1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
molecule keywords Fibrillarin-like pre-rRNA processing protein
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
5FEDA 2P1DA 1GOLA 4ZZNA 3I79A 1M0EA 3DNDA 3ZLXA 3G5TA 4LRMA 1Z5MA 1GNGA 4PF4A 3AC5A 3VUHA 4ENYA 4F9YA 1H1QA 1O6LA 2I62A 3VC1A 4BGGA 4EOOA 4FKSA 1V1KA 3P9JA 3ZFXA 4EQCA 5KBRA 2PXCA 2ZJWA 2QC6A 4PTEA 4U3YA 2OFVA 2XJ1A 2B55A 4RG0A 4BTJA 4F0FA 4ZY4A 5C4KA 1WMKA 3TKYA 1ZY5A 3EN4A 5EI6A 1UU8A 3DDQA 2IDJA 4NU1A 4RJ5A 1Z57A 3BU5A 3P7AA 4RIWB 4GYGA 1AD5A 4C4GA 4QMYA 4FTIA 3LXLA 3A62A 4DGGA 3PSBA 5J95A 1EQAA 2BFXA 3EN6A 3SXJA 2UYHA 3ER8A 4FTRA 5EKUA 2I7QA 4LWOA 2I6GA 3HMMA 4RJ4A 4R77A 8MHTA 4XRJA 3NUYA 4DH5A 2W5BA 3BGQA 4QPSA 2ZV2A 3GXLA 1FOTA 3FL4A 4O83A 5DR6A 3BYMA 2J0IA 4EWQA 5HZNA 4AGCA 3OY3A 1H1SA 4RLLA 3UIBA 4BVUA 2BMCA 5FXQA 1SYKA 1A48A 3KC3A 2QOFA 2YDIA 3QKKA 3GVUA 4N4SA 2W5HA 4I6HA 4IC7A 3C1XA 4D4RA 3QOXA 1XBCA 2AVNA 5AV2A 2C4GA 4A6EA 2RG6A 3GCSA 1FPUA 1SVEA 2O8YA 3KKVA 3TCPA 4C61A 2B53A 3BU3A 4C4IA 4EKIA 2JIIA 1H1WA 1ZOHA 2OW3A 4J99A 4FEVA 4OBPA 3ELDA 3G8BA 4WNMA 4QMWA 3UZPA 3BZ3A 4LI5A 4DG2E 4FA2A 2WQEA 3CBLA 5EOLA 4DEDA 2DULA 4G1WA 2XB7A 3PRIA 1Q5KA 1X19A 4X61A 3UJ7A 3TM0A 2X2LA 3LLAA 3BLQA 3VQUA 2IPXA 3VBYA 3HKOA 4PP7A 3MYGA 4G6OA 1KYZA 3I9FA 2WTWA 4UBAA 4AW1A 2WMSA 4EKLA 1BMKA 3FPMA 3FZSA 3LCOA 2FGIA 4DG3E 4E31A 2B9EA 4OGRA 3TACA 4RSRA 3KQ7A 4HYUA 5CEPA 3FC1X 3LIJA 1CM8A 4PL3A 4EWHA 5DT2A 4D55A 5TO8A 3S2PA 4U7PB 3ROYA 2VX0A 1Q3WA 5KO1A 3IS5A 4YPDA 5FM2A 4F1OA 4ERWA 2PWYA 5D12A 2JDTA 2ZB0A 1IA9A 1ZYCA 4OW8A 3HVIA 1XR1A 3FKOA 2HXLA 5CQUA 2HIWA 3UNZA 3UGCA 4RVFA 2X6EA 3LCKA 1PXPA 3HVKA 3QA8A 2W1ZA 2CCHA 1AV6A 3QTIA 3PJ3A 2RL5A 5HNBA 2WTDA 3LFNA 2OU7A 2QR7A 5T3QA 4CMOA 2C6LA 4OBQA 5ICGA 3PVWA 3QYWA 4WUNA 4YMJA 5BVWA 4CKJA 3FI8A 3UOJA 4PNIA 3R1NA 3RGFA 5AP3A 3SRVB 1LEWA 4FBXA 3C0KA 2W96B 3SOCA 4HGYA 3HUBA 3CY2A 2OIBA 3LCUA 4C03A 3O7LD 3PRFA 4EHEA 1YHWA 4DBNA 5LVMA 2ZBPA 3E7PA 4CD0A 5DI1A 1I09A 2ITZA 3DK6A 2YXEA 1F5QA 2ZM1A 4IDVA 1Y8GA 2O06A 2JHPA 4QQ5A 4ISCA 3RNIA 5ICFA 2HXQA 3B8RA 3UBDA 3HCEA 4EH8A 4ZTMA 5LVNA 3EVBA 3ZBXA 3I64A 2IDKA 4JBVA 4FICA 1SMHA 3O8TA 2B54A 2P0CA 4Q9SA 4FSTA 5J8IA 4Q2AA 3DMHA 3TFWA 2KULA 1JLUE 3BQCA 1MHTA 3R9OA 4DH3A 1NV8A 2CJMA 5DOSA 4FOBA 5EQJB 1GZOA 4I5CA 5C8KA 1VE3A 3EOCA 3C4WA 5LQCA 4MNEB 4L67A 4QNYA 2X8IA 3R1SA 1WCCA 1O6KA 5DPVA 4TPTA 5AA9A 4PONA 4MQ1A 4QVGA 4KNBA 4K9YA 2OF2A 3GENA 1E1XA 2XRWA 2P40A 3FHIA 4FNZA 2QKWB 3THSA 5E8XA 3VW6A 3OCTA 3FLQA 3C4XA 3R22A 3THBA 4BCOA 5JRQA 2GLUA 5K5XA 1ZLTA 2B1PA 3LQ8A 4J8NA 3MI9A 4IWOA 4X2FA 2P3GX 4H3BA 3PJ2A 2B9IA 3R7OA 1Q0SA 2H96A 2ONLA 5AUXA 3D7ZA 4OTGA 5BVEA 3NYOA 4I93A 4AUKA 4YTFA 4YLLA 1VJYA 4I0SA 3FLNC 3FZTA 4HCUA 3VS3A 4R7HA 2R3KA 3NTVA 3D2IA 5C8MA 1TQIA 3QRJA 5J7HA 4JVGA 2BRNA 4FUYA 3DY7A 4D58A 4ZLYA 4NKSA 2GNIA 4HPTE 2Y1WA 4YZDA 4AW2A 3UQCA 1V0BA 1Y91A 4GJ2A 4HZRA 2YIYA 4V05A 1Q0TA 1WFCA 4KVZA 3UQFA 2XVDA 2NP6A 3DS6A 5GM2A 4R05A 2ZMDA 3EN7A 4MX9A 4UWCA 1GZKA 3OS3A 2J5EA 3DOGA 4BIBA 1XH7A 3OP5A 3ZLSA 3D15A 4A9UA 2PZYA 3ORKA 4GCJA 4PWYA 5CYIA 5FTGA 3MJ1A 3NNUA 3QQKA 2CSNA 2I0VA 2PMOX 2Z2WA 2ONLC 1JVPP 4M0ZA 3LX6A 3A27A 4DITA 3DU8A 5LQKA 2ZBRA 3DLCA 2ESMA 4F99A 2OG8A 3GFEA 2PBFA 2BZHB 4YPSA 3I0OA 4I0TA 3UJBA 4BP1A 3LFQA 3I7BA 3UOHA 5C8NA 4BLWA 2YM4A 2VU3A 3FZ1A 3KREA 4AFJA 2XK3A 3DK3A 3JWHA 5H02A 5CCBA 4MWHA 5D1NA 3QGYA 4X3JA 2HOGA 4E6DA 3BHTA 5AJQA 1UIRA 4BDAA 2XEYA 1OKYA 2WGJA 3GUBA 3ZXTA 2W9ZB 4AX8A 3OZRA 3SSOA 3LDFA 2FSLX 3QTWA 3AXTA 3C6MA 3HVHA 4RJ3A 2RIOA 4M68A 4TRLA 3Q6WA 2HZ0A 4V01A 4X3FB 3G6GA 1GAGA 4EK9A 4G31A 2VO7A 2YCFA 2JHAA 2QOOA 3UNJA 2I6LA 3M6UA 4RWIA 1J7UA 3HMIA 4FNXA 4GFMA 2WZJA 4IV8A 4TYJA 2Z7LA 3ZC6A 3KKZA 5LQAA 3GC7A 3CGFA 4EHVA 5J9YA 5KKRB 4EOLA 2AR0A 2V5QA 4Y5HA 3ZS5A 3WSTA 3I6UA 3DB6A 2JLDA 1YZ3A 1J1CA 4ZAUA 1UNGA 3KU2A 4IB5A 1REKA 1T45A 2P2IA 3C0IA 5LCKA 3WF5A 4AWIA 5A4TA 4KIOA 4F9CA 3DBCA 3BYSA 4DFLA 3S0OA 3DULA 4FL1A 4ALVA 3LBYA 3P9NA 2RFSA 5GNKA 5E8VA 2QOBA 3LSTA 1RJFA 3MA6A 5H8BA 3V5TA 3UZUA 2ITTA 3LJ2A 4X3FC 1OKVA 5CVFA 3DMFA 4CTKA 4P58A 4L9IA 5CUQA 4E2ZA 3JUHA 4QP2A 3R8MA 4PNKA 1NW5A 2CCIA 5B2LA 2G1TA 3DBQA 4N57A 3SRVA 5DRYA 2YIXA 4LMNA 3QD2B 4JDJA 2BZIB 3C50A 1YI6A 3ORMA 3HLLA 5LMAA 2YITA 1Y8CA 2H1RA 1OL6A 2B52A 4BGHA 2PJDA 1BI7A 4MQ4A 5CSVA 4GOND 2HY81 2FK7A 3CQEA 4MQ2A 5AA8A 3VHEA 4X21A 4HVGA 2H00A 4FKGA 3LMGA 4M3QA 3RHKA 2PMNX 4MVFA 4S2ZA 3UMXA 1PXOA 4BRXA 1R18A 2R2PA 4WNOA 2AOXA 3PP1A 4WA9A 5ETAA 1NKVA 3HNGA 1EG2A 2XK4A 3CC6A 4ER6A 2UW8A 4H3QA 2FK8A 4QYEA 5HESA 3Q5ZA 5AM7A 1YVJA 1PHKA 2EUFB 2VZ6A 3OU2A 3ID6C 1M17A 3R6TA 4GC9A 5D7AA 4E5BA 3N9XA 5DEWA 3ZUTA 3Q5IA 4G3CA 4MYGA 3MH1A 3SAYA 2R3OA 5DLYA 2IW9A 1Q8UA 2UYQA 2NNWB 3QV2A 1PXIA 3A7GA 5H8EA 4A4OA 5I9YA 1X1AA 4FV2A 4P7KA 2ZZNA 3BHHA 5FDPA 3UJDA 1XWSA 2BHHA 4RIYB 5P8WA 4ANLA 4KAOA 3QX2A 4M97A 2YN8A 4MEDA 4AOJA 3HCDA 2A1AB 4IDTA 4U81A 4JNWA 4G6LA 2WU7A 2F2UA 3HUCA 4PMTA 5EW8A 4J71A 3EIDA 5CSWA 5EI2A 3CPBA 4XG6A 2X1NA 5IKMA 2BZKB 1NA7A 2OLCA 2QD9A 3OCGA 4H05A 