4FEWA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor pyrazolopyrimidine pp2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
266
structure length
266
Chain Sequence
RETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 77
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fewA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4fewA02
1YXVA 4AT5A 1PXLA 3KXZA 5JSMA 4RWJA 4I93A 3SW4A 4TWCA 2WXVA 3NVKI 3RTPA 2VTAA 2YHVA 2FUMA 3NEWA 2QI8A 3UODA 2GFCA 2X6DA 5E8XA 2CN8A 1MUOA 3NUXA 4YZCA 4JX3A 4XP0A 3PXZA 5DT4A 1ND4A 3CCNA 4TWOA 4E5AX 4HVSA 4AN2A 3PPJA 4PTEA 3A7JA 2FSOX 3FZRA 3KULB 4AE6A 2HXLA 3ODZX 3SRVB 3WYYA 4YO4A 2P55A 2C1BA 1YHVA 3LXNA 4CSVA 4XBUA 4FT3A 3KCKA 2C6KA 5AV4A 5AIRA 1DM2A 3W2CA 5IUHA 2VTTA 5L2WA 3F66A 2VTMA 3COKA 3KXMA 4EH8A 5FXSA 4RLLA 5HG5A 4QP8A 1YDTE 3QBNA 2FO0A 4IBMA 3R9OA 4RA4A 3FZTA 4BCFA 4EOPA 4APPA 1P5EA 4XRLA 3QQHA 5TR6A 4DFNA 2XJ0A 3VUHA 3FKLA 3LLAA 4DFYA 4OBOA 3BYMA 5E4HA 2PVKA 4FE2A 4QP9A 4JQ7A 4YC6A 5ETAA 5M55A 2FSMX 4EYMA 3WBLA 4QP4A 5IQGA 2BTRA 3PXQA 3ZYAA 2JDOA 3ZHPC 4X3FB 2WQMA 3E88A 1W7HA 3LVPA 3KXNA 4AW5A 3ALOA 3OY1A 2YM5A 3LAUA 1FVTA 2W17A 1R0EA 3NCGA 3OS3A 4J98A 4QMYA 4KD1A 4Y83A 4RX7A 5B2MA 1UU3A 3E7VA 3QFVA 3ZM9A 1PXNA 1WFCA 3UZPA 3PIXA 3EFLA 4RSSA 1BI7A 4QTCA 3BWFA 5HX8A 3QHRA 3K54A 4XNEA 3U6IA 2PVNA 4OGRA 2W4OA 4RZWA 2C6LA 3W55A 4C37A 3RM6A 3QQKA 3MH2A 3UVQA 2BIYA 1BI8A 2YDKA 4IB1A 4QYYA 5D7VA 3W18A 4DT9A 4KBAA 4EONA 4FTTA 3Q9WA 1CM8A 4RWKA 2VU3A 3TTJA 3UZRA 5LMAA 4EH5A 5J9ZA 1GOLA 2J50A 2VX1A 3U87A 2IJMA 4XRJA 2XK3A 3UTOA 4WHZA 4TYIA 3FY0A 3NUYA 3TNPC 5IH4A 1KOBA 3LOKA 5KHWA 5M57A 4MVFA 3RHKA 4I92A 3C4WA 2GTMA 2QOHA 2V0DA 3R28A 4QMPA 4ZY6A 2ZDTA 5A4LA 2B54A 4LOPA 4XG8A 3LFEA 3W0SA 3F7WA 5CEPA 3IW7A 3HV6A 3QLFA 2B7AA 2F9GA 2WAJA 3R1YA 2IW6A 3C4ZA 1HCKA 4LG4A 3V01A 2DYLA 3BU5A 4HVIA 1ZMWA 4E6AA 3W0NA 4X6RA 4OTGA 4A4OA 4Y73A 3HMMA 3VVHA 3UIBA 4O84A 3O0GA 4R3RA 5DEWA 4D9UA 4CEGA 3MN3A 1PJKA 3ORIA 4JDJA 1PXPA 4FKUA 2YWPA 2EXCX 5CSWA 3B2TA 3PLSA 5LVLA 1SNXA 3G9NA 4NT4A 3UNJA 1G8SA 1H8FA 4J71A 4DEEA 4L3JA 3OXIA 3N4VA 2ITYA 4MK0A 1YRPA 3FV8A 4H1MA 4HVHA 3BHHA 3CQUA 3M42A 2R3OA 2I6LA 4ZTNA 4AOJA 1Q8TA 4YUQA 4Y85A 3R01A 2I1MA 4JDHA 3NSZA 4I20A 4AN3A 4O86A 2JAVA 5BVWA 4EUTA 3UMXA 3BI6A 4OTDA 5ACBC 5DT0A 4NTTA 3MA6A 2A2AA 5L6OA 4G5PA 4S31A 3ODYX 1K9AA 3I4BA 3NW7A 3LCOA 3T3VA 3VULA 3QZIA 2RG5A 2WMTA 4LM5A 2VWUA 1PXJA 3N9XA 4FIEA 2WNTA 4FZFB 5FRIA 5I9ZA 5DT3A 5DR6A 5AX3A 5JFVA 4FTAA 4X3FC 2CCIA 3QCSA 3VHEA 3PSBA 1QPDA 2WMSA 3QGYA 2Y6MA 5AP3A 1ZYCA 3BE2A 2BDJA 4YNOA 4MNEA 5CI7A 5FTQA 4IACA 1O9UA 4FKTA 4D2RA 4MWHA 3F2AA 3MH1A 5DN3A 3KVXA 5CNOA 4FNWA 4BCOA 2BVAA 1WZYA 2XK4A 3BZ3A 4RC4A 2CKEA 3QC9A 4ZMEA 2BDWA 4HYUA 3EKKA 2B52A 3AT4A 2GHLA 4CZTA 4BY9E 3HP2A 4KA3A 4NM5A 5T3QA 5FEQA 1OKZA 3QTWA 4QP7A 3EL8A 5A4EA 2ZM4A 3MVMA 1WBWA 2VN9A 4IAYA 3KY2A 1FPUA 1NVSA 4AG8A 2Y4IC 5EI2A 1Q5KA 4RWIA 4BBMA 1XH5A 4PNKA 3I6WA 4IWQA 3R21A 2WQNA 3TI1A 2XUUA 4GVJA 2P3GX 1ZYDA 2XNEA 1QCFA 5CEOA 4DGGA 2HW6A 2W5AA 2F49A 4J8NA 4PY1A 3ANRA 4GT5A 3HNGA 3FY2A 4AGWA 3A7IA 1XBAA 4G6OA 3FSFA 3C5IA 5D10A 4N4SA 3NAXA 4ASDA 4KKEA 5LARA 4FV5A 3UIMA 1MP8A 3ELJA 5BMSA 4O7LA 2J5FA 3SG9A 4FTMA 4WRSA 2QQ7A 3NYXA 4E8AA 3C1XA 5CSXA 2AYPA 5BVNA 3R7IA 4IW0A 4MTAA 3R8LA 3V51A 2WTVA 4M14A 4BHNA 2C6EA 4MNFA 5CU2A 3ZCLA 5LCKA 4L44A 4DH7A 2XEYA 4QQ5A 5EG3A 4RX5A 3GC8A 3GI3A 1J7IA 4FSRA 3OCSA 3PPZA 3R0TA 3PVBA 1G8AA 3FMEA 2Y7JA 3SX9A 3A2CA 1Y6AA 3MBLA 3OT3A 3FLYA 4XG6A 3UQCA 1WCCA 3PE2A 3R9DA 3W1FA 3R7YA 3EQHA 4FYOA 3GC0A 4G16A 3DLZA 5HBEA 4BDFA 2OF2A 3VBYA 1RE8A 2PSQA 2XNNA 2WTDA 4U9AA 5DPVA 3U55A 2R3GA 2AC3A 4QMNA 2A1AB 3NW6A 5BUJA 4O21A 3EFWA 4FTRA 2RFEA 4O96A 4BDCA 4WRGA 3VJNA 4B4LA 3DB8A 3ULIA 1M2QA 3UIXA 4AGDA 3KL8A 5AFVA 5F1ZA 3HGKA 2OFUA 3I79A 4LL5A 3DFAA 3PDTA 3FMMA 4O81A 2QURA 3CSVA 5JEBA 1YDSE 1PKDA 3O23A 4ZTSA 3KC3A 1ZYJA 3PZEA 4JG7A 5IA5A 2VTJA 3R8PA 4A9UA 3ENHA 4K11A 3G9LX 4DTAA 2R0IA 3VUDA 4PMPA 2X1NA 3BKBA 1S9JA 4IVDA 4MQ2A 4FNXA 4ZS4A 1UVRA 2PZIA 3OXZA 4IB5A 4IX4A 4YBJA 3ZEWA 1XH7A 1WBPA 2BHEA 2PVFA 4IAAA 3DDPA 4C59A 5L2TA 3ROYA 4HW7A 3FI3A 4CFFA 4F08A 1ZMUA 2W4KA 5HIEA 3NR9A 3COIA 3TZ7A 3CC6A 5EM8A 5DA3A 4USFA 2VGPA 3LIJA 3E8CA 5LCJA 2H34A 4R1VA 3ZFXA 2IW8A 4UZDA 4FG7A 2XNBA 2XNMA 3AXWA 4IC7A 5M08A 4TXCA 3OUKA 3I0QA 4FV7A 2A0CX 1GZNA 3TZ9A 3BEGA 1GY3A 2WMAA 4H3BA 3K5VA 4MXYA 2B53A 4JBQA 3C4EA 4FV3A 2PY3A 3QHWA 2VWBA 3TYKA 5BVKA 5EQEA 3PIYA 4E5WA 3E3BX 4M67A 2FGIA 3I5NA 5DBXA 5BVDA 1ZY5A 5DFPA 4O91A 2UZEA 3ZC5A 3W2RA 2E9PA 4EZ5A 3PXFA 3R8ZA 5C26A 5H8GA 5A4CA 5C9CA 4EQUA 1VR2A 2RFSA 4XG2A 5E8WA 3UMWA 1IRKA 3PA4A 3PUPA 4F63A 3ZUTA 2UZNA 4LMNA 3U4UA 5A4QA 3PXKA 4IJPA 3JPVA 3NS9A 3CP9A 4RJ5A 4OTHA 1LP4A 2REIA 1YWVA 4AA5A 4W4VA 3O8UA 3FL4A 5JZJA 3EN6A 3PLAE 3ZLSA 4PL5A 4UY9A 1XH6A 4M12A 1OUKA 4WNPA 2DUVA 1R0PA 3IDCA 4OR5A 3EQIA 4TYJA 4O38A 1YXTA 5AA8A 4GCJA 3NCZA 2QO9A 1V1KA 2A19B 2VX0A 1UKHA 2J7TA 2W1CA 4S30A 5GIOE 2OK1A 2GMXA 3KA0A 4YC3A 1H1QA 1R39A 5HCXA 1W98A 3OROA 1H07A 4GYIA 3GCPA 4GKHA 3F5PA 