A 2I7QA 3CPBA 1JQHA 4FBXA 1H1WA 4J7BA 3RM7A 2B4SB 3MV5A 1EH4A 3F9NA 4I94A 3ZOSA 3TUDA 2WTVA 4FZ7A 4QMPA 5IZFA 4DLIA 2GNFA 3THBA 4YZCA 3TZ8A 5IH4A 5M57A 2J0KA 4FTOA 3R8MA 1OPKA 3KN6A 4LL5A 1OPJA 5AAGA 2WIHA 5J8IA 3QTSA 2QQ7A 5IMXA 3EQRA 3KU2A 4KBAA 4EZ5A 2CNUA 3V8WA 3HUBA 5TF9A 5LWNA 3ZUTA 4RQVA 3U8WA 2X9EA 2X8EA 2XBJA 2Y6MA 4BCIA 1R39A 3PE1A 4GKIA 4O86A 3QRKA 4YZBA 4B8MA 2UW3A 2DWBA 4BCMA 4JDKA 4BYJA 4NK9A 5C8MA 5DFPA 4XJ0A 4IDVA 2R3GA 5E7RA 4E20A 4KRDA 4ANQA 3HV6A 2HELA 3NRMA 4LUEA 5AWMA 3M42A 3DQXA 3OG7A 1NW1A 2OIBA 3PA3A 3NW7A 5C01A 3ZBXA 3ZYAA 4AWIA 2XKDA 1YXUA 2B53A 3G90X 5I9WA 5L2TA 3C4WA 3CE3A 4PNKA 2R5TA 3U6JA 5J7HA 1F3MC 4FYOA 2YDKA 3HX4A 3ORLA 2BFXA 3DBEA 4UALA 4GSBA 4ACCA 3SGCA 1U5RA 3PTGA 4FICA 3NUSA 5BX0A 3FBVA 3GQLA 4BDKA 4E26A 1CTPE 4I22A 2I0VA 2R4BA 3OVVA 3F6XA 2C5OA 4QQ5A 2H96A 2NO3A 4FTKA 3A7FA 3BGZA 5H8EA 1FVTA 5HE2A 3R8LA 5LMBA 4DC2A 1E1VA 4B4LA 2C5NA 3FHIA 4WIHA 4G34A 5EW8A 5A6NA 2R3RA 3FMJA 3OF0A 3P0MA 4JIKA 5EDQA 2ZV2A 1LUFA 2VAGA 5AUVA 2OSCA 4WG5A 4FV1A 3TZMA 2NPQA 3ZUVA 3OW4A 5HO7A 3DAJA 3FQSA 2QD9A 4JXFA 5IQAA 1E1XA 4C3FA 3PSBA 1NY3A 5LVMA 2F2UA 4O0WA 5D7VA 2G2HA 1OBDA 4TW9A 2WTDA 3BQCA 4G5PA 4GIHA 2QOQA 2BHHA 1H07A 4U8ZA 4AZTA 4XV2A 5J9ZA 3PXZA 4LRMA 3WF9A 4MCVA 3BELA 1YXVA 4I6QA 2GNGA 3ATSA 4IM0A 4DH8A 4FEWA 5BUJA 1SNUA 3CP9A 3QRJA 4O7YA 3R9OA 4ZAUA 1ZOGA 4HPTE 5BYZA 3PPZA 3FPMA 2HZNA 3ZSHA 4GVJA 2R3KA 1PKGA 4GJ3A 3OCGA 4U40A 4G9CA 4BTMA 4YMJA 1CDKA 3GVUA 3VS5A 4BHZA 4PY1A 3R7YA 3RHXA 2B7AA 3QAME 4G6OA 1Z9XA 4PL5A 5FP6A 4AW5A 3E8DA 1CKIA 2UZOA 4OLIA 2XYUA 2XNPA 3TV7A 4YJSA 3LFNA 5D9HA 4OBPA 4RJ8A 3DTCA 5HVYA 2RL5A 3VUMA 2ZJWA 2PVNA 2YM8A 2HOGA 5EH0A 5IH5A 4DYMA 3POZA 5FBNC 3KKVA 4PRJA 5JFVA 3NNVA 4O83A 4PDSA 4C7TA 3DKFA 4ITHA 4QNAA 4XH6A 5JQ8A 2YHVA 2QOBA 4WSYA 1PXLA 3IW8A 4V05A 3GBZA 4E6AA 4FX3A 1ZMUA 3DFAA 5IQHA 2B0QA 5GIPE 2XCHA 3TNHA 2UW8A 4JT3A 4YHFA 4CCBA 3G6GA 3HMOA 4GG5A 2GTMA 4M13A 4KIPA 3O51A 4IACA 4JRNA 4ANMA 4F9CA 3Q5IA 4UEUA 3LE6A 3ZHPC 4B9DA 1H00A 4CCUA 3W0OA 3W18A 4QTCA 4AE9A 4A07A 4XG4A 2R2PA 4YHTA 4DG2E 4CEGA 2JAVA 3Q9YA 4BYIA 5ANKA 4C4JA 5IEVA 2J6MA 4D4YA 3HAVA 2V5QA 3RZBA 5BPYA 2J2IB 2REIA 2VU3A 2DQ7X 1IASA 4TWCA 4JBQA 3SRVB 5EYCA 4ZJJA 5J95A 4E73A 3QA8A 4PTEA 4RFZA 5LVLA 4RJ5A 2P33A 3IS5A 2I1MA 4M14A 3TEIA 4DCAA 3EN7A 2PTKA 3DJ5A 4I0SA 4C34A 4E4XA 4MXZA 4ITJA 3TIYA 1H25A 5FTQA 3S3IA 5IA1A 3WI6A 3QHRA 2YWPA 4FSQA 4YJUA 4FIJA 2YITA 2QHNA 3DB8A 3WYXA 4HVGA 4EOIA 3O7LB 5E1EA 5BVEA 4ASZA 1XKKA 2Q83A 4DEIA 2KULA 4OTRA 3UBDA 3OWLA 5HU3A 5M55A 5E8UA 3RM6A 1YHSA 2PUPA 2W1GA 4BBEA 2J7TA 3KY2A 2QU6A 2YIWA 3RPVA 1J7IA 4U43A 3QZFA 5DYJA 3QX2A 3BE9A 1OL1A 2JLDA 3OWJA 2A0CX 4L42A 5DI1A 5GHVA 4C0TA 4Q9ZA 3EFKA 4DF3A 4AW0A 4FV0A 4AW2A 4KABA 3R2BA 4X2FA 4A7CA 3ET7A 2XKFA 3NNUA 4WKQA 2X2LA 3NZ0A 5HKMA 1W7HA 4O7LA 5FLFA 4AT5A 3C5UA 3F3TA 4H58A 4EQUA 1PMEA 1WBNA 2CPKE 2GNLA 2O8YA 1H1SA 2CGXA 2WMUA 4FSZA 3ZM9A 4FMQA 2QLQA 2C6TA 3OWPA 5FG8A 4AN9A 3QTUA 2OXDA 5AAFA 4B6LA 3ENHA 1O6KA 4L52A 3CIKA 3FKOA 4DGNA 2WTWA 3OFMA 1RDQE 1REKA 4FGBA 4YZDA 1TQIA 4RIXA 4BCKA 3EN4A 5CEOA 5EYDA 3V5PA 4FKQA 4YSMA 4FKRA 3PIYA 5AP6A 3OEFX 5M4IA 4HGSA 4TT7A 4EYJA 4LRJA 4UXLA 1A9UA 3EQIA 2ESMA 2VO6A 3Q60A 4FZ6A 3I0OA 4RPVA 1OZ1A 1ZLTA 3ZZEA 4ZS0A 2QI8A 4HJOA 1BI7A 3EN9A 5FTOA 3CCNA 4ZS4A 1IA9A 4WNPA 4YJNA 4FEXA 4GK4A 3BWFA 4ZTHA 3EMGA 2WMSA 1SYKA 3GFEA 5DVRA 3UTOA 4A9UA 1TQMA 4C4EA 4DGLC 5IH6A 1R1WA 2B9FA 1PKDA 1XBAA 3RWQA 3SC1A 2ITZA 4NWMA 3FZOA 4U97A 1IEPA 3HA6A 3L9LA 4OTFA 4EK8A 4J96A 3M2WA 4LMUA 3ACKA 3KF7A 4MD7E 5LVOA 2QONA 4M0ZA 2JDSA 4FKGA 1Q5KA 4DN5A 3Q32A 4F0GA 2WU7A 1OIQA 3FZPA 3QFVA 4GRBA 3D5UA 3Q3BA 2YA9A 3FYJX 1DAWA 4FK6A 3EZRA 2OWBA 3K3IA 4FZDB 4ORKA 5AX9A 5CEMA 4IB1A 3F3UA 2ZB1A 4RLLA 3NUAA 3V5JA 5LQFA 1GZOA 4F09A 3QQLA 4G3FA 5FUTA 4AACA 4DEHA 2WGJA 4BDCA 2Q0BA 2WTIA 3O23A 5LARA 3O50A 4ZTNA 4BBFA 4ENXA 1XJDA 2OH4A 2QURA 4IQ6A 3R8ZA 2PL0A 2ITYA 3BLHA 3KRLA 1Y6BA 4QMVA 5A14A 3HV3A 1V0BA 