2VNWA 4DG0E 4YZBA 2VO3A 2NXCA 3ATTA 5KS2A 5GJDA 2Z60A 3DFAA 4QP1A 4O7SA 3FUVA 3ZUVA 3MTEA 1MQ4A 2ZWAA 3BI6A 3KRWA 2SRCA 3BGVA 3WZJA 5CD1A 4GF5A 2VN9A 5JK3A 1OGUA 1WBNA 3E88A 4MXAA 3SXSA 4YUZA 4BDGA 3O7WA 5EDPA 3P78A 2G2FA 3FZOA 3R63A 2PUUA 5CVVA 3QBNA 4RFZA 3TV7A 2IW8A 3OWLA 3BYOA 4DEIA 1ZOGA 4O96A 4YJOA 3QC9A 5AFVA 2ZM3A 3ZSHA 4ANSA 4FIEA 1ZZLA 4BDJA 4A6DA 5CVDA 2W1FA 1B39A 3QQLA 1QCFA 3O71A 3TNWA 3PXYA 5ANGA 4GUBA 4F1TA 1NBIA 4FT7A 4HW7A 3H9FA 3BX5A 3CD8A 4D1ZA 3O51A 2GQGA 4E6QA 1IAJA 3Q60A 4IVDA 4JIAA 4TYEA 5DHJA 3ENMA 5F94A 5L6WL 4YHFA 3T7TA 4FT3A 4LOOA 2OB1A 4DCEA 5EMLA 5K0FA 3VBVA 2UZEA 3OWKA 3HV5A 4QQJA 4LG4A 5HX8A 4V0GB 5HLNA 5M09A 3EL8A 2C6KA 5HBEA 2VZ9A 1LUFA 2G01A 5EYDA 3E92A 2OFUA 3Q96A 3Q32A 3CQUA 5BW4A 2HZIA 5L8JA 3N4UA 3QQUA 4XLVA 4QTDA 4LM5A 4FT4A 1KSWA 5GM1A 3H10A 4O0YA 3UOKA 3L1SA 4JDHA 1ZG3A 3PFGA 3UC3A 5EMMA 2QCSA 2ORED 3BGPA 2YERA 1PYEA 4PINA 3FHRA 3LFBA 4FV5A 2OZAB 4L3JA 4U44A 2Z02A 1PKGA 3QCSA 2Q0NA 5K9IA 2JH8A 1ZKDA 4N6YA 1Q3DA 4O7RA 4HPUE 1JQDA 3ZZEA 4RIXA 3HECA 5JGBA 3LXPA 3EFLA 3NEWA 3ZHPC 4JRNA 4YSJA 1KV1A 5EMJA 2BIKB 4D1XA 4PWNA 1QMZA 3RAHA 3IO7A 3ORXA 4QNAA 4EH9A 3F5UA 1OUKA 4PL5A 5A4EA 3TOSA 2VWIA 1RI5A 2HCKA 3I53A 4ANQA 3NIEA 4RTPA 3TDWA 1BX6A 3E5AA 2HELA 3F2NA 4ALWA 2WMXA 4KBCA 3Q9ZA 1JQHA 5JQ5A 3FPGA 3SR4A 2YAAA 4MBLA 2E9OA 3H0ZA 1SUIA 2FVDA 4NM7A 1ZMVA 5CF5A 3RINA 2H34A 1K9AA 5LOHA 3MIYA 3PA3A 1R0EA 4OTQA 2PT9A 3V5QA 3HRBA 4A9YA 1BKYA 3FMJA 3G2OA 5I9WA 1I1NA 1V0PA 3V8VA 4IMYA 4AP7A 4ZLZA 3G2MA 3U4WA 3LCVB 4P7JA 4CV9A 3VSEA 5JN2A 3VVHA 4PTCA 5LWMA 4M14A 1ZOEA 3RTPA 2YTZA 2C69A 5EKNA 5IQFA 4CCUA 4IX6A 3HMNA 4O0XA 4DE4A 3TT0A 3RPSA 3KCKA 3L9NA 4JQ7A 2GU8A 5JFVA 2HWOA 3ME5A 2QU6A 4RX8A 5JFSA 4F84A 2CGWA 3RALA 4ERKA 3QZGA 1YOMA 1QZZA 3EQFA 3PPJA 1B38A 3R28A 4FODA 3TM4A 2XP2A 2JDSA 4GEOA 4FV1A 5CZHA 4PTGA 4CKRA 1FP1D 3K0BA 3R8VA 4QTCA 3W32A 2ACXA 3L8PA 3Q2JA 4OTRA 4FYOA 2OJFE 3F7ZA 3QZFA 4GT4A 4QP7A 2EB3A 4W8EA 5EK7A 3V51A 3U6HA 7MHTA 2AVDA 4DFNA 3UJ9A 3MESA 1ZARA 3MFSA 3POZA 1TW3A 2Z6QA 4MXYA 5IA5A 4BB4A 2IVSA 3H9OA 2XIRA 2P8JA 1A06A 1Q62A 3OCSA 2IG7A 2QQ7A 2E9UA 4U97A 5HCXA 1KYWA 4DT8A 4HG2A 4O38A 3WE8A 3NWWA 5KYGA 3MHTA 4FUXA 4QMMA 4P7FA 4FIJA 1L8TA 2F7ZE 3D2KA 4HZSA 3VJOA 3HCAA 4QQCA 5DWRA 5EEHA 3TV6A 5EVJA 4FV0A 2Q83A 4OTFA 3UC4A 2IN6A 4CKEA 3JY9A 3JWJA 2R5TA 4JL9A 3SM3A 3OT8A 4WBBB 3FLYA 3QQGA 5JR3A 4DA5A 4YHJA 2JKMA 1W83A 3JY0A 4O6LA 2PZ5A 1U46A 4F08A 4BGQA 2H11A 2EWAA 3L9LA 4IW0A 5CLPA 4BDFA 3MCTA 4PGHA 3W2RA 1JBPE 3KFAA 4F63A 4ZTBA 4FSUA 3BU6A 1P39A 3GU3A 2VDWA 3FPEA 3OE5A 4ZS0A 1XJDA 5DRDA 4HVHA 1E9HA 4LQMA 4HVIA 1VEBA 5IH5A 5LJJA 2JG3A 1G3NA 1OBGA 3BE9A 1JSVA 2GTMA 2LGCA 3K54A 4BDCA 2PL0A 5IH3A 2ZOQA 3RZBA 4BC6A 1S9IA 3DJ5A 5I9UA 2B0QA 5IEVA 2FO0A 3EQCA 4ZP5A 5BVOA 4JR3A 3JVSA 4FNYA 2OZVA 3R7EA 3VUGA 4A7CA 5HVKA 2JAVA 4E8AA 3M6VA 3QCXA 3FTDA 3R9HA 3E8CA 5JFXA 5CAOA 4KBAA 2HWKA 1J7LA 4L44A 2BVAA 3PP0A 5ITAA 3VUIA 5EM7A 4FKUA 5FGKA 5IQAA 3FPFA 5EOVA 3DFCB 3C3PA 5CEKA 3PVGA 3KQTA 2OIQA 4XUFA 4CCBA 5FULA 1URCA 4YUQA 5A4LA 1VBFA 2BUJA 5CT7A 2PUNA 4AT5A 4ATNA 2JITA 2OGVA 4G2FA 4YSMA 3DKGA 3KN5A 3VBWA 2I0HA 5KMJA 5BYYA 5C1QB 2I0EA 3JWGA 2P35A 2QNJA 3A2CA 3QYZA 3FZRA 1O9HA 3UO6A 2IH4A 3PXKA 4CKIA 4TN6A 4BCQA 4PDYA 1WVYA 2C1AA 3EQIA 4U80A 1APME 4HVDA 2C3KA 3HDNA 4M84A 3MGGA 4FT0A 4E4MA 4KDCA 4OBWA 4YBKA 3BBTB 4PMMA 3AC1A 4M67A 4WG3A 4F6WA 2HW6A 3QTZA 4B17A 3NDJA 3I81A 3VIDA 4EK5A 3I7CA 1NVRA 4NSTA 4PV0A 5CVHA 1Q99A 1XHAA 2JAMA 4RSSA 5CTPA 4EH2A 4KKGA 3LW0A 3DAEA 4G3GA 3PVBA 4E4NA 4AZTA 4DFBA 2REIA 4X2KA 2V22A 1KE7A 3MW1A 4EJ7A 2NYUA 3MVMA 4XV9A 4X1OA 1RJBA 3HGKA 4L68A 2IFTA 3EGEA 4PYQA 2UW0A 3FMNA 4ORKA 3TIYA 3W2SA 1GZ8A 3CJRA 3OE4A 2IH5A 2JKOA 3BGDA 3I0QA 2W7XA 5EIFA 5KQRA 4O29A 4FSZA 4GOMD 4IQ6A 4ALUA 2PKWA 4YR8A 3V3VA 4O2ZA 4LYNA 2EG5A 3OEFX 3UO4A 4QDKA 4DEAA 3FAAA 1Q8WA 3LXNA 5TOZA 3RI1A 1RQQA 2PPQA 2QVSE 2GCDA 3QWJA 3RCJA 4MIKA 4FL2A 1ZGJA 3SX0A 3I5NA 4U3ZA 4LL5A 1CDKA 3V5PA 4EQZA 1YRPA 3R71A 4FSRA 3W55A 2YUIA 2W1GA 2WTKC 4GQBA 3KXGA 3G7UA 1UA2A 2RG5A 4QP4A 5JSMA 3PXFA 4Y5QA 2VWWA 4IX3A 1VZOA 3KULA 4KKHA 1QAOA 4BCJA 2G1PA 2BH2A 4TL0A 3ANXA 1FQ1B 1H1RA 2EX4A 4DFZE 3QUDA 4ER5A 3OVVA 3THRA 4EOPA 5CF6A 3EL7A 4FG9A 3PB3A 5DWQA 3R7VA 1IASA 4RWKA 3HV3A 5IG1A 2P2HA 3GU6A 4FTJA 3KXNA 2R3GA 2YJSA 4FR4A 4QMUA 4TYHB 2XYUA 2JDRA 1WVXA 3HVJA 2IH2A 3AC8A 4JQ8A 1JNKA 3TTJA 3EHAA 5AAFA 5KCVA 1OPKA 2VWVA 3FC2A 4PMSA 4RRVA 4I92A 1L3RE 3VW8A 1IM8A 1ZQ9A 3CD3A 2F8LA 3ZXZA 4R8RA 1TKIA 4HYIA 2FA2A 2RF9A 5AM6A 3U6IA 3G5DA 3T7RA 4Y85A 5K01A 3DKOA 1M6YA 2CGXA 2EJTA 5CEIA 3ZTXA 4Y83A 5DA3A 5IEXA 3LBFA 1JG2A 2OF4A 3E8DA 4F9AA 2VTQA 1I44A 2VTNA 4FKQA 4S30A 4EQUA 3SLSA 5A4QA 4TYHA 4XS2A 3F7WA 3GCPA 3V6SA 3EWHA 2YFXA 5HQ0A 1T46A 4WG4A 5ICEA 1PJZA 4D4VA 2EXCX 1JPAA 3FY0A 1G60A 1OR8A 4FZAB 1B42A 3AXWA 5CU3A 2ZVJA 1YXVA 1Z3CA 1PMNA 3DR5A 4Y2HA 3SKCA 2BM9A 2R3LA 3CKKA 4PYOA 3LXKA 4FV3A 5L3AA 1REJA 2UZ4A 2BRBA 4HYSA 5FQOA 4ZMFA 5IH4A 3D2LA 4JI9A 2P33A 3UJCA 3HX4A 4QMZA 3T7SA 4UXQA 