3QKKA 2C5XA 4FZDB 4AZWA 4D58A 4ITIA 3IQ7A 4ZMFA 1J7UA 4PMSA 5CVFA 3ANQA 4UBAA 3ZC6A 4BCNA 5A14A 4GK3A 4L3LA 3BWJA 2IVUA 4BHZA 5C8NA 4TKSA 5CQUA 3W8LA 3QZFA 4U45A 3AD6A 1PYEA 3MSSA 4NJ3A 4AE9A 4K9YA 1PKGA 1H26A 4BDEA 4L8MA 5I9UA 3JS2A 4G1WA 4IHPA 3UOJA 1Q41A 3G6HA 5HO7A 5DGZA 3ZRMA 4AGCA 1JLUE 1PW2A 4JBPA 4WSYA 1JAMA 4J99A 1VEBA 2E9VA 3AC2A 4IB3A 3G33A 4TPTA 4XEYA 2CDZA 4ZTMA 5GINE 3QGWA 3ZSGA 3FAAA 2OG8A 3I6UA 5BYLA 3HMOA 5E9EA 4PL4A 2QOIA 2YABA 2ZYBA 5DE2A 5ANDA 5TF9A 3QD3A 4FEUA 2WZJA 4X2JA 3RGFA 5IUIA 4LMUA 3GT8A 3II5A 1BKXA 1UKIA 2YJSA 3UBDA 2IG7A 4EK6A 2YEXA 4GSBA 3OVVA 4AA0A 5JMSA 3U6HA 5E91A 4IB0A 4LFIA 2IZUA 4HPTE 4TN6A 5EDQA 4YPDA 2YACA 5EW9A 3F5UA 2XRWA 4X0MA 2PVJA 3A8XA 3AD5A 5KBQA 3K2LA 4S2ZA 3G0FA 2NRUA 4QMLA 2OF4A 5J9YA 2UZOA 2WMUA 2XM8A 2JDRA 3KMMA 2J9MA 3HV7A 3OWLA 2WIPA 3VUIA 2Z02A 2QO7A 3CQEA 2C5VA 4DFZE 2W9FB 4H36A 4AUAA 4ZZOA 2P2HA 5KX8A 4AS0A 3L8XA 3D2KA 4O7WA 4JBVA 5FEEA 3TL8A 2O8YA 3KF7A 3VW8A 4EZ7A 3QUEA 4DITA 3R9NA 4RFMA 4EH9A 2XK9A 3ZH8A 4YHJA 4ZY5A 3UOLA 2I0YA 4PDSA 4I0RA 2EU9A 3GNIB 3DTCA 3LCDA 3NIEA 3Q60A 5GJGA 2VX3A 4R78A 4AZSA 4MQ1A 1H24A 3WOWA 5I9XA 4BZDA 4WUAA 4EC9A 3R73A 4RVKA 4YNEA 3WYXA 2OXDA 2UUEA 4B9DA 4RC2A 3OG7A 3R7UA 3G2FA 3O17A 4EYJA 4V05A 2WGJA 4XMOA 5IH5A 4I21A 4N70A 3LFQA 4YP8A 5FP6A 2HY0A 4IH8A 3SHEA 3P7CA 4FT7A 4AW0A 4USDA 3TIZA 4NCTA 1KWPA 4QP2A 5KBRA 3FLZA 3PJ8A 5CEMA 3CKXA 3VQUA 2QG7A 2GS7A 4ACHA 3ATTA 4OLIA 5FXRA 2WQBA 4IFCA 4EOLA 1XBBA 3QU0A 3BHUA 5AUUA 5ANEA 5CAUA 5IDPA 3BV3A 3B8QA 3MFTA 3W2SA 2Y4PA 3BEAA 4JXFA 2OBJA 1IAHA 3ZFMA 1ZZ2A 3CBLA 3R1SA 4YLLA 3HRBA 1LR4A 1H01A 3NUUA 2C1AA 2GHGA 4BGGA 3FYKX 1U5QA 2XIZA 4QNAA 4DC2A 2X2LA 2WTJA 3GP0A 1A06A 4ZLOA 1ZAOA 5EI8A 2W1DA 2YCQA 3POZA 4QPSA 2Z7RA 2ZB0A 4LRJA 3E64A 4XLVA 2VWIA 2VTNA 4OBPA 4BZOA 1Q62A 4L67A 3AT2A 3H4JA 4FEVA 3GCUA 4GV1A 4RIYB 5EM7A 1VYZA 2ZV9A 3E5AA 3QRUA 1UNLA 5E1SA 3MV5A 4BTKA 1ZLTA 4ZY4A 2QVSE 4AZTA 4GS6A 3PP0A 4IAZA 4QMMA 3VQHA 2UZLA 1E1XA 3IGGA 3MY0A 3TM0A 4I22A 5LMBA 5LVOA 4CMTA 3E8DA 1R1WA 3IOKA 3N4UA 4WZYA 3DA6A 1IA8A 5KCVA 4UXQA 4P5ZA 2H9VA 5FG8A 1JBPE 3V3VA 5J7HA 2JIUA 3RZBA 2HZ4A 1UU7A 2XCHA 4Y95A 4QNYA 4G3DA 2BZIB 3FZPA 2R7IA 2PVMA 3VBTA 5IEYA 3GU7A 4BBEA 3QRIA 4J53A 4EQMA 3DAJA 4YC8A 1AQ1A 1OIUA 4YU2A 2C6IA 5BVFA 2UW0A 5CT7A 2QHMA 2ZM3A 1XH9A 3C0GA 3R63A 5KUPA 2VTIA 4RG0A 1SVHA 2C6MA 2RGPA 4C2VA 4G3CA 1P4FA 3W16A 4IAIA 5EW8A 3FI4A 2R3QA 4OTRA 5HHWA 1OITA 5GIPE 3F6XA 4P90A 3IW4A 4RMZA 3E62A 5HE3A 3UP7A 5JN2A 4PX6A 4TZRA 2WU7A 3C7QA 3UDBA 1WBVA 3BYSA 2OJ9A 2WB8A 1FGIA 3GU8A 3U6JA 4AACA 2GS2A 2F2CB 3PJCA 1M14A 4AU8A 1SNUA 3QTUA 1UA2A 3HV5A 1P14A 4CFVA 4D1ZA 1JKSA 3L8PA 5A3XA 2WELA 5FQDC 4MBIA 3IDBA 5CENA 1URWA 4FKGA 5IQEA 4G3FA 1Q8WA 4A9TA 2GNIA 4PRJA 2CGWA 1PHKA 4BCPA 1OKWA 5HNIX 2GQGA 4JX7A 4QYEA 3WF7A 2IZRA 3LM0A 4EH3A 4FSTA 1I09A 3TT0A 3D14A 2QU6A 4I23A 4U3YA 3MH0A 2BZJA 3FZ1A 5IQHA 3HLLA 5CLPA 2CKPA 2X6EA 3NLBA 3HA6A 3LFAA 2Y9QA 3AC3A 5EDRA 4O7TA 3F2RA 4I6BA 3D9VA 4XOYA 4RVTA 4U44A 3KXHA 3QRJA 4UALA 5HE2A 1MQ4A 2J0IA 4ALWA 4AW1A 5HLPA 2OIBA 3R83A 5KKRC 2OZAA 4Z9LA 3W10A 2XK6A 5IMXA 4TTHB 5JQ8A 1XH4A 3FUPA 5E8SA 3F5GA 1JSUA 3NPCA 3F5XA 5EM5A 4O0RA 4FMQA 1MRVA 1OM1A 4M3QA 1SZMA 3OCTA 3VS6A 2XEZA 1FVVA 3WZEA 2QONA 2X4ZA 1WMKA 4ARKA 4E7WA 3Q2JA 4ZSEA 1REKA 4F6UA 2XYNA 3ETAA 5EOBA 3ZRKA 5IA1A 2UZVA 3ACKA 4L46A 4MD7E 3D7TB 4FR4A 4MXAA 2FH9A 1Z57A 3TUCA 2PE1A 3BBWA 4AZEA 5DRBA 3BPRA 3Q32A 3PY0A 4DG2E 4CG9A 3QKMA 3HA8A 4S34A 2VTLA 4IIRA 3OC1A 3FPQA 4USEA 4Q5EA 4U5JA 1Y8GA 2XNOA 4ZSLA 4ZSJA 1U54B 2RKUA 3MH3A 2XZSA 3QD2B 4QT1A 4ZJVA 3OEZA 3DKFA 3QAME 2WKMA 3DZQA 4S33A 4ITHA 2OWBA 4XS2A 4BCGA 3UQFA 3EN9A 3FDNA 3ZSIA 4BDIA 2KTYA 3BLHA 3D7ZA 2X81A 4QYGA 3SKCA 3ORXA 4EWHA 4QMQA 3LQ3A 1YI4A 4ZTQA 3R7EA 1WBTA 4HCUA 4RIWA 4CQEA 5B2LA 3EQRA 3R00A 3RAKA 4FV0A 2YWVA 4RX8A 3V5LA 5I9VA 5C27A 4KS8A 4JQ8A 1TQPA 1IR3A 3QTSA 1O6KA 5C8MA 5BVOA 1OUYA 3FI8A 2QR7A 4BCHA 2BRGA 2YN8A 5DVRA 3V8TA 3CGFA 1Y57A 4CFXA 4YJOA 3ZEPA 4DFLA 3BU3A 3HAVA 1REJA 5A54A 2HY81 5CAVA 3F82A 5KMLA 2J51A 3DDQA 3A61A 4FC0A 4XG9A 3PVUA 3GQLA 3P0MA 3FHRA 3PVGA 4N57A 4FZ6A 3UYSA 3ULZA 1H0WA 4FKSA 3PE1A 4BIBA 4EOSA 4V0GB 3WZKA 2FSLX 2ZV2A 3E7OA 4E6QA 2R9SA 1OPJA 4TT7A 2E9OA 3QTZA 2BMCA 3K3JA 2P33A 2I0VA 1Q61A 2YIQA 4XG7A 3Q6UA 2C69A 4CV8A 5EM6A 4PP9A 5K5XA 1YWRA 4CTCA 4YSJA 4QYFA 5LJJA 4FTQA 4F65A 4AT4A 4Q2AA 4O7PA 3GU5A 2UZTA 4IZ5A 4QQTA 4IAFA 2IVVA 3U9CA 2F7ZE 3FMHA 3BHYA 4I0SA 4NUSA 4EK8A 4ZTHA 2PK9A 4EOKA 1OB3A 3F61A 4KABA 4C3FA 1FGKA 1YHSA 3DXNA 2ZMCA 4FVRA 4YO6A 3UQGA 3MW1A 4ASEA 4XUFA 4PTCA 4MXZA 4EOMA 3RWQA 2NNWB 2YM4A 3JVSA 4EQCA 4YZNA 3VS2A 4MWIA 3VRZA 2Y4IB 2E9NA 3NWWA 4XHKB 4DG0E 2UZBA 1ZY4A 4C58A 2YERA 4ZZMA 5CAOA 4U94A 2XB7A 4IE9A 4O0YA 2XK8A 2XJ2A 4A9YA 2BKKA 5A4TA 4RIOA 2W1HA 4R3CA 1H4LA 5E8ZA 2GFSA 2OZOA 3BYOA 4KAOA 3ORLA 4XV2A 4GJ3A 2X9EA 1I44A 4QMSA 3Q4TA 3M2WA 1URCA 3R6XA 2RFDA 4DCEA 3NUAA 3QWKA 3ALNA 4DA5A 2JFMA 4CGAA 2G2HA 3FLWA 3LMHA 3TACA 2PHKA 4O83A 4M97A 4YJRA 3RVGA 3Q5IA 5HKMA 4BI0A 3FKOA 3NNXA 5BUEA 