1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrillarin-like pre-rRNA processing protein
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
2HTEA 4A9UA 2HV9A 4YJQA 5FBOA 3G9NA 3LJ1A 4AS0A 3DDPA 1Q41A 4CFUA 2XJ1A 5E2BA 2H9VA 3AGLA 4TRLA 3NW7A 4O7VA 4DITA 2QO7A 2IH4A 5HNIX 4CV8A 4NM0A 2YTZA 5K5NA 5H9BA 2Y4PA 4ALUA 5H02A 4S32A 4HCTA 4UN0C 4D1XA 2EJUA 2ZBQA 2WXVA 4RBLA 1DAYA 5KMMA 3O8UA 4FVRA 4RV9A 5GJGA 2QCSA 4CFFA 2X2MA 3UQCA 4AU8A 2VTJA 4E26A 3UJGA 5E8VA 2C7QA 1ZRZA 4EI4A 4BCHA 2XUUA 3QUEA 2R3GA 1N7IA 3GCQA 3AMAA 3TV7A 2UZLA 3C6MA 4CV9A 3G2PA 5HQ0A 3HZTA 4USDA 1QPJA 2XNMA 4PRJA 3LFQA 1XXLA 2P3QA 3GGDA 2A0CX 3CKKA 3LDUA 4C3PA 2OIQA 4C0TA 4HW7A 3TT0A 3PRFA 3TR6A 2B54A 3FZRA 3PA4A 1UV5A 2JDRA 5AWMA 1XHAA 1L3RE 1UNGA 5EMKA 4HYIA 3Q9YA 1TPYA 2ZSUA 4MD9E 2J5FA 4L53A 4QP3A 3WE4A 2ACXA 4DKJA 5CSVA 3CGOA 3V5WA 2C0OA 3WZJA 3QLFA 3QQUA 1H1PA 4Z7HA 3QZGA 3G5LA 5HKMA 4FNWA 2W0JA 3Q6UA 3UIXA 1JQDA 5DNRA 2IVSA 1Q8ZA 3TRKA 2A1AB 4II5A 2P4IA 4R3PA 3I58A 3K5VA 5AP6A 2WO6A 3ZHPC 3PG1A 2BIYA 2Y8OA 2BZGA 2PV0A 4EBWA 5ICEA 4GT5A 2N47A 4P90A 4FR0A 3F3WA 1ORIA 3SAYA 1NY3A 4Z9LA 2GS9A 4CT2A 3V5QA 2WOTA 3MGGA 5D11A 5LQNA 3ALOA 3VBXA 2R3LA 2BKZA 5M55A 3OE4A 5FDXA 1B38A 3M33A 3TIYA 1E1XA 4EK5A 1PKDA 3MDYA 4ZSEA 3TL8A 2BTRA 3MQ2A 2JBPA 4TPTA 2OG8A 2VTHA 2J0KA 5CX9A 3IYLW 3BKBA 4HGLA 1GZNA 4BGHA 2PSSA 2G15A 1OIRA 5AAGA 5DRBA 4QMXA 3ANRA 4LGHA 1H1SA 3BV3A 4D5HA 4K33A 2QOBA 3OP5A 3ANXA 3UO6A 2OU7A 5HNBA 3TNPC 2R9SA 3G51A 2QRVA 4RQKA 4IAZA 5AFVA 2KULA 5EH0A 2Y1WA 3Q04A 4HZRA 2I40A 5M56A 5E90A 4X3FB 2JH8A 4E2ZA 3NPCA 4YTIA 4QPPA 1CMKE 5K0GA 4V01A 2EU9A 3ZOSA 4DEEA 4V0QA 2GNFA 3DBDA 1JSUA 1EAMA 2UYCA 1M0EA 2WMWA 4XEYA 4EONA 3K54A 1ZOEA 4KKGA 2I6GA 2PMNX 2QC6A 1PXJA 1S9JA 4RFMA 4RLKA 3NYVA 2PE2A 3TZMA 4OBWA 2PT6A 4OTHA 2UZEA 4NTSA 1G5SA 3GWZA 4I93A 3OWKA 2ZYBA 4ORKA 5D12A 2YVLA 4M37A 4GFMA 5ICCA 3AC2A 4NSTA 4XCUA 3QKMA 5AP7A 3ZH8A 4TZRA 3HCCA 1M2QA 2C7RA 2W99B 2QOIA 3ZRKA 1M52A 3F5GA 4UEUA 5C9CA 3AOXA 2P3OA 3OFMA 3UIBA 2Y7JA 4FG8A 5FLFA 1MRVA 4O7RA 3H9FA 1BKXA 3CEKA 4MNFA 5M4IA 5EGSA 4X3FC 1RI3A 5FTQA 4XV2A 3OZ6A 2GCDA 5FHQA 3E88A 3D7TA 2ITPA 5DT3A 3NVMB 3QQHA 2JDSA 3HA7A 3LMHA 3PSCA 1U4DA 5JZJA 2ZWAA 3HMOA 3P2EA 3G6HA 3GQIA 3D15A 3DXNA 3DP7A 5ANOA 4FT5A 4RTNA 4WRSA 2WTVA 3MI9A 5M53A 3LE6A 2R5TA 4GOOD 4OX9Y 5IF1A 3PVBA 4IWPA 3I79A 2FUMA 3R6XA 4YZNA 3UJBA 5KE0A 3VS2A 2H8HA 4K6MA 3MCZA 3GU8A 2QI8A 4U7TB 3HMMA 4LGGA 4HCVA 4L6QA 2H6DA 2W1FA 1M6EX 2C68A 3BI6A 5IA1A 5JK3A 2GS6A 4KIFA 4FE2A 3UP2A 3BX5A 1UVRA 3SLSA 2ITWA 4FTOA 3E63A 2BFXA 3QQLA 2XYQA 4TNDA 2OXXA 3OMVA 5HOQA 3VBTA 2OZOA 4YTFA 2VX3A 4O0TA 5IUGA 4MXXA 3KPYA 3ORIA 4Y2HA 3G8AA 3NYNA 4ZTBA 1GNGA 2YR0A 1WCCA 2X7GA 3DNEA 3PSBA 4ZJJA 2X6DA 3VRYA 3PJCA 2YXDA 5KS2A 5GJDA 3VS6A 3F6XA 2V22A 3ALNA 3V3VA 4QMTA 5JRQA 4FL1A 3TDVA 4AZSA 4GU6A 3KPVA 2R3IA 1JLUE 5IEVA 5J95A 3G90X 2REIA 3ZM9A 2PVFA 3S95A 1H0VA 2XB7A 2EG5A 4AGDA 3LKZA 3Q4CA 2HZIA 4TYHB 5IQAA 3KQQA 2OJGA 5HD7A 1Q3WA 2BRMA 2HELA 5C26A 2PUIA 5JFWA 1VQ1A 4JS8A 2XNGA 4EEVA 3BEAA 3ZUUA 4MX9A 1OKWA 3F2NA 2YM8A 4FIHA 1J7LA 2X8IA 1J7IA 4DFUA 3E62A 1FPUA 4E4XA 3WIKA 5HICA 3U6IA 4FIFA 3FKLA 1KE5A 3KMMA 3BV2A 4QO9A 4D4RA 2P7IA 5IU2A 2VO3A 4YZMA 3NYOA 3HMPA 4ITJA 4X1OA 5E1DA 3BIZA 5EYCA 1Q0TA 3TZ7A 3SVVA 2NXCA 4MF1A 3X0DA 4O6EA 4FTCA 1YI4A 4CMOA 3FWQA 2YABA 3MTLA 3WIGA 2YA9A 3DU8A 