4JDKA 4ACCA 2H6DA 4EUUA 3TKAA 3LQ5A 3SW4A 4R78A 5JRSA 2CGUA 4IAIA 4BIDA 2PVKA 3BHYA 1WXWA 4BDKA 2AN3A 5K4JA 3A4TA 3KR0A 5ICCA 4O6EA 2IZSA 2YZAA 5E2BA 2ZV9A 1SVHA 3ANRA 4FKWA 3C0GA 4R1YA 5IUGA 2O07A 2F7EE 3Q6UA 4EOIA 4DA4A 4B7TA 4F9BA 2FHPA 5TF9A 1UWJA 2FSMX 3KEXA 4LOPA 5DGZA 3VS4A 2XBAA 3ORHA 5EKXA 5FEEA 3WZDA 4DGNA 3ERKA 3PS9A 3ZRLA 3EYGA 3V5LA 3P71T 1M6EX 1L3CA 5DG5A 5HORA 3UQGA 5AUZA 1H0WA 3TKUA 2WA2A 2HWPA 5CI6A 3BIZA 3EVCA 4RWZA 3KPUA 4G17A 4CEGA 5KMOA 3P7CA 5AP2A 2PVLA 2VNYA 4B99A 2J0MB 2OBJA 2ZMCA 5HD7A 4HCTA 4QRCA 3I5UA 2PVFA 5HG7A 1YWRA 1FGIA 1ZXEA 1LEZA 3QHWA 4PDPA 2GPYA 3AD6A 1EJ6A 4E32A 1O54A 3P5KA 3QFVA 3FUXA 5HU9A 5E1EA 5M4FA 3QUEA 4PDOA 2ZAZA 3DJ7A 3ETAA 2OXXA 3EQGA 4W8DA 5HIBA 4ZY5A 5M57A 2N47A 4FGZA 3UG1A 4IX5A 4AFEA 4AXAA 2QM3A 3VBXA 3PLAE 1I9GA 3TV4A 4RBLA 3S3IA 5K0EA 4OTIA 2UVZA 4OUCA 1V0OA 2Q0BA 3QD0A 4X6RA 4X6QC 3UVRA 1J91A 3MS9A 2ZVAA 4BDIA 4F65A 5JT2A 2BAQA 4G34A 4DMGA 4WUAA 3D94A 3CKWA 4H58A 3R7YA 3ZDIA 5FADA 5MHTA 5CAUA 2J0LA 5E7RA 5FTQA 4CVAA 2GPHA 2GH1A 1VQ1A 4P2KA 3M11A 3NYVA 4AZFA 3C51A 1JR4A 3IG7A 3JYAA 4U7ZA 4A4LA 3PG3A 4OA8A 5CAPA 2VDVE 4FOCA 2DUVA 3M6XA 4CKBA 4RTNA 1Y6AA 4HVSA 3NR9A 4BLVA 2AOVA 4HJOA 3RIEA 2RKUA 4PUZA 1KE9A 4AA0A 3PTGA 3C4ZA 2Z8CA 4MNEA 5EOBA 2UZWE 2ZFUA 3HNRA 2GMXA 5FWAA 2FSOX 4GG7A 5BUIA 3Q4CA 5CSHA 5EHYA 4K0YA 3I6WA 1KHHA 5DM1A 3UO5A 4DYMA 2ITXA 3II5A 3NIZA 2G9XA 3HV4A 3PPZA 3MH3A 4NL0A 4NWMA 2XK7A 4C7TA 4EOQA 1ORIA 1IAHA 2JEDA 3BE2A 5K3YA 1G6Q1 4LRJA 3ZRMA 3S00A 3OROA 5HU3A 2XIYA 1SNXA 3W2QA 3IOPA 3WF7A 3SC1A 4EL9A 3E8EA 1H1DA 4BHZA 3KR9A 2HW7A 3A60A 3W33A 2BAKA 2W1EA 4FT9A 5ETIA 3R24A 4N6ZA 3F4KA 3NDMA 3OU7A 3TQSA 4B0GA 4GVJA 4C2VA 2CGVA 2I40A 3EKNA 3SD0A 3F88A 5AP5A 4DH1A 4CQEA 2CMHA 3EEYA 3PA4A 4XP0A 4ZTRA 1S9JA 4MBJA 4PCAA 4GK4A 5A6NA 3MFUA 2YR0A 2PVYA 4QYFA 1H4LA 2VTMA 3WZEA 5AAEA 4V0QA 3HZTA 1NY3A 2Z6UA 3OT3A 3A7FA 2JHCA 3LKDA 5HIEA 4J7BA 3UPZA 3TUCA 1UKIA 3RPOA 2A19B 4XCUA 4B8LA 1A9UA 4ZMEA 4BY9E 1V39A 3P2EA 2VTTA 5H3QA 4MWIA 3B89A 2BPMA 3B3FA 3UA3A 5CASA 5IQDA 2JIUA 1JAMA 3LJ1A 4MF1A 4YBJA 4QDJA 2VP3A 2PZPA 3IW6A 3MPTA 5EFQA 4USEA 2A4LA 3CY3A 4ITJA 3EVAA 4QQKA 3TRKA 3D7TB 4KUJA 4E6CA 4K2RA 2V7AA 3PZEA 4MXCA 5JQ8A 3VJNA 3C6KA 4YJNA 3GRRA 3KHKA 3KPJA 4JS8A 2IZUA 4UB7A 2WTJA 2XNGA 3MVLA 5AV4A 5M06A 4RX5A 3LFAA 2BZGA 2FUMA 1MJFA 4F70A 2GA9A 4FSXA 3WIKA 3K6RA 1KWPA 1YDTE 3DKFA 3QF9A 4EYMA 4W4WA 4I41A 2X6DA 5GINE 4JJRA 3CXWA 2OJJA 3T9TA 5CS6A 2XS0A 2BHEA 1ORHA 1DUSA 4I6FA 1XXLA 5CM2Z 3PWDA 4R6VA 1Q97A 4C08A 3DGKA 5DN3A 5IQHA 2X7OA 1BC5A 3EVZA 2IBSA 2WPAA 3E3PA 5F4NA 5E1DA 3R9XB 4CV8A 3CIKA 2R3MA 1JKLA 2JC6A 4PP9A 4YZNA 5KVAA 2PYWA 4QVKA 3JWIA 5DXJA 3NJRA 1KE6A 3UA4A 3EQPA 5JGAA 3D83A 2PK9A 1KPHA 2ERCA 3T0IA 2PE1A 2UZTA 4MK0A 3HL7A 3MBLA 4N0SA 4RWLA 5D10A 2PMIA 2G8NA 4QMOA 4DH7A 1NXKA 4WG5A 1YWNA 4OBOA 2ITOA 3F2RA 3FLWA 3KVXA 3QD3A 4R5YA 2XYVA 4YUXA 3R73A 4BBEA 3DDPA 3FYKX 4FTUA 2PX4A 3ALOA 4RV9A 3TN8A 2P4IA 3PJ8A 4FEXA 3UYTA 4EEVA 4XOZA 4BI1A 2R0IA 3HRCA 3WZKA 5HE1A 4JX3A 4Z16A 5DXAA 2IZRA 3HP2A 1X8BA 1SVUA 4PYNA 3IW7A 5LQFA 3M2WA 3LQ3A 2W1DA 4TW9A 4IM2A 2HZ4A 2C5OA 4BCMA 4Q9ZA 3R0QA 3SSMA 4KSQA 2FH9A 1J7IA 3UIXA 3ER9A 3RWPA 2OBFA 4QYHA 1OL2A 4RWJA 5HEZA 1P1CA 3DLZA 4FVPA 3KF4A 5FP6A 2AN5A 4NK9A 5AUYA 3CJQA 5AEPA 2H8HA 2PVMA 3P08A 2XNBA 4F85A 4AF3A 3UIUA 3V5WA 2R0UA 3QGWA 2ZLBA 3KVWA 2DYLA 3D5WA 5FWDA 3FUUA 2XF0A 3NVKI 3FZGA 3MY5A 3REOA 5HVYA 2OPBA 3BLRA 1UNLA 3QCYA 5E8WA 3R83A 2WEIA 2C6MA 5CALA 5ICPA 3BWYA 3KQPA 4O22A 1G38A 4K33A 3GXOA 2OK1A 3R02A 4FKLA 2V74B 1H27A 4HOKA 4J52A 4QT1A 4IC8A 4IV0A 1NW7A 3RPRA 4BCNA 4I0RA 5L2SA 2J4ZA 5BP7A 4J95A 2GFSA 3P79A 3SGLA 2WFYA 3FL5A 4DFUA 2CKOA 2QO9A 4M15A 2W99B 3DXZA 4NW5A 5J1WA 4KS8A 2AOWA 5D1HA 1CTPE 3HV7A 3I4BA 3KK9A 4EHZA 1GZNA 1T43A 3KQQA 2NRUA 4GOOD 1KV2A 3PY3A 4E1ZA 4GKIA 5IA0A 3OU6A 3EVGA 1IXKA 2PTKA 2GHMA 4M0YA 3ZC5A 3E05A 2BALA 4ZZOA 1HCKA 2VAGA 2VD5A 3FRHA 4P7EA 4NYEA 3LM5A 5CU0A 1RJDA 4I21A 1JG1A 3DTNA 2UYCA 3MPMA 2YIQA 5IA3A 3R30A 1JG4A 4XV3A 2HMYB 2UYOA 3MH0A 4QMLA 1R39A 3TNQB 3P2IA 3SMQA 4ZSEA 5DM4A 2ETRA 5EW3A 4K6ZA 2JDVA 4BTMA 3DA6A 3RODA 3OTVA 3B8QA 5M55A 3B3GA 3COMA 4IZ5A 4QQNA 3ZO3A 2P41A 1IRKA 4UX9A 2RFDA 2X8EA 3VS2A 5K0LA 4R1VA 3GP0A 4BYIA 2B9HA 4JR7A 5EQEA 4I6BA 5CXZA 4V0RA 3G89A 4KRGA 4RVMA 4WXHA 5M5BA 1RJGA 4HGLA 3CTHA 1IG1A 2BKZA 1DI8A 2WIHA 1F0QA 2I0YA 4I5PA 1G8SA 5HG8A 2VTJA 3ZO1A 4RGJA 1H00A 2B4SB 3F5GA 3HVCA 5BPYA 4FT2A 2UZDA 3QKMA 5DM0A 1PMVA 3ZUUA 2WTKB 2X39A 3FXWA 4FK6A 5IUHA 2C7OA 4E2YA 1Q61A 3LECA 2UW6A 3ODZX 4USFA 4YJVA 1YWVA 5CAQA 4Y46A 4C38A 2GNJA 2QU5A 4RA5A 4W4YA 2R3JA 2XVMA 4QMPA 5GWXA 3H30A 3LFSA 2YDJA 4IM3A 4BI2A 4DEBA 4OT6A 4HTFA 1XKKA 3GBZA 1W98A 1GIHA 3OY1A 2UZVA 3DH0A 3EGVA 3P9IA 3GFWA 4G3DA 4APPA 3I58A 4X7QA 3LPMA 3MY0A 2J0KA 3NUAA 3DXYA 5ANJA 4AN3A 4ACDA 3N4TA 1NW1A 4DCAA 3GCUA 3DV3A 5F20A 4ACMA 5A6OA 4LFIA 3V6RA 2VTIA 3G8AA 1OM1A 2YJRA 5HNIX 3EQHA 3FWQA 1JSTA 4MKCA 5U4XA 4WNPA 3TL8A 2VUWA 3UG2A 5BQ0A 2CMGA 4JQEA 4BTKA 2C0TA 4M37A 3AC3A 