4IEBA 3HECA 3AMAA 4L43A 3BHTA 1OL5A 4R5YA 2FB8A 2VTHA 3O7LD 4NU1A 4EOIA 2JDTA 3HKOA 5E8VA 4Z55A 4CKJA 2YAAA 2AC5A 4FSUA 3GCQA 4TY1A 3TKUA 5IG1A 5CU3A 3LJ0A 3NNWA 3P4KA 4AOTA 5IZFA 3MVJA 4EEVA 3EQDA 3OXTA 2GPHA 3QYZA 3BLQA 3NVMB 2XH5A 2WO6A 2V62A 5B0XA 4L01A 2CNVA 4QOXA 3KN5A 4RIXA 3KF4A 4C36A 4FSQA 5AUYA 3SVVA 5LWMA 2IWIA 2I40A 2UW8A 4U98A 2JIVA 2H6DA 4MXXA 2QOQA 5AM6A 4B0GA 4E93A 5HTBA 2PE2A 5CT0A 1KV1A 1BL6A 1CKIA 2RF9A 3DQWA 3KXGA 4CV9A 4E6CA 5JH6A 5E92A 2R3KA 5FM3A 4GT4A 4MBJA 2Z60A 3VNTA 5KE0A 2C0OA 3NUSA 4BC6A 3FXXA 3GCSA 1E1VA 3IECA 3Q4ZA 2ZV7A 4KIOA 4MBLA 3ZMMA 5JT2A 1PRYA 3CPBA 2HIWA 4KRCA 4EORA 3CS9A 1Z9XA 5HQ0A 5H2UA 3MFSA 4EOQA 3V5PA 1KUTA 4PP7A 1B39A 2OO8X 3MB6A 3MTFA 2BILB 4GG5A 3UP2A 4PV0A 4WNMA 4CLIA 4DEDA 4J7BA 3PRFA 3BYVA 4D1SA 3DK3A 2VGOA 1FBNA 4F70A 3CTQA 4QMVA 2PVHA 3RPVA 1SVEA 4DLJA 4Q9SA 5CALA 3C51A 3CE3A 4NWMA 4UXLA 3IKAA 3UO5A 4IZ7A 5AV0A 1PMEA 3A7HA 4C4FA 3KULA 2J0KA 3OHTA 4JR7A 3SRVA 2ZAZA 4H3PA 4BIEA 3F69A 3TTIA 5JZNA 3RPRA 5IU2A 2CJMA 1Q8UA 4R7HA 3BIZA 4EK5A 1HOWA 1NT2A 3GVUA 4NYEA 3DBCA 4HGLA 3U8WA 5LQFA 4CFMA 1RDQE 5EKOA 4WUNA 3GEQA 2YCFA 3OWJA 5CQWA 1OL2A 5EI6A 2G15A 5CZHA 2X7GA 4E26A 1FINA 1O6YA 2W1GA 2SRCA 5DLSA 2CNUA 4IMYA 3V6SA 4BDDA 2XJ1A 4BCIA 4CRLA 5BNJA 4JG8A 5EQYA 4A07A 4Q9ZA 4NW6A 2R3RA 3LXKA 2ETMA 3AG9A 4WBBB 4FV9A 4K0YA 2QLQA 1CKPA 5JRSA 2R3NA 2X7OA 3W0PA 1OL1A 1G5SA 4DINA 2VTPA 3MPAA 2GQRA 5CU4A 1NVQA 4FKWA 3UIUA 3OBGA 3NYNA 3OW4A 2UVZA 3W33A 2AUHA 2Y0AA 2VUWA 5AJQA 4AQCA 1L3RE 4NJDA 3DKCA 3CD3A 4C4EA 2O64A 3GENA 2WU6A 3BQCA 3N4TA 4MYGA 1YKRA 4U43A 3L9PA 2J5EA 4M7IA 3EQGA 3GQIA 4H1JA 5DWRA 4LUDA 2WOTA 3RPYA 3WZDA 2Z7QA 4AZVA 5GHVA 4OUCA 4B7TA 5A46A 3Q6WA 3R9RA 5I9YA 4RLKA 4RVMA 5B2KA 5IA0A 4EH7A 3IDPA 4GFMA 3TNHA 3DU8A 3IO7A 1L8TA 3EH9A 3QQJA 3RPSA 4OBQA 3DT1A 2BPMA 1QPEA 4F4PA 3C4FA 3P7BA 1YOLA 5F95A 3IW5A 2CMWA 3OEFX 4QYHA 3WI6A 4MHAA 1X8BA 2QR8A 3RK7A 5K4IA 2VNYA 5DG5A 1TKIA 3LPBA 3O50A 5JKGA 4Q5HA 5D7AA 3QRTA 1WBOA 5EFQA 2JDSA 3HX4A 2JLDA 4B99A 5BYZA 4YMJA 1GZKA 2EXMA 3AQVA 4TYHA 5FBOA 5HGIA 4FIHA 2CKQA 4WA9A 5D11A 2W1IA 3W8QA 2OJFE 2QO2A 3PP1A 4ZXTA 2HCKA 3MESA 4Y5HA 3ZXTA 5CNNA 4F6WA 2VO0A 3KKVA 3U4WA 1OPKA 4GRBA 1YQJA 2XVDA 3SQQA 2J0JA 3GOPA 3LMIA 4EBVA 3MJ1A 4HGEA 4RA5A 4FA2A 3WZUA 4APCA 3E8EA 3TIYA 5KMNA 1IASA 4L9IA 5L2IA 2UZWE 4HCTA 4D5HA 4D4YA 5AMNA 3HP5A 4GEOA 5HVYA 3KMWA 4FG8A 3ROCA 4FV8A 3NGAA 1JKTA 2OFVA 1H1RA 3Q5ZA 2XA4A 1J7LA 2NPQA 3ZLXA 2OJGA 4GIIA 3SC1A 4F7LA 4WG5A 3O7LB 4W4YA 4PUZA 3PTGA 4YJSA 3VWAA 4R1YA 1ZYSA 5EOLA 3QCQA 1OGUA 4KKGA 4GG7A 4I5CA 1T46A 3CY3A 1DAYA 1M17A 3PJ2A 4FV2A 4JRNA 4XG4A 1UNGA 1NXKA 2PL0A 5E8YA 1UU8A 2BHHA 2PWLA 3C9WA 1NVRA 4FSMA 1SM2A 4ZAUA 5AUVA 3DFCB 4M15A 4O7YA 5EHOA 5KZ0A 3SA0A 2F2UA 2UW5A 5HE0A 2QODA 4HZRA 4RJ4A 2WHBA 2YCSA 1A48A 2YZAA 4EJNA 3RINA 4FBXA 4Y8DA 4YR8A 3IK3A 1PMNA 3GOKA 3MPTA 4DFXE 1H0VA 5J95A 4FKPA 1RW8A 4B8MA 3VBWA 1XO2B 3KRLA 3QALE 4FVQA 5CU6A 4UB7A 3VS0A 2Z7LA 4E4XA 4FTUA 2VWWA 4F1OA 3HRFA 4GIHA 4E1ZA 5CEQA 3LQ8A 3O71A 4M0ZA 2J4ZA 3HV3A 4FEWA 4F1TA 3EB0A 3RAWA 5JGBA 5KMKA 1M7QA 5AV3A 4E4LA 2HZIA 5ACKA 2BCJA 4CXAA 3PA3A 3LFBA 5TKDA 1Y91A 1U59A 4DBXA 1YI3A 4L6QA 1G3NA 4DFBA 4R7BA 4F6SA 5EH0A 1JSVA 2XNGA 2YDIA 2B1PA 4C62A 1T45A 2VTSA 2X4FA 2GU8A 4KS7A 2G1TA 4L7SA 1QMZA 4AFJA 4FKLA 4EBWA 3QTIA 4AN9A 4D2SA 1K2PA 3CXWA 1GAGA 5CYIA 3D5UA 5G6VA 4JI9A 3UC3A 4BTJA 2QOCA 3WF9A 4X7QA 3F3ZA 3I1AA 4NFMA 1Q24A 4QMUA 3PJ1A 4L7FA 3KRWA 4DLIA 5HE1A 2R3PA 3EZRA 3L9LA 4J97A 3OCBA 3TUDA 1VJYA 4ZTRA 1IEPA 3MGYA 3UE4A 2QOLA 2BRHA 5C8KA 4ZEGA 4CT1A 2J0MB 5AP4A 3ORPA 5IUGA 3IGOA 5C4LA 4KNBA 4CT2A 4YZDA 1P4OA 5HEZA 5HX6A 2F7XE 4IWOA 2P0CA 3BHVA 4H05A 2PZ5A 3LXLA 4FTKA 2F4JA 4HGTA 3P79A 4LYNA 5J87A 4BDAA 4DCAA 3GXLA 3A8WA 2DS1A 4IC8A 1O6LA 1MQBA 4KUJA 4PF4A 4U81A 3DK7A 2WTWA 1XWSA 2UV2A 2YIRA 5AP5A 5HO8A 2WMWA 3VS4A 4AFEA 4DFUA 1M2PA 1LEZA 4Y72A 1B6CB 2W99B 1S9IA 4DEHA 2WTKC 4FSYA 4LV8A 2OJIA 4KSQA 3VBQA 4GT3A 4GK2A 4MEDA 5HLNA 3R22A 4K77A 4YJNA 2R0UA 5ETCA 5G1XA 3SGCA 5FDPA 2R4BA 2OI4X 5JGDA 1V0BA 2Z2WA 3OFMA 3PWYA 4YZ9A 5HG9A 2LGCA 3LFCA 1EH4A 4DEGA 3QC4A 3P7AA 4FSWA 3TG1A 3OUNB 3TN8A 4C0TA 4OW8A 1YW2A 3SAYA 1GZ8A 2YDJA 2HENA 3QTXA 3LFSA 4JVGA 5D12A 1CMKE 1OI9A 4F7NA 2ACXA 3COHA 5AWMA 4FTLA 4P4CA 4AW2A 4E5BA 5IQAA 1NA7A 3H3CA 3IS5A 5K5NA 2YA9A 3MPMA 4LQMA 1XJDA 4X3JA 3ORZA 4CMOA 3ZDUA 5H8BA 2JKKA 1R3CA 3T9TA 3LLTA 1ZRZA 2X8IA 2JEDA 3TZ8A 3VF8A 3AGMA 4FUYA 4IVBA 3C50A 4R77A 3FYJX 3KGAA 3TUBA 4ANMA 5FXQA 1JSTA 2GQSA 4JDIA 3PSDA 2C3IB 4IM2A 3DNDA 4CRSA 5CF4A 4HPUE 4Z16A 5AADA 5JFSA 5HG7A 3PY3A 4FK3A 4RJ7A 4NW5A 3AC8A 4ID7A 4F9AA 2HWOA 3JUHA 2CNQA 4ZSGA 4BICA 4EKLA 2A27A 2GNGA 4FV4A 2JGZA 3FMJA 3HMIA 1J1CA 5LMKA 3IW6A 3GFEA 4FT5A 4XV9A 4DEIA 3PFQA 5AV1A 1W8CA 1SMHA 1YDRE 1BL7A 3S2PA 3A62A 4M69B 4O2ZA 4JAJA 3QTRA 2WQOA 3DXQA 4WT6A 5ANGA 4JLCA 4FL1A 4AF3A 4E73A 3EYHA 4FNYA 4W8DA 2X39A 1YXXA 4FKQA 4ZOGA 4O7OA 2UW4A 2BRNA 4LUEA 2DWBA 4NCTC 2JIIA 3AOXA 4TRLA 5FDXA 3F9NA 3DJ6A 3UOKA 3G51A 5EHYA 3TV4A 4EK3A 3OY3A 2YITA 3R8UA 3BV2A 