4FV8A 4NCTC 3C9WA 4RVTA 3POZA 3N9XA 3MH0A 4IHPA 4WHZA 5DOSA 5DRYA 4EH5A 1YXTA 3DQXA 3H9RA 3EH9A 4BDJA 3BGDA 5CEPA 3OROA 2FHPA 4R5YA 1V0OA 3DCVA 4C62A 3R7IA 3AC3A 3MBLA 1JR4A 5E7RA 3A61A 2Q83A 5DLSA 2YEXA 3CC8A 3QD2B 3P9JA 3TKAA 3R28A 5E1OA 4XP2A 2UZTA 3UQFA 4Z7GA 3AT4A 3REPA 5K0CA 3RAWA 3DB8A 4BGQA 3QCYA 5D10A 1CM8A 2PE1A 1XBBA 5BX0A 4CFNA 3BHYA 3COMA 2J9MA 4ZP5A 2NYUA 3VW6A 1KPGA 4GW8A 2LAVA 4X2FA 4FTUA 4NCTA 4U42A 4U79A 4EMSA 4CMTA 5IQEA 4DYMA 5LVPA 3R8LA 3Q53A 1SZMA 4HTFB 2OF2A 3NAXA 2W1ZA 4QMOA 3G0EA 4LQMA 3HCBA 1FBNA 2AS0A 2R2PA 5GP1A 3OY3A 3KGAA 2ITYA 4RC4A 2P0CA 2GQRA 4YU2A 4J71A 5J7HA 4RVKA 4F4PA 3FYCA 5HE2A 3DZQA 3AC5A 4POOA 3FUTA 3UNZA 3R2YA 4C08A 4BDHA 3L9MA 2XNOA 4FSMA 4Y83A 2BAJA 3KU1A 1LEZA 4IE9A 3NIEA 2J4ZA 2UVXA 3MJ2A 4DCMA 3BHVA 4AZVA 2LD4A 2C3LA 4FMQA 4AZWA 1RQQA 3F5XA 3RJCA 3GFEA 1JQEA 4RTQA 4NKAA 4QMNA 3C5UA 1IA9A 3FEGA 5AMNA 5CF6A 3P9CA 1PMUA 3MJ1A 2Z6AA 1KV2A 3BCEA 3PE1A 1OL5A 4AE6A 3UP7A 2QOOA 3IS5A 2GFSA 4O27B 1QL6A 4C04A 2YDJA 2V62A 4G3FA 2O64A 2OK1A 2NP7A 1Y8YA 2ZW9A 4EH7A 1XH9A 2VX0A 3WZKA 4FGRA 1UU9A 5C0OE 4FT9A 5DT0A 5BVFA 4RTKA 3KXGA 2PVJA 4JG8A 5F2OA 2GNIA 4QMQA 3L9PA 3FL4A 2PZYA 2QM3A 1A06A 4IIRA 1TQIA 4IDVA 5CNNA 3UE4A 4G17A 4O2ZA 3KCKA 4KSPA 4AUAA 4DAWA 2OBFA 4J52A 2J51A 4UY9A 2QQ7A 3IPHA 2OO3A 3VQUA 4CEGA 3UJ9A 1R78A 3DT1A 5FXSA 2OWBA 4IM2A 4RIOA 4QNYA 3BEGA 3OTVA 3EMGA 3QALE 4RA5A 3M4XA 3OPNA 4FTAA 2GNGA 3EQRA 4PQNA 4F9YA 3D2KA 3GC9A 1Z9XA 5L8JA 4AT5A 1F0QA 1WBVA 4YC3A 3A27A 3FLQA 5C4LA 3BWCA 5D41A 5IDNA 1OL2A 5IUIA 3UMWA 5LMKC 4MKCA 4JQ7A 4BLVA 5LQJA 3VULA 4N57A 2BR1A 3KCFA 3GC7A 3R04A 4PNKA 4EQUA 3G33A 3H2BA 4BCPA 4O2PA 2IN6A 3S2PA 3LJ2A 5DR6A 4CLJA 4JXJA 5GINE 4ASXA 3GC0A 1QPEA 4PV0A 4AX8A 4AP7A 4IJ9A 4D9UA 1GIJA 5EHGA 1GZKA 2CPKE 5CVEA 2R3QA 4ACHA 3GCUA 2IP2A 3EVZA 4XG2A 2VWZA 4FT0A 5FRIA 4AT4A 3E92A 2UYOA 4X3JA 3FZGA 2GHGA 3TUBA 3LZBA 3NUSA 2YZLA 5CAQA 3HVKA 1ATPE 3EOCA 3UODA 3I60A 3Q3BA 4EHGA 3ER8A 5LMKA 4YC6A 3DB6A 4QMMA 3CD8A 3P0MA 2ITNA 2ITXA 4HYUA 3KQYA 5EM7A 5FUTA 3WF8A 3BRBA 4RIYB 2VWXA 5IISA 5DGZA 4RX1A 4ZLZA 2XKEA 3FUPA 4YNEA 5CXZA 5DX0A 5FTOA 2VO7A 1BL6A 1H4LA 4BZNA 4EZ7A 5D7VA 4L01A 2W4OA 4XUDA 3R22A 3BYMA 4IM0A 4IVCA 1SMHA 4RZVA 2G2HA 2JJQA 3MPMA 4KINA 3OCJA 2X9EA 3PJ2A 1ZY5A 3I64A 1J3HA 5CCXA 2X7OA 2B1PA 2XEZA 2JKQA 2DPMA 4ZS0A 4YZCA 3ZXTA 1I44A 3W2OA 2ADMA 2VDWA 1G8AA 4GK2A 2GTMA 1EJ6A 2ITTA 1CKPA 3K0BA 4J96A 3HRFA 2PMLX 3QYZA 2OIDA 4RG0A 4HNFA 3P23A 2ZAZA 2XK6A 4HCUA 4J95A 1REKA 5HGIA 4MHAA 3BGPA 1SVHA 2BROA 1YFJA 2XCKA 3O8PA 2WEVA 2UW3A 3ZLSA 3I4BA 2WMRA 3RNIA 4BB4A 3ROCA 1K9AA 5D1JA 3QHWA 5KZ0A 4EOLA 3C0HA 3NDMA 2O57A 1U5QA 3Q9WA 3OWJA 4OR5A 3ROYA 4C4FA 3O4FA 4XOZA 1HMYA 3KU2A 1IM8A 3T9TA 5IMXA 4F70A 2GTNA 1OITA 3TKUA 4BYIA 4KKEA 1WZYA 3TG1A 4IQ6A 5IQHA 5JQ5A 4CT1A 1KUTA 3DLIA 3IONA 3KY2A 4U43A 5AX3A 1UKIA 4DH1A 3A2CA 4G16A 4AF3A 5EIFA 2WMBA 5JRSA 2R6ZA 2R3MA 3NLBA 4X6QC 3HV6A 4XS2A 4ZOGA 5CU0A 3E3PA 2JC6A 3EWHA 4E4MA 4OGRA 2JKOA 2J50A 4YLJA 2PU8A 3OXIA 3OBGA 5DH3A 3FDNA 2QHMA 1BI8A 3HDMA 3M6XA 4XG3A 3C3PA 5KZIA 1TQMA 3VUMA 1E1VA 3BXOA 4FUXA 4JL9A 2IDKA 1FGKA 3FYDA 4UBAA 3RCJA 2W4KA 4DF3A 4JQ8A 1G8SA 2C6KA 3NUPA 3FLSA 1QMZA 4FSUA 5DR2A 1YQJA 2X4FA 1RE8A 4AQCA 3R02A 2NXJA 1YHVA 4CFMA 4DE4A 4EOKA 4C36A 3HGKA 3MPAA 2GSFA 1U54B 3A7FA 3NNWA 3UJ8A 4B99A 5FCDA 4WNPA 4LUDA 4LG4A 5AV1A 5DBXA 3OOMA 4L43A 