2YEXA 4G31A 2QOFA 3ROYA 4BR3A 3NAXA 4WA9A 2CLQA 2ONLC 3IW5A 3MDYA 1ZYDA 3G33A 3E8NA 4PMTA 4BI0A 5D10A 1Q8UA 2YIQA 1Y8YA 4Y83A 2NP8A 3QUDA 5CZIA 4F7JA 2J0MB 4XBRA 3QTRA 3MFSA 4O22A 3ZONA 3NCZA 1GZNA 4GFMA 2BRGA 4AZWA 4FTMA 4HYUA 4S30A 2R7IA 3TZ7A 3BEGA 4NIFB 3FMHA 2UW4A 1K3AA 4YHJA 3VS3A 4MF1A 4ZTLA 2AUHA 3DBQA 3BYVA 4X2GA 4X21A 1Q8WA 3N4VA 3AD6A 2IG7A 2XA4A 2XCKA 1YDSE 4YLLA 3OMVA 3QZIA 5JH6A 3IW4A 5HQ0A 1P5EA 4R5YA 3GB2A 3FZSA 1H0WA 5TO8A 5EHYA 3VAPA 4FVPA 2J0LA 2CDZA 3KCFA 3AMBA 5K5NA 1G8SA 1PRYA 1RJBA 4FVRA 1FBNA 2NRYA 3D5WA 3FMMA 5CYIA 2P0CA 4DFNA 3D4QA 4I5HA 4Y85A 1YHVA 4L9IA 5DIAA 1ZAOA 2O3PA 4FNWA 2VTTA 3UG2A 3ZRLA 3R7IA 2JD5A 2X0GA 5HTBA 4KSPA 5J9YA 3CQEA 1TQPA 4LUDA 3U9NA 3GCUA 4A9SA 1ZZ2A 5DG5A 4FV2A 4GT4A 4N57A 4LYNA 3LCKA 5IA4A 3CPCA 1OIUA 4L45A 3LHJA 4MEDA 5HX6A 2BKKA 3A7HA 4USEA 3C4XA 2XNGA 3FLNC 4ZY5A 3N4TA 4TKSA 1Q3WA 5AIKA 4FEQA 2X7FA 5C26A 3UIMA 4BCGA 4IX4A 4EL9A 3E7OA 3Q4TA 4L53A 2XK3A 3H0YA 3UIBA 1P14A 4GH2A 5EHOA 5TT7A 5ACKA 3DAEA 3P23A 1YQJA 4WO5A 1FVVA 2Y8OA 4AAAA 1QMZA 3QA0A 4Z7GA 5BNJA 3FC1X 1XBCA 2VO0A 3DU8A 3PUPA 3C4ZA 2ITPA 3ZDUA 4BCQA 2PE0A 4PP9A 3E63A 5EYMA 3MVLA 4G5JA 4WBOA 4ZMFA 4XNEA 4IX6A 4BTFA 4CZTA 2BALA 3VC4A 3LPBA 5DEYA 4C38A 4NTSA 1P2AA 4RIXB 4ZSAA 1OIRA 3C1XA 3OS3A 3PFQA 4XEYA 4BDEA 1W0XC 3PZEA 3QWJA 3BX5A 3VQHA 3MH1A 1Q8TA 5HBHA 2BIKB 3OEZA 5CSPA 1STCE 4DAWA 3EL7A 2UW6A 3QTWA 4HPUE 4UZDA 3L1SA 3SLSA 2FO0A 4DEAA 2JDTA 4FKWA 2VNWA 2J51A 3AC1A 1UKHA 4TN6A 4ZXTA 3UJGA 2PZRA 3H3CA 2C4GA 3KRXA 5CTPA 3UE4A 4I24A 4JS8A 3ZM4A 4DEGA 3PVUA 5A46A 3ANRA 2O5KA 3PWYA 5HD7A 4YC6A 4HZRA 4EORA 1APME 3AXWA 4K33A 1SM2A 2C6LA 4AU8A 4FV7A 4EOOA 1O6LA 2UZVA 3O0GA 3VF8A 4AZVA 2WQEA 2YIRA 3GQIA 3L9PA 5KO1A 5M07A 3L8VA 5M44A 4Q5HA 3R00A 5B2KA 3AC3A 4XG3A 5IQCA 2I0YA 3LFAA 3FI2A 3LZBA 1GIHA 3MN3A 3ORKA 4H3BA 4LM5A 1CKJA 2OF2A 5HICA 5IA5A 2OXYA 3ZEWA 5AUTA 4NJDA 3WBLA 4LG4A 3JYAA 1JLUE 2XZSA 3FMNA 4RX7A 3KRWA 3MPAA 3REPA 4YTCA 3TN8A 3OCSA 4EH2A 4IEBA 3VBTA 5CT0A 3LCSA 2O2UA 5E8WA 2HZIA 4F6SA 1Q24A 2R3QA 4YNOA 3SW7A 4BC6A 3TL8A 4CFXA 1OKVA 1JNKA 5A4QA 2W5AA 4U41A 2VWZA 1FINA 4QPSA 1XH7A 2OJJA 4EHGA 2XYNA 4ARKA 5HEZA 3IKAA 4O96A 2J5EA 2QG5A 3PY0A 5DEWA 2BZHB 3GC9A 3NSZA 3W0RA 5TR6A 2WMRA 4XG9A 3PE2A 3PXFA 3VUIA 2E2BA 2IW8A 2VWWA 2QR8A 2J4ZA 3F2AA 4GVAA 3LKMA 4CV9A 2B55A 1PYXA 5HGIA 3P79A 5J1VA 2J0JA 3ZXZA 4DGGA 3MIYA 2C3JA 3RP9A 3QTIA 4Y95A 4C33A 1UU9A 4LV8A 1H24A 4IAAA 2OZOA 2V55A 3NYOA 2XMYA 2ERZE 3PSDA 4MHAA 3KMUA 3O8TA 2RFSA 4YUQA 2X2KA 4UXQA 4C4FA 5KMNA 4U42A 3UQGA 4O2PA 4ACMA 4KB8A 4L3PA 4DEDA 2X1NA 3MPTA 3QKKA 2JIIA 3NUXA 3U54A 4FTAA 4MXOA 5FDXA 2PVLA 3QUEA 4RMZA 2YCSA 5CU3A 4ZSGA 1OVEA 2JFLA 1U5QA 3GOPA 3IGGA 2ITXA 4A9RA 3BBTB 4KRCA 1L3RE 2YJSA 2YAAA 4GG7A 5AV3A 4XBUA 2ETRA 4U45A 1ZY4A 2LAVA 4RZVA 4QMZA 4LMNA 4AA5A 4C02A 3QQJA 3RAIA 1JWHA 5HX8A 2VTOA 4EOQA 4MAOA 3COMA 3MWUA 4RZWA 3PXQA 3U87A 4C62A 3IK3A 3A8WA 4TZRA 1JPAA 2YDJA 3ZUUA 2F57A 3DKCA 2YIXA 4O82A 2PVYA 3FJQE 4BICA 4F64A 5IQDA 5HE0A 3A4OX 3IOPA 1UV5A 2VO7A 3G0EA 1MQ4A 5DT4A 5J9LA 3OHTA 3DLZA 3KGAA 3R9DA 3WARA 4FTRA 1UKIA 3K5UA 5K5XA 3A7IA 5K4JA 4QMUA 4BTKA 4O0TA 4DGMA 3GCSA 4QTAA 4BCJA 3NS9A 4O7WA 4KBCA 3BYUA 3SV0A 3H0ZA 4I5CA 4R6VA 5AJQA 2XNEA 3DY7A 3GU4A 3HP5A 5DLSA 1ZYSA 3NLBA 4AGUA 2CKOA 5AUXA 3FHRA 3CLYA 3CR0A 4UBAA 3F5PA 4BY9E 1JAMA 4FKJA 2P2IA 4D4RA 4V04A 5BUIA 3P9JA 3S95A 4NTTA 4FNXA 2C69A 3KVXA 2WB8A 3IW7A 4IH8A 1ZZLA 4S2ZA 4X6QC 3HRCA 4DTBA 1OL7A 3LJ2A 3ZFYA 4G6LA 4R7HA 1M7NA 4AZFA 2ZAZA 4I6HA 4MNFA 5CEQA 4BDFA 2HWOA 2YABA 4CQEA 1LR4A 5A4CA 3R22A 4U7ZA 3V6RA 4O7NA 3R7OA 3S0OA 5FEEA 3HMPA 4YC8A 2Z7SA 4HGLA 4Y46A 1GY3A 3PYYA 3ZLXA 4XRJA 3Q6UA 2XIKA 4XYFA 4Y8DA 5ACBC 4UB7A 4YJRA 3UDBA 2QR7A 2JAMA 3KN5A 2HCKA 4MVFA 3T3VA 3I1AA 2BIYA 5HG8A 3CQWA 5KNJA 4AE6A 3FQEA 2PUNA 2R0IA 2ZV8A 4CFFA 2OJ9A 2UZEA 4B8LA 3UMXA 3NUNA 3OZ6A 1I44A 4ACHA 4F0FA 4JBVA 4Q2AA 4Z3VA 4YC3A 4O21A 3G9LX 3DB6A 3KB7A 4BBMA 3UPXA 1M52A 2XEYA 4GFOA 