4IZYA 3QXPA 4P7EA 1JOWB 4NIFB 2I7QA 3GB2A 5D41A 5I5ZA 3CGOA 5CXHA 3UOHA 1Q8YA 4CTBA 1E9HA 1WVWA 1J3HA 5KKRB 3MFRA 4DH3A 1FOTA 2YAKA 1MRUA 3RNIA 5K4JA 4K33A 4R6VA 4MXCA 3RK5A 1LEWA 3TJCA 2BAJA 1OBDA 3P23A 5FD2A 4EK4A 2W96B 4BDHA 3G15A 2UW3A 3L8SA 4QMOA 3AMBA 2EVAA 2QOFA 3EKNA 3BX5A 3HZTA 4O0WA 3ZZEA 4C02A 2GNHA 1W83A 2UW9A 4I6FA 4TW9A 2LAVA 1JKLA 1FVRA 2V55A 2PPQA 2NO3A 2C68A 2R3JA 2OH0E 4P5QA 3WF6A 2GNFA 2UW7A 2VAGA 2W9ZB 3H0ZA 1YXUA 3DK6A 3QCXA 4FTCA 4IM3A 4GU9A 4I24A 4F99A 4TYEA 3UPZA 5HORA 3LZBA 3ZO1A 5I9WA 3MTLA 3O96A 5EYCA 5AUZA 1STCE 3IPHA 4G2FA 3RM7A 4O7VA 1W82A 5ETIA 2PVRA 4GMYA 2CKOA 2XRUA 3KK8A 5TO8A 4AAAA 5L2SA 4CVAA 3UJGA 5AX9A 3EZVA 4YGAA 2JBPA 3ZDIA 3OZ6A 4KSPA 4ORKA 5CAPA 4CLJA 2QOBA 2R3HA 2UZUE 3FE3A 3EQCA 4G3GA 3ZFYA 2J90A 3QL8A 3LMGA 3ORKA 5F4NA 5BVEA 4EHVA 5CEKA 3IG7A 2RG6A 1GIHA 2V22A 3GC7A 3OTUA 1JKKA 2OIQA 5DIAA 2ZM1A 2ITZA 4FT9A 2Q0NA 4FK6A 3H0YA 4CFWA 4U41A 4QMXA 4Z7HA 3FMKA 3MA3A 3Q53A 1CSNA 2WTIA 4HJOA 4I5MA 3QQLA 1WAKA 3DNEA 5F20A 4JNWA 5IQFA 1YOJA 3Q2MA 4WKQA 4ZJJA 4I6QA 4OT5A 3FLQA 2ETRA 2WMXA 4O82A 2JAMA 3ZXZA 4A9SA 3DXPA 4XP2A 3ZRLA 5BX0A 3NAYA 4GUBA 5CEIA 4QQCA 3RAHA 2XNPA 4I3ZA 4G31A 4UX9A 3H10A 2C6DA 2R3IA 3VBXA 5IMEA 3JYAA 5DNRA 5EYMA 4OTIA 2GDOA 3CR0A 4D28A 3BBTB 3FZSA 2IPXA 4G6NA 1M2RA 4II5A 3L9NA 4KKHA 3RI1A 4O0UA 4NSTA 4PDPA 4XG3A 4NL0A 4C4JA 4K18A 4KBCA 3COMA 5CTPA 3E8NA 2BIKB 4CCUA 3I0OA 3W0QA 4ZLYA 4WNOA 2PZPA 3Q3BA 5LOHA 5TT7A 3TDVA 4BI1A 3AC4A 4RBLA 3I81A 2R3LA 4FL2A 4X2GA 3VHKA 2ZDUA 2IW9A 1PY5A 2PMNX 4ENYA 1DI9A 3D0EA 1KE7A 2UZDA 3WARA 2ITUA 1J1BA 5HD7A 4OT6A 3RALA 4U8ZA 4CMUA 3SG8A 4G3EA 4PMTA 3AC5A 3A4PA 2R7BA 4DE4A 1U5RA 3WF5A 4BRXA 4RJ6A 3KREA 3NYOA 4QPAA 1JPAA 4ANSA 3C4XA 1Q4LA 2PMIA 2Y8OA 3E63A 4ALUA 5DR9A 4FTOA 4F0FA 3EMGA 2XCKA 3QZHA 2RL5A 3HRCA 5ANJA 3JVRA 3PIZA 4NH1A 5IQIA 4F9WA 2OLCA 2GTNA 1BYGA 3U54A 4LL0A 3F7ZA 4JOAA 3FMNA 3UVPA 4EI4A 4K8AA 2WMVA 3HUCA 2BROA 3PYYA 4QTDA 4FICA 4UYNA 5AEPA 3FBVA 3KCFA 1TQMA 3FZOA 5HCZA 1OPLA 3UVRA 4CZUA 5HNGA 5F94A 3POOA 2OXYA 2E9UA 4NZWB 4NM7A 3CIKA 5AIKA 2C6OA 5KMOA 4GU6A 2VO6A 3S4QA 4IDTA 3OOMA 4R7IA 4RIXB 4F64A 2QLUA 1JQHA 5M4FA 4L53A 5IPJA 3MJ2A 3HL7A 3SXFA 2QNJA 3TWJA 3HMPA 3QA8A 3R8VA 4DHFA 3R71A 3QZGA 4D55A 2O3PA 3VS3A 5EHLA 3VS1A 4N0SA 3KN6A 4DH1A 4TNDA 2PVLA 4PQNA 2HW7A 4ALVA 4AX8A 2JDVA 2NP8A 2X9FA 1QPCA 4UV0A 3RPOA 3R02A 2B9FA 1OIRA 3MDYA 3PVWA 4AOIA 3G0EA 2C0TA 5ITAA 3IW8A 4RJ3A 4FIGA 1APME 4BCKA 4BR3A 3DCVA 1CDKA 2Z8CA 3E92A 5HICA 4EKKA 4FIFA 4NM0A 4QO9A 1V0PA 3DKGA 4F9YA 2I0HA 2G2IA 5C03A 2HXQA 4RIYA 1OVEA 4BTFA 3ZSHA 1BMKA 3LJ2A 4RZVA 4ACGA 2ONLA 2CLQA 4GFGA 4IQ6A 4NM3A 2C6TA 3LW0A 4WIHA 2F7EE 4IX6A 4UN0C 2RIOA 4GJ2A 4BN1A 4PDYA 4RQVA 5DI1A 3TNWA 2QHNA 4C33A 2XIKA 3OBJA 3ZLYA 5KMIA 4LOOA 4I5HA 1Q99A 2C30A 4MNEB 4U0IA 4F7SA 4C4GA 4LOQA 5GJDA 4UYAA 4LRMA 4HVGA 3AT3A 3EJ1A 5HU9A 3FJQE 1OL6A 4YJQA 1JWHA 4U6RA 5IQDA 1Q3WA 3EWHA 3FQSA 2WD1A 3PPKA 3D5WA 4IVAA 5M07A 3QD0A 5L8LA 1H00A 2OW3A 4HYSA 4M84A 4P2KA 2VD5A 3KEXA 2ZOQA 4D0WA 2HZNA 2YM6A 4DH8A 3M1SA 3SW7A 2BFXA 2ZMDA 4XBRA 1OECA 3ZLWA 3DBFA 1R78A 3NNVA 3ORMA 4FODA 2NRYA 3CKWA 4X21A 1PMVA 1UU9A 2CLXA 5ANIA 3C0IA 3ZM4A 5HVJA 4YJTA 1AGWA 3L1SA 5J8IA 4C3PA 1FQ1B 3RP9A 3BGQA 3GU6A 1WBNA 4XJ0A 3TDWA 5JFWA 5ETFA 2XF0A 3QXOA 4KINA 5CVGA 5FBNC 3ACJA 5AUWA 5HBJA 2QG5A 4EOJA 3DV3A 5CSVA 3NIZA 2BRMA 3TJDA 1H08A 1H1SA 1B38A 3GGFA 2JKQA 4RWLA 2YM8A 3A4OX 4JIKA 3BELA 1NW1A 1V0OA 4XV1A 4XX9A 4RFZA 3ZZWA 4J95A 3WF8A 1Q3DA 2ITPA 3DGKA 5D1JA 2WOUA 4QP3A 3DZOA 3ID6C 4JR3A 2C3LA 4R5SA 5CF8A 2VTRA 1BX6A 4O7SA 3SOAA 2JKOA 5ANKA 4A9RA 3REPA 3KU2A 3LQ5A 4EHZA 4RVLA 2HELA 1ZXEA 2FSTX 2PMOX 2UW6A 3QQGA 2XBJA 4XP3A 4EH2A 4TYGA 4JQEA 4DTKA 4TYHB 3S0OA 3KXXA 4N6ZA 4JAIA 4YZBA 3OOGA 2W5HA 3QX2A 4R3PA 5FP5A 1WBSA 2XIRA 3QUDA 4ASXA 3AMYA 3KMUA 1OBGA 1ZZLA 4I4FA 1KV2A 2HYYA 4JDKA 4MD9E 4PL3A 5LVPA 1IA9A 5FEDA 4DN5A 5BQ0A 4IZAA 3UO4A 2H96A 3O8PA 1YVJA 4D1XA 1BUHA 2KULA 5FUTA 2QKWB 4AZFA 2BKZA 3GU4A 2B9JA 4FI1A 3UYTA 3W0MA 3TEIA 2W05A 2X2MA 4FSNA 2J2IB 3FKNA 4YLKA 3D7TA 4FKJA 3HVCA 3EOCA 2XKEA 3EN5A 2IZTA 4MXOA 2B9HA 2VWZA 2VRXA 3DLSA 3UG1A 1Q8ZA 2JFLA 1WVYA 4GH2A 3E93A 4FG9A 4F09A 2R64A 4IFGA 1U54A 3P5KA 4G5JA 5EYKA 2BZHB 4H3QA 3VN9A 4D4RA 3OW3A 3V6RA 3KQ7A 1W84A 4ITJA 3CEKA 4ZLZA 3D83A 3FL5A 3BQRA 3K5UA 1U4DA 3KB7A 4O0SA 5E7RA 5J1WA 5M06A 2C5OA 3BCEA 4JIAA 2YCRA 4BDJA 3PG1A 2GNJA 4XV3A 2PUIA 4XCUA 2OIDA 4NTSA 5IA4A 2W7XA 5CANA 2OJJA 2CGXA 3V04A 1PXKA 2FYSA 4YHFA 3L9MA 3VC4A 5HZNA 1KE6A 4O0XA 5EYDA 5CXZA 5CSPA 5I4NA 4O0VA 3MVLA 2Q83A 5T68A 3JY0A 3QCYA 5AA9A 3HAMA 4V04A 3C4CA 1XQZA 3LKMA 3FHIA 3Q96A 3KRJA 3B2WA 3LHJA 3AGLA 5L6WL 3SXRA 3T8OA 2IN6A 4RT7A 3I7CA 3Q04A 1ATPE 2WMRA 4D4VA 3Q4UA 3R1NA 4EHEA 4IAKA 4M13A 2GS6A 5IEXA 4ONAA 4QP6A 1ZOHA 2C3KA 4GL9A 4ZIMA 4PWNA 4NFNA 2QOKA 5LWNA 4V0GA 3F3VA 5AP1A 5E1EA 4YLJA 4ZTLA 5J9LA 1QL6A 4J8MA 3WZJA 4BDGA 4QRCA 2GSFA 5CZIA 5FM2A 3NUNA 4X3FA 3HYHA 3MFUA 4U42A 4TWPA 4BCQA 3C5UA 1NY3A 5L8KA 5EDPA 3QWJA 4RX9A 4A7CA 3JY9A 3QKLA 2BAKA 4FX3A 5AM7A 