2Z2WA 2Z6UA 2EFJA 1H1WA 2HXQA 3CS9A 3IKAA 3HAMA 3ORXA 5A4CA 5CAOA 3HA6A 3RW9A 5BQ0A 4NM3A 3UOLA 4ER0A 2WTWA 1H27A 3SRVA 5D1HA 4OW8A 4IDTA 1ZAOA 4FG7A 4APPA 3ACKA 1ZYCA 5HIJA 4USFA 3MVJA 4BF2A 5L6OA 3IW5A 3KXXA 5DRDA 3GO4A 3NTVA 3A60A 1Q99A 1KE7A 3Q60A 4RX8A 2OXTA 3PX2A 4R05A 3BLRA 1FMKA 4K1BA 1KE9A 2WMXA 4R6WA 2WTCA 4LOOA 3RWQA 3DMFA 1YW2A 5CEQA 5DTMA 3PVUA 4O91A 2QOCA 4GUAA 3LVPA 2ITQA 5LVNA 5U4XA 5D1NA 4BY9E 2BM9A 3GRUA 5EW9A 3R9DA 4QQKA 4AZFA 2C4GA 1O6YA 2Z7QA 1RJEA 4Z2YA 3MVHA 4QMUA 4ZTLA 3WSTA 2EUFB 4GL9A 2Y6OA 1RI2A 3QQKA 4KBAA 5JT2A 4A07A 1IRKA 3KA0A 4MQ2A 2ZMCA 5C03A 3DUWA 3II5A 3LLAA 2W5BA 1JKSA 2EVAA 1BL7A 2Q41A 2BRHA 4TWNA 2WQNA 4ZJIA 2P2IA 3Q4UA 3EL8A 5LVOA 2VTLA 3QTIA 1KPIA 3VIDA 3KR9A 4U81A 4XUEA 3GUBA 3BU6A 4WNMA 1D2CA 5A54A 5L2IA 4EHVA 1FQ1B 5HTCA 4RIXB 2ZVAA 4OTGA 3V8VA 4QYHA 5J8IA 3LXNA 2CKPA 3OTUA 4IX3A 5DHJA 4WUNA 4JBOA 4B7TA 3FZTA 2GA9A 1T43A 2VTQA 5M4FA 2BHEA 5EI2A 4BTJA 2J90A 3QGWA 2PULA 3P9NA 5CVUA 2Z60A 4JIKA 3BWFA 5I9WA 3SX9A 2PBFA 4NH1A 4RYLA 4MVFA 2PVHA 3Q4TA 2JITA 3FC2A 4OBQA 3T3VA 3L9LA 4FZFB 1CSNA 4BDKA 3FE3A 3OF0A 4NWMA 1J91A 3EQBA 4G9CA 5A3XA 3M6VA 3ZDUA 5K0JA 2EX4A 1KPHA 4CTCA 3UYTA 3QX2A 4WVLA 3UIUA 3ZO4A 4YO6A 1Y6BA 3GFWA 1IEPA 2VUWA 4M67A 4ANBA 2YWVA 2ZBPA 4FZ7A 3PXZA 3E93A 1ZZ2A 4FV2A 4GC5A 5LQCA 2J2IB 4XLVA 4TYIA 4S2ZA 1NA7A 3K5UA 4DGLC 4RFZA 3ZFMA 4QTTB 3MY5A 3R01A 4G2FA 2VWIA 4FVQA 2PZRA 5CSHA 4RSSA 3FZSA 5JN2A 1E9HA 3FUXA 4FKSA 2O06A 2DULA 4LMNA 3DBCA 5A4QA 4CKEA 4C38A 1XBAA 3OUNB 4PNEA 3ZCLA 2C6EA 4GJ3A 5K0BA 4GYGA 4XUFA 1XH8A 4OQEA 3HUCA 2WB8A 4F9BA 4FT7A 3EVBA 3PTGA 5GIOE 4MNEA 4FSNA 4EOPA 2EJTA 2HWKA 3ACJA 5M5BA 1JSTA 3JXWA 2PHKA 2IBTA 5FP6A 1TW2A 4WG4A 3R7EA 5L2WA 4FKOA 1M7NA 4PP9A 3DTWA 2XNBA 3CP9A 5IKMA 5A14A 4ENXA 4ZEGA 2F8LA 3TMAA 4ERWA 3EEYA 4P5QA 4M69B 1PMVA 1XQZA 1ZG3A 1JKLA 3VS1A 2W1IA 4LOQA 3UVQA 1OZ1A 3FXWA 4EK6A 4PMMA 3EYGA 4R7HA 4IVDA 5HG5A 3TNQB 3MW1A 3R63A 1IY9A 1SG9A 4GKHA 3V8WA 3FAAA 3TXOA 5CI7A 3ZUVA 4C4JA 2ZFUA 4YSJA 3FQHA 4F63A 3QRTA 5A4EA 4ZSAA 5CVVA 5KMIA 1R8YA 4FTIA 2QONA 3KR0A 2RL5A 3U8WA 2XRUA 3EGEA 4FTLA 3JPVA 3JY9A 3ID6C 1Q8UA 3A8WA 3SHEA 5JZNA 3IDCA 5CCBA 3C1XA 4Y8DA 5C4KA 4ENYA 3V01A 1O9GA 2HZ4A 4ZTRA 4TN6A 4C7TA 5CM2Z 3O71A 5F1ZA 5KCVA 4PCLA 3I6UA 5HO8A 2ZBRA 3EVEA 3V5TA 3FY0A 2PL0A 3P97A 1IR3A 4FP9A 5M51A 4WNOA 5EKNA 2HAKA 3UTOA 3M6WA 4FTNA 4N70A 4K8AA 2ETRA 3LBFA 1OIQA 3GCSA 3OW3A 3DXZA 2HW6A 3FLZA 5AUYA 4YPDA 3UDBA 4F9WA 2KW5A 1KWPA 3B2WA 5J9ZA 5JKGA 3UYSA 3R7UA 4RZWA 1G6Q1 2I1MA 1OECA 1PW2A 3CPCA 5J5SA 1XCJA 3QCXA 5DA3A 4NK9A 2RKUA 5E9EA 3V97A 5M4UA 1OKZA 1UNHA 4NW6A 4CRSA 2OFUA 3T7TA 4ZSLA 4I0SA 5IEYA 2J7TA 4Y95A 4CTKA 3HCDA 4DGMA 3GEQA 5DR9A 3RM6A 2B52A 3D5UA 3E23A 2BKKA 4U3YA 3LECA 4QQ5A 4YJUA 5DWRA 2B78A 4C4EA 4Y46A 4F1MA 1H28A 3PYYA 3ZC5A 2UVYA 1W83A 4G1WA 3DKGA 3CJGA 3GQLA 4FEWA 1ZMUA 3QRJA 4IB1A 3C4WA 3BZBA 3UVPA 1JQHA 2RFSA 4XG7A 5B7VA 2J0JA 5FA8A 1KSWA 4F08A 1X8BA 2WQEA 3FI8A 1O9UA 4B9DA 4DH8A 4F9AA 3C51A 1ZGAA 4FODA 4WG3A 4DLIA 5JFSA 4TYHA 3UPZA 2RFEA 3FTCA 5L6PA 2PX2A 1I4WA 5KMOA 4X6RA 3TUCA 3A7EA 4JAIA 2XNPA 5M07A 4MWIA 5EHOA 3B3GA 3D0EA 2LGCA 2UW4A 5K09A 1JTEA 2B55A 3EEOA 4D5KA 2QOFA 4FKUA 4MXZA 1WMKA 3KF7A 5AP5A 3A99A 1MUOA 4GV1A 2UW8A 3HA8A 3R3HA 2OZAB 3MB6A 4Q5HA 3P9KA 4O0SA 3OZRA 4ZY5A 1SUSA 5AUTA 3NZ0A 5B2KA 4L9IA 3ZONA 5K5XA 1PXMA 3TNWA 5AUUA 2NXEA 