4O6LA 3TJCA 1U54A 3VWAA 4JJRA 2I6LA 5I9YA 4WRGA 4ALVA 4LL0A 3TM0A 4MBLA 3UG1A 1PXIA 2VTMA 3ORPA 5HU9A 1JKLA 3H9OA 3QYWA 5FXRA 1VYZA 1H26A 4WNMA 4YZNA 1IRKA 3BBWA 3GU8A 4YU2A 2XM8A 5C8NA 5JZNA 5IISA 4OTGA 2FVDA 3PRFA 5EM7A 4ZSJA 4FTLA 4RWKA 4FKSA 5B2LA 2C30A 4HCTA 2ERKA 3RVGA 2EB2A 2I0HA 2WOUA 4C4HA 2BRBA 5CX9A 3D2IA 2C0IA 3PJ8A 4Y73A 3DXNA 4F99A 2YCFA 5FXQA 3KRJA 4WG3A 3MTLA 2VD5A 4ENYA 3B2TA 4RWJA 3BIZA 3LQ3A 5H9BA 4NL0A 3OTUA 3QKMA 4GIIA 5JKGA 3FKNA 1OKZA 3V04A 1V1KA 4FV5A 3QCSA 3EQFA 4FV4A 4O38A 3VBYA 2XK7A 5AX3A 5C8KA 3HYHA 5JSMA 5CXZA 2YM4A 4J98A 3U6HA 4LFIA 5T68A 3EOCA 3B8RA 3OCBA 5CY3A 2V62A 3V5QA 4ALWA 4NW6A 4FT0A 5AP4A 5KCVA 5BMMA 2OFUA 3T9TA 4C2VA 2PU8A 1DAYA 1FGKA 3JY0A 4E6QA 4D1XA 2C0TA 5BVOA 4ZY4A 3F69A 3NW5A 1H01A 3UP2A 1NT2A 3BU6A 1UVRA 4E8AA 3MH3A 5DR2A 4RC4A 3FQHA 4BTJA 4GUEA 3BGPA 3VO3A 5DA3A 4O0VA 4YPDA 3TJDA 4W4WA 4G17A 4IVBA 2JEDA 2UZWE 4FVQA 2ZV7A 3D15A 3PXYA 2Z2WA 4F0IA 3ORTA 2CNQA 5CSHA 4EWQA 5EFQA 4IAKA 1ZARA 2EXCX 1BX6A 4P90A 3VBVA 4CGAA 4FL3A 2GS2A 3D7ZA 4Y5HA 2J9MA 2X39A 3AT2A 5FBOA 5I9UA 3RMFA 5KZ0A 5AAEA 4UY9A 3EH9A 2CCHA 3HV7A 4V01A 2W1IA 5L6WL 4C61A 3AQVA 1H27A 4ERKA 3ORNA 5ANIA 4FOCA 4DT8A 5L2WA 2HW6A 4CRSA 2FSMX 5AA9A 3PJ2A 1OM1A 5T3QA 2BAQA 3BEAA 2GCDA 4I20A 4EH9A 2B9HA 4RX9A 3VW6A 4YZMA 5CF8A 3NIZA 2PMNX 4CLJA 5CNOA 1QPEA 3F3WA 2WQNA 1Y8GA 3MGYA 5KMMA 3QC9A 3UNKA 3R9NA 4YZ9A 4FIGA 2BVAA 2PVHA 1WBTA 2Y9QA 2ZOQA 2PE2A 3KQ7A 3N51A 4IE9A 4MYGA 3CQUA 4XP3A 4CMUA 4CZUA 5KHWA 1KE7A 3PPJA 2WAJA 3G2FA 3ODZX 4KS8A 3FI3A 1W83A 4YBKA 3ZS5A 5ETFA 4ZJVA 3BYMA 4GT3A 3HDMA 4Z55A 3JVRA 3R9HA 1YOJA 4O6EA 4U3YA 3TNIA 4JDIA 1YRPA 1M2PA 4RIYB 3DFCB 4OTHA 5D12A 3PRIA 5CU2A 4IC7A 5CVFA 3P5KA 5LMKA 5IUHA 3ACJA 2BFYA 2DYLA 5AM6A 3OC1A 1IG1A 3TZ9A 4EHEA 2CMWA 3AC8A 1Q61A 4D9UA 3LW0A 3FI8A 4BGQA 4CMOA 2BROA 5KMIA 3DTWA 4HCUA 2ZDUA 2R3IA 5IMEA 1FMOE 3OBJA 1HCLA 4M69B 2NRUA 2XK9A 4QMNA 3G0FA 4I23A 1J1BA 3QRUA 4M68A 3C0HA 3FSFA 3WZUA 3R83A 3UP7A 1RW8A 4RJ7A 3KULA 5CAPA 2GQSA 2OF4A 2YN8A 3OBGA 4GU9A 4J8NA 4O91A 4XOYA 5H2UA 3Q9WA 4BDHA 4DG0E 5BQ0A 4YNEA 3MJ2A 3DPKA 5AMNA 4QYYA 2OO8X 5G1XA 1H4LA 2IVUA 4QMOA 4GV1A 5HLNA 3TIZA 3K2LA 3UNZA 3W2PA 4F9WA 2X8DA 4M67A 1VEBA 2RFEA 5DH3A 4DH3A 2BZKB 3KVWA 2OW3A 3MBLA 5I5ZA 4QPAA 3FLSA 5EM6A 4F6UA 3L8PA 4PL4A 3UQCA 5IEYA 1U46A 1H1RA 1M2QA 2VNYA 3LLAA 4QP2A 4AFJA 4PTCA 1U54B 2BAJA 4AT3A 5CASA 2QOOA 5HBEA 2OKRA 4QP4A 2IVVA 4IWOA 2XNOA 4RJ6A 1MUOA 3KXMA 4EHVA 2GFCA 1UA2A 3D94A 1K2PA 3ZC6A 4D1SA 1OL2A 1NVRA 4PUZA 4G16A 3I60A 4QNYA 3D5XA 2GS6A 4EH3A 5HD4A 4EI4A 5M51A 3FMDA 2R3NA 5EQEA 4ZZMA 4FT9A 1UU7A 3MFRA 3R73A 5HLWA 1J1CA 4JRVA 5HHWA 5DHJA 2CKPA 4EH6A 2GDOA 3R8PA 5LVPA 1YVJA 4W8DA 4YJTA 3CD3A 2ZM1A 3OY1A 4HCVA 3RALA 2H8HA 2VTAA 2IZRA 2HIWA 3DOGA 5DR9A 4L44A 5JT2A 3D83A 3OTVA 2QLUA 3COIA 3ZFMA 1IA8A 2AC5A 3UNJA 3R71A 4GYIA 3MIAA 5K3YA 5IA3A 3MI9A 3MJ1A 3KRRA 3GOKA 3MA6A 2W96B 4ITIA 3V5TA 1JSUA 3HKOA 2C6OA 5EW9A 3HMMA 2F7EE 3ZFXA 4O7OA 1WBSA 4EOJA 1Q3DA 2A2AA 3Q5ZA 2ZMCA 5LOHA 1XHAA 1AQ1A 4IAFA 2VTPA 2BRMA 3Q2JA 3ZCLA 3QC4A 4KINA 4I21A 4RIWA 1DI8A 4UX9A 2HYYA 2JKQA 3LMIA 2Y6OA 5EDRA 3ZDIA 3ZO4A 3ZTXA 1FMKA 2Z8CA 3DS6A 3NR9A 1KV2A 2WMXA 4GS6A 3EN6A 3CD8A 3R8VA 3MESA 2O0UA 2C0OA 3BE2A 2GNHA 4CNHA 4IBMA 1KE6A 4O0RA 3TTJA 5A3XA 3KXZA 2C1BA 1JKSA 2WPAA 3ITZA 3QQGA 5L8LA 3BHUA 2QOKA 3ROCA 3SD0A 2Y0AA 2ITWA 3PP0A 4E4MA 4B0GA 5L2SA 2WOTA 3OW3A 2RGPA 3UIXA 4L7SA 3LFSA 1GNGA 2UZTA 3OT8A 4ZSEA 1YI3A 4K11A 4D4SA 2IWIA 4KKHA 1ZOHA 4PDOA 5DBXA 5KHXA 3IGOA 4MXXA 1IAJA 4L46A 1SVHA 2UVYA 1SVGA 2W1CA 4I41A 3IQ7A 1GZ8A 3FAAA 4AOIA 2C3IB 3GENA 3HV5A 4HYHA 4WUAA 3VBQA 3II5A 3MY0A 4G1WA 1UNLA 1YOMA 5AA8A 4IWDA 2C6EA 5CVGA 4F08A 2YCQA 4NH1A 3R02A 4AF3A 2HW7A 4C36A 3WZKA 3LXPA 4K6ZA 5FEQA 3QCXA 1VYWA 1M14A 4NM0A 4EWHA 3P08A 1GAGA 4NM5A 5K4IA 4C4GA 3QALE 3MY5A 3RI1A 1REJA 2X2MA 3SXRA 4IB5A 4QMTA 2XB7A 4M0YA 3R04A 3BGQA 2PVKA 4G3CA 2IPXA 2W7XA 4H1MA 3RNIA 4F7LA 3E3BX 3ORXA 4FIIA 3GCPA 