3FXZA 1YHWA 3G90X 4K6ZA 1GZOA 2VTOA 3T3UA 2Z7SA 3FPMA 4ACMA 4B8LA 3A60A 3MB7A 4PMMA 3G6GA 3BLRA 1WVXA 3R30A 2PZRA 2P4IA 5BPYA 3LJ1A 4AWIA 2ERZE 3OWPA 4EUUA 3BRBA 3RCJA 3VUKA 5JK3A 3ZO3A 3MI9A 3DJ7A 2R5TA 2BFYA 1YXSA 4LV5A 3WIKA 3O2MA 3ERKA 5DEYA 2OXXA 2PU8A 5C1QB 5LVNA 4BCJA 2C4GA 2HAKA 1OMWA 4J96A 3ZO2A 3PY1A 5IH6A 2H8HA 2VZ6A 4MD8E 4DH5A 4K1BA 3E3PA 2EB2A 4FKRA 4YPSA 4ZP5A 3DPKA 5DRDA 3PG3A 3S1HA 3N51A 4FGRA 5A6OA 3HDMA 4W4XA 5CI6A 1PXMA 4O7NA 1HCLA 5M4CA 2IVTA 1UWHA 4D9TA 2VV9A 3H9OA 4ENXA 3LFFA 3D5VA 2X2KA 4C35A 4YHTA 4DBNA 3R1QA 3ZBXA 2GNLA 3DBDA 2BUJA 5CVHA 3RJCA 2HK5A 3LE6A 4RGJA 1UWJA 4BF2A 5E8UA 4MAOA 3ZUUA 3D4QA 4TWNA 4O27B 5IISA 3GCVA 1XH8A 3FSKA 3HDNA 3LCSA 5T6KA 5HG8A 1PXOA 3ZU7A 4B6LA 2WTKB 1M7NA 4OTQA 5AAEA 4FT0A 3ATSA 1FMKA 1A9UA 4GFOA 4JBOA 3B8RA 1F3MC 4LRKA 4YTIA 3A7GA 4BZNA 3GFWA 3ORNA 3QQUA 4E4MA 3RAIA 5JGAA 2WQEA 2EB3A 2C5NA 2WTCA 3MVHA 3F3TA 3KK9A 3P1AA 4WNKA 5CWZA 3RWPA 3OWKA 5M56A 2O2UA 4E4NA 4F7JA 2J0LA 4IANA 4BGQA 3UO6A 1XKKA 3W2QA 3O8TA 3CLYA 5GJFA 4A4XA 5CF6A 4E6DA 5HIBA 2PMLX 3NUPA 4X2NA 4NKAA 2BALA 3NRMA 5FTGA 2B4SB 5J5SA 4QMWA 3FC2A 4GVAA 4PNIA 4L00A 4ZS0A 1SYKA 2XM9A 3L8VA 1PMUA 3NZ0A 4FZAB 4RJ8A 4FL3A 5K9IA 3OCGA 4IX3A 2XKDA 4FTIA 2R2PA 4FVPA 4G9RA 4IJ9A 4U97A 2CN5A 3UC4A 4BDKA 5BYYA 3E87A 1GIJA 3R7OA 3EFKA 1W0XC 4H58A 4D0XA 4EHGA 3FC1X 3K3IA 3V8SA 3P86A 3VRYA 5DHJA 4WD5A 5CS6A 3T9IA 1OKVA 1Y8YA 3DTWA 3Q9ZA 5AP2A 4IX5A 3BU6A 3W32A 4YSMA 4IWPA 4C4HA 1VZOA 3TNQB 1KSWA 3V5JA 4DG3E 5L3AA 1P2AA 3FMLA 3S95A 5CF5A 2PE0A 4MCVA 3P9JA 5H8EA 2O63A 2IVSA 3DJ5A 4J52A 4C7TA 5HVKA 1RJBA 4AA4A 5M4UA 4RPVA 4UWYA 4IADA 2W1ZA 4DEBA 3QLGA 4WG3A 4YTFA 2W06A 2BRBA 2F57A 3FMDA 4YJVA 3GUBA 4J1RA 1XBCA 2PYWA 3ET7A 4U3ZA 3SV0A 3R2BA 5DOSA 4ZK5A 5LVMA 3EQFA 4HGSA 4DAWA 4HNIA 3DAEA 4GKIA 2J6MA 4QP1A 3TXOA 2ETKA 5C01A 3MIYA 4M8TA 4BDBA 5HLWA 5M51A 1OIQA 4ZSAA 5HIDA 4KB8A 2FVDA 2YM7A 3CTHA 5C4KA 5ICPA 1VYWA 2QD9A 3RCDA 4DEAA 3TKIA 3PA5A 2JKMA 3I60A 3CD8A 2BR1A 3F88A 2QKRA 2G9XA 2OH4A 4JG6A 5IF1A 5HBHA 3DKOA 1AD5A 4WBOA 4UZHA 3UGCA 2YIWA 3KRRA 3V5TA 2VTQA 4U7ZA 5FTOA 1OZ1A 2O65A 4UWCA 4I1ZA 3ORTA 4BYJA 4EC8A 1H25A 5AUTA 5CAQA 5JFXA 2XKCA 3EN4A 1YWNA 3EN7A 4GW8A 1IAJA 3ZO4A 4FV6A 4DF3A 3D5XA 2VWVA 5LXMA 5EK7A 2GHMA 3PWDA 4FZ7A 3RMFA 5KMMA 3R9HA 3R8MA 1UNHA 3OT8A 5KMJA 2YIXA 4A06A 3DOGA 4CFUA 2OICA 1YI6A 4FUXA 4JJRA 2C0IA 5H9BA 3ZOSA 4L68A 2JITA 4XYFA 3F3UA 2YIYA 4X6QC 2XK7A 3WE8A 3BE9A 1H1WA 3PXRA 4GUEA 4YZMA 5ANOA 1J91A 3FXWA 3UNZA 3AD4A 4WOVA 2GCDA 2WMQA 4KRDA 1F0QA 2ZJWA 5IA3A 5AV2A 3MY5A 4EOOA 1KE9A 4KIQA 5BMMA 2BAQA 2JBOA 3VAPA 5A6NA 3EHAA 2WEVA 4O0TA 4BB4A 5HNBA 5M53A 1PXIA 3PRIA 4C3RA 3Q9XA 3FLNC 4MKCA 4MF1A 3TZMA 1ZMVA 3VBVA 5TOZA 2V5QA 4NKSA 4G17A 3TV7A 1ERKA 4C2WA 3FQHA 1GIIA 4BIDA 4ANBA 4FTNA 4QTEA 4K2RA 2DQ7X 1SVGA 3CJFA 4C4IA 3EYGA 5AAFA 3FQEA 3KFAA 2O5KA 4OTWA 4D5KA 5IA2A 3UG2A 1RQQA 4O7RA 1FMOE 3M11A 1XHAA 3C0HA 3QUPA 3EIDA 4RRVA 2IZSA 3G5DA 3NW5A 4Y46A 4ERWA 4HNFA 2X0GA 2OGVA 4FOCA 3TV6A 4I94A 5JQ5A 5AP0A 4MH7A 3MIAA 2ZB1A 2EWAA 3EQBA 3QTQA 5FLFA 1ZOEA 3TKHA 5EKNA 3NDMA 2HWPA 4S32A 5EW3A 4ACDA 3R04A 5LMKC 3MY1A 3DY7A 4QTBA 2B55A 3W2PA 5CX9A 4RFYA 4YURA 1GJOA 4RC3A 2O0UA 4Z7GA 2W1FA 4L42A 3VO3A 2PUNA 2ITQA 3HUBA 4M68A 5L6PA 2CHLA 2V7AA 3RKBA 3MS9A 3LFNA 1LPUA 3P08A 4E20A 4LI5A 5KHXA 4M0YA 5EQPA 4NK9A 4YTCA 3VS5A 3OP5A 3VJOA 1JVPP 2HZ0A 1XR1A 4MX9A 4O7ZA 5AP7A 2B9IA 3NMUF 4YTHA 4EL9A 3EFJA 3QD4A 1OKYA 4GK4A 2OKRA 2QCSA 3NYVA 2W4JA 4XH6A 3PJ3A 3V8WA 4AXAA 3DS6A 5K3YA 4FKIA 4LGGA 3SDJA 4FTJA 3U51A 2OZAB 5CY3A 2YISA 4C38A 5DYJA 3CY2A 4DGLC 3I5ZA 4H39A 3DBEA 5L8JA 1H27A 5DH3A 2G2FA 1QPJA 4A4LA 4DTBA 2EUFB 4DT8A 1Z5MA 4FSZA 3V5QA 4BGHA 1YOMA 4FIJA 3C13A 5H3QA 4ACCA 4XOZA 5KZIA 3OMVA 3I7BA 4EH6A 3QF9A 1OIYA 4OTFA 3WILA 1CKJA 2HOGA 4CCBA 3VUMA 3LFDA 3D15A 3R2YA 2VWYA 3KVWA 1M52A 4TNBA 4O6EA 4JT3A 3U9NA 2X8EA 3D94A 2PZYA 2YFXA 1IG1A 2CSNA 3Q4CA 4HZSA 1TVOA 5M4IA 2ITNA 4FOBA 2R3FA 1OL7A 3H9RA 3JR1A 3PSCA 3QRKA 3SD0A 4WG4A 3KRXA 4BCMA 4I4EA 4LGHA 3RHXA 3VS7A 5AP6A 3H30A 5DR2A 3SLSA 3A7FA 2QU5A 3SOCA 4DYMA 2XKFA 2YJRA 2WPAA 4QMZA 4WO5A 4C34A 2A4LA 2CCHA 5HTCA 4BTMA 2C5YA 4GYGA 3P78A 3PXYA 4RIWB 4F0IA 4D4SA 5JRQA 4AGUA 4G6LA 4HOKA 1U46A 2VO3A 3DB6A 4PTGA 4BBFA 4PDOA 3DQXA 3W0OA 4I6HA 5CSHA 3ITZA 3UNKA 5F9EA 4ANQA 2WFYA 4HVDA 5E8TA 2JD5A 1KOAA 2UVYA 3QYWA 3JXWA 3HEGA 5B7VA 3H9FA 2YZLA 2QC6A 5A9UA 2ZV8A 4L45A 3VUGA 1PYXA 2CPKE 4I0TA 4N6YA 3ENMA 4QQJA 3ZS5A 2PULA 1H28A 4FKOA 4I5PA 4ANLA 4ERKA 1DAWA 2V7OA 4BVUA 1TQIA 4FV1A 3WIGA 3Q9YA 3QA0A 4EZ3A 3S00A 4IM0A 4CG8A 2XBAA 1GNGA 3TCPA 4AP7A 4Z3VA 1ZWSA 5KNJA 3FEGA 3QX4A 3VW6A 5HU3A 4FEQA 3RK9A 4DGNA 4F9CA 4X2KA 4EWQA 4IDVA 4JL9A 3MYGA 2VWXA 2ESMA 1Y6BA 2W1EA 3CPCA 4CFNA 4IWDA 5M09A 4FNZA 2R3MA 4CKRA 3PZHA 5HESA 2CGVA 4HCVA 2BDFA 3ZBFA 4FEXA 1KE8A 2ITOA 5CASA 5J1VA 4F9BA 4BYIA 4RQKA 3D2IA 3VIDA 4BKJA 3ZTXA 2OU7A 2XP2A 2YM3A 3IONA 3OTVA 5FGKA 4HYIA 1CTPE 1MRYA 2ITWA 3FLSA 3GBZA 4O6LA 2ITTA 2G01A 4UWBA 4EH4A 4TL0A 3ZUVA 3LXPA 2XS0A 3QQFA 4G34A 3HV4A 1JNKA 