3KMUA 3QLGA 3D14A 3LBYA 4EOSA 3R9RA 1WXXA 3I5NA 4QMVA 5EHYA 4I5HA 2NXNA 5T6KA 3TJDA 4A7CA 3FPHA 3TM5A 4IB5A 2DYLA 3LCUA 2WTKC 3SV0A 2X2LA 2O65A 3DNDA 3H10A 4GK3A 3MHTA 3BYVA 2BRBA 2PWPA 1OBDA 4NU1A 3QTWA 3FSFA 1Y8CA 4ZJVA 3BHHA 4E6AA 3TZ9A 4NT4A 5K9IA 3HP7A 4R3CA 5ANDA 3BE2A 4RLLA 3VC4A 3FMNA 4I0TA 3WYXA 2AOTB 1KV1A 3BYUA 3PS9A 3F88A 4KIPA 4DCAA 4XP3A 4P7GA 5HIKA 4A6EA 1VYZA 2XK8A 2VRXA 3WE8A 5MHTA 2OF4A 2C5XA 3D5VA 5DE2A 4R6XA 3LOKA 4O7WA 5T6BA 1J7UA 3L1SA 3QTUA 3DZOA 4RTRA 1XKKA 2AN4A 3HV3A 4NJ3A 3LM0A 2WGJA 4FKWA 3ZLXA 4TWOA 3DKFA 4XH6A 3IDPA 9MHTA 2QO2A 5DYJA 4G6NA 4JG6A 4D55A 3OOGA 3UJ7A 5I9VA 4RX9A 3FPGA 5HBHA 1JWHA 2ZIFA 5I9ZA 4C4AA 1XVAA 4UV0A 3DAEA 4E6DA 3W18A 3T3UA 1M17A 5LVMA 2V0DA 4J97A 1YF3A 3UFBA 3V5PA 5KQSA 5BUEA 3O96A 3KL8A 3DJ5A 5AUZA 3QUDA 3IW7A 4HGTA 4X2NA 2YDKA 5CWZA 1KE8A 1JQ3A 2UW0A 4BBMA 5TKDA 5DT4A 3CTHA 2V7EA 1JOWB 1JKKA 3U51A 4GUEA 3AXSA 4FKVA 4IAIA 4YPSA 2IW6A 3Q52A 3EJ1A 4ZTHA 2H34A 2G2IA 5CF8A 4TXCA 4CLIA 3KREA 1GJOA 4O7YA 4ANSA 3GRVA 4CTBA 1XCLA 4EL9A 4UALA 2ITUA 3PSDA 3A7JA 3I81A 3D4QA 2X8DA 3VJOA 4ZS4A 4HGEA 5T67A 3MPTA 4EK4A 4GOMD 3QOXA 4EHEA 4BBFA 4O7SA 5HIBA 4NFNA 2PT9A 1V0PA 1CTPE 2CL5A 1JTFA 3P79A 3PPKA 5HE0A 3DQWA 3FRHA 3FMMA 4EH2A 4H0NA 2Y4IB 1VJYA 3B3FA 2W1EA 3JVRA 3FTDA 2FH9A 3R0QA 5CU6A 5IQBA 1ZHFA 4LWPA 4CG9A 3DH0A 4YUVA 3TFWA 5F94A 3DLZA 4EYMA 4AA5A 4FGBA 4QP7A 2QD9A 4O29A 5AP3A 1YOLA 4GOLD 1X1AA 2QU5A 5HIIA 3LSTA 5FXRA 4L44A 4GU9A 2W96B 1YWVA 3VUGA 4YUXA 2BUJA 1BLXA 1ZY4A 4F64A 3VC2A 4PTGA 2H1RA 4JG7A 1PXOA 3G8BA 3GU7A 2BALA 2C1AA 3C0GA 1FMOE 4R1YA 4CCBA 3AD5A 5CSXA 2YM5A 8MHTA 3ODYX 4JT3A 1SQFA 1X19A 3ENMA 4ACDA 4LL5A 4GIHA 5KO1A 4H1MA 2ONYA 3AJDA 4BDBA 4RSRA 5LQUA 4QMWA 5CVDA 4X21A 1R0EA 4QPSA 3SOCA 4ATNA 3AXTA 5CSWA 1UWVA 3KXZA 3HECA 4PYMA 4PUZA 1NV9A 1OPLA 2F7XE 4FV3A 4A4XA 4F7SA 2A14A 3T8OA 2I7QA 4CKRA 5CVJA 4FL3A 5DRTA 2Y4IC 2VWUA 2R3OA 3QC4A 4BKJA 4IB0A 3W2PA 3SDJA 1H07A 4LRJA 3WILA 3HM2A 4DEHA 5AM6A 4BDEA 3R24A 4FIGA 3I5ZA 2IJMA 3H0ZA 4OQDA 3THRA 2WQMA 4TNBA 4IJPA 4M15A 1GY3A 4C07A 3DBQA 2R3RA 1F5QA 3PUPA 4YJRA 3Q9ZA 3PZEA 3AQVA 3GI3A 2YXLA 4O7TA 4TYEA 3CR0A 5EKXA 5CEIA 2C3JA 3SA0A 3E8EA 3V5LA 4EKLA 4QMSA 3JWJA 3WI6A 4C35A 4PGHA 2I0EA 3ORNA 4BDGA 3CXWA 2GLUA 5CENA 2GS2A 3POOA 3PXKA 4FSZA 3AT2A 5HBEA 1TVOA 4PYQA 2PY6A 1WVXA 2X81A 4UWCA 1W98A 2OW3A 5EOVA 2I6LA 3CVOA 5HZNA 3PB3A 4E5AX 4V0GB 5DM2A 3MH1A 3VYWA 3KK9A 4GEOA 2P1DA 4E2YA 2PZPA 4IZ5A 2AVNA 4M84A 3LCVB 3PP1A 1XJDA 3OW4A 3TI1A 3GU3A 3OFKA 3MCTA 3MESA 4RTJA 5DEWA 3UJCA 4E93A 5IDPA 5DX1A 4RJ3A 3ZSGA 1JSZA 4BHNA 3UZRA 3CKWA 4QQJA 1RJGA 3HVCA 1RJBA 3FHIA 4NUSA 4W4VA 3EGVA 4U5JA 1CDKA 4IZ7A 2VGPA 2OY0A 5JQ8A 4M7IA 1NBHA 2YIXA 1OIUA 3BQCA 5TF9A 4JXFA 2QOKA 3I7BA 5K4JA 3TQSA 3KN5A 3KB7A 3R7YA 4CSVA 2WAJA 2C5VA 3E64A 4FL2A 5BMMA 4YJVA 4DFLA 4MBLA 5DG5A 3RZBA 4P7KA 2C69A 3LCSA 5DN3A 1Y6AA 5IG1A 4PDYA 1KP9A 4D0XA 3D5WA 3EB0A 5FWAA 4L3LA 4JOAA 2JG3A 5GNKA 3HX4A 1VLMA 2P3GX 3ERKA 2UUEA 3FPFA 4LRKA 3G6GA 4YZBA 2NPQA 3VS5A 4UZDA 5EM8A 2WIHA 1Z3CA 3TIZA 4DA4A 1T45A 1XO2B 2XK4A 4GT3A 3GXLA 4XLIA 4RTMA 4XX9A 4C4GA 2XIRA 3A4OX 2GS7A 3FQSA 3KVXA 5BW4A 2CMWA 2VTRA 4W8DA 3OVVA 2VP3A 4K18A 2UZBA 4MXCA 2YDIA 2XYRA 2C5OA 4FICA 3DXQA 5AUXA 3R7OA 4R77A 4WBBB 3VS0A 2X7FA 4E31A 2W17A 1UWJA 4IV0A 3AC4A 1HCKA 5DXJA 5CF5A 4XCXA 4DFYA 5GM2A 4L3JA 3BLQA 5K0LA 3LW0A 3VNTA 