4O84A 3W16A 4BDJA 4YSJA 5A54A 5JQ5A 2VX0A 2BR1A 4IHPA 2GPHA 1S9IA 4K77A 4QYHA 1S9JA 3AT4A 5AM7A 5FGKA 3ZC5A 1WMKA 1PXMA 4QP6A 4CVAA 2OLCA 3VS4A 5J5SA 3MSSA 4R3CA 1GIJA 4ZSLA 5FXSA 5DT3A 4AZEA 4R1YA 3E5AA 5D11A 5GINE 2W4JA 4QP9A 5ETAA 3FZTA 2P55A 3NVKI 2OJIA 2WMTA 3NWWA 2CSNA 3R01A 4QMQA 5ITAA 1KE8A 4YURA 3FLQA 3KK8A 1NXKA 4M7IA 4EBWA 1M2RA 3LIJA 3ZH8A 3W0PA 3EYHA 2W5BA 3ERKA 3BHHA 4FG8A 3C4EA 4FZAB 1ZRZA 3KULB 3L8XA 1LPUA 1GJOA 5CT7A 2ITQA 4XCUA 2XIYA 2E9UA 5AUWA 3ATTA 3DGKA 2BDJA 3Q6WA 2VUWA 3RGFA 2GS7A 3QGYA 1XH4A 1ZOEA 4FSMA 3FWQA 1J91A 3NUUA 5EK7A 5HCXA 5CAUA 5E8VA 3Q9XA 2XRWA 3KMWA 4CG9A 4II5A 2WIPA 4IAYA 1A06A 4QP1A 1DS5A 4UZHA 1NVSA 3L9MA 4CMTA 4FKOA 3NNWA 4FK3A 4QTDA 5CWZA 3UZRA 3PP1A 2YWVA 3ZLSA 4ZJIA 3PIXA 3IO7A 4CXAA 1ERKA 2HY81 3VBWA 2FH9A 5BVKA 4UWYA 4BZNA 2CLXA 3AGMA 3AMAA 5M06A 4O7ZA 4TYGA 4V0GA 2YM7A 2LGCA 4M12A 3SXFA 2IZSA 4EC9A 4IAIA 2JFMA 3NYNA 4FZFB 4PMMA 3G6HA 2V22A 4FGRA 4R77A 3WYYA 4S31A 4LGGA 4OUCA 4EOPA 3P4KA 2B52A 4AP7A 3TWJA 4A9YA 1UU8A 4FI1A 4N0SA 3GNIB 4D9TA 4QOXA 3DK7A 3N4UA 4DT9A 3BLQA 4MBJA 4FKIA 5KMJA 1PMUA 2JBPA 3VRYA 5TOZA 1GOLA 3ODYX 5LVNA 4MKCA 3KA0A 2JDOA 2PYWA 2VN9A 4FT7A 4WRSA 4YTHA 3PIZA 3W33A 4ALUA 3QD4A 4DE4A 5M08A 1H28A 1MRYA 4HVDA 4D1ZA 4BDGA 3GC8A 4YP8A 5A6OA 4Q5EA 3AGLA 3MB6A 3QHWA 4B7TA 2WO6A 4K2RA 3NMUF 1WCCA 5IQIA 3ZRKA 1OPLA 4FL2A 4IVAA 4RIWB 4ZIMA 5EG3A 3G5DA 4ZTQA 4D28A 4OR5A 2YZLA 3I5NA 2OBJA 2QU5A 3ELJA 2BRNA 4B99A 3PY3A 4FIFA 4E93A 4FSRA 4YO4A 2QHMA 3LFQA 3VULA 4IB0A 4G6NA 4HVSA 4AUAA 4RGJA 3JPVA 4QMWA 3NX8A 3U55A 5C4LA 4L43A 3QTQA 3RAWA 4A9TA 4HW7A 4OW8A 2C6KA 4E4NA 5F9EA 5IDNA 5IUGA 4YO6A 1XBBA 3R63A 4KS7A 2W1EA 3QF9A 2FA2A 2BUJA 3GEQA 3KXXA 4GKHA 4XMOA 4PMPA 3F5GA 3RJCA 3M1SA 3PWDA 2VWYA 4DITA 4RWIA 2GQGA 2GTNA 5M56A 3EB0A 4FTUA 4PNIA 5EQYA 4CKRA 3GP0A 3BKBA 4F63A 4FEUA 4ZY6A 3LMGA 3KMMA 1QCFA 4O0XA 4PV0A 1Z57A 3VF9A 2WXVA 4JX7A 4M3QA 2XH5A 2RFNA 5B7VA 1V0PA 5D1JA 4K18A 5IU2A 2R3PA 1CM8A 3Q9ZA 4EBVA 5L6PA 4KD1A 3W0QA 1FOTA 4RFYA 3BPRA 4EOMA 2J50A 2OK1A 3HV4A 3FUPA 4XV1A 5HNBA 3ZU7A 4C3RA 1DM2A 3HECA 3AT3A 5A9UA 4F1MA 4OGRA 4J97A 4NUSA 1OB3A 2J5FA 4IX3A 2QVSE 3K54A 4BCNA 4ZMEA 5EM5A 4M84A 5IQGA 4BDBA 4UYNA 3MVHA 4J53A 5LJJA 2J0IA 2X7GA 4DG3E 2CGVA 4GCJA 4RT7A 3LM5A 1YI6A 4FODA 3CTJA 5EI2A 3ZSGA 4AGWA 4Z7HA 3P7AA 1FGIA 5GJGA 2O63A 3COHA 1FQ1B 2XKCA 2IZTA 3H4JA 2HY0A 3QQFA 1ZMWA 1AD5A 3C5IA 2JITA 3FL5A 4XG6A 5BMSA 4TWNA 1CSNA 4L7FA 3PJ3A 5BVWA 5CS6A 5CENA 2W4KA 2WMQA 3R2YA 4XG8A 1KE9A 2XK6A 5HIBA 4OT5A 2VGOA 2UZBA 2WMVA 3HDNA 4FKUA 3A7GA 1W82A 1WBOA 2IVTA 3EKNA 4NM7A 3UZPA 3BV3A 3KC3A 4DINA 1PXJA 3D2KA 4GK2A 1L8TA 2R3HA 4UV0A 4UWBA 2FUMA 3GFWA 3TV4A 3D14A 3U9CA 5AUUA 3A61A 2UZLA 3IW6A 4FUXA 4TRLA 2BRHA 2ONLA 4EOSA 5LCKA 1IR3A 4TTHB 3R1YA 3VS6A 2BKZA 2W9ZB 2W9FB 3S4QA 1QPJA 4WOVA 2PHKA 1Y57A 1XH8A 3BHYA 4X6RA 5ETCA 2C68A 2GHLA 4Z9LA 4WUNA 2PWLA 5KBQA 4FNYA 2VWXA 2XNBA 4E6DA 4GMYA 5E8ZA 2X8IA 4P2KA 1ZMVA 3GT8A 3FLYA 4A4XA 2XNNA 4FL1A 4FTJA 4ONAA 5FTGA 5A4TA 5CU0A 5DR6A 1R78A 5E91A 1UNHA 5EKNA 4P5ZA 2X7OA 3I5ZA 4JAJA 4BDDA 2BDFA 2BTSA 5DWRA 3DAKA 2OFVA 4BIBA 3VRZA 3O8PA 3RPYA 4O7SA 4DGOA 2G2IA 4QP3A 1TKIA 3SHEA 3PVGA 4A06A 4ASDA 5BUEA 3RCDA 1MQBA 3LVPA 4MH7A 4G2FA 3HVCA 4FTIA 3DLSA 4J8MA 4JBPA 3RK5A 2VWVA 3HNGA 4RJ4A 5E4HA 3IOKA 3DKOA 2VWBA 4CSVA 4G9RA 4NKAA 4USDA 3W0NA 3QQKA 4AW1A 4J1RA 1P4FA 3A2CA 5CU6A 1NA7A 2OH0E 2UVZA 5HZNA 2PSQA 4IJ9A 2VTSA 5HG9A 1H8FA 4JIAA 2P3GX 1UU3A 3R7VA 3AC5A 2WEVA 3IDBA 3E87A 2XP2A 2PMLX 2W0JA 3HUCA 4LV5A 5JFXA 4ZTSA 4APPA 2PPQA 4JDJA 4ANSA 2I40A 2GHMA 3DBDA 3NDMA 4DBNA 3SOAA 1DI9A 5I0BA 1R0EA 3W2OA 4FG9A 2B1PA 3GU6A 3Q4CA 4GL9A 3ORIA 3DDQA 3NPCA 4HYIA 5KX8A 3UO4A 3HRFA 4X7QA 5EKOA 1TVOA 3VJNA 2H34A 4F70A 3EFJA 1A48A 2GSFA 4R78A 5AIRA 4O27B 3DXPA 4PQNA 2UVXA 2BAKA 3IPHA 4FSYA 3TI1A 5AV1A 3UVRA 4FKLA 3W32A 2VX3A 3CJFA 5EM8A 3VS0A 1UNGA 3S2PA 4YLKA 3DQWA 3QWKA 3R8UA 1YXTA 3RK7A 3BRBA 3EKKA 3FXXA 3P78A 5C4KA 3QXPA 4C35A 