2CNUA 2YCRA 4G3EA 5DFPA 4UEUA 5E91A 5K09A 1MRVA 4GK3A 2BTSA 3MSSA 4FTMA 3KPYA 4E93A 1QPEA 3TJCA 3QC4A 5FRIA 4CTBA 3F3UA 4D5KA 4POOA 1ZGAA 1NBHA 2BRHA 4RIOA 3KQVA 2GNFA 1Y6BA 3MA3A 1VP3A 2ZCJA 4L45A 4FIGA 3DCVA 3QXPA 4NT4A 4CFNA 2QLQA 1OI9A 4KB8A 4H0NA 3EVFA 3F61A 4EUTA 4E33A 4UWYA 3K2LA 4YU2A 3HAMA 1L9KA 3AXSA 4HSGA 1YB2A 3R9DA 2WXVA 4O84A 4LRKA 3NCZA 4O21A 4LOQA 2V0DA 4D9UA 5KHXA 2PY3A 3CJFA 4BDBA 2CLQA 1U54B 2H9VA 2OJGA 3LAUA 4IB1A 5CF4A 3ULIA 3MJ2A 4EONA 2PT6A 1PXJA 1XBBA 4GFGA 3IONA 5HEKA 3P9KA 4EZ3A 4XP2A 4E4LA 4FR0A 1YFJA 4A9TA 4OX9Y 3AC4A 2PUIA 3SX9A 2C3JA 4FX3A 2PGXA 2R6ZA 3A26A 4GEKA 4RTLA 2C7QA 3QQFA 2X81A 2ZULA 2UW9A 3ZM4A 5KMIA 4ANMA 2AC3A 5T6KA 4O0VA 5DYJA 2YXLA 1QANA 5E92A 1UV5A 2QURA 4IEBA 4CFXA 2IW6A 1UVRA 4BHNA 5K0GA 4GBED 2O5KA 1E1VA 3GB2A 1UWHA 3OW3A 1ZHFA 3BXOA 4QYGA 3U87A 3KR2A 4AW0A 3OFMA 1FVRA 3EZVA 3Q04A 3ZFYA 3ULZA 2W17A 3LZBA 2YX1A 4MH7A 4FVQA 3KB7A 4FEQA 2C1BA 2WQBA 4I20A 2ZW9A 4UZHA 3BKBA 4X3FA 4YO6A 5D11A 5E8UA 1XVAA 3ZM9A 5I0BA 3SW7A 2B3TA 3GRUA 2GQSA 5E1OA 1STCE 5HIKA 3VC2A 4ZXTA 2VTSA 1KE8A 4RPVA 1L1EA 1MP8A 3Q4ZA 1SUSA 1H24A 2XCKA 2PZIA 3P86A 4IB3A 3IKAA 4L3LA 4OQDA 1BI8A 3HA8A 2WOUA 1P4FA 3A4OX 3W16A 4DGLC 3OHTA 3KY2A 5EKOA 3PFHA 1NE2A 4I24A 3QAME 3KMMA 5C03A 2FB8A 2IVVA 4NM0A 3U4UA 4CFVA 3LDUA 3R1YA 4QP6A 4YZ9A 3DAKA 3QTQA 5HZMA 4FGBA 3BYUA 4IADA 5DBXA 4BCHA 3MWUA 2ZDUA 1UNHA 1M2QA 2XIXA 5HO7A 1NW3A 2B2CA 4FSWA 3GOPA 5EDRA 2EXMA 4GS6A 4RIYA 3NW9A 3R01A 3CKXA 4U40A 1ZYDA 3BCEA 1XH4A 3L8XA 4IAYA 5EQPA 1JKTA 1M2RA 2X4FA 5JZNA 2JBPA 4XJ0A 5M4UA 1OMWA 4EK8A 1N7JA 2BM8A 2X9EA 3BEGA 3WYYA 5M4IA 1P1BA 3RAWA 1SVGA 3MB6A 1EIZA 4LV5A 3G2QA 5D41A 2OZAA 2WELA 3QTXA 4FGRA 3A8XA 4O7VA 5HE3A 4FIFA 3V97A 2XCHA 2R7IA 4AS0A 4KSPA 3RPYA 4CZUA 3ZFMA 3A99A 1XJ5A 3U9NA 4RJ6A 2WIPA 3BGZA 2WK1A 2XK8A 3EVDA 4I22A 3WZUA 3E8NA 4Z55A 1YXUA 4IKPA 4C36A 2XM9A 5FLFA 2QOLA 3CR0A 3JXWA 4HGTA 4YJRA 1H28A 2PXXA 4MXZA 4RTQA 2O64A 3KGAA 3G2FA 3VYWA 4UXLA 1YHSA 3F66A 4EK3A 4FSDA 3L9PA 4RLKA 3FXZA 3OEZA 4ZS4A 2ZZKA 3U81A 4EOJA 4R3PA 3BV3A 4TNDA 5CZIA 1R8XA 2CKPA 4QQTA 3T3VA 4UN0C 3UPXA 5IPJA 2G71A 3P0MA 4MD8E 5GJGA 3TG1A 4J8MA 3IHTA 2UVXA 5HG9A 1OKZA 2WO6A 3GDHA 3HAVA 3AY0A 4FV7A 1G5SA 3Q4TA 4G3FA 1YXTA 2WAJA 3FBVA 3VWAA 4DLJA 4E5AX 2IZTA 4O91A 3VN9A 4D1SA 5BNJA 5LQUA 4PL4A 3HMOA 3C5IA 4H36A 5DH3A 5K0CA 5K0BA 2NP7A 1UWVA 3QZHA 2ITQA 2C3LA 2C5XA 5CWZA 2R4BA 3A7EA 4AU8A 5GOZA 4IVBA 4Y8DA 4FG8A 1BYGA 1LPUA 3FZPA 1U5QA 3NSZA 5CNOA 1MUOA 4L3PA 4RX7A 2XRUA 2Y4PA 5AUVA 3B7PA 4P7GA 5AUWA 3E63A 5H2UA 3VF9A 4PRJA 3VHKA 2OY0A 2YEXA 4FI1A 1XDUA 1FGKA 3BBWA 3NDIA 1FVTA 4M7RA 3OPNA 3DP7A 4XG7A 4NJDA 5TKDA 4GUEA 1HNNA 1JWHA 4G5PA 4YJSA 4OTHA 2P7IA 5ERGB 1DL5A 2VGPA 3SDJA 3PA5A 4A9SA 3UZTA 3P97A 1YUBA 2O2UA 2OICA 4ER0A 2QOKA 1DCTA 1MQBA 2XA4A 4EH7A 5ACKA 4BZNA 5DX8A 4B6LA 2J50A 1DM2A 3OZTA 4CT1A 3DTWA 3FKLA 4HGEA 4DGMA 1DAYA 4XNEA 1RI1A 4FTAA 1L3BA 5DTQA 1M7QA 4RIWA 1JSXA 1YW2A 4GT3A 4J96A 5DT4A 2YM5A 3BUSA 4FV8A 4IACA 3FXXA 4J1RA 3LFDA 4USDA 3RK9A 5EHGA 4ZK5A 4EH5A 5HIJA 3OUNB 4YZCA 1RI4A 1Q24A 2OJ9A 4MD9E 4A9RA 3UJAA 3AMYA 3FPJA 4C33A 3KXXA 2GB4A 2PVCA 2YABA 4XRLA 5HCZA 4XG2A 1H0VA 4B9DA 4UYNA 3H2BA 1YKRA 1YOLA 2WQNA 4ASEA 1FPQA 2BR4A 2Z7RA 4PQNA 4U79A 4WRGA 4JBQA 4YJPA 2XNNA 4AZSA 4F1MA 1F38A 1MRUA 2X9FA 4QP8A 4XEYA 4XBUA 3HP7A 2HV9A 2HZNA 4X2GA 3DQWA 3WF8A 3ZMMA 3BV2A 4KIGA 1UKHA 2HR1A 3C4CA 3D5VA 4DN5A 3Q7EA 5FTOA 1QAMA 1NVQA 2J6MA 3E93A 2HENA 5LQNA 1H1PA 2QLUA 4FK3A 4CRLA 3NYXA 4GC5A 3OXZA 3KN6A 3FKNA 4J53A 4X2NA 5FDXA 3PG1A 2GTNA 2WTIA 3IW8A 3VS1A 5IDPA 2P3OA 3RHXA 3TJDA 3HV6A 4IANA 4G9CA 4C35A 2PHKA 4DTAA 4EH6A 4GFOA 5ACBC 1SM2A 3FMKA 3P2KA 3PSDA 1YF3A 1ZWSA 3DBFA 2XIKA 5IA1A 3B5IA 4DLIA 3NNVA 3PWYA 4TXCA 3MAGA 4DF3A 5FXRA 2AUHA 1YI4A 3NUXA 2WMAA 4G16A 5DR9A 1ATPE 4Z2YA 3P7BA 3M33A 3RJCA 4HRAA 3DXNA 1PYXA 2R3PA 3LFCA 5AADA 4RVHA 2IIPA 2ZTHA 3W8LA 5KMMA 3O31A 4JT3A 4GUAA 5HKMA 2R3FA 1CKIA 4G9RA 4M8TA 4R5SA 4WKQA 5KNJA 4RVLA 4XUCA 3ODYX 4ACGA 3AD5A 3EH9A 1WZYA 3KA0A 4PCLA 4OQEA 2WNTA 4GV1A 5IISA 3C9WA 4KW7A 1XO2B 3G0EA 4IZ7A 4U9AA 2I1MA 4RT7A 3ORNA 3CGGA 3DKCA 1P5EA 4F86A 3VO3A 2V7EA 1YFLA 2C5VA 5DR2A 1K2PA 3Q87B 3HA3A 3U55A 4D5HA 10MHA 3BEAA 3HA6A 3A7HA 4JG7A 2PE2A 4H3PA 3OBJA 1TQPA 2NRYA 3FE3A 5CSXA 4QTAA 3S4QA 3EMBA 3HA5A 1AQJA 4M7IA 3HEGA 3QRTA 1ZYJA 4EJNA 3FLSA 4YTIA 3TM5A 3TNIA 4MHTA 3C3YA 3AMBA 4EVIA 2J7TA 5M08A 4YLJA 1YDSE 5AV1A 3VUDA 3IEIA 4NTSA 5EYCA 4WNKA 5B7VA 5B0XA 2A14A 2R3HA 2UV2A 3F6XA 4NH1A 5E4HA 4OR5A 5EMKA 5HVJA 3PYYA 4FC0A 4W4VA 5G02A 4O27B 4ONAA 5EM6A 1BOOA 3CBGA 5IA2A 3QWKA 2XJ2A 2O63A 4BYJA 2IVTA 4RJ7A 4YNEA 2ZYBA 3AJDA 5LSAA 5EYKA 2UZUE 1AF7A 2IP2A 3VNTA 4YC6A 5CU4A 1EH4A 3H3CA 2GS9A 4NJ3A 4QO9A 4XG8A 5HHWA 2VWXA 3JR1A 3GRYA 5HIDA 4BBFA 4L6QA 5FHRA 5JMSA 4BLUA 4E20A 1ZRZA 3U54A 5IEYA 3UODA 2J90A 3LFEA 3ORTA 3G9NA 4B8MA 3KU1A 4DQ0A 4CGAA 3VBQA 3MPAA 2QI8A 2WMWA 4S33A 2QHMA 2EB2A 3ZZWA 5CXHA 4E6AA 5M56A 4QPNA 3QALE 2C47A 5IMEA 1QYRA 5AP6A 3SV0A 1IA8A 1RE8A 3U8WA 1XBAA 3QRUA 