1GIIA 1H24A 3QOWA 3ZU7A 3QD3A 2PYWA 4C4HA 3NUAA 4F9CA 3HCAA 1V0BA 3P08A 2VWYA 3EVFA 3SXRA 5A4TA 4C37A 4Y73A 4IM3A 3OE5A 4FKTA 3NW6A 2CN8A 1M2PA 2QG7A 3MFSA 4O7NA 1WZNA 4GH2A 2GFCA 3VUHA 3AY0A 2HCKA 4FEQA 2CKEA 2RFNA 3PVWA 5BVKA 3ET7A 5CAUA 4A6DA 1URWA 3TOSA 4RMZA 2CGXA 3OCGA 2HXLA 5B2MA 2GQGA 4YJSA 5HLPA 2FSTX 2C7OA 3B8RA 4RWLA 3P5KA 4C06A 3R21A 2GHLA 3JUHA 3AC8A 3FXXA 4EH8A 3P4KA 4W4XA 2W7XA 2FB8A 5LCKA 4QNAA 3LFSA 4D28A 3G2FA 3MB7A 3QFVA 3ORHA 1PXNA 1QAOA 2OB1A 4RJ8A 2WZJA 2AZTA 2B9EA 3ZRLA 4DC2A 3RAIA 5EQPA 4R8SA 3SSMA 3W10A 1FP2A 4Z55A 1UIRA 3CJTA 4RWZA 1KR5A 2R64A 4CKJA 4XYFA 3HEMA 2HK5A 4FNXA 2GU8A 1OKYA 4C58A 2IG7A 4QTDA 3SX0A 1YUBA 3E3BX 4K2RA 4UWBA 5C27A 4GG7A 2P3LA 4R78A 5EDRA 3SQQA 5E8SA 4EQMA 3LL7A 3NYXA 4UYAA 3PTAA 4B8MA 4E2WA 4RTPA 5EHIA 4EK9A 3OWPA 2G1PA 3LJ0A 3PFGA 2CMHA 3W1FA 4HVHA 1UKHA 2ZB1A 3UO4A 2WPAA 4RIXA 1QAMA 3FMDA 3DMHA 4FZ6A 5HCXA 2B25A 2BZIB 4Y5HA 3E7PA 3BZ3A 5HESA 5ACBC 3EQHA 3OWLA 1PXLA 2X39A 3QTQA 5FDPA 2AOUA 4JDHA 2Z02A 4JI9A 2OKCA 4D9TA 4HH4A 3DAKA 4FKGA 4I6BA 4AN3A 2BHHA 2PZIA 1PMEA 5H3QA 2CNQA 3VUDA 3EN6A 1V1KA 3H9OA 3ME5A 3C3YA 2F7EE 5CNOA 4YV2A 1R18A 2PKWA 3QQFA 2XS0A 3TNIA 2EXCX 1AQIA 4EH6A 2V7OA 3SXJA 2FCAA 2B3TA 1WXWA 1F3MC 4IWDA 5ICGA 2R4BA 4R1VA 4L68A 3ZSHA 5E8TA 5KUPA 2XIYA 4XOYA 5BNJA 3HUBA 4DM3A 4DHFA 5HI2A 3AXWA 4GFGA 2OJIA 3KQVA 4X41A 4FV6A 1G55A 3ZO2A 4ER5A 1ND4A 3GXOA 4CWAA 1PHKA 4F6SA 2SRCA 4HZSA 2B7AA 2WD1A 1FVRA 2Z8CA 4MXAA 4G3CA 4QTBA 4ER7A 5EOBA 4RJ7A 2JGZA 3GB2A 3W2SA 4Z16A 5KKRB 3F2RA 3KQSA 5FEQA 3ZMMA 4HG2A 4DH7A 4P4CA 3HMIA 3QX4A 4I23A 1MQ4A 4CG8A 3DULA 2YM6A 2PPQA 5D7AA 4L7VA 4PYJA 1BOOA 4AN9A 3OS3A 2PWYA 2XVDA 2YITA 4YJNA 3T7RA 3D7ZA 2YCSA 5EM5A 3PY1A 4K11A 3B5IA 5EG3A 1XBCA 4IANA 3HCEA 3SXFA 1L3IA 4G6OA 4U8ZA 3UGCA 3C0IA 3KF4A 2C47A 4JBPA 5DFPA 5DI1A 1PYEA 5AADA 3PZHA 3IDBA 4JNWA 5FM2A 4O83A 4BBEA 1LUFA 4QP8A 4K9YA 4QP1A 5IQGA 4C4IA 1R00A 3PLAE 5EDQA 3TZ8A 1ZQ9A 2JDTA 1H01A 3VHEA 3LDFA 3O7WA 5CQUA 2GNHA 4CGAA 3DJ7A 3DR5A 5ANGA 2CN5A 5BYYA 3ZS5A 3PIYA 4O86A 3S0OA 2GB4A 1OBGA 2OJFE 5IZFA 4L42A 5ANIA 3ZLYA 2BDJA 3PFHA 3QXOA 4A9YA 4O21A 3KR1A 3ZO1A 1NVRA 3DFAA 4RX5A 5KKRC 1H1QA 3G5TA 3R00A 3UC4A 2F2UA 3KULA 3O8TA 4RTSA 4U7ZA 1YXVA 4S34A 1XH6A 5FGKA 3Q5IA 3WF6A 4EJNA 1NBIA 4YC8A 1RI5A 4QT1A 2OJJA 4YHJA 5FWDA 2IGTA 2BPMA 4BLUA 2BCJA 5IEXA 3BQRA 1ZZLA 3RALA 1P14A 1Q5KA 3F3TA 5I0BA 4CKCA 3GCPA 2WFYA 5BUIA 4AOTA 5DPMA 3IGGA 4YMGA 1O54A 3R8VA 1OMWA 5EDPA 4N6ZA 4TKSA 4FBXA 3R8UA 2YUIA 3OHTA 3KQ7A 3MGYA 2BRNA 4DINA 3PA3A 4WG5A 4AGUA 2VTTA 4KS8A 3OT8A 3NCGA 4CD0A 3B7PA 1U59A 1J1BA 4ZZMA 1H25A 3FKOA 2O0UA 4RVDA 4G5JA 2HENA 5HTBA 2PX8A 4LUEA 3O23A 7MHTA 3DA6A 3QWJA 5CS6A 1R74A 4BIDA 2A27A 3P78A 1W7HA 3RVGA 3W55A 3HAVA 4EH4A 5ITAA 1Q24A 4MHTA 4E70A 4XMOA 3EVCA 1YI3A 1OL6A 4DZRA 4OTFA 4L8MA 4OT5A 1ZMVA 4WKQA 1WY7A 3LQ8A 4JR3A 3LPMA 3QD0A 4KBCA 3EFKA 5KMNA 2ZJWA 2VZ6A 1NW3A 5ANEA 3OD6X 4ZSGA 3E7VA 4DTBA 3GVUA 3NVKI 1I1NA 1MJFA 4YURA 3LHDA 3BE9A 4LMUA 4PDOA 4E4LA 4APCA 2ZV7A 4ANMA 3VVHA 2W1DA 3VC1A 4KIQA 2CMGA 1VP9A 5EK7A 3A62A 5ACKA 2FSLX 3LFEA 1Y8GA 1W0XC 4KWCA 5AV0A 3RHXA 5HILA 1OUKA 3TV6A 4L00A 1HNNA 4DFBA 5FM3A 2ETKA 1X1CA 4PIMA 2RF9A 4ZZNA 3A7DA 2BTSA 4HYSA 3THBA 2PVMA 4BCFA 1VE3A 4ZLOA 1PJZA 2A2AA 4DG0E 2BILB 1F38A 5CU2A 4GEKA 4PNIA 2YN8A 3BGIA 2OH0E 5JEBA 4FSYA 1FJXA 2XIXA 5I9XA 2WMSA 3QZIA 3KFAA 4WT6A 