1KE5A 4G9CA 3BYUA 3CTJA 2IO6A 2Q0BA 3FWQA 3O51A 4ZZNA 5CU0A 2VNWA 3TNIA 1DS5A 3BGZA 2WMBA 2QOOA 4IVCA 1DI8A 2PUUA 4UEUA 1LUFA 5IDNA 2X8DA 3F2NA 2XIYA 4KWPA 2ITXA 2XYUA 2XIXA 4DGMA 3THBA 1BLXA 4CNHA 3IOPA 3R7VA 1F5QA 2FA2A 2BZKB 4F0GA 2W0JA 3LCTA 4QTAA 5GNKA 2CGUA 2ZVAA 3W0RA 2PUPA 5M44A 2WEIA 4L52A 4Y5QA 2JC6A 4U80A 1UV5A 3OF0A 2P2IA 4HYHA 4I41A 4DGOA 4EJ7A 5HCYA 4CKIA 4F1MA 3BGPA 2ITVA 4XLIA 1ZARA 3UZTA 2XMYA 2VO7A 3W2OA 2OSCA 1ZOGA 4FKVA 2X7FA 2E2BA 1Q97A 2C47A 4BI2A 3LCKA 4JS8A 4YBKA 5AAGA 3Q52A 1H1PA 5D9HA 4FYNA 3CQWA 3A99A 5HI2A 5IQBA 4U79A 3GC9A 5BUIA 5IEVA 4AT3A 3UPXA 4JRVA 5AUXA 3S3IA 3ZONA 4CD0A 2B0QA 2BTSA 4O2PA 2Y6OA 3HMNA 4QMTA 3VF9A 4C61A 5KO1A 2WIHA 4ZJIA 4FGBA 2W5BA 3NX8A 4L3PA 3OD6X 2PVYA 4KIPA 3EL7A 3DAKA 2I0EA 3DBQA 2C3JA 3F3WA 3MWUA 2PTKA 4YJPA 3FI2A 5E90A 3SXSA 4V01A 3NNUA 3LM5A 1K3AA 2ERKA 5I0BA 4X2FA 5IQCA 2UVXA 5HD4A 2ONLC 4FIIA 4O22A 4KBKA 1PF8A 3EQPA 4U40A 4YJUA 4W8EA 3V5WA 3WE4A 3AC1A 3CJGA 2RFNA 4ASZA 4W4WA
chains in the Genus database with same CATH superfamily
1YXVA 4AT5A 1PXLA 3KXZA 5JSMA 4RWJA 4I93A 3SW4A 4TWCA 2WXVA 3NVKI 3RTPA 2VTAA 2YHVA 2FUMA 3NEWA 2QI8A 3UODA 2GFCA 2X6DA 5E8XA 2CN8A 1MUOA 3NUXA 4YZCA 4JX3A 4XP0A 3PXZA 5DT4A 1ND4A 3CCNA 4TWOA 4E5AX 4HVSA 4AN2A 3PPJA 4PTEA 3A7JA 2FSOX 3FZRA 3KULB 4AE6A 2HXLA 3ODZX 3SRVB 3WYYA 4YO4A 2P55A 2C1BA 1YHVA 3LXNA 4CSVA 4XBUA 4FT3A 3KCKA 2C6KA 5AV4A 5AIRA 1DM2A 3W2CA 1ST4A 4QEBA 5IUHA 2VTTA 5L2WA 3F66A 2VTMA 3COKA 3KXMA 4EH8A 5FXSA 4RLLA 5HG5A 4QP8A 1YDTE 3QBNA 2FO0A 4IBMA 3R9OA 4RA4A 3FZTA 4BCFA 4EOPA 4APPA 1P5EA 4XRLA 3QQHA 5TR6A 4BJJA 4DFNA 2XJ0A 3VUHA 3FKLA 3LLAA 4DFYA 4OBOA 3BYMA 5E4HA 2PVKA 4FE2A 4QP9A 4JQ7A 4YC6A 5ETAA 5M55A 2FSMX 4EYMA 3WBLA 4QP4A 5IQGA 2BTRA 3PXQA 3ZYAA 2JDOA 3ZHPC 4X3FB 2WQMA 3E88A 1W7HA 3LVPA 3KXNA 4AW5A 3ALOA 3OY1A 2YM5A 3LAUA 1FVTA 2W17A 1R0EA 3NCGA 3OS3A 4J98A 4QMYA 4KD1A 4Y83A 4RX7A 5B2MA 1UU3A 3E7VA 3QFVA 3ZM9A 1PXNA 1WFCA 3UZPA 3PIXA 3EFLA 4RSSA 1BI7A 4QTCA 3BWFA 5HX8A 3QHRA 3K54A 4XNEA 3U6IA 2PVNA 4OGRA 2W4OA 4RZWA 2C6LA 3W55A 4C37A 3RM6A 3QQKA 3MH2A 3UVQA 2BIYA 1BI8A 2YDKA 4IB1A 4QYYA 5D7VA 3W18A 4DT9A 4KBAA 4EONA 4FTTA 3Q9WA 1CM8A 4LDTA 4RWKA 2VU3A 3TTJA 3UZRA 5LMAA 4EH5A 5J9ZA 1GOLA 2J50A 2VX1A 3U87A 2IJMA 2XALA 2XK3A 4XRJA 3UTOA 4WHZA 4TYIA 3FY0A 3NUYA 3TNPC 5IH4A 1KOBA 3LOKA 5KHWA 5M57A 4MVFA 3RHKA 4I92A 3C4WA 2GTMA 2QOHA 2V0DA 3R28A 4QMPA 4ZY6A 2ZDTA 5A4LA 2B54A 4LOPA 4XG8A 3LFEA 3F7WA 5CEPA 3IW7A 3HV6A 3QLFA 2B7AA 2F9GA 2WAJA 3R1YA 2IW6A 3C4ZA 1HCKA 4LG4A 3V01A 2DYLA 3BU5A 4HVIA 1ZMWA 3W0NA 4E6AA 4X6RA 4OTGA 4A4OA 4Y73A 3HMMA 3VVHA 3UIBA 4O84A 3O0GA 4R3RA 5DEWA 4D9UA 4CEGA 3MN3A 3PUFC 1PJKA 3ORIA 4JDJA 1PXPA 4FKUA 2YWPA 2EXCX 5CSWA 3B2TA 3PLSA 5LVLA 1SNXA 3G9NA 4NT4A 3UNJA 1G8SA 1H8FA 4J71A 4DEEA 4L3JA 3OXIA 3N4VA 2ITYA 3NFGB 4MK0A 1YRPA 3FV8A 4H1MA 4HVHA 3BHHA 3CQUA 3M42A 2R3OA 2I6LA 4ZTNA 4AOJA 1Q8TA 4YUQA 4Y85A 3R01A 2I1MA 4JDHA 3NSZA 4I20A 4AN3A 4O86A 2JAVA 5BVWA 4EUTA 3UMXA 3BI6A 4OTDA 5ACBC 5DT0A 4NTTA 3MA6A 2A2AA 5L6OA 4G5PA 4S31A 4FJVA 3ODYX 1K9AA 3I4BA 3NW7A 3LCOA 3T3VA 3VULA 3QZIA 2RG5A 2WMTA 4LM5A 2VWUA 1PXJA 3N9XA 4FIEA 2WNTA 4FZFB 5FRIA 5I9ZA 5DT3A 5DR6A 5AX3A 5JFVA 4FTAA 4X3FC 2CCIA 3QCSA 3VHEA 3PSBA 1QPDA 2WMSA 3QGYA 2Y6MA 5AP3A 1ZYCA 3BE2A 2BDJA 4YNOA 4MNEA 5CI7A 5FTQA 4IACA 1O9UA 4FKTA 4D2RA 4MWHA 3F2AA 3MH1A 1XMMA 5DN3A 3KVXA 5CNOA 4FNWA 4BCOA 2BVAA 1WZYA 2XK4A 3BZ3A 4RC4A 2CKEA 3QC9A 4ZMEA 2BDWA 3ML1A 4HYUA 3EKKA 2B52A 3AT4A 2GHLA 4CZTA 4BY9E 3HP2A 4KA3A 4NM5A 5T3QA 5FEQA 1OKZA 3QTWA 4QP7A 3EL8A 5A4EA 2ZM4A 3MVMA 1WBWA 2VN9A 4IAYA 3KY2A 1FPUA 1NVSA 4AG8A 2Y4IC 5EI2A 1Q5KA 4RWIA 4BBMA 1XH5A 4PNKA 3I6WA 4IWQA 3R21A 2WQNA 3TI1A 2XUUA 4GVJA 2P3GX 1ZYDA 2XNEA 1QCFA 5CEOA 4DGGA 2HW6A 2W5AA 2F49A 4J8NA 4PY1A 3ANRA 4GT5A 3HNGA 3FY2A 4AGWA 3A7IA 1XBAA 4G6OA 3FSFA 3C5IA 5D10A 4N4SA 3NAXA 4ASDA 4KKEA 5LARA 4FV5A 3UIMA 1MP8A 3ELJA 5BMSA 4O7LA 2J5FA 3SG9A 4FTMA 4WRSA 2QQ7A 3NYXA 4E8AA 3C1XA 5CSXA 2AYPA 5BVNA 3R7IA 4IW0A 4MTAA 3R8LA 3V51A 2WTVA 4M14A 4BHNA 2C6EA 4MNFA 5CU2A 3ZCLA 5LCKA 4L44A 4DH7A 2XEYA 4QQ5A 5EG3A 4RX5A 3GC8A 3GI3A 1J7IA 4FSRA 3OCSA 3PPZA 3R0TA 3PVBA 1G8AA 3FMEA 2Y7JA 3SX9A 3A2CA 1Y6AA 3MBLA 3OT3A 3FLYA 4XG6A 3UQCA 1WCCA 3PE2A 3R9DA 3W1FA 3R7YA 3EQHA 4FYOA 3GC0A 4G16A 3DLZA 5HBEA 4BDFA 2OF2A 3VBYA 1RE8A 2PSQA 2XNNA 2WTDA 4U9AA 5DPVA 3U55A 2R3GA 2AC3A 4QMNA 2A1AB 3NW6A 5BUJA 4O21A 3EFWA 4FTRA 2RFEA 4O96A 4BDCA 4WRGA 3VJNA 4B4LA 3DB8A 3ULIA 1M2QA 3UIXA 4AGDA 3KL8A 5AFVA 5F1ZA 3HGKA 2OFUA 3I79A 4LL5A 3DFAA 2XARA 3PDTA 3FMMA 4O81A 2QURA 3CSVA 5JEBA 1YDSE 1PKDA 3O23A 4ZTSA 3KC3A 1ZYJA 3PZEA 4JG7A 5IA5A 2VTJA 3R8PA 4A9UA 1TFFA 3ENHA 4K11A 3G9LX 4DTAA 2R0IA 3VUDA 4PMPA 2X1NA 3BKBA 1S9JA 4IVDA 4MQ2A 4FNXA 4ZS4A 1UVRA 2PZIA 3OXZA 4IB5A 4IX4A 4YBJA 3ZEWA 1XH7A 1WBPA 2BHEA 2PVFA 4IAAA 3DDPA 4C59A 5L2TA 3ROYA 4HW7A 3FI3A 4CFFA 4F08A 1ZMUA 2W4KA 5HIEA 3NR9A 3COIA 3TZ7A 3CC6A 5EM8A 5DA3A 4USFA 2VGPA 3LIJA 3E8CA 5LCJA 2H34A 4R1VA 3ZFXA 3UDTA 2IW8A 4UZDA 4FG7A 2XNBA 2XNMA 3AXWA 