4NZWB 5AWMA 3NYNA 1X1CA 3WF6A 2VTLA 3LCCA 3E3BX 3GU4A 4GSBA 4EK6A 4PYIA 5HE2A 3R8PA 4CZTA 2YDKA 2YACA 1WAKA 3GOKA 3O96A 3QRIA 3KK8A 4E7WA 2ITNA 2IVUA 4F9WA 3PX3A 3RP9A 4AACA 1PXKA 3N4VA 5E8YA 5EG5A 1JQEA 2XVAA 4GH2A 1UU7A 3V8TA 3D14A 3LKMA 1XH6A 2CN8A 1SQFA 5J9ZA 3O4FA 4DKJA 1LP4A 2E9VA 3PFQA 4YTCA 2ETMA 2F49A 4GYIA 4CFFA 2WMUA 5IQCA 4E2WA 4DAWA 5LQRA 4DTBA 3DXPA 2C7PA 4YUYA 4FKIA 2PX8A 2OZOA 4RA4A 4K6MA 3GU8A 3PIZA 3W1FA 5E8JA 3FQEA 4CXMA 1GJOA 2ITYA 4U6RA 3VF8A 3F9NA 4XYFA 5DRTA 3MN3A 3BWBA 4UY9A 1K3AA 1OVEA 2HNKA 4RYLA 3RCDA 4IX4A 2ZIEA 5HOQA 3EEOA 3F3WA 3HCCA 3X0DA 2VRXA 5LMBA 4BN1A 3V8WA 5C4LA 3PIXA 3MIAA 3G9LX 2C0OA 3GQLA 4QPAA 4W4XA 4MNFA 3F3ZA 5HGIA 3EYHA 3SXRA 3VULA 4AZWA 1D2CA 2KTYA 5IH6A 4GU6A 4L7VA 4TZRA 4BP3A 3G90X 2HK5A 4L8MA 1U4DA 2HY0A 3WARA 5EI8A 5IZFA 1XCLA 3NW5A 2QRVA 1H07A 4C05A 3PZHA 5ANIA 1OECA 3LKZA 4PDSA 3PXQA 2IBTA 1BL6A 4U45A 4RX1A 4I4EA 5DSXA 4MXXA 4DC2A 3ZLWA 3B2TA 2WA1A 5A3XA 2XYQA 3OCBA 3KPWA 1F3MC 2VWUA 4AZVA 3MQ2A 5FUTA 4R6WA 1KR5A 5LMKA 2P3QA 4ASXA 2JKQA 1YQJA 3TUBA 3ENHA 3ELYA 4NM3A 4U7TB 5EZSA 3KMUA 4NCTA 2UW4A 3SSNA 5L6PA 5KHWA 3F5PA 1OL5A 2C6TA 5LR6A 1GY3A 3UVQA 2NO3A 4DT9A 1UU9A 5DEYA 1SKMA 5BUJA 4E73A 5F2OA 2JKKA 5CEOA 5EM5A 4E70A 2PLWA 2GSFA 1M14A 3AGLA 3MTIA 3UFBA 5HD4A 4QMVA 2P55A 2X4ZA 4O7LA 3AD4A 3SG9A 3PVCA 3P1AA 2XNEA 1W8CA 3G6HA 1XH9A 3F3VA 4IJ9A 3RKBA 1TPYA 2J2IB 3MVJA 4XBRA 2XM8A 4FTKA 4AN9A 3CP9A 2PWPA 4PIMA 4CTCA 3GQIA 3EFWA 4A06A 4C04A 2QG7A 4FEUA 4GOLD 3PE2A 5E9EA 4YV2A 4O0WA 3C13A 2V62A 3ALNA 4B4LA 2CKQA 3GI3A 5BMMA 3HCFA 4GJ3A 5E9WA 3GC9A 4FKOA 4GU9A 4L53A 3DXXA 2WMRA 4C4FA 2ZIFA 3EPPA 4FIHA 1D2GA 2O65A 4TWCA 4XH6A 2WHBA 3VRZA 5L2IA 3QTSA 3CCFA 5FQDC 3N51A 3QZIA 3POOA 3FI4A 5EDQA 3ZEPA 4AE6A 4DBXA 1JQ3A 1BLXA 3NUPA 4FZVA 5DX0A 2Y4IC 1JTFA 4FTQA 3UVPA 3AT4A 3RPVA 4FZDB 2C6IA 4GK2A 3FPHA 1JG3A 1QPCA 4IFGA 4RC2A 4EK4A 5HBJA 3G33A 3I1AA 3QOWA 4FSQA 2W4KA 2C5YA 3C5UA 5IQGA 4APCA 3MTFA 2ZSUA 3TXOA 4ARKA 1KXZA 2YM7A 3P8ZA 4F6SA 3GWZA 2R3QA 3QRKA 4L43A 3ZO2A 4KIQA 3ZCLA 1AGWA 4FSYA 4EZ5A 3BWFA 2CL5A 4EBVA 3PPKA 3UJ8A 3AWIA 1OL7A 1L3IA 2JBOA 3DAJA 3ORIA 2QRVB 5CEMA 3BWJA 2JD5A 3GRVA 3R3HA 3FYDA 2J5FA 4JXFA 4L42A 1NV9A 4RZVA 3SVVA 3FQHA 4X41A 4NFNA 4IAZA 4EC9A 2OB2A 5BW5A 2PU8A 4V04A 4YMHA 1OIYA 5HILA 5FEQA 5CNNA 1XH5A 4D0WA 5FQNA 2LAVA 1OIRA 5ETFA 5EPEA 1FMOE 3G51A 4TWNA 2GS2A 5C27A 3TI1A 4YC3A 5CF8A 3T3UA 3GNLA 5T6BA 2UUEA 2QODA 3IW4A 3K5VA 1ZMUA 3ATSA 3NVMB 4DTKA 2GS6A 2CDZA 5CT0A 5F2NA 2PVJA 1NT2A 3EMGA 4AGDA 4CFWA 4BR3A 2VGOA 3O0GA 4O7YA 3RVGA 3ZLYA 5IQIA 4H1JA 4D2SA 4EHGA 3MVHA 2ITWA 4YV0A 3R8LA 3LCTA 5D9HA 3UP7A 4HCVA 4OT5A 2R9SA 3OD6X 3R2YA 2XKFA 5JGDA 2PY6A 4AA4A 4PNEA 1R0PA 4FVRA 2GQRA 4OBXA 3QLGA 4XUDA 3DBDA 4FTCA 5FA5A 1QPJA 3DNEA 2JDOA 3L8DA 4II5A 2A27A 3WF9A 5LVOA 4ACHA 4IB0A 3M4XA 3TR6A 1KP9A 4YUWA 4IBMA 4YUVA 3FTEA 1M7NA 4L7SA 4Y72A 5E8TA 3P4KA 4E2XA 3U6JA 4PYLA 3DT1A 5JUWA 3KRLA 1N2XA 3BELA 3W2CA 2QR8A 5BVDA 3IGOA 5GP1A 3C0HA 2ONYA 4QMQA 1W84A 4PIPA 4XG4A 1VP9A 3DMGA 1DI9A 4G6NA 1Y57A 2Y0AA 3LE6A 4KABA 1IR3A 3LMIA 5BYZA 5M53A 3RW9A 4AT4A 2BFYA 3FUPA 5GIOE 3OG7A 3CPCA 1RI3A 3DUWA 3LHJA 3OMVA 1RW8A 2OH0E 2GNHA 3MY1A 4YLKA 3R0TA 4QP9A 5I5ZA 5L6OA 4R3RA 1JOWB 3P23A 5M51A 1VLMA 5AP1A 2J51A 4EOMA 2Q41A 4R8SA 5DTRA 2ZM4A 3OW4A 2DQ7X 5E90A 4LGGA 4XUEA 1WY7A 4FIIA 4KD1A 3UZRA 2V55A 5BVFA 1SG9A 5FA8A 1AQ1A 3WI6A 3FSFA 3TZ9A 3HDMA 1H8FA 2PVRA 3BPRA 3LOKA 4CLIA 4BICA 4S31A 4ENXA 2LD4A 3A61A 4MD7E 2OO3A 2VX3A 2Z6AA 2PVHA 1XDZA 5T67A 3AGMA 1O9GA 3UE4A 5E1BA 5JEBA 3WIGA 1BL7A 1X1DA 2OKCA 2ADMA 2W4JA 3SA0A 2IWIA 3H4JA 3MTLA 5I9XA 3QA0A 2XKDA 2B78A 5HX6A 3GCVA 3AT2A 4CLJA 5EHIA 3H0YA 4TNBA 2G15A 3TIZA 3ZU7A 4EMSA 1PMUA 3IDPA 4R3CA 2GFCA 2XNPA 3QD4A 3PE1A 4ZTQA 4ZTLA 3R9RA 4ZLOA 3FUWA 2ERZE 4R6XA 3WBLA 4C3FA 5K0NA 3F2AA 1ZYSA 2YM8A 3A8WA 3NLBA 4L00A 4EORA 4F7NA 4K1BA 5HICA 1NW6A 5K4IA 1FP2A 4H39A 4GG5A 3Q3BA 5IMXA 1P91A 3VS6A 4C4JA 4BCGA 3UJGA 1R00A 1R6AA 5KBQA 1HMYA 4TTHB 2FRXA 4FG7A 2XYRA 3G5LA 4NW6A 4FE2A 5T68A 5AP4A 2GHLA 2J0JA 4IVAA 3VS7A 4BTFA 3EKKA 1XCJA 1KOBA 3FMDA 4EI4A 5E8ZA 2PE0A 3TKHA 3G0FA 4QTEA 1NW8A 2QY6A 4XHKB 2PMLX 5CANA 3TLJA 1SZMA 4MXOA 4EH4A 3ELUA 3HM2A 3JS2A 3V5JA 4NKAA 2ZWVA 5CENA 3EN9A 3HTXA 4HH4A 4QYYA 4RVTA 2VWZA 2C68A 3CTQA 1YI3A 2XKEA 2BRGA 2BIYA 2NPQA 2PWLA 4S34A 2AYPA 4KS7A 4RFMA 5AMNA 4AT3A 4RTOA 4IHPA 1M52A 3QX4A 1GIJA 2WQOA 3FMMA 4WBOA 5C9ZA 4KKEA 3PSCA 3H9RA 4FKJA 3L8SA 4UYAA 2X7FA 4FKTA 2W1IA 2VTHA 4LGHA 4O2PA 2GS7A 5FM3A 3NRMA 3NX8A 3PUPA 4KIPA 4QMSA 1J1BA 5ANDA 3UIMA 1FVVA 2R64A 3ELJA 3FYJX 4FTNA 4NIFB 3ZO4A 3GRZA 2AC5A 5ANOA 4D4YA 1WBTA 3A7JA 4RQKA 3F69A 3VQHA 2YM3A 1G8AA 3G2PA 2A2AA 1PW2A 3DBEA 4JX7A 4KINA 3OWJA 1D2HA 2DWBA 5GJFA 5EC8A 1PRYA 3EB0A 4GIHA 3FQSA 1XDSA 3PX2A 2G2IA 3KQMA 3BWMA 5A54A 3GCQA 5DE2A 5J87A 3R9NA 3FMEA 3PDTA 4JOAA 4BI0A 1WXXA 3S68A 4YZMA 4O0SA 3RM7A 1INLA 4Q5EA 5E1SA 2VV9A 4MHAA 4FSNA 4BZDA 1P14A 3OXIA 4DFXE 2VTOA 4RFYA 2ZBQA 4YJQA 2XK6A 3NUUA 1OIQA 2W06A 4IWPA 4C37A 5C1IA 3LCDA 