2IZUA 5F94A 4CKIA 2R7BA 2VGPA 1WAKA 2RF9A 4QP8A 5D41A 3OXIA 2GQRA 3H9RA 3A60A 3DDPA 3FE3A 3HLLA 3O71A 4RFMA 5L3AA 5IG1A 4FT5A 4IFCA 5L6OA 5F4NA 4TNDA 4DFBA 3F82A 4MD9E 1OI9A 2Y4IB 3A99A 2CJMA 2WHBA 2R3JA 3EZVA 2R9SA 3GCQA 3EQDA 1UWHA 5AV2A 5TKDA 3C0IA 2XK8A 3KK9A 3ZO3A 2QO7A 3GGFA 4F65A 4KIQA 3BZ3A 3R28A 3E8CA 3DJ6A 4AGCA 4AS0A 3R6XA 5CALA 1YOLA 4N6YA 4NCTA 4QMXA 4EKKA 5M4CA 3NUPA 2BILB 2FGIA 4FC0A 4HOKA 4XLVA 1B39A 4XUFA 2VTIA 5AP5A 4CT1A 2WTCA 3K3JA 3MPMA 1PW2A 3ULZA 4EK4A 4GFGA 3W8LA 4I5MA 2XIRA 3QCQA 4WT6A 4K1BA 2YJRA 3W2RA 4S34A 3HP2A 4LQMA 1SVEA 5E92A 3EHAA 3NUYA 4J95A 4TPTA 2Q0NA 3JXWA 3QX4A 5ANEA 3WIGA 3HRBA 3E88A 4NFMA 3RWPA 3UODA 3W2QA 4CD0A 3UQFA 2GFSA 4EC8A 4XOZA 4O2ZA 4RJ3A 3SXSA 2CKQA 4X2JA 3LJ0A 3FXZA 5EI6A 4W8EA 4CT2A 3T3UA 4JOAA 5CQWA 5GNKA 5FEDA 5HNIX 2WU6A 4BCHA 4QQCA 4U5JA 4N70A 4IZYA 3VIDA 5IA0A 2F4JA 1H0VA 4I92A 4MQ1A 3UO6A 3NAYA 3QQHA 3E62A 1YWVA 4L6QA 3OXZA 4GT5A 2WMAA 4LOQA 4RVLA 4FKPA 4IVCA 3EQHA 4TWOA 4TWPA 5CEPA 5JZJA 3TKHA 1Q8ZA 4BCPA 2R3MA 5CF4A 3VUKA 3ZLYA 4AOTA 2EVAA 2XVDA 3F88A 3GC0A 3ZSIA 5L2IA 3C13A 5AP1A 3TG1A 4XG7A 4EH7A 3WIKA 1PMVA 3HGKA 3PVBA 5HORA 3QKLA 3KREA 4QQJA 4AGDA 4JQEA 5H8GA 4FKTA 5ANDA 2QKRA 2PVMA 3P86A 4IAZA 4IMYA 4ZOGA 3VUHA 5CF6A 2QO9A 4EZ3A 3EQGA 4G3EA 3TNQB 3E8EA 4DFLA 3GUBA 2X9FA 3S00A 4HVIA 3SDJA 5ANGA 4IIRA 2PVRA 4BRXA 3JR1A 1WBVA 3W2SA 2AC3A 3FC2A 5CAQA 5I9XA 1XO2B 2QNJA 5C9CA 2HZ0A 3KXGA 4EK6A 5B2MA 4EJNA 2DS1A 3QZGA 3QLGA 3C4FA 4UYAA 1OUYA 3HZTA 3LFEA 4Y5QA 5JK3A 5EHLA 4D2SA 5I9VA 5K9IA 2WNTA 2XJ1A 3HL7A 4EH5A 5I4NA 1BUHA 3EQPA 3LXLA 4M97A 3QRTA 3R9RA 5M53A 2Z02A 2EWAA 4CV8A 4TYJA 4NU1A 4QMMA 4RSSA 2GMXA 4WNKA 3SQQA 3UO5A 4ZZOA 1ZYCA 4GW8A 4PDPA 3F5UA 5EOBA
chains in the Genus database with same CATH superfamily
2UZNA 4FV8A 5F95A 3PG3A 3VW8A 2NNWB 3F2NA 4L8MA 2ITVA 4FTCA 3VBXA 5HTCA 3PJCA 4RX8A 3SVVA 5GIOE 1MRUA 3QYZA 4K8AA 4QRCA 2FYSA 2PZ5A 3WOWA 5CNNA 3D5VA 4R1VA 4XHKB 3MFTA 4U79A 3SA0A 4O81A 4FSTA 3HEGA 4BI2A 2JKOA 1X8BA 2OIQA 4FT3A 2R3FA 4RBLA 4EQCA 2CGUA 5CSVA 3IECA 4FV9A 3AG9A 4L3JA 3AOXA 1GIIA 2GHGA 2YAKA 4IVDA 4ZTMA 3I7BA 4EH4A 1UWJA 1M17A 4F7NA 3B8QA 4USFA 4MWIA 1T45A 2O65A 3EFLA 3H30A 1OMWA 4XRLA 3DA6A 1P4OA 4C59A 4CTCA 3BV2A 2UW7A 4YBJA 3Q53A 1PXKA 3AC4A 4L01A 4NYEA 5HE3A 5CANA 2ITTA 2WTKB 4YJPA 4IZAA 4BF2A 3RAKA 2HWPA 4Z16A 1J3HA 1I09A 5AV4A 3C0GA 1H08A 3P7BA 5CXHA 4RWLA 4AX8A 4DFXE 3QD3A 4ZLYA 4FSWA 4O0UA 4IZ5A 4LOPA 3FYKX 4CKJA 3DZOA 2YISA 4GU6A 4R7IA 4JI9A 4FKVA 4KKGA 2XF0A 4BCFA 1BL6A 4L67A 3MH0A 2UZUE 4CTBA 4EH8A 3E3PA 3O2MA 4U0IA 3DNEA 3UOLA 4MXYA 4Q9SA 3WZJA 2G9XA 3VJOA 4EK5A 4FTTA 4HNIA 3HMIA 1ST0A 2UZDA 3CC6A 2PZYA 3R21A 5EYKA 4CLIA 3U6IA 3TYKA 4TNBA 3TDWA 4CFVA 4X3JA 3VHEA 5LCJA 4GJ2A 4D4VA 4K0YA 3CJGA 4QO9A 4AXEA 2OI4X 1PYEA 2FB8A 3LXNA 4JR3A 3TNWA 3UPZA 4QYFA 5CSXA 1NVQA 4JX3A 4KIOA 3GU7A 2UW0A 2R0UA 5B0XA 3V5WA 4E5AX 2OJFE 4EEVA 4AXDA 3I0QA 3VUGA 2C3KA 2WFYA 4QTBA 4EONA 3AMYA 4ID7A 3VS1A 2C47A 1H1PA 2OXXA 2BHEA 2ZV9A 3CBLA 3ZRMA 3U4UA 1WFCA 2HAKA 3OOMA 2Z7LA 2Z7RA 2ZMDA 3LQ8A 3UZTA 4IJPA 4GEOA 1V0OA 1YDRE 2PE1A 2XK4A 3BLRA 2CCIA 1KOAA 3QD0A 4X3FA 1WVYA 5CEIA 1OECA 4WNOA 2VX1A 4IW0A 2YM6A 5IA2A 2QOIA 5F20A 5LXMA 1MP8A 3K5VA 2QC6A 3KFAA 5HCZA 3NYVA 4XG2A 4I4EA 4P7EA 4QYEA 1BLXA 5A4LA 4M8TA 4MX9A 5CEKA 2V7AA 5J87A 3UDTA 5EW3A 1OGYA 2PUUA 1G8AA 3DKGA 4E6CA 4MXAA 1OKWA 2W1ZA 2OU7A 5HG5A 3MH2A 4RVMA 3D7TA 1YDTE 2PY3A 4IFGA 3PZHA 3NGAA 3F61A 5IUIA 3BCEA 1F5QA 3TMOA 4JL9A 3ZXTA 4DBXA 2JBOA 2BZJA 4HNFA 4DTKA 3VQUA 4BDAA 3B2WA 4FIEA 4LGHA 4IWPA 1ZXEA 2ZM4A 3PXKA 4PMSA 4XP2A 3ULIA 2E9NA 4AOJA 4EUTA 5IQFA 4NW5A 4E7WA 3CTQA 3V8SA 3OCTA 5ANOA 4EUUA 3TCPA 4OTQA 2W1HA 4EJ7A 2HXLA 5HLPA 4JAIA 5HG7A 4X2KA 3DBFA 3A62A 2Y4PA 5BYYA 1PY5A 2CKEA 2WELA 4I4FA 4PP7A 4GUBA 3EJ1A 3ZO2A 4JDHA 5KMKA 2ACXA 2W1DA 4AZSA 2BTRA 4OTIA 3V3VA 3I6WA 3QTZA 4IB3A 5T6KA 4RVKA 3MTFA 4S32A 3F5XA 2X6DA 4R5SA 1J7UA 1YW2A 4FE2A 2Z7QA 3O96A 5HIDA 3RTPA 1M7QA 3AC2A 