4IC7A 5M08A 4TXCA 3OUKA 3I0QA 4FV7A 2A0CX 1GZNA 3TZ9A 3BEGA 1GY3A 2WMAA 4H3BA 3K5VA 4MXYA 2B53A 4JBQA 3C4EA 4FV3A 2PY3A 3QHWA 2VWBA 3TYKA 5BVKA 5EQEA 3PIYA 4E5WA 3E3BX 4M67A 2FGIA 3I5NA 3O5AA 5DBXA 5BVDA 1ZY5A 2XANA 5DFPA 4O91A 2UZEA 3ZC5A 3W2RA 2E9PA 4EZ5A 3PXFA 3R8ZA 5C26A 5H8GA 5A4CA 5C9CA 4EQUA 1VR2A 2RFSA 4XG2A 5E8WA 3UMWA 1IRKA 3PA4A 3PUPA 4F63A 3ZUTA 2UZNA 4LMNA 3U4UA 5A4QA 3PXKA 4IJPA 3JPVA 3NS9A 3CP9A 4RJ5A 4OTHA 1LP4A 2REIA 1YWVA 4AA5A 4W4VA 3O8UA 3FL4A 5JZJA 3EN6A 3TMOA 3PLAE 3ZLSA 4PL5A 4UY9A 1XH6A 4M12A 1OUKA 4WNPA 2DUVA 1R0PA 3IDCA 4OR5A 3EQIA 4TYJA 4O38A 1YXTA 5AA8A 4GCJA 3NCZA 2QO9A 1V1KA 2A19B 2VX0A 1UKHA 2J7TA 2W1CA 4S30A 5GIOE 2OK1A 2GMXA 3KA0A 4YC3A 1H1QA 1R39A 5HCXA 1W98A 3OROA 1H07A 4GYIA 3GCPA 4GKHA 4AAYA 3F5PA 3QKKA 2C5XA 4FZDB 4AZWA 4D58A 4ITIA 3IQ7A 4ZMFA 1J7UA 4PMSA 5CVFA 3ANQA 4UBAA 3ZC6A 4BCNA 5A14A 4GK3A 4L3LA 3BWJA 2IVUA 4BHZA 5C8NA 4TKSA 5CQUA 3W8LA 3QZFA 4U45A 3AD6A 1PYEA 3MSSA 4NJ3A 4AE9A 4K9YA 1PKGA 1H26A 4BDEA 4L8MA 5I9UA 3JS2A 4G1WA 4IHPA 3UOJA 1Q41A 3G6HA 5HO7A 5DGZA 3ZRMA 4AGCA 1JLUE 1PW2A 4JBPA 4WSYA 1JAMA 4J99A 1VEBA 2E9VA 3AC2A 4IB3A 3G33A 4TPTA 4XEYA 2CDZA 4ZTMA 5GINE 3QGWA 3ZSGA 3FAAA 2OG8A 3I6UA 5BYLA 3HMOA 5E9EA 4PL4A 2QOIA 2YABA 2ZYBA 5DE2A 5ANDA 5TF9A 3QD3A 4FEUA 2WZJA 4X2JA 3RGFA 5IUIA 4LMUA 3GT8A 3II5A 1BKXA 1UKIA 2YJSA 3UBDA 2IG7A 4EK6A 2YEXA 4GSBA 3OVVA 4AA0A 5JMSA 3U6HA 5E91A 4IB0A 4LFIA 2IZUA 4HPTE 4TN6A 5EDQA 4YPDA 1G8KA 2YACA 5EW9A 3F5UA 2XRWA 4X0MA 2PVJA 3A8XA 3AD5A 5KBQA 3K2LA 4S2ZA 3G0FA 2NRUA 4QMLA 2OF4A 5J9YA 2UZOA 2WMUA 2XM8A 2JDRA 3KMMA 2J9MA 3HV7A 3OWLA 2WIPA 3VUIA 2Z02A 2QO7A 3CQEA 2C5VA 4DFZE 2W9FB 4H36A 4AUAA 4ZZOA 2P2HA 5KX8A 4AS0A 3L8XA 3D2KA 4O7WA 4JBVA 5FEEA 3TL8A 2O8YA 3KF7A 3VW8A 4EZ7A 3QUEA 4DITA 3R9NA 4RFMA 4EH9A 2XK9A 3ZH8A 4YHJA 4ZY5A 3UOLA 2I0YA 4PDSA 4I0RA 2EU9A 3GNIB 3DTCA 3LCDA 3NIEA 3Q60A 5GJGA 2VX3A 4R78A 4AZSA 4MQ1A 1H24A 3WOWA 5I9XA 4BZDA 4WUAA 4EC9A 3R73A 4RVKA 4YNEA 3WYXA 2OXDA 2UUEA 4B9DA 4RC2A 3OG7A 3R7UA 3G2FA 3O17A 4EYJA 4V05A 2WGJA 4XMOA 1XMLA 5IH5A 4I21A 4N70A 3LFQA 4YP8A 5FP6A 2HY0A 4IH8A 3SHEA 3P7CA 4FT7A 4AW0A 4USDA 3TIZA 4NCTA 1KWPA 4QP2A 5KBRA 3FLZA 3PJ8A 5CEMA 3CKXA 3VQUA 2QG7A 2GS7A 4ACHA 3ATTA 2AEGA 4OLIA 2WQBA 4IFCA 4EOLA 5FXRA 1XBBA 3QU0A 3BHUA 5AUUA 5ANEA 5CAUA 5IDPA 3BV3A 3B8QA 3MFTA 3W2SA 2Y4PA 3BEAA 4JXFA 2OBJA 1IAHA 3ZFMA 1ZZ2A 3CBLA 3R1SA 4YLLA 3HRBA 1LR4A 1H01A 3NUUA 2C1AA 2GHGA 4BGGA 3FYKX 1U5QA 2XIZA 4QNAA 4DC2A 2X2LA 2WTJA 3GP0A 1A06A 4ZLOA 1ZAOA 5EI8A 2W1DA 2YCQA 3POZA 4QPSA 2Z7RA 2ZB0A 4LRJA 3E64A 4XLVA 2VWIA 2VTNA 4OBPA 4BZOA 4DDIA 1Q62A 4L67A 3AT2A 3H4JA 4FEVA 3GCUA 4GV1A 4RIYB 5EM7A 1VYZA 2ZV9A 3E5AA 3QRUA 1UNLA 5E1SA 3MV5A 4BTKA 1ZLTA 4ZY4A 2QVSE 4AZTA 4GS6A 3PP0A 4IAZA 4QMMA 3VQHA 2UZLA 1E1XA 3IGGA 3MY0A 3TM0A 4I22A 5LMBA 5LVOA 4CMTA 3E8DA 1R1WA 3IOKA 3N4UA 4WZYA 3DA6A 1IA8A 5KCVA 4UXQA 4P5ZA 2H9VA 5FG8A 1JBPE 3V3VA 5J7HA 2JIUA 3RZBA 2HZ4A 1UU7A 2XCHA 4Y95A 4QNYA 4G3DA 2BZIB 3FZPA 2R7IA 2PVMA 3VBTA 5IEYA 3GU7A 4BBEA 3QRIA 4J53A 4EQMA 3DAJA 4YC8A 1AQ1A 1OIUA 4YU2A 4BJJB 2C6IA 5BVFA 2UW0A 5CT7A 2QHMA 2ZM3A 1XH9A 3C0GA 3R63A 5KUPA 2VTIA 4RG0A 4DHJA 1SVHA 2C6MA 2RGPA 4C2VA 4G3CA 1P4FA 3W16A 4IAIA 5EW8A 3FI4A 2R3QA 4OTRA 5HHWA 1OITA 5GIPE 3F6XA 4P90A 3IW4A 4RMZA 3E62A 5HE3A 3UP7A 5JN2A 4PX6A 4TZRA 2WU7A 3C7QA 3UDBA 1WBVA 3BYSA 2OJ9A 2WB8A 1FGIA 3GU8A 3U6JA 4AACA 2GS2A 2F2CB 3PJCA 1M14A 4AU8A 1SNUA 3QTUA 1UA2A 3HV5A 1P14A 4CFVA 4D1ZA 1JKSA 3L8PA 5A3XA 2WELA 5FQDC 4MBIA 3IDBA 5CENA 1URWA 4FKGA 5IQEA 4G3FA 1Q8WA 4A9TA 2GNIA 4PRJA 2CGWA 1PHKA 4BCPA 1OKWA 5HNIX 2GQGA 4JX7A 4QYEA 3WF7A 2IZRA 3LM0A 4EH3A 4FSTA 1I09A 3TT0A 3D14A 2QU6A 4I23A 4U3YA 3MH0A 2BZJA 3FZ1A 5IQHA 3HLLA 5CLPA 2CKPA 2X6EA 3NLBA 3HA6A 3LFAA 2Y9QA 3AC3A 5EDRA 4O7TA 3F2RA 4I6BA 3D9VA 4XOYA 4RVTA 4U44A 3KXHA 3QRJA 4UALA 5HE2A 1MQ4A 2J0IA 4JMQA 4ALWA 4AW1A 5HLPA 2OIBA 3R83A 5KKRC 2OZAA 4Z9LA 3W10A 2XK6A 5IMXA 4TTHB 5JQ8A 1XH4A 3FUPA 5E8SA 3F5GA 1JSUA 3NPCA 3F5XA 5EM5A 4O0RA 4FMQA 1MRVA 1OM1A 4M3QA 1SZMA 3OCTA 3VS6A 2XEZA 1FVVA 3WZEA 2QONA 2X4ZA 1WMKA 4ARKA 4E7WA 3Q2JA 4ZSEA 1REKA 4F6UA 2XYNA 3ETAA 5EOBA 3ZRKA 5IA1A 2UZVA 3ACKA 4L46A 4MD7E 3D7TB 4FR4A 4MXAA 2FH9A 1Z57A 3TUCA 2PE1A 3BBWA 4AZEA 5DRBA 3BPRA 3Q32A 3PY0A 4DG2E 4CG9A 3QKMA 3HA8A 4S34A 2VTLA 4IIRA 3OC1A 3FPQA 4USEA 4Q5EA 4U5JA 1Y8GA 2XNOA 4ZSLA 4ZSJA 1U54B 2RKUA 3MH3A 2XZSA 3QD2B 4QT1A 4ZJVA 3OEZA 3DKFA 3QAME 2WKMA 3DZQA 4S33A 4ITHA 2OWBA 4XS2A 4BCGA 3UQFA 3EN9A 3FDNA 3ZSIA 4BDIA 2KTYA 3BLHA 3D7ZA 2X81A 4QYGA 3SKCA 3ORXA 4EWHA 4QMQA 3LQ3A 1YI4A 4ZTQA 3R7EA 1WBTA 4HCUA 4RIWA 4CQEA 5B2LA 3EQRA 3R00A 4F78A 3RAKA 4FV0A 2YWVA 4RX8A 3V5LA 5I9VA 5C27A 4KS8A 4JQ8A 1TQPA 1IR3A 3QTSA 1O6KA 5C8MA 5BVOA 1OUYA 3FI8A 2QR7A 4BCHA 2BRGA 2YN8A 5DVRA 3V8TA 3CGFA 1Y57A 4CFXA 4YJOA 3ZEPA 4DFLA 3BU3A 3HAVA 1REJA 5A54A 2HY81 5CAVA 3F82A 5KMLA 2J51A 3DDQA 3A61A 4FC0A 4XG9A 3PVUA 3GQLA 3P0MA 3FHRA 3PVGA 4N57A 4FZ6A 3UYSA 3ULZA 1H0WA 4FKSA 3PE1A 4BIBA 4EOSA 4V0GB 3WZKA 2FSLX 2ZV2A 3E7OA 4E6QA 