3UDBA 3UTOA 4QMNA 2Y1XA 4RTJA 3E7OA 2F57A 1R78A 2YZLA 3EFJA 3AC2A 4AA5A 5G1XA 1VIDA 4HC4A 5CVJA 3R21A 3PXZA 4IAKA 4WHZA 5CU2A 3IPHA 3L8VA 2O0UA 2X2KA 3MDYA 1R74A 2QO2A 3GC8A 2C30A 5CQWA 5I9ZA 5A14A 2YWPA 3NUNA 2VWYA 1EJ0A 3K3IA 3EMDA 4CKCA 5HO8A 2WOTA 3IQ7A 3QCQA 2PZRA 1WVWA 5M07A 1FINA 2VO0A 4ZJJA 5HFJA 4IH8A 2WMVA 4KBKA 3EQDA 3E62A 3WE4A 3EZRA 5DIAA 4DHFA 4Y30A 1NVSA 4LUDA 3OC1A 4YO4A 2JFMA 4NUSA 4NCTC 5D1JA 5EW9A 2E2BA 3A7IA 3MB7A 5L2WA 3BWCA 3TPZA 3QKLA 5LQJA 4ASDA 5DLSA 3DOUA 3C4FA 3RAIA 4EC8A 2VDUE 4X0MA 4ZTSA 3LHDA 4P5QA 3VUMA 4BCIA 4CT2A 5AX3A 4AW5A 4HGZA 5T64A 4HNIA 3OOGA 4TWPA 2NXEA 2BR3A 3G15A 4JIKA 5DRBA 3CQWA 5J5SA 5LVLA 5BVNA 3BKWA 1WG8A 5FXSA 3NAXA 4MTLA 5IU2A 3BZBA 4AGWA 1ZY4A 1W82A 2UZLA 3GCZA 1PXNA 2Y4IB 3W8QA 5EHOA 3PT9A 3Q53A 5E9JA 5AP7A 3OUKA 4C02A 4RX9A 3QTRA 3FY2A 5DT0A 3UMWA 4X2JA 4F7SA 4BBMA 4IWNA 4KDRA 4RTRA 3ET7A 1M2PA 1ZAOA 4FKVA 1YHVA 4FMQA 2FPOA 3FTCA 4DM3A 3RK7A 3BYVA 3EQRA 3L9MA 3IYLW 2QOQA 3F82A 3ITZA 2BZJA 2VO6A 3KQSA 3R6XA 4ZEGA 4ZJVA 5HTCA 2ONZA 4K18A 2BDFA 5K03A 2WTVA 1PJKA 5CEQA 4C4EA 2X8DA 2Z7SA 2IGTA 2IO6A 5L2TA 4YV1A 4UWBA 3ZONA 4RVGA 4FZ6A 4UV0A 3ZRKA 5A9UA 5A4CA 3I60A 4RZWA 5AIKA 3ZDUA 2YQZA 3LL7A 3EN5A 2F2CB 4R7BA 5E8RA 2UW7A 1P4OA 1SNUA 2C0IA 2GHGA 3GU5A 4FTOA 4K11A 2OXYA 3ZEWA 4Z7GA 4MAOA 4RJ8A 3MB5A 5AUUA 3M70A 3GGDA 3ZOSA 4U42A 2R3NA 3CTJA 1CMKE 3R04A 5FP5A 4FL3A 3PY0A 4MTAA 3ZSGA 4CFUA 3BRBA 2OSCA 3KULB 1F3LA 4WSYA 1R8YA 3MERA 3U9CA 1YXSA 3FLZA 2UW5A 4E4XA 5EEGA 3RMFA 3AG9A 2FCAA 3D5UA 4ZOGA 3QQHA 4ER7A 2B25A 2I9KA 3QLFA 5LWNA 4CFMA 4JG6A 3CGOA 3PJ1A 1I4WA 4UALA 4CMTA 5JFWA 3W2PA 4MCVA 3EFKA 3O2MA 3NMUF 2W4OA 4FSMA 2QKRA 1PXMA 5KZ0A 2EFJA 4WVLA 4X60A 2X7GA 3IDCA 3OF0A 2C6DA 4PY1A 2YISA 5AP0A 1BHJA 4CTJA 5CCXA 4ZSGA 4TKSA 4LECA 2ZDTA 3IGGA 4FTLA 5IQEA 3QUPA 1WS6A 2PVNA 3AT3A 3NUSA 2XUUA 4PYMA 1H01A 3TWJA 3O23A 1RJEA 2XEZA 1EAMA 4LG1A 3Q52A 4XG3A 4ZJIA 1ZZ2A 2Y9QA 1R3CA 4ZTNA 2G2HA 4DGOA 2BILB 2ITVA 4RQVA 2J9MA 3FMLA 1U2ZA 2ZIGA 4KWCA 4O0RA 5EG3A 4Z9LA 4I6QA 3TZMA 1U59A 4AE9A 2K4MA 2PULA 3GU7A 4GVAA 4AOTA 4QP3A 2PSSA 4U43A 3DTCA 4PX6A 3PVUA 5CI7A 4AUAA 4O7NA 3FMHA 4YTHA 4ZTHA 3UOLA 3ACJA 5FTWA 2ERKA 3D4QA 4C07A 1JKKA 3LVPA 2W05A 4BCFA 4CMUA 3TNHA 2X0GA 5J1VA 3BQRA 2B9FA 3MFTA 2GDOA 3NGAA 4JLCA 1PF8A 2GNGA 3PLSA 4YNOA 5H9BA 2AZTA 2DPMA 4AOIA 2F4JA 4IVCA 3DPKA 4TYIA 2NP8A 4FV9A 3OZ6A 1XH8A 3D5XA 4GW8A 3GJYA 1URWA 3NWBA 1PY5A 3BHUA 3KL8A 4O7TA 1YOJA 5BYLA 1CSNA 3R7IA 2WMBA 4IZAA 3R1QA 4IE9A 4NTTA 1XQZA 4O81A 4QMTA 1N7IA 2AOUB 3LM0A 2KW5A 2XZSA 5KMKA 2WD1A 4D28A 3COHA 5L8KA 1U54A 4O7WA 4JBOA 1OBDA 4F09A 5EZQA 1H26A 4A4XA 5FCDA 1JTEA 3CEKA 3IK3A 2WU6A 4IJPA 4O7ZA 4DEGA 2QONA 2RFNA 3ZYAA 3O8PA 5H8GA 3V04A 3NWEA 3BLHA 3IECA 3W2OA 4QTTB 4C34A 1CKPA 3S1HA 5C26A 4WOVA 5K8VA 3HMPA 1YDRE 3GC0A 4JDIA 4E5WA 3SQQA 1DAWA 4CNHA 1R1WA 4L52A 1KUTA 2BDWA 3G88A 5FUBA 5LARA 2Y6MA 2YA9A 5KKRC 4RC4A 4FP9A 4O86A 5K0JA 2AS0A 4DCMA 4O0TA 4CRSA 2C7RA 4YJTA 4HYHA 5FBNC 3F3TA 4FS8A 3AMAA 3R2BA 5EIWA 5CU6A 3A7DA 5EH0A 2W1HA 3KXMA 5TT7A 3COKA 3Q2MA 2AN4A 3KRJA 4C2WA 4C0TA 3OWPA 2YM6A 5HI2A 3E23A 3UJ6A 4I5MA 1TVOA 2WMQA 3FV8A 4U8ZA 5JZJA 5F9EA 3TUDA 4GMYA 2BTRA 3DZOA 4LWPA 3DLIA 4WT6A 1Y8YA 3LFFA 5FD2A 4D9TA 4M38A 4U5JA 2VTAA 2WQMA 3E7VA 1WZNA 4EH3A 3DZQA 4XV2A 5EYMA 4XV1A 2O05A 1KIAA 3CCNA 1VL5A 3LLTA 3NNXA 4H1MA 4JRVA 4I5HA 3A4PA 4TWOA 5AV3A 3NS9A 4BIEA 4GIIA 5C9CA 4M36A 4CG9A 4WD5A 5ETCA 5HIMA 4I94A 4CSVA 5M44A 2R3IA 4C4AA 3CVOA 4ZSLA 3UP2A 4BKJA 3OBGA 3C7QA 3ORZA 4YC8A 2AOTB 1YZHA 1WBWA 2CKEA 4F6UA 3V01A 2UZBA 3ACKA 4QMXA 4BCPA 5CVGA 4J98A 5D7VA 2OKRA 2PSQA 4IM0A 3LJ0A 1KPGA 4HGSA 2R3RA 4G5JA 3Q4UA 2XMYA 1H08A 4V0GA 3W10A 2RFEA 3LMHA 4FYNA 4UOEA 5ANEA 3VS5A 3IOKA 2XNOA 3ORLA 1Q8TA 4IAAA 4KWPA 1RDQE 2BAJA 2BCJA 2JFLA 2YIWA 4KA3A 4U0IA 4JAIA 1UFKA 1OIUA 1W7HA 3M1SA 4XG9A 4PGGA 4WRSA 1QL6A 3JPVA 2QOCA 3I5ZA 3SXFA 3HCBA 4RTMA 4XX9A 2F9GA 2CMWA 4OTWA 1OPJA 3COIA 4ITHA 1B6CB 3ANQA 5LCJA 3CC8A 4QPPA 3ZBFA 2YXDA 3ERCA 3EJ1A 4N70A 4XLIA 1ND4A 2CHLA 2UVYA 2ITPA 5ANKA 5EHLA 5J9LA 2AOTA 3LPBA 3EVEA 3OCJA 4XCXA 2HYYA 4TT7A 4ZY6A 2WB8A 2CWWA 4M69B 2E5WA 4P4CA 3K3JA 4U41A 1FMKA 2YCQA 4S32A 3FEGA 2YHVA 3FI2A 4P90A 5DVRA 2IJMA 5HBHA 1KPIA 1XTPA 5CX9A 2OI4X 5DSTA 5IF1A 2O3PA 3NAYA 3Q9XA 4I3ZA 4JAJA 3RWQA 1CKJA 4DINA 3PIYA 2VS1A 5K05A 5BVKA 1ZMWA 3VRYA 5E8SA 3RK5A 1FBNA 2O57A 3FSKA 4C58A 5DT3A 3D0EA 4GL9A 3ROCA 2FYSA 4XOYA 5GHVA 4IWQA 4PMPA 4AAAA 2RGPA 4F7JA 1HOWA 1WBVA 5C01A 3W18A 5IUIA 4OTDA 2AOUA 3D9VA 3LDGA 3D7TA 2A0CX 4YP8A 4WO5A 5I9VA 3TZ8A 5EQYA 3DQXA 4IIRA 4F0IA 5KMNA 4ITIA 5KX8A 3T9IA 3KPVA 3PXRA 3WILA 5BX0A 2PV0A 2CKDA 4PYKA 5B1SA 2FSTX 1Q8YA 3LGAA 5DPMA 1JSUA 1O6YA 1OPLA 5CY3A 4D2RA 4GKHA 4LV8A 4BDEA 5CSPA 1YXXA 2OXTA 3B2WA 3QL8A 4OLIA 4EYJA 2ZZMA 3FJQE 2DS1A 5HG5A 1DS5A 1IY9A 3KR1A 4C06A 4DCGA 3TKIA 2Y8OA 1J3HA 1WBPA 5IDNA 1LR4A 2XBJA 3S95A 3DXQA 3WYXA 3PTAA 2EVAA 3CSVA 1P2AA 1QPDA 4RC3A 5KE0A 3JVRA 4EBWA 2GAFA 4Z3VA 5KQSA 3FPQA 4Y73A 2W5AA 2YIRA 4FKPA 4FT5A 4NFMA 3U51A 3WOWA 