3IDPA 4FV3A 3KL8A 3FLZA 4TXCA 3R1QA 2WKMA 4TYHA 4ACDA 5E8TA 3TT0A 1YWRA 3Q04A 4MWHA 5E8YA 1XQZA 2BZIB 3ZBFA 2BDWA 5HE1A 4U6RA 4KKEA 5AV0A 1JOWB 2VZ6A 4FJVA 5GJFA 3PXRA 3HAMA 3GU5A 3NYXA 1OL5A 1KUTA 5DT0A 5JN2A 4D55A 5CU4A 4BCOA 4H3QA 4TYIA 5HCYA 3O7LD 1PXOA 3RCJA 4WHZA 2NYAA 5DN3A 4X0MA 2XBAA 4DCEA 3C51A 4BDIA 4KAOA 5E90A 5JEBA 5BYLA 1ZY5A 4O0YA 3HMNA 2WMBA 4H05A 5BVDA 4ZZNA 2C5XA 1U4DA 2A19B 2VTRA 5DPVA 4LRKA 2IW9A 4R3PA 5C1QB 1R3CA 4A4OA 3DV3A 3DZQA 2RG6A 4MNEA 2WD1A 4NFNA 2CHLA 5AP3A 1XH5A 4QYGA 2YACA 2QKWB 3F3VA 5DGZA 4I1ZA 2Y7JA 2JGZA 4AQCA 4D5KA 1O9UA 3ORMA 2CGWA 2CNVA 3LFCA 2OG8A 3NEWA 3BYOA 2HZ4A 5EI8A 3RAHA 3W8QA 4BZDA 4C37A 5KKRB 4I0TA 1PF8A 2Y4IC 1XH6A 5JRSA 4CFMA 1ATPE 3PA5A 3PLSA 3W2CA 3DXQA 3CY2A 3QXOA 2B54A 2FSOX 3FDNA 1B6CB 3Q96A 2W06A 3H9FA 2OZAA 4RA5A 3L9NA 4JG7A 2VTLA 3WF8A 3WF6A 1J7LA 1O6YA 1PJKA 3R7EA 3OT3A 2G15A 3FKLA 2Z60A 3MVJA 2E9PA 1HOWA 2CN8A 2E9OA 2PMIA 4JG8A 4AXFA 4BB4A 2WQMA 1W98A 3CTHA 3SAYA 5JFSA 1MRVA 3BHTA 2W05A 4BJJA 5KZIA 4FV6A 4A4LA 4BVUA 3MS9A 4BIDA 4ZLOA 2C3LA 1WZYA 5ETIA 3CEKA 4QMLA 3OWKA 2A27A 3WF7A 4PX6A 5J1WA 4CFUA 2CN5A 5HVKA 2YCRA 3OUKA 2JKKA 3A4PA 4AXAA 2XUUA 4IWQA 2JIVA 3LCOA 3FL4A 1JVPP 3TNPC 2ZYBA 4X2NA 2YERA 5BV3A 4OT6A 1URCA 2ETMA 2XRUA 4X3FB 3UDSA 3C4CA 2RIOA 5KUPA 4NJ3A 3TDVA 2GU8A 5KBRA 3A8XA 3COKA 3FV8A 3RK9A 4RRVA 3W10A 1SMHA 3W0SA 2EUFB 3SG9A 4C4IA 1JKTA 1OBGA 4MQ2A 3TV6A 1CMKE 4HVHA 5ANJA 5KMLA 5L8JA 3JUHA 2IN6A 4O7TA 4BHNA 3KXNA 3I4BA 2OIDA 2A1AB 3R0TA 1ZWSA 1YXXA 4S33A 3VVHA 3P5JC 4J52A 4MXCA 3W0MA 4BKJA 1U59A 3IONA 2B9JA 1SNXA 4NM3A 2XS0A 3RPOA 4H1JA 4IM3A 3VHKA 5ICPA 3CGFA 2X6EA 3UOJA 4EOKA 3FEGA 4APCA 3D7TB 2YM3A 5H3QA 3UIUA 4G3DA 4DLJA 3F3ZA 3TXOA 4BZOA 1YXSA 1BL7A 4W4VA 3VNTA 5C03A 4E5WA 2W17A 4L3LA 5AUZA 4K9YA 3W55A 4PWNA 4UWCA 5AP2A 2PZIA 4TY1A 5JFWA 5L2IA 1FVRA 1KV1A 3EQCA 4FG7A 2VV9A 5CVHA 5HO8A 4DH1A 3DBCA 5HESA 5JGDA 4U98A 3MW1A 5FD2A 4IANA 1URWA 3BYSA 5M4UA 1YI4A 5EDPA 3NIEA 5CI6A 5E8SA 4RLKA 4IADA 4YGAA 1WVWA 5E1SA 3ID6C 4PDYA 4O0SA 4XV3A 5FP5A 2ZVAA 4YR8A 5CAOA 2VTNA 3UOHA 3VN9A 5JGBA 3E92A 4F6WA 3MB7A 4JG6A 4Y72A 3EYGA 3MYGA 4GYGA 4CFNA 3BWJA 3I6UA 5EOLA 4ZTRA 3SX9A 3PLAE 3TKUA 1BKXA 4JQ8A 4L00A 1QPCA 3BU3A 5JRQA 4I93A 2ZM3A 3UVQA 1LEWA 2H6DA 3QGWA 1PXNA 3RPSA 3F7WA 3LAUA 1Q41A 4AFEA 3G15A 3ANQA 3C9WA 4WD5A 3E64A 1BI8A 3T9IA 2PZPA 1VR2A 4U94A 4DEBA 3KEXA 2O64A 2RKUA 2X4ZA 4TYHB 2F9GA 5DE2A 1Y6AA 4H36A 3VS7A 2AYPA 2VTJA 3PY1A 2JKMA 2C5YA 4KA3A 4XLIA 4MBIA 4QTEA 5IEXA 2ITOA 3PVWA 2VWIA 3KCKA 3G9NA 4WG4A 3DJ7A 3V01A 4HZSA 4N6ZA 2OJGA 2PVJA 3KIOC 4ZP5A 2P4IA 2WQBA 3QCYA 4CRLA 2XARA 4GK3A 5HBJA 1RQQA 2QOHA 4IDTA 5E8XA 2KTYA 2BMCA 2VRXA 4ASEA 2XALA 4QMSA 4ZLZA 2YFXA 3GCVA 3LMHA 4FTNA 3DT1A 4DTAA 2XAMA 4OTWA 3UYSA 5DNRA 5IQEA 1XWSA 3UYTA 4F9AA 4YTFA 3OUNB 1QL6A 2BCJA 4JNWA 2IVSA 3SW4A 4I6LA 3MY1A 1Q62A 1W84A 1YWNA 2C6MA 3V5LA 4UN0C 2R64A 4PTGA 4RX5A 5EQPA 2WTKC 3CY3A 4MNEB 3RHKA 2C1AA 3UGCA 4D0XA 2IO6A 3OP5A 2PUIA 3POOA 4H3PA 5LMAA 1F0QA 3QL8A 3SG8A 3UVPA 2WZJA 3CGOA 3P7CA 1XH9A 4BGGA 2F2CB 2OICA 3DNDA 2JDVA 4WBBB 3JVSA 5G6VA 2G2FA 2R3OA 5HVJA 3SOCA 2F7ZE 3ZZWA 4ANLA 4DEEA 3I7CA 2ZB0A 3LFDA 4DFUA 4JLCA 4I6BA 1Q97A 3V51A 3PSCA 2QO2A 4ANBA 5HNGA 1JBPE 5JGAA 2C5VA 4FR4A 2VO3A 4FYNA 4D0WA 5IDPA 4MK0A 3U51A 2OZAB 3CKXA 1WBPA 4KWPA 3UOKA 3E7VA 3P1AA 1CKPA 4NCTC 3Q4UA 1AGWA 4YJVA 2XKEA 2R3LA 1H1QA 2UV2A 2C6DA 4BIEA 2EXMA 2FSTX 4DH5A 4TL0A 5CI7A 2JC6A 1K9AA 1PMNA 2WQOA 3BQRA 3D9VA 3ETAA 4G3GA 1R0PA 3LCTA 3EWHA 4PL3A 3JY9A 4CFWA 4HGEA 3ALNA 1OL6A 3JS2A 3WZEA 3NFFB 4QMYA 4R3RA 4RA4A 2YZAA 3CKWA 5IQBA 3QRIA 4QT1A 3FPQA 3VUDA 4XV9A 4BI1A 4DA5A 3ALOA 3FZ1A 4XS2A 1G5SA 1KSWA 3QUPA 3ZO1A 4FSUA 2G01A 4EKLA 1QPDA 5FDPA 3EN5A 5KE0A 5CSWA 3ZLWA 5M09A 4XP0A 4M15A 2W99B 1W8CA 3FI4A 5GJDA 3RINA 4JMQA 4V0GB 3ZMMA 2BPMA 2PMOX 2YM5A 2DUVA 3LFBA 1Q8YA 1Q99A 1OGUA 1WVXA 3QQUA 3QU0A 3I81A 4MUQA 4RC3A 4C3PA 3TACA 3EQBA 2XIZA 3R1NA 1E9HA 4E5BA 2E9VA 2HXQA 3LJ1A 