3U4WA 3UPXA 2PX5A 4PY1A 5HVJA 3EZVA 4U3ZA 4LWOA 4F0FA 4QYYA 5EZQA 5I5ZA 5HNGA 2JDVA 5A6OA 4V05A 4UYNA 1YFLA 3GOKA 4E1ZA 3PFQA 2V7AA 4AFEA 5CU3A 5EQYA 1Q4LA 3LFDA 1SKMA 2WTIA 4TW9A 4EWQA 1BYGA 4GG5A 2QU6A 4FSRA 3FUWA 4DEBA 1JG1A 2GMXA 3EZRA 4F1TA 2QG5A 2WMTA 2JD5A 4GS6A 3F3ZA 4DLJA 4FTMA 5HBJA 1R6AA 2X9FA 4QVKA 5I9YA 2XJ0A 4DGOA 4R8RA 5FQNA 1ZXEA 5DSXA 2XNEA 5CU4A 3BWJA 3V6SA 4D1ZA 1FGIA 2YM3A 2XVAA 1T46A 1R8XA 5EW8A 4TTHB 5HX6A 2VD5A 4MXYA 4H3PA 1F3LA 1H1DA 4TWPA 1SUIA 3EQPA 4JR7A 2IVUA 4X0MA 1WBTA 5E9JA 1AQ1A 3BGZA 3PRIA 4PYOA 4FTKA 5C9ZA 4RIWA 4ID7A 5HLNA 2ZB0A 4RWIA 3D9VA 5FD2A 5EM6A 5AP1A 2G1TA 3GRZA 5CZIA 3R9XB 1J1CA 4Q9SA 4ALVA 1NW5A 3NNUA 3N4UA 3OZSA 3DS6A 5AAEA 3HP5A 4L67A 3I9FA 3PJ3A 3O50A 3SC1A 5K0NA 4KS7A 4S31A 1I09A 4IAAA 4B17A 5CASA 2GHMA 3JVSA 2HOGA 3R73A 1ZYJA 2B0QA 2AC3A 2P33A 2PE0A 2NP8A 2CJMA 4BLWA 5J87A 4H05A 3W32A 3LCCA 2VDVE 3KK8A 1NVQA 3L8DA 3E05A 1YHWA 4A06A 2DUVA 3NAYA 3EVDA 5CAPA 2JIIA 5IQFA 4MAOA 3RKBA 3ZRMA 4HGZA 2C6OA 4BDIA 1B39A 1KOAA 3G2OA 2VWVA 4HPUE 2WMQA 3DTCA 3C0KA 3ZEPA 3DBFA 3LM5A 4PL5A 5IA3A 3AMBA 4FA2A 3CKXA 3NWWA 4ZTNA 3A4PA 1IAHA 4BI0A 3DY7A 3C4CA 3NS9A 4B0GA 5JGDA 3BU5A 5LQFA 5G6VA 3P9IA 5CT0A 4DGGA 2W5AA 3QRIA 4DT8A 3ELWA 4QTEA 4YMJA 2I62A 3BYSA 4YZ9A 4EOIA 5BVOA 4O82A 3ZDIA 3U9NA 1GOLA 1G38A 3FYKX 3FHRA 2BVAA 4RPVA 3LFAA 4I6QA 5LWNA 4E2XA 2HWOA 4L45A 5H8EA 2WTJA 4LECA 2ONZA 3F66A 5A46A 3I0QA 4NZWB 4NTTA 2I7CA 1OL7A 2R3HA 4YUZA 3MH3A 2IZSA 5ANKA 3HDNA 3FJQE 5BPYA 4F99A 3LCOA 4ZIMA 1P4FA 3DXYA 2J0IA 2XEYA 5BW5A 3MA6A 4RT7A 5LVLA 2XK9A 2ESMA 3IO7A 4CKBA 3HVHA 3O17A 3BWYA 3TCPA 3IW8A 4HC4A 2VWWA 5FA5A 4G3GA 2E9VA 1FVTA 3VSEA 3GCZA 3PDTA 1VP3A 3HNGA 5GJFA 3RINA 3P1AA 3CJRA 1AGWA 5FXQA 5L8KA 4WOVA 3PIXA 3P8ZA 4ITIA 1IG1A 3E8NA 3COHA 4W4YA 3CQEA 4IB3A 2IBSA 3EN7A 2F49A 1PY5A 2CCHA 3LFCA 2E9NA 5IH4A 4A4LA 4F09A 5M09A 3EPPA 5ETCA 3ELDA 5G02A 4E20A 2CKQA 3EHAA 5HEKA 4RJ5A 3ORTA 4FC0A 4HSGA 4GT4A 3U6JA 4FUYA 5H2UA 4I0RA 1H0WA 2JAMA 1WFCA 2GAFA 2FYTA 4O7ZA 3ZZEA 3C5IA 2KTYA 3GU4A 3LIJA 1JSVA 4D2RA 4YO4A 4UB7A 4M12A 4QRCA 2IZUA 3PPZA 1L3BA 4FT2A 2Z6QA 3VBVA 3F2AA 3UO5A 4FV4A 4ACGA 3IV6A 4PL4A 3EKNA 4FT4A 1WVWA 3FYJX 5ANJA 3OFJA 3WYYA 3D2LA 1S9IA 1QPCA 2YIRA 3FBVA 3S1HA 3F3VA 5HU3A 4RVLA 4XG6A 4UX9A 4DEIA 4DH5A 2XBMA 3PA5A 3K3IA 4LM5A 4WIHA 1KYZA 4JDIA 3EFLA 3GGFA 2UW6A 1WS6A 2HY81 2VX1A 4EVIA 5EOLA 3OCBA 3F61A 3AWIA 3QF9A 2ZDUA 3IW6A 1GZOA 4FYNA 1XR1A 5M44A 4O6LA 3KVWA 4QPAA 3EQGA 3HP2A 3QQGA 1SQGA 3B89A 4AOJA 2FSOX 4R3RA 5E1SA 4O22A 3TPZA 4KA3A 5FBNC 3KQOA 1EIZA 3RCDA 4X7QA 3OEFX 2R3KA 1OKVA 1R3CA 3HKOA 5AIRA 3QTXA 3B8QA 4XG9A 2OLCA 2YFXA 2VDUE 4FX3A 2C6LA 3GDHA 5EZSA 1JG2A 2QNJA 4QTCA 1WAKA 2X8EA 5T68A 3ENHA 3BUSA 3GJYA 3KEXA 4XP0A 5C8MA 2VNWA 3SRVB 2VU3A 1XTPA 2K4MA 1W84A 3G2MA 2GQSA 1JAMA 2WA2A 2G8NA 2UZWE 3M70A 4QP2A 3QYWA 4I5PA 5KNJA 4PYKA 4GYIA 4J99A 3BKWA 2QHNA 3KRWA 3KHKA 3RM7A 1H00A 3LQ5A 4M68A 1B42A 3PIZA 2ZZKA 3WF9A 3RPYA 1BUHA 5CYIA 4F1OA 4BDAA 2UZOA 2P55A 1UFKA 5LQAA 2QY6A 4KW7A 3QZHA 4M97A 3R7VA 2E2BA 5KHWA 5EYDA 1VEBA 4OA5A 5TT7A 4WO5A 3U54A 3L8XA 2G70A 5ERGB 2X4ZA 2PX4A 2QYOA 3HV7A 4FSDA 3IOPA 4AN2A 4D2SA 5CANA 2QOHA 4O0RA 3W2QA 4PX6A 2OPBA 4TT7A 5CSPA 3K3JA 3G0FA 4BTMA 5AP2A 4MEDA 3JWGA 2XMYA 4CQEA 5JGAA 1OR8A 1P5EA 3C50A 3Q5ZA 4G9RA 2PVKA 4CXMA 3P71T 4OBPA 4D1SA 4HYHA 3FUUA 4KBKA 4OLIA 1HOWA 3VF9A 