2R9SA 1OPJA 4TT7A 2E9OA 3QTZA 2BMCA 3K3JA 2P33A 2I0VA 1Q61A 2YIQA 4XG7A 3Q6UA 2C69A 4CV8A 5EM6A 4PP9A 5K5XA 1YWRA 4CTCA 4YSJA 4QYFA 5LJJA 4FTQA 4F65A 4AT4A 4Q2AA 4O7PA 3GU5A 2UZTA 3RNYA 4IZ5A 4QQTA 4IAFA 2IVVA 3U9CA 2F7ZE 3FMHA 3BHYA 4I0SA 4NUSA 4EK8A 4ZTHA 2PK9A 4EOKA 1OB3A 3F61A 4KABA 4C3FA 1FGKA 1YHSA 3DXNA 2ZMCA 4FVRA 4YO6A 3UQGA 3MW1A 4ASEA 4XUFA 4PTCA 4MXZA 4EOMA 3RWQA 2NNWB 2YM4A 3JVSA 4EQCA 4YZNA 3VS2A 4MWIA 3VRZA 2Y4IB 2E9NA 3NWWA 4XHKB 4DG0E 2UZBA 1ZY4A 4C58A 2YERA 4ZZMA 5CAOA 4U94A 2XB7A 4IE9A 4O0YA 2XK8A 2XJ2A 4A9YA 2BKKA 5A4TA 4RIOA 2W1HA 4R3CA 1H4LA 5E8ZA 2GFSA 2OZOA 3BYOA 4KAOA 3ORLA 4XV2A 4GJ3A 2X9EA 1I44A 4QMSA 3Q4TA 3M2WA 1URCA 3R6XA 2RFDA 4DCEA 3NUAA 3QWKA 3ALNA 4DA5A 2JFMA 4CGAA 2G2HA 3FLWA 3LMHA 3TACA 2PHKA 4O83A 4M97A 4YJRA 3RVGA 3Q5IA 5HKMA 4BI0A 3FKOA 3NNXA 5BUEA 4IEBA 3HECA 3AMAA 4L43A 3BHTA 1OL5A 4R5YA 2FB8A 2VTHA 3O7LD 4NU1A 4EOIA 2JDTA 3HKOA 5E8VA 4Z55A 4CKJA 2YAAA 2AC5A 4FSUA 3GCQA 4TY1A 3TKUA 5IG1A 5CU3A 3LJ0A 3NNWA 3P4KA 4AOTA 5IZFA 3MVJA 4EEVA 3EQDA 3OXTA 2GPHA 3QYZA 3BLQA 3NVMB 2XH5A 2WO6A 2V62A 5B0XA 4L01A 2CNVA 4QOXA 3KN5A 4RIXA 3KF4A 4C36A 4FSQA 5AUYA 3SVVA 5LWMA 2IWIA 2I40A 2UW8A 4U98A 2JIVA 2H6DA 4MXXA 2QOQA 5AM6A 4B0GA 4E93A 5HTBA 2PE2A 5CT0A 1KV1A 1BL6A 1CKIA 2RF9A 3DQWA 3KXGA 4CV9A 4E6CA 5JH6A 5E92A 2R3KA 5FM3A 4GT4A 4MBJA 2Z60A 3VNTA 5KE0A 2C0OA 3NUSA 4BC6A 3FXXA 3GCSA 1E1VA 3IECA 3Q4ZA 2ZV7A 4KIOA 4MBLA 3ZMMA 5JT2A 1PRYA 3CPBA 2HIWA 4KRCA 4EORA 3CS9A 1Z9XA 5HQ0A 5H2UA 3MFSA 4EOQA 3V5PA 1KUTA 4PP7A 1B39A 2OO8X 3MB6A 3MTFA 2BILB 4GG5A 3UP2A 4PV0A 4WNMA 4CLIA 4DEDA 4J7BA 3PRFA 3BYVA 4D1SA 3DK3A 2VGOA 1FBNA 4F70A 3CTQA 4QMVA 2PVHA 3RPVA 1SVEA 4DLJA 4Q9SA 5CALA 3C51A 3CE3A 4NWMA 4UXLA 3IKAA 3UO5A 4IZ7A 5AV0A 1PMEA 3A7HA 4C4FA 3KULA 2J0KA 3OHTA 4JR7A 3SRVA 2ZAZA 4H3PA 4BIEA 3F69A 3TTIA 5JZNA 3RPRA 5IU2A 2CJMA 1Q8UA 4R7HA 3BIZA 4EK5A 1HOWA 1NT2A 3GVUA 4NYEA 3DBCA 4HGLA 3U8WA 5LQFA 4CFMA 1RDQE 5EKOA 4WUNA 3GEQA 2YCFA 3OWJA 5CQWA 1OL2A 5EI6A 2G15A 5CZHA 2X7GA 4E26A 1FINA 1O6YA 2W1GA 2SRCA 5DLSA 2CNUA 4IMYA 3V6SA 4BDDA 2XJ1A 4BCIA 4CRLA 5BNJA 4JG8A 5EQYA 4A07A 4Q9ZA 4NW6A 2R3RA 3LXKA 2ETMA 3AG9A 4WBBB 4FV9A 4K0YA 2QLQA 1CKPA 5JRSA 2R3NA 2X7OA 3W0PA 1OL1A 1G5SA 4DINA 2VTPA 3MPAA 3PFYA 2GQRA 5CU4A 1NVQA 4FKWA 3UIUA 3OBGA 3NYNA 3OW4A 2UVZA 3W33A 2AUHA 2Y0AA 2VUWA 5AJQA 4AQCA 1L3RE 4NJDA 3DKCA 3CD3A 4C4EA 2O64A 3NFFB 3GENA 2WU6A 3BQCA 3N4TA 4MYGA 1YKRA 4U43A 3L9PA 2J5EA 4M7IA 3EQGA 3GQIA 4H1JA 5DWRA 4LUDA 2WOTA 3RPYA 3WZDA 2Z7QA 4AZVA 5GHVA 4OUCA 4B7TA 5A46A 3Q6WA 3R9RA 5I9YA 4RLKA 4RVMA 5B2KA 5IA0A 4EH7A 3IDPA 4GFMA 3TNHA 3DU8A 3IO7A 1L8TA 3EH9A 4LV7A 3QQJA 3RPSA 4OBQA 3DT1A 2BPMA 5BV3A 1QPEA 4F4PA 3C4FA 3P7BA 1YOLA 5F95A 3IW5A 2CMWA 3OEFX 4QYHA 3WI6A 4MHAA 1X8BA 2QR8A 3RK7A 5K4IA 2VNYA 5DG5A 1TKIA 3LPBA 3O50A 5JKGA 4Q5HA 5D7AA 3QRTA 1WBOA 5EFQA 2JDSA 3HX4A 2JLDA 4B99A 5BYZA 4YMJA 1GZKA 2EXMA 3AQVA 4TYHA 5FBOA 5HGIA 4FIHA 2CKQA 4WA9A 5D11A 2W1IA 3W8QA 2OJFE 2QO2A 3PP1A 4ZXTA 2HCKA 3MESA 4Y5HA 3ZXTA 5CNNA 4F6WA 2VO0A 3KKVA 3U4WA 1OPKA 4GRBA 1YQJA 2XVDA 3SQQA 2J0JA 3GOPA 3LMIA 4EBVA 3MJ1A 4HGEA 4RA5A 4FA2A 3WZUA 4APCA 3E8EA 3TIYA 5KMNA 1IASA 4L9IA 5L2IA 2UZWE 4HCTA 4D5HA 4D4YA 5AMNA 3HP5A 4GEOA 5HVYA 3KMWA 4FG8A 3ROCA 4FV8A 3NGAA 1JKTA 2OFVA 1H1RA 3Q5ZA 2XA4A 1J7LA 2NPQA 3ZLXA 2OJGA 4GIIA 3SC1A 4F7LA 4WG5A 3O7LB 4W4YA 4PUZA 3PTGA 4YJSA 3VWAA 4R1YA 1ZYSA 5EOLA 3QCQA 1OGUA 4KKGA 4GG7A 4I5CA 1T46A 3CY3A 1DAYA 1M17A 3PJ2A 4FV2A 4JRNA 4XG4A 1UNGA 1NXKA 2PL0A 5E8YA 3AKKA 1UU8A 2BHHA 2PWLA 3C9WA 1NVRA 4FSMA 1SM2A 4ZAUA 5AUVA 3DFCB 4M15A 4O7YA 5EHOA 5KZ0A 3SA0A 2F2UA 2UW5A 5HE0A 2QODA 4HZRA 4RJ4A 2WHBA 2YCSA 1A48A 2YZAA 4EJNA 3RINA 4FBXA 4Y8DA 4YR8A 3IK3A 1PMNA 3GOKA 3MPTA 4DFXE 1H0VA 5J95A 4FKPA 1RW8A 4B8MA 3VBWA 1XO2B 3KRLA 3QALE 4FVQA 5CU6A 4UB7A 3VS0A 2Z7LA 4E4XA 4FTUA 2VWWA 4F1OA 3HRFA 4GIHA 4E1ZA 5CEQA 3LQ8A 3O71A 4M0ZA 2J4ZA 3HV3A 4FEWA 4F1TA 3EB0A 3RAWA 5JGBA 5KMKA 1M7QA 5AV3A 4E4LA 2HZIA 5ACKA 2BCJA 4CXAA 3PA3A 3LFBA 5TKDA 1Y91A 1U59A 4DBXA 1YI3A 4L6QA 1G3NA 4DFBA 4R7BA 4F6SA 5EH0A 1JSVA 2XNGA 2YDIA 2B1PA 4C62A 1T45A 2VTSA 2X4FA 2GU8A 4KS7A 4MUQA 2G1TA 4L7SA 1QMZA 4AFJA 4FKLA 4EBWA 3QTIA 4AN9A 4D2SA 1K2PA 3CXWA 1GAGA 5CYIA 3D5UA 5G6VA 4JI9A 3UC3A 4BTJA 2QOCA 3WF9A 4X7QA 3F3ZA 3I1AA 4NFMA 1Q24A 4QMUA 3PJ1A 4L7FA 3KRWA 4DLIA 5HE1A 2R3PA 3EZRA 3L9LA 4J97A 3OCBA 3TUDA 1VJYA 4ZTRA 1IEPA 3MGYA 3UE4A 2QOLA 2BRHA 5C8KA 4ZEGA 4CT1A 2J0MB 5AP4A 3ORPA 5IUGA 3IGOA 5C4LA 4KNBA 1OGYA 4CT2A 2NYAA 4YZDA 1P4OA 5HEZA 5HX6A 2F7XE 4IWOA 2P0CA 3BHVA 4H05A 2PZ5A 3LXLA 4FTKA 2F4JA 4HGTA 3P79A 4LYNA 5J87A 4BDAA 4DCAA 3GXLA 3A8WA 2DS1A 4IC8A 1O6LA 1MQBA 4KUJA 4PF4A 4U81A 3DK7A 2WTWA 1XWSA 2UV2A 2YIRA 5AP5A 5HO8A 2WMWA 3VS4A 4AFEA 4DFUA 1M2PA 1LEZA 4Y72A 1B6CB 2W99B 1S9IA 4DEHA 2WTKC 4FSYA 4LV8A 2OJIA 4KSQA 3VBQA 4GT3A 4GK2A 4MEDA 5HLNA 3R22A 4K77A 4YJNA 2R0UA 5ETCA 5G1XA 3SGCA 5FDPA 2R4BA 2OI4X 5JGDA 1V0BA 2Z2WA 3OFMA 3PWYA 4YZ9A 5HG9A 2LGCA 3LFCA 1EH4A 4DEGA 3QC4A 3P7AA 4FSWA 3TG1A 3OUNB 3TN8A </