5I9ZA 3ORZA 3OOGA 4L68A 3OY3A 4OBQA 4D2RA 4QQTA 3LCDA 3DK6A 4FNZA 4KUJA 3R7UA 4FA2A 3F7ZA 4H39A 2QOLA 3CS9A 3UC4A 2A4LA 4AXCA 3Q2MA 1GZKA 5IPJA 2I0EA 3LM0A 1KOBA 2ITUA 4IZ7A 1VJYA 3PUFC 5E9EA 2XAOA 4R7BA 5AUYA 3ENMA 1ZYJA 2UW5A 2ITNA 3RPRA 4F7SA 4F4PA 4YJOA 5HI2A 3NVMB 3WE8A 4ZK5A 3W1FA 2XEZA 4DHIB 3WZDA 3AD4A 3FXWA 4U44A 2AEGA 2XM9A 4F9BA 2XJ0A 2YDIA 3PPKA 1BYGA 5AP0A 3F66A 3LOKA 4JVGA 4KBKA 4ACGA 4AN2A 2PVFA 2UW9A 4YPSA 5M4FA 2P2HA 2PULA 3DK3A 4TYEA 2QG7A 3FMEA 4RIOA 4N4SA 4DHFA 5JMSA 1JSVA 5FM3A 4NSTA 3OXTA 2ZDTA 4YTIA 4KSQA 3V6SA 4LOOA 2VTQA 5HIEA 2PK9A 4U81A 1PHKA 4U3ZA 3FY2A 4O7RA 3BHVA 3UMWA 4E4LA 3LQ5A 3PG1A 4LI5A 2IW6A 2YIYA 4O7PA 1PXPA 5CQUA 5FQDC 3IDCA 4RG0A 4NZWB 3NNXA 4RQKA 5CLPA 3T8OA 4EOLA 2UUEA 4W4XA 5DOSA 5DRBA 4IC8A 3WE4A 4YLJA 1FPUA 5CAVA 1B38A 3F2RA 3QZHA 5C27A 4MD8E 4NT4A 4J99A 4C58A 5AADA 2X4FA 4F9YA 3U4WA 2EB3A 1KWPA 3D0EA 4I6FA 2RG5A 3BI6A 5DRDA 3PJ1A 1OITA 3FMLA 4FTQA 1LEZA 1RE8A 3NCGA 1OKYA 3FSKA 3G51A 3GI3A 4PF4A 5BVFA 5CZHA 2SRCA 3L8SA 4I0RA 3C50A 3OROA 1VZOA 4WZYA 2V0DA 2W1FA 2JIUA 3RKBA 2OGVA 4IX5A 4MTAA 3LFFA 4NKSA 3TKIA 4W4YA 3KF4A 4HGTA 3WF5A 4FIHA 3R30A 4I5PA 3UC3A 4OTDA 4FUYA 1JSTA 4I3ZA 3V8TA 1OUKA 2QOCA 3IG7A 4JR7A 1T46A 3WILA 4RIYA 3QLFA 3A7JA 2X81A 5LMKC 3FLWA 4O7VA 4OBOA 2WEIA 1LP4A 4HYSA 5KKRC 1Y91A 2V7OA 1Z5MA 4EYMA 5AFVA 2W4OA 1YHWA 4F1TA 4ASXA 4U80A 3VS2A 4EK3A 3AD5A 4EZ7A 2QODA 3FMKA 3QTXA 4EQMA 2F7XE 2XNMA 3AKJA 4JBOA 1HCKA 3CXWA 3I79A 4AA0A 2C6IA 4F1OA 1WBWA 2JDRA 4FOBA 2EU9A 3C7QA 3HA8A 4RC2A 3PA4A 3LXKA 3SKCA 3NW6A 5F1ZA 2VWUA 3MVMA 1BMKA 4FEVA 5D7AA 5AEPA 4C2WA 3MA3A 5A4EA 3TTIA 2HENA 3S1HA 3N9XA 4YJQA 4EHZA 3KXHA 3FY0A 4DFZE 3R1SA 4D5HA 3M11A 3TUCA 1Q4LA 2GNIA 2HK5A 2WMWA 3FZRA 5LWMA 4ZEGA 1JKKA 1ND4A 4AG8A 4DFYA 4E1ZA 4BN1A 3TUBA 3ZEPA 3EL8A 3GC7A 5L8KA 3Q52A 2ETKA 2XIXA 3H10A 2GNJA 4RVTA 3CSVA 4DH7A 2W5HA 2H9VA 3O17A 2IJMA 1G3NA 4J71A 4QDVA 2J90A 2FSLX 2VTHA 5CF5A 2B9IA 4AA4A 3QD2B 3LLTA 4IM2A 4X3FC 3QBNA 3PDTA 3Q4ZA 4U9AA 4BGHA 2WTJA 5AP7A 3GXLA 3EFWA 1SZMA 5FRIA 3MFUA 3BU5A 4AN3A 3E93A 1IAHA 4P4CA 4XX9A 3O8UA 2QCSA 4FSNA 1XR1A 2F49A 4JQ7A 4KNBA 4P5QA 3SRVA 4AT4A 5FM2A 1YKRA 1OIYA 4QP7A 1KE5A 4CG8A 5IF1A 4D58A 3OD6X 4ERWA 2RFDA 5KMOA 5H8BA 3DCVA 3EIDA 2G1TA 2XJ2A 2I7QA 3CPBA 1JQHA 4FBXA 1H1WA 4J7BA 3RM7A 2B4SB 3MV5A 1EH4A 3F9NA 4I94A 3ZOSA 3TUDA 2WTVA 4FZ7A 4QMPA 5IZFA 4DLIA 2GNFA 3THBA 4YZCA 3TZ8A 5IH4A 5M57A 2J0KA 4FTOA 3R8MA 1OPKA 3KN6A 4LL5A 1OPJA 5AAGA 2WIHA 5J8IA 3QTSA 2QQ7A 5IMXA 3EQRA 3KU2A 4KBAA 4EZ5A 2CNUA 3V8WA 3HUBA 5TF9A 5LWNA 3ZUTA 4RQVA 3U8WA 2X9EA 2X8EA 2XBJA 2Y6MA 4BCIA 1R39A 3PE1A 4GKIA 4O86A 3QRKA 4YZBA 4B8MA 2UW3A 2DWBA 4BCMA 4JDKA 4BYJA 4NK9A 5C8MA 5DFPA 4XJ0A 4IDVA 2R3GA 5E7RA 4E20A 4KRDA 4ANQA 3HV6A 2HELA 3NRMA 4LUEA 5AWMA 3M42A 3DQXA 3OG7A 1NW1A 2OIBA 3PA3A 3NW7A 5C01A 3ZBXA 3ZYAA 4AWIA 2XKDA 1YXUA 2B53A 3G90X 5I9WA 5L2TA 3C4WA 3CE3A 4PNKA 2R5TA 3U6JA 5J7HA 1F3MC 4FYOA 2YDKA 3HX4A 3ORLA 2BFXA 3DBEA 4UALA 4GSBA 4ACCA 3SGCA 1U5RA 3PTGA 4FICA 3NUSA 5BX0A 3FBVA 3GQLA 4BDKA 4LDTA 4E26A 1CTPE 4I22A 2I0VA 2R4BA 3OVVA 3F6XA 2C5OA 4QQ5A 2H96A 2NO3A 4FTKA 3A7FA 3BGZA 5H8EA 1FVTA 5HE2A 3R8LA 5LMBA 4DC2A 1E1VA 4B4LA 2C5NA 3FHIA 4WIHA 4G34A 5EW8A 5A6NA 2R3RA 3FMJA 3OF0A 3P0MA 4JIKA 5EDQA 2ZV2A 1LUFA 2VAGA 5AUVA 2OSCA 4WG5A 4FV1A 3PFYA 3TZMA 2NPQA 3ZUVA 3OW4A 5HO7A 3DAJA 3FQSA 2QD9A 4JXFA 5IQAA 1E1XA 4C3FA 3PSBA 1NY3A 5LVMA 2F2UA 4O0WA 5D7VA 2G2HA 1OBDA 4TW9A 2WTDA 3BQCA 4G5PA 4GIHA 2QOQA 2BHHA 1H07A 4U8ZA 4AZTA 4XV2A 5J9ZA 3PXZA 4LRMA 3WF9A 4MCVA 3BELA 1YXVA 4I6QA 2GNGA 3ATSA 4IM0A 4DH8A 4FEWA 5BUJA 1SNUA 3CP9A 3QRJA 4O7YA 3R9OA 4ZAUA 1ZOGA 4HPTE 5BYZA 3PPZA 3FPMA 2HZNA 3ZSHA 4GVJA 2R3KA 1PKGA 4GJ3A 3OCGA 4U40A 4G9CA 4BTMA 4YMJA 1CDKA 3GVUA 3VS5A 4BHZA 4PY1A 3R7YA 3RHXA 2B7AA 3QAME 4G6OA 1Z9XA 4PL5A 5FP6A 4AW5A 3E8DA 1CKIA 2UZOA 4OLIA 2XYUA 2XNPA 3TV7A 4YJSA 3LFNA 5D9HA 4OBPA 4RJ8A 3DTCA 5HVYA 2RL5A 3VUMA 2ZJWA 2PVNA 2YM8A 2HOGA 5EH0A 5IH5A 