3HNRA 3QRKA 2OO8X 4YHTA 4AZTA 3QRUA 3JR1A 3EQDA 3N4TA 3PJ8A 4ISCA 3PWDA 2CLXA 4JX3A 3FMEA 3UVRA 4GCJA 4DMGA 1BX6A 3V5JA 5IH6A 3QWKA 4AGWA 5FADA 3CLYA 2IIPA 4IACA 3B2TA 1ZARA 4N6YA 4ZXTA 1EJ0A 2YERA 2JKKA 3BT7A 2CLQA 3PT9A 3MTFA 4DGNA 4ASDA 1DI9A 2W06A 3SXSA 5BP7A 1PXKA 4I94A 3ELJA 5DX8A 1FOTA 1SNUA 4DQ0A 2WOUA 4I6HA 3ULZA 2PVRA 3U81A 3FY2A 4BRXA 3U6HA 4FIJA 4ZY4A 3P7CA 4D4SA 3GENA 3EGIA 3FTEA 4IV8A 3GIWA 3MB5A 2XRWA 4FKLA 5CLPA 4YUQA 4P2KA 4DH3A 3UNKA 3BGQA 3CJFA 3UMXA 5ETFA 4AZEA 4EOOA 3R2BA 3UG2A 4AFJA 5AV4A 4E7WA 3ZZWA 2XIZA 3FMKA 5CAVA 3VHKA 2YIWA 3MFUA 4XNEA 4JDKA 4I22A 3MS9A 3MTIA 3EN5A 5TR6A 4GFOA 5K8VA 5EYKA 3K6RA 3LKMA 2B4SB 2CSNA 3OT3A 4O38A 2OICA 3QU0A 5E1BA 2B9JA 4DBXA 1EQAA 4L46A 4O0VA 4FKRA 3FSKA 4JAJA 3KR2A 5CD1A 3NW9A 4MNEB 4NW5A 2UZ4A 3Q87B 4J98A 4YNOA 1JG4A 3TNHA 4C34A 3EKKA 4FSXA 3RGFA 2XKDA 4PINA 4K77A 3VW8A 4QDJA 4XJ0A 4J53A 3TWJA 3MYGA 4I92A 2WMVA 2H11A 1JKTA 2UZVA 5KMLA 3NRMA 3M6UA 2B9IA 3UOKA 2C7PA 2CNVA 2CKDA 2WIPA 1STCE 1L1EA 3B3JA 1P91A 5ETIA 3NCZA 3HMNA 5DT2A 4RA4A 4BCMA 4EYJA 2AOWA 2O07A 5EHLA 4U6RA 3ZUTA 4FV9A 1M14A 1OVEA 3S00A 2UVZA 3SSNA 3THSA 1P39A 1SYKA 2A19B 4KDCA 2YAKA 5IA2A 5HU9A 2G71A 2EXMA 2HWPA 3E87A 4E5WA 2JFLA 2VTSA 3PVGA 4N0SA 2ZM3A 2RIOA 3R9OA 2IH2A 1IAJA 3OXZA 3SR4A 3A4TA 1OUYA 4ZMFA 2P2HA 2R7IA 4OBXA 3OBJA 3NWEA 3OU2A 3WBLA 4LV5A 3QKKA 3CTQA 3Q6WA 2OYRA 4U9AA 3FZPA 2WMAA 3VQHA 2AN5A 1WBNA 3ELYA 4HOKA 5IUHA 1XDUA 4X3FA 4ZTMA 3F5UA 3U4UA 3W2CA 2Q0NA 3VJNA 4IZYA 2H00A 4WSYA 1SVEA 5J1VA 2I0HA 4GOND 1QZZA 1XJ5A 3R8ZA 5EQJB 4FS8A 4NIFB 2YJRA 3AD6A 5HIEA 3A7IA 3H30A 1Q0SA 2VTOA 1KHHA 1QPDA 4G6LA 5C8NA 4KRDA 4CFWA 4XRLA 3R0TA 1RJFA 4FGZA 2XK7A 5BVEA 1VIDA 4I6FA 3UA3A 4FKJA 3GT8A 4D58A 1L3CA 2DWBA 4C03A 1ZOHA 5K4IA 1VYWA 3AT3A 3PY3A 2PXCA 4WRGA 4PMSA 2ZV8A 3LXKA 4E33A 4RWJA 4RQVA 4IX5A 3DXPA 3TJCA 3UZUA 1D2HA 5HFJA 5AUWA 3C13A 4CCUA 3L8PA 4ASEA 4PL3A 1URCA 2YIYA 2QO9A 1OI9A 2PK9A 2ITVA 3ORMA 4FZDB 1Q8WA 3GC8A 5C01A 4MD8E 4N4SA 4EJ7A 3LKDA 4M14A 4LRMA 2FK8A 3ORZA 4KRCA 4DCEA 2IH5A 3EFJA 2YJSA 3TLJA 3SOAA 2OB2A 3RTPA 1DM2A 2R0IA 2JHCA 2PXXA 4ER3A 4QVGA 4F6WA 1A9UA 4AW1A 2Y9QA 2CKOA 2ZIGA 4YTCA 3NNXA 4GMYA 5FUBA 2ITZA 3AMYA 5EEGA 2P8JA 5FEEA 5HG8A 3TM0A 3IW4A 3LCTA 3E5AA 1BC5A 4GF5A 4U97A 4C2WA 3NJRA 5HIMA 4MQ4A 4PYLA 2XBJA 5H8GA 5C8KA 3ULIA 2R3SA 2WU6A 2V74B 1FPQA 3ZSIA 4HPTE 3ZFYA 2UZDA 1OM1A 2CHLA 3W33A 2FK7A 2CCIA 2YAAA 3PX3A 4R7BA 3ELUA 3TKYA 1U46A 5DIAA 5AUVA 2OFVA 2Y0AA 4OTRA 3BELA 3WZDA 4XUCA 1R1WA 4DN5A 5E9QA 3DOUA 3ZEWA 4QYEA 1MP8A 3ZBXA 4EKGA 4X2JA 3FZOA 5EKOA 4ZK5A 4E32A 3OXTA 2W5HA 2WQBA 2ORED 1N7JA 2PY3A 3E8SA 2O5KA 2VGOA 4PF4A 4J7BA 3KPWA 2PXAA 4P7EA 1QYRA 3VUIA 5DM0A 2X6EA 3NX8A 1ZWSA 2BR5A 3G7UA 3OU7A 4FK6A 5L8LA 4IAFA 4OTDA 4BTKA 5F2NA 2WTKB 4RJ4A 3AGMA 4WNKA 4DG3E 2C6TA 1ZLTA 2AC5A 3R8PA 4KUJA 3S3IA 4JVGA 2DQ7X 1NV8A 5BVWA 4FV0A 5ETAA 2WQOA 4EWHA 3CY2A 3QHRA 4WD5A 3OUKA 2XCHA 4LOPA 5CALA 3D2IA 3CPBA 3TV4A 2GPYA 5CXHA 3BHTA 4EZ5A 2O3PA 2HMYB 3P2KA 4QOXA 4QP9A 4QMPA 4PDPA 5CEMA 4RTLA 1LPUA 3CY3A 5AIKA 5BYZA 3SKCA 4NECA 5L2TA 4YJOA 3JS2A 1YWNA 5AP0A 4FV7A 4Y85A 5AJQA 4YGAA 4BDDA 3IOKA 4XV9A 3PXQA 4BCNA 2QVSE 4ZSJA 4TL0A 4YUWA 1AV6A 4YZDA 5EMLA 3R83A 5F20A 3RI1A 4OA8A 3O51A 2C1BA 3OU6A 2Y1XA 3GP0A 3I5UA 2YISA 4NL0A 1ZOGA 3NUNA 2JHPA 4FZVA 4OT6A 4BCJA 1O6KA 4FK3A 4BP3A 5E8ZA 5EPEA 3FZ1A 5E4HA 4BCOA 