1VPTA 1HCLA 3OXTA 2G72A 3Q9WA 4ZSAA 3UNKA 4LMUA 2XJ0A 3KXZA 1RI2A 2R3SA 3KQYA 4KIFA 4NECA 3DJ6A 4FZFB 2XH5A 5AUTA 1WBOA 3NNWA 3KRRA 2ETKA 4R7IA 4BDHA 4FKRA 3HP5A 4XP3A 1QAQA 2QE6A 3BGIA 1H25A 3HEMA 5E2AA 3GIWA 3HA7A 2UW3A 2B7AA 9MHTA 5F95A 3KQWA 4AG8A 4M13A 3VAPA 1JSZA 2BR5A 4YMGA 2QOIA 4I23A 4C62A 3M6WA 1Q41A 3GO4A 2GNLA 5EM8A 2YVLA 3TTIA 1SQGA 2OYRA 4L01A 3KRXA 5FHQA 3PY1A 2OWBA 2UZOA 3O7LB 4FZ7A 4EOKA 4RMZA 3FDNA 3MFRA 2E9NA 3IW5A 4ANBA 4CWAA 2I7CA 3O17A 5K5NA 2BKKA 5AAGA 2JGZA 1G55A 4YJUA 3R8UA 3UBTA 3Q9YA 1FJXA 5A46A 1U5RA 5IQBA 2OIDA 3TEIA 1IEPA 2CLXA 1W0XC 4FEWA 4Q5HA 2Y7JA 4KRDA 3TNPC 5AIRA 5LVPA 4HNFA 4BDDA 5CAVA 3KQOA 5F1ZA 3TDVA 4CXAA 3AQVA 3DLSA 3TZ7A 3QTUA 4GT5A 4O0UA 3RM6A 1PXLA 3OOMA 4DZRA 2UZNA 3SVZA 3BKXA 4ER3A 1WBSA 4EKGA 4YGAA 2OJIA 5KMLA 3CLYA 3QHRA 2CPKE 4HTFB 4F4PA 2XKCA 3E8SA 1Q4LA 2EJUA 5GIPE 2HAKA 4AGUA 3IDBA 4FTTA 2R7BA 3VBTA 5F2KA 2ITUA 3AOXA 3SHEA 4DH8A 3ZH8A 4AN2A 2BDJA 3NPCA 3GT8A 3NW7A 4TYGA 4AQCA 4O82A 4ZSJA 5HLWA 1PKDA 2G70A 3EGIA 4ID7A 1TQMA 4LUEA 1KOAA 3OTUA 3FYCA 4IWDA 4QTUB 3O8UA 3CS9A 2V7OA 2XK9A 4J97A 3VS0A 2W9FB 4D4SA 2JIVA 4DEHA 4KRCA 4Y95A 4E26A 5EGSA 5JKGA 1VR2A 4RVKA 4ZIMA 4DEEA 1GIIA 5TR6A 5HNGA 2WTCA 2BROA 5AV0A 3OFJA 5I4NA 2ZV7A 1VYZA 4I1ZA 3ELWA 3OZSA 5AX9A 3R8ZA 2OH4A 1O9UA 2QO7A 3CE3A 4WIHA 5DM2A 2ZV8A 4C4HA 1BKXA 3R00A 1KE5A 3A25A 5FBOA 3MV5A 4BF2A 2O0LA 5BUEA 2Z7QA 4E30A 3UYSA 3FI3A 5DTMA 2QOHA 3QQJA 3IV6A 4FV4A 5L8LA 2YWVA 4JG8A 1ERKA 3RAKA 4RIXB 4IAFA 2NXNA 2P7HA 2C3IB 3REPA 2VTPA 3CJTA 5G6VA 3LCSA 2VTRA 4FV6A 3MGYA 3HYHA 2C6OA 4L46A 3K5UA 3QXOA 3MH2A 5B2KA 5KUPA 3B3JA 3FRIA 2CNVA 5E9QA 4C59A 2W1CA 1Z9XA 4MBIA 2X2MA 2CNQA 1OL1A 3NCGA 3KF7A 4C3PA 4D0XA 5LMKC 2JH9A 1PMEA 2VX1A 4RVDA 5HIIA 3FTFA 1VYWA 4QOXA 4NM5A 2JJQA 3KMWA 1OITA 4PYJA 2XNMA 4K77A 3CJGA 3M42A 3ORPA 4K8AA 3SG8A 2NXJA 4P5ZA 1Q8ZA 2ZB1A 2PX5A 2VWBA 3E64A 4GRBA 5HCYA 4ZZMA 3GEQA 5KZIA 4ASZA 4EZ7A 4I4FA 3HRFA 3NZ0A 3BHVA 4YURA 4DFYA 2FYTA 4RTSA 2ESRA 3QU0A 1OUYA 5JH6A 5DNRA 5CVUA 3V8SA 4XMOA 4A07A 5CVEA 5E1MA 2WMTA 1OKWA 3T8OA 5HTBA 5BMSA 3R7UA 3VUKA 2HTEA 5IA4A 3SGCA 4CG8A 2WKMA 4X63A 2QG5A 2B9JA 4G56A 3KCFA 1X1BA 4RTKA 3GGFA 2PX2A 3FUTA 5BXYA 1AQIA 3O50A 2QYOA 4IZYA 4M12A 2EU9A 2C6EA 4JBPA 1MRYA 2XIZA 4BCKA 3MCZA 4Z7HA 5CIYA 5C0OE 2QHNA 2WEVA 3DB8A 2XBMA 1JKSA 5FG8A 2PXAA 4L7FA 3SOAA 4QTBA 4BZOA 2P3LA 2CN5A 4F7LA 2OXDA 2BR1A 3C4EA 2BRMA 3NW6A 4FNWA 2YCSA 3VC4A 5HE0A 1OB3A 4EKKA 4F0GA 2PUPA 3GNIB 3KXHA 5B2MA 5LXMA 3P9CA 1UU3A 3UWPA 1BUHA 4OA5A 2YAKA 2Y6OA 2F7XE 4EQMA 2XYNA 4LL0A 4JXJA 2C5NA 4TY1A 4C3RA 2W0JA 3PJCA 3DK7A 4IFCA 3ZSIA 3F5XA 3E87A 4AZEA 1OZ1A 4F64A 3BT7A 2OO8X 4UZDA 5M4CA 3OFKA 4MWZA 2E9PA 4EOSA 5HLPA 1TW2A 5DX1A 3EQBA 3TMAA 4YHTA
chains in the Genus database with same CATH superfamily
3K8YA 5AKKA 4QJBA 4HGQA 4V0ME 3D6JA 2HCFA 2WMOB 4RG0A 4I4CA 1E3DA 1UT6A 4CCSA 4DGQA 1ZY5A 1R0WA 4QREA 2O0HA 2Q6KA 5FPKA 1XQ6A 3DQQA 4XFJA 1EVIA 3NUYA 4H7EA 2W5BA 4A2QA 1E8MA 1XMXA 5KCZA 5A6SB 1VIVA 3JQBA 5IUKC 4UUPA 3MN1A 4TX1A 3M6LA 4AWAA 2Z2XA 3ROMA 3WKBA 1JIJA 4L9AA 1PJ2A 4ENUA 2C0CA 3OOWA 4NZMA 4DG2E 1ZESA 2KX7A 4LNUB 3UV6A 4NATA 1W36D 1LZKA 1AU9A 4CLRA 1PLKA 2CBZA 1DRKA 2ZRDA 3TACA 3T5MA 3N2YA 4EWHA 1AA9A 2VX0A 3DCYA 1XR1A 3Q0EA 1ZGCA 4ZPJA 1LNQA 4P5EA 1USVA 2WTDA 3IP1A 4FDLA 3CU5A 1Z22A 3AL3A 5ICGA 2HJVA 3IBGA 1S2LA 4PNIA 2YW9A 3OM1A 2AEEA 4E2FA 4WADA 5FXMA 2ZM1A 4B2YA 5DP2A 2VT6A 4V03A 3KSMA 1R9GA 4IJVA 3TG2A 2B54A 2LTAA 1KEUA 4FMDB 3R9OA 2AYXA 4Q3LA 4L67A 3OG9A 4JYBA 1LA2A 1AXEA 3QH4A 1KI2A 3AP1A 1N34B 3OZ7A 3EH1A 1XUOA 2C57A 5DT9A 1ECJA 4TT3D 3D7ZA 4IGAA 1N5IA 4RVCA 1MT3A 1CUIA 5B3AA 3DZFA 3ZY4A 4YZDA 4HZRA 2OENG 1XKQA 2XVDA 1ZA2A 5EGNA 6NULA 2ZIXA 3DOGA 1OAAA 4GCJA 3MJ1A 2Y67A 1SULA 4IZOA 3IJRA 3JQQA 3IJEB 4OATA 4HMPA 2ZRHA 4DXHA 4UE3S 3UOHA 5EWJA 1FDUA 1ZHHA 4YRJA 4B6EA 2EJCA 2W2LD 4X3JA 1N6RA 1JBKA 2XODA 1GUYA 4E7OA 3HVHA 4MQFA 5DBIA 3ESCA 1CHNA 4GFMA 2WJIA 4NE9A 4NDAA 2P65A 5HKLA 4IB5A 4AJKA 3AB3A 5A4TA 5LCKA 4DFLA 2IITA 3ND7A 3V5TA 4EHJA 2R25B 4D42A 2V7BA 4RADA 4E1AA 4P80A 4K03A 3PC6A 5LMAA 2OV1A 2PJDA 4MZXA 1G1AA 4IVRA 1V5FA 1W1IA 3FYUC 2XMSA 3FMPB 4NI5A 5LKRA 5F5XA 3Q5ZA 5AM7A 3F7OA 2R3OA 4TTIA 1Q8UA 5F2EA 4CIVA 4J71A 5BMVB 4XG6A 3WLRA 2OLCA 3OCGA 2NXCA 2Q4TA 1P2BA 3DXFA 3OZIA 1LEHA 5CD1A 2VN9A 4W99A 3O7WA 5EDPA 1IOWA 5IASA 2OYSA 4QWWA 4FIEA 1ZZLA 3MTAA 3O71A 2ATXA 1Q1EA 4QBGB 5EMLA 3ICPA 3VNRA 5HX8A 3PNKA 4F2DA 4BBJA 2V6GA 3OT5A 1KSWA 3BGPA 4H17A 3AIOA 4GR9A 3RK1A 4HQLA 3LXPA 3E35A 2Q5LA 1TT5B 4Q3EA 2O2ZA 3FPGA 3RKSA 1RWOA 2A3NA 1ZMVA 3RINA 1L7EA 2QN7A 4MVJI 2BYTA 3VR4A 3DF7A 3GY0A 2ZR9A 2Z3WA 3OM0A 3PPJA 4U2FA 3X1YA 4N3NA 4CKRA 4QP7A 5LQNA 4X92A 2EB3A 1P1IA 2YV3A 2VHCA 3TTSA 1Q2XA 2ZT5A 2DERA 4PTZA 4ZI5A 1E3QA 2ZYVX 5AVSA 2J9FB 2RJNA 3DBOB 1RRMA 5BV3A 3JWJA 3DL4A 4YHJA 4MO9A 2JKMA 4CIBA 5LL6P 4PE5B 4FSUA 3GYBA 4HVHA 2OAGA 3GEBA 4QRDA 1TQHA 3WO0A 2WP8J 2XB6A 2QUZA 3WR5A 2B0QA 3GWGA 1MNQA 2JAVA 1PLLA 3D9QX 4XRGA 5BYYA 4ZMSA 4FGLA 3L1KA 2QNJA 1O9HA 1RAEA 3MGGA 