4DYMA 3POZA 5FBNC 3KKVA 4PRJA 5JFVA 3NNVA 4O83A 4PDSA 4C7TA 3DKFA 4ITHA 4QNAA 4XH6A 5JQ8A 2YHVA 2QOBA 4WSYA 1PXLA 3IW8A 4V05A 3GBZA 4E6AA 4FX3A 1ZMUA 3DFAA 5IQHA 2B0QA 5GIPE 2XCHA 3TNHA 2UW8A 4JT3A 4YHFA 4CCBA 3G6GA 3HMOA 4GG5A 2GTMA 4M13A 4KIPA 3O51A 4IACA 4JRNA 4ANMA 4F9CA 3Q5IA 4UEUA 3LE6A 3ZHPC 4B9DA 1H00A 3W0OA 4CCUA 3W18A 4QTCA 4AE9A 4A07A 4XG4A 2R2PA 4YHTA 4DG2E 4CEGA 2JAVA 3Q9YA 4BYIA 5ANKA 4C4JA 5IEVA 2J6MA 4D4YA 3HAVA 2V5QA 3RZBA 5BPYA 2J2IB 2REIA 2VU3A 2DQ7X 1IASA 4TWCA 4JBQA 3SRVB 5EYCA 4ZJJA 5J95A 4E73A 3QA8A 4PTEA 4RFZA 5LVLA 4RJ5A 2P33A 3IS5A 2I1MA 4M14A 3TEIA 3BL7A 4DCAA 3EN7A 2PTKA 3DJ5A 4I0SA 4C34A 4E4XA 4MXZA 4ITJA 3TIYA 1H25A 5FTQA 3S3IA 5IA1A 3WI6A 3QHRA 2YWPA 4FSQA 4YJUA 4FIJA 2YITA 2QHNA 3DB8A 3WYXA 4HVGA 4EOIA 1XMMA 3O7LB 3AKLA 5E1EA 5BVEA 4ASZA 1XKKA 2Q83A 4DEIA 2KULA 4OTRA 3UBDA 3OWLA 5HU3A 5M55A 5E8UA 3RM6A 1YHSA 2PUPA 1XMLA 2W1GA 4BBEA 2J7TA 3KY2A 2QU6A 2YIWA 3RPVA 1J7IA 4U43A 3QZFA 5DYJA 3QX2A 3BE9A 1OL1A 2JLDA 3OWJA 2A0CX 4L42A 5DI1A 5GHVA 4C0TA 4Q9ZA 3EFKA 4DF3A 4AW0A 4FV0A 4AW2A 4KABA 3R2BA 4X2FA 4A7CA 3ET7A 2XKFA 3NNUA 4WKQA 2X2LA 3NZ0A 5HKMA 1W7HA 4O7LA 5FLFA 4AT5A 3C5UA 3F3TA 4H58A 4EQUA 1PMEA 1WBNA 2CPKE 2GNLA 2O8YA 1H1SA 2CGXA 2WMUA 4FSZA 3ZM9A 4FMQA 2QLQA 2C6TA 3OWPA 5FG8A 4AN9A 3QTUA 2OXDA 5AAFA 4B6LA 3ENHA 1O6KA 4L52A 3CIKA 3FKOA 4DGNA 2WTWA 3OFMA 1RDQE 1REKA 4FGBA 4YZDA 1TQIA 4RIXA 4BCKA 3EN4A 5CEOA 5EYDA 3V5PA 4FKQA 4YSMA 4FKRA 3PIYA 5AP6A 3OEFX 5M4IA 4HGSA 4TT7A 4EYJA 4LRJA 4UXLA 1A9UA 3EQIA 2ESMA 2VO6A 3Q60A 4FZ6A 3I0OA 4RPVA 1OZ1A 1ZLTA 3ZZEA 4ZS0A 2QI8A 4HJOA 1BI7A 3EN9A 5FTOA 3CCNA 4ZS4A 1IA9A 4WNPA 4YJNA 4FEXA 4GK4A 3BWFA 4ZTHA 3EMGA 2WMSA 1SYKA 3GFEA 5DVRA 3UTOA 4A9UA 1TQMA 4C4EA 4DGLC 5IH6A 1R1WA 2B9FA 1PKDA 1XBAA 3RWQA 3SC1A 2ITZA 4NWMA 3FZOA 4U97A 1IEPA 3HA6A 3L9LA 4OTFA 4EK8A 4J96A 3M2WA 4LMUA 3ACKA 3KF7A 4MD7E 5LVOA 2QONA 4M0ZA 2JDSA 4FKGA 1Q5KA 4DN5A 3Q32A 4F0GA 2WU7A 1OIQA 3FZPA 3QFVA 4GRBA 3D5UA 3Q3BA 2YA9A 3FYJX 1DAWA 4FK6A 3EZRA 2OWBA 3K3IA 4FZDB 4ORKA 5AX9A 5CEMA 4IB1A 3F3UA 4AQKA 2ZB1A 4RLLA 3NUAA 3V5JA 5LQFA 1GZOA 4F09A 3QQLA 4G3FA 5FUTA 4AACA 4DEHA 2WGJA 4BDCA 2Q0BA 2WTIA 3O23A 5LARA 3O50A 4ZTNA 4BBFA 4ENXA 1XJDA 2OH4A 2QURA 4IQ6A 3R8ZA 2PL0A 2ITYA 3BLHA 3KRLA 1Y6BA 4QMVA 5A14A 3HV3A 1V0BA 2YEXA 4G31A 2QOFA 3ROYA 4BR3A 4QDEA 3NAXA 4WA9A 2CLQA 2ONLC 3IW5A 3MDYA 1ZYDA 3G33A 3E8NA 4PMTA 4BI0A 5D10A 1Q8UA 2YIQA 1Y8YA 4Y83A 2NP8A 3QUDA 5CZIA 4F7JA 2J0MB 4XBRA 3QTRA 3MFSA 4O22A 3ZONA 3NCZA 1GZNA 4GFMA 2BRGA 4AZWA 4FTMA 4HYUA 4S30A 2R7IA 3TZ7A 3BEGA 4NIFB 3FMHA 2UW4A 1K3AA 4YHJA 3VS3A 4MF1A 4ZTLA 2AUHA 3DBQA 3BYVA 4X2GA 4X21A 1Q8WA 3N4VA 3AD6A 2IG7A 2XA4A 2XCKA 1YDSE 4YLLA 3OMVA 3QZIA 5JH6A 3IW4A 5HQ0A 1P5EA 4R5YA 3GB2A 3FZSA 1H0WA 5TO8A 5EHYA 3VAPA 4FVPA 2J0LA 2CDZA 3KCFA 3AMBA 5K5NA 1G8SA 1PRYA 1RJBA 4FVRA 1FBNA 2NRYA 3D5WA 3FMMA 5CYIA 2P0CA 4DFNA 3D4QA 4I5HA 4Y85A 1YHVA 4L9IA 5DIAA 1ZAOA 2O3PA 4FNWA 2VTTA 3UG2A 3ZRLA 3R7IA 2JD5A 2X0GA 5HTBA 4KSPA 5J9YA 3CQEA 1TQPA 4LUDA 3U9NA 3GCUA 4A9SA 1ZZ2A 5DG5A 4FV2A 4GT4A 4N57A 4LYNA 3LCKA 5IA4A 3CPCA 1OIUA 4L45A 3LHJA 4MEDA 5HX6A 2BKKA 3A7HA 4USEA 3C4XA 2XNGA 3FLNC 4ZY5A 3N4TA 4TKSA 1Q3WA 5AIKA 4FEQA 2X7FA 5C26A 3UIMA 4BCGA 4IX4A 4EL9A 3E7OA 3Q4TA 4L53A 2XK3A 3H0YA 3UIBA 1P14A 4GH2A 5EHOA 5TT7A 5ACKA 3DAEA 3P23A 1YQJA 4WO5A 1FVVA 2Y8OA 4AAAA 1QMZA 3QA0A 4DDGA 4Z7GA 5BNJA 3FC1X 4AAYA 1XBCA 2VO0A 3DU8A 3PUPA 3C4ZA 2ITPA 3ZDUA 4BCQA 2PE0A 4PP9A 3E63A 5EYMA 3MVLA 4G5JA 4WBOA 4ZMFA 4XNEA 4IX6A 4BTFA 4CZTA 2BALA 3VC4A 3LPBA 5DEYA 4C38A 4NTSA 1P2AA 4RIXB 4ZSAA 1OIRA 3C1XA 3OS3A 3PFQA 4XEYA 4BDEA 1W0XC 3PZEA 3QWJA 3BX5A 3VQHA 3MH1A 1Q8TA 5HBHA 2BIKB 3OEZA 5CSPA 1STCE 4DAWA 3EL7A 2UW6A 3UDZA 3QTWA 4HPUE 4UZDA 3L1SA 3SLSA 2FO0A 4DEAA 2JDTA 4FKWA 2VNWA 2J51A 3AC1A 1UKHA 4TN6A 4ZXTA 3UJGA 2PZRA 4QEBA 3H3CA 2C4GA 3KRXA 5CTPA 3UE4A 4I24A 4JS8A 3ZM4A 4DEGA 3PVUA 5A46A 3ANRA 2O5KA 3PWYA 5HD7A 4YC6A 4HZRA 4EORA 1APME