3HDNA 3BJMA 4B48A 1GSAA 1YONA 1Q11A 1L5OA 1E2HA 4RVSA 4RHEA 1S4QA 5IHXA 3WL6A 1T36B 2BFCA 3SX0A 3DKPA 1AUXA 1SCAA 4LL5A 5CDFE 3HK2A 4KLNA 4X1YA 4LRSB 1QAOA 4BCJA 2QZZA 1QX3A 2IQ5A 5CX1B 2F8TA 1ODIA 4ED9A 2R3GA 1ESZA 2QIPA 2OG2A 5MFPA 2F8LA 1N3IA 1AGNA 5HS4A 4W5OA 2QVCA 3ZTXA 1XCPA 3AESB 3EISA 4S30A 2HB6A 1NVDA 2QN9A 1PZNA 1PJZA 1WKVA 4QG7A 1B42A 1QG2A 2W71A 1U2EA 3Q6IA 3R77A 1Z3CA 2CJWB 4D25A 3EDMA 1E5QA 1X6VA 2ZB3A 1MENA 3L7NA 1XELA 5LZ5A 1HQKA 1JAYA 1PQUA 4S3MA 5TPWB 3SJCA 4G1VA 3GG9A 1CQWA 3EEQA 2HA6A 2ZV9A 4E5DA 5H0IA 2QPLA 2FRDC 3QEBZ 4JU8A 1RAGA 3P71T 4POAA 4B81A 2QSZA 4G17A 3NDPA 2IZ7A 1RP1A 1LEZA 3AD6A 3UCFA 3CX3A 3JR3A 2YWRA 2QM3A 3TV4A 4CI0B 3PT5A 3HXQA 2J0QA 4NS4A 3QD0A 3P5SA 4YP0A 1P2UA 4DMGA 2EV9A 2GH1A 2I80A 3DTVD 4OSPA 2I6FA 3QYAA 4OA8A 2VDWB 2EFDB 4B7XA 1Y9ZA 3V2IA 4RELA 4U2CA 4YFYA 4Q93A 1Z13A 4HJRA 3I6YA 4FINA 3PPZA 1I10A 3W7BA 5ITWA 2ENUA 2POCA 4CG0A 3LXMA 3A6DA 4XIFA 1DBQA 1ST3A 3QLUA 4KBGA 1RKBA 2I7DA 1C9MA 3NKVA 2IY8A 3RPOA 4R69A 2PZPA 4USEA 1L7BA 1BGVA 1KMHB 1QORA 4N12A 3F8SA 2V7AA 3GRRA 4HQFA 3VKUA 2IZUA 2JGRA 1CUBA 3V34A 4JB3A 4OUDB 2FUMA 1MJFA 4JLKA 1J20A 3RU7A 4R6VA 2AFRA 2JIRA 1BC5A 5HM8A 2WPAA 2JC6A 1I3KA 3BIWA 3D83A 4FFVA 1FK8A 4N0SA 3EDYA 5IPFA 2B37A 3BB3A 1LTKA 1JFTA 3ZGOA 1CVRA 3BMCB 2P4IA 2GN8A 1L4FA 2WYUA 3K35A 2G0TA 5UKDA 2O7NA 3P32A 4DLBA 2ICAA 3MWEB 4I7EA 3LVBA 1XXHE 4YT4A 1VPDA 3L1JA 2XKAA 1PFYA 2V74B 2QAJA 1TF5A 2GFSA 3Q10A 4GDMA 4EFDA 1YS9A 3PI6A 2QN8A 2RG1A 1F6BA 3DEHA 2XMCA 2PTKA 4JGBA 4C20A 5F98A 4X20A 3SU8A 3P2IA 2ETRA 4BTMA 4K6ZA 1U7ZA 2ZP1A 3JQ9C 1IG3A 2BC9A 3QE9Y 5JFTA 4BYIA 1K75A 1RJGA 2BKZA 1CUUA 4B76A 3RU9A 4FT2A 3TLYA 1DPFA 2FPRA 2IELA 2I33A 4ZVVA 4C38A 1EWYA 2NSHA 5TGDA 1G20E 2YDJA 3U4MA 4JLVA 1IJEA 3P9IA 4BB5A 4MI6A 4LY3A 3N4TA 4YRLA 2CLHB 4UNQA 2VUWA 3UG2A 2W6MA 1KY2A 1J56A 2XNDA 2FV8A 1ZW6A 4CTBA 3NCTA 4PR3A 4TL7A 2OORC 3HAMA 4Q7JB 1VL1A 4C5AA 3DMTC 4M89A 2CLQA 1U54B 5ALNA 4IB1A 4M9RA 1NVTA 4JROA 4XP2A 4E4LA 3R3XA 1K7SN 5D3KA 4RTLA 5FKJA 3U80A 2XE8A 2QURA 1YO6A 1E1VA 3GB2A 2QK4A 5CD9A 4Q4LA 3AHIA 5TVKA 1NJ2A 2JZNA 3REFA 1JW9B 1WUTA 1TIPA 3E6AA 3LT5A 4TS4A 1DHRA 1P4FA 1CP2A 3OHTA 5EKOA 3EG5A 2GJ8A 4YRDA 3HBMA 1BU8A 1M2QA 1RJWA 3AUFA 5HBGA 3GCGA 1GZ7A 3FCXA 3WYYA 3U3DA 3GROA 3RK4A 3QELB 3QTXA 3RPYA 1GL3A 2V55B 4L0CA 4RJ6A 4XDHA 1S8AA 5FLFA 1PT6A 3ZNOA 3W79A 1C1DB 2COKA 3FZNA 1JRLA 1GCOA 3LBHA 5LXTF 2WILA 3FKJA 2NYAA 2DLNA 3CIOA 2IIVA 3BDAA 1MO6A 1N3YA 4J0KA 3ZE0B 2ITQA 1R8QA 2XAMA 3N74A 2JHFA 4Y8DA 1PGOA 1VI2A 1U9JA 5D6NA 1VFNA 4RX7A 4PRJA 4S35A 2W4MA 4M7RA 3BBWA 4ND8A 3NOQA 3K05A 3DP7A 2VCYA 4ZVQA 1R0CA 4A9SA 2VZEA 5KB3A 4NZOA 1PQYA 2XA9A 3RT1A 1DCTA 1T34A 1U3VA 4BVLA 4GX5A 4GT3A 3M9WA 1RWBA 5HIJA 3K0AB 1CD5A 3UJAA 3KXXA 5EQDA 2QBYB 3IVGA 3CUUA 3HP7A 3ZMMA 1KDZA 2WSSA 4OYRA 3EDCA 1KETA 3NYXA 3VS1A 3IW8A 3BHJA 4DT1A 3P2KA 1GILA 2QL6A 3CW9A 5C35A 3WGZA 5HJ7A 3RJCA 1ULTA 4UTOA 5DP1A 1XD8A 4K6CA 3EH9A 3LUCA 1CUJA 1ZK1A 2WNTA 4IZ7A 1IHOA 4OYYA 2Z5VA 2RGUA 3U55A 2JLCA 3SZGA 1XEWX 1YRYE 3S4QA 1TQPA 2E4VA 2PVSA 4TMYA 2QTVA 2YHSA 1BQEA 3F6CA 4D3FA 4FEYA 2O8FB 5B7VA 1A9XB 1BW9B 2R3HA 4NH1A 1VLVA 4JJ6A 2O63A 4ZV9A 2HJ9A 2GD0A 2I67A 4E20A 1SUCA 5FBHA 1PR3A 1W59A 1U81A 2P5YA 3QALE 1EZZA 3KBOA 3WIDA 3U8WA 1XBAA 3O6VA 1X3LA 2YACA 4DV6B 1R6DA 2H16A 1JQEA 4E51A 3D14A 5J43A 4ANFA 5J4VA 2P2ZA 2UUAB 4H6WA 3BYZA 5ER9A 2PX8A 3L7JA 1SMKA 1NE7A 3MN3A 3LYHA 1ZJWA 1RYDA 3GQLA 5C8YA 4MNFA 1Z4MA 4UVGA 1L7QA 5JZMA 2EKQA 5EI8A 3TNYA 1NYRA 3PXQA 1W2WB 5TB5A 5FLEX 1GT6A 3UJNA 3SZ3A 5ERYA 3THYB 1TQ2A 3HZZA 2NO3A 5DEYA 5CEOA 4Q16A 2Q3HA 4E70A 2GSFA 3SYNA 4QMVA 4O7LA 3AD4A 3P1AA 4JB2A 4MRPA 1ZBQA 1EEXB 5KI6A 2VUUA 4XI9A 1JWLA 5HQ3A 2ENWA 3EXIB 2QE7A 1F14A 3MJSA 2WMRA 1FXUA 4C4RA 3QZIA 4AG6A 3VZQA 2VBGA 4C3UA 4GK2A 3BH0A 1KEEB 2F1KA 3EB9A 3UPUA 4EZ5A 3AWIA 1AV7A 3FYDA 1I2CA 4REQB 4RZVA 2VTEA 4EC9A 4JL6A 4Y67A 4B6QA 1ODFA 5EPEA 5C5CA 1QV6A 4QXRA 5EAIA 1G2QA 3NVMB 1WCXA 4PZZA 1C9YA 4BR3A 3RVGA 3F6PA 4PAQA 4RZSA 5D9HA 3IR7A 6REQB 2XLCA 5JGDA 1KA9H 5KPJA 3QLGA 1XHEA 1II0A 4R1SA 4IBMA 3RV3A 5L4LA 5DWDA 2CCGA 4YPOA 1EFKA 3W0SA 3LE6A 4JCOA 1T9GR 1JLRA 1MW9X 5C4MA 4FYJA 4MMZB 3EZXA 4QOIA 2WTUA 3LVFO 2F1RA 1SAYA 3AL2A 3VJLA 1SG9A 2QQFA 1UR5A 4BICA 4J6EA 5FBRB 4HNTA 3AFHA 3WIGA 2ZE8A 4BO4A 3CVWA 5A4IS 5H80A 3SA0A 4QJ4A 1DNPA 4B3GA 3UUWA 4EGJA 5HCUA 2VKTA 5CA1A 3FUWA 4RHTA 5J2TF 4PCVA 1VYHA 3A8WA 3IXQA 1ZD1A 2FJ0A 1FP2A 3GFOA 1N5MA 5KBQA 3Q7TA 2FRXA 4FG7A 5T68A 4S24A 3KLBA 1J9ZA 2K6GA 1MAAA 3G0FA 3W3AA 1DE0A 2IIQA 4Z4FA 1O94C 4QYWA 1EM8A 2VWZA 2BIYA 3ZHUA 5A3RA 1M52A 3PUJA 3QENA 3JQ6A 1AK9A 4I4TA 4FKTA 1A9XA 2W1IA 2VTHA 2Y0DA 1I2ZA 1H6DA 1JB1A 4FTNA 4M8KA 3K9QO 5GJFA 3PDTA 3O9ZA 4Q5EA 3DZDA 4U7FA 2W06A 4GECA 3I0MA 3R21A 1LLQA 4CCAA 2ZUSA 4DLSA 3G23A 2WMVA 5I7EA 1Z63A 1VJGA 4J90A 4NCTC 5EHQA 2FF7A 1JHQA 3TCKA 4AW5A 3KB8A 2X9NA 2HF9A 2MINB 3QFFA 1DJMA 5FXSA 2I4IA 3BZBA 5E9JA 2JGEA 2PLAA 4RX9A 9GPBA 4F7SA 4AECA 4G65A 3O75A 2VXOA 4IX9A 2BDFA 3HRIA 2X8DA 1QCYA 1XMJA 1Z7GA 1VKNA