3VS7A 2BDWA 1ZYSA 1OIYA 4NJDA 2IFTA 4FYOA 1WBOA 4FOBA 5AM7A 4GK4A 4IH8A 4MBJA 5JMSA 4PTEA 2E9UA 2NRUA 5M57A 4MK0A 3BU3A 3W8LA 2JLDA 3AD4A 3DTNA 5GM1A 5K0FA 1KXZA 1BHJA 1UA2A 4Y30A 3F7WA 5H8BA 3EN4A 3EVGA 3A8XA 1SVUA 4BTFA 4USEA 3D5XA 4P58A 1PXPA 3KKVA 5KBQA 2JIUA 2PUNA 1FVVA 3FUVA 4BIEA 4BIBA 5HD4A 2WA1A 1UU3A 4QP6A 3KRXA 3ORKA 2AOXA 3I7CA 5K05A 1XH7A 1K3AA 2X1NA 3R1YA 4HVDA 5FTGA 4KB8A 5IH3A 2R7BA 4U80A 4IZAA 4E5BA 2QE6A 4ZLYA 4ALWA 4FKPA 3DJ6A 3H4JA 2C0IA 5M4CA 4C61A 4XBRA 2XYVA 4ANQA 1P1BA 4Y72A 5EEHA 4A4OA 4FIEA 2QODA 2FSMX 4HTFA 1DI8A 3CQUA 1AD5A 4J8MA 2PJDA 2OJ9A 2OSCA 5E8WA 3T0IA 3REOA 4QMYA 4CMUA 5CVHA 5EMMA 2C0TA 3KQMA 1BMKA 2JFMA 5HCZA 3F5PA 3CD3A 1IASA 4CNHA 4IFCA 3CGFA 5HG7A 4IVAA 2BFYA 5EVJA 1KYWA 3GNIB 4AXAA 4PMTA 2GNJA 3QA0A 3UZPA 2WHBA 2OH4A 5HORA 2ZVJA 3MAGA 2AR0A 2ZULA 3OY1A 4IAKA 4AA0A 4D4VA 1JG3A 3F9NA 1OPKA 2G9XA 4EQZA 3LFNA 5AEPA 3NUXA 2IVVA 3MFRA 4FIIA 4QYFA 3KRLA 1RW8A 4F84A 4M7RA 3RIEA 2AVDA 3PXRA 1B6CB 2X2KA 3EVAA 4DBNA 3VO3A 4QMLA 2Q0BA 4QTAA 5E91A 2UZNA 2R3PA 1X1BA 3KN6A 2BAQA 3SW4A 5CF4A 5D9HA 2P35A 4PYNA 3HA5A 2WTDA 4ARKA 4O0UA 2YCFA 3VBYA 4QQNA 1SNXA 1Z57A 3JY0A 4FV5A 1YDRE 2H96A 1DL5A 4KDRA 4FVPA 3FLWA 3BWBA 5IA4A 3BPRA 1OB3A 3O7LB 1LEWA 2VTIA 5GIPE 4CKIA 3OG7A 4BI1A 4RRVA 5CT7A 4YR8A 3U9CA 2YM7A 3PWYA 2BM8A 4FEUA 2XBAA 4X2KA 1H08A 3QXPA 4XRJA 2OZVA 2BH2A 2ESRA 2IZTA 3LAUA 2JHAA 4EK3A 5CVGA 4D0WA 3O7LD 1H26A 4DEGA 2B53A 3F82A 1NKVA 3HYHA 1Q62A 1UU7A 1BKYA 5CEOA 5IA0A 1YDTE 4AWIA 1L9KA 3SMQA 2PLWA 2GH1A 5FG8A 3IEIA 2QURA 3VUKA 4RVHA 1SVGA 5E1EA 3RPSA 4J8NA 5EW3A 4NYEA 2W1GA 5IPJA 2ZIEA 4MXOA 3QGYA 2E9PA 4X63A 2PWLA 1M2RA 4JBVA 2ZWVA 4AA4A 2QKWB 3VN9A 4YJTA 1PKGA 4F7LA 5I4NA 4BN1A 3HV4A 5E8YA 3RMFA 1HCLA 4O0WA 5J9YA 1XWSA 5K0EA 4GJ2A 2Y6MA 5JFXA 3PJ1A 4M0ZA 4L7FA 2HY0A 2BR4A 3EMBA 2UW9A 3L8VA 2P40A 4ANLA 4XHKB 3FLYA 3ITZA 4BCIA 2VTAA 2I0YA 2HR1A 5HEZA 2Z7LA 4P7JA 4HVSA 2HIWA 4FG9A 3DGKA 3FLNC 4WUAA 3JWIA 1H1RA 3A7GA 5CTPA 4CFVA 3VBQA 2HW7A 2PSQA 3R6TA 3PG3A 4GKIA 3G9LX 5EMJA 3HRCA 4PWNA 3KPUA 3WF7A 4W4WA 3P86A 4PMPA 2IW9A 4C3RA 2FGIA 5AAFA 4EORA 1DCTA 1V39A 5KMKA 2IDJA 3MH2A 4RIYA 5BXYA 3VS3A 3MY0A 3BGVA 5HLWA 3BKXA 3JYAA 3NUYA 4NFMA 5IMEA 4QYGA 4YSMA 3NWBA 1FINA 5EC8A 3GOPA 3DXXA 3NDJA 4D4YA 3W2RA 2UW5A 2OXDA 3MERA 4MWZA 4LI5A 3CJQA 4G5PA 1ZKDA 4RVMA 5E8JA 3FRIA 5T3QA 3QBNA 4O81A 3SSOA 4EOMA 4NM7A 3FKNA 3LX6A 4BGGA 3FI3A 2IW8A 5CI6A 3A25A 4F65A 3GRRA 3TEIA 3KXNA 4PCAA 5F2KA 1WBPA 5HX8A 3ZYAA 1NW1A 1M6YA 3MA3A 3LQ3A 3HL7A 4ASZA 2JDOA 1LR4A 3RHKA 5HE1A 2F9GA 3TACA 3ZTXA 4BVUA 1YOMA 2CWWA 4RJ6A 2O63A 2EWAA 4R7IA 4M0YA 3Q7EA 1PJKA 3S4QA 4A9TA 2WMUA 3RK9A 4QP4A 4K0YA 5CZHA 2IWIA 2BMCA 3DK3A 3CBGA 3O31A 1ERKA 5JH6A 3M1SA 3LMGA 3MWUA 5DSTA 4L7SA 4FSQA 5I9UA 3DLSA 3SW7A 4GSBA 3KXMA 3IGOA 3P2IA 3KQWA 4I24A 4TYGA 2OIBA 1AF7A 5M08A 4AUKA 4F7NA 5AA8A 1MHTA 4JRVA 2W9ZB 4YBKA 4X2GA 2ETMA 4F6UA 4O0XA 3DLCA 5CQWA 1IA8A 4MH7A 1REJA 2QOQA 2XYNA 2FPOA 2YXEA 2W4JA 5IH5A 2PMIA 5GHVA 1UU8A 4BICA 4BCKA 4X61A 3NMUF 3DMGA 2JIVA 4KVZA 2QLUA 1H8FA 3N4VA 4DTAA 5M06A 2ZTHA 3VRZA 5FP5A 3LCDA 5JR3A 2UV2A 3FTFA 3C4ZA 3LDGA 3QAME 3V04A 3CTJA 1VL5A 4GVJA 3F69A 4YLKA 3FI4A 5A9UA 4ACCA 4GBED 4QQCA 4ERKA 4XV1A 3V6RA 4F0IA 4C3FA 2VV9A 4XG4A 3UBTA 3KKZA 3S68A 4AW5A 4IW0A 4OTQA 3UQGA 2VAGA 4V0RA 4KIOA 2AOUB 4KRGA 4MCVA 5L2SA 2C3IB 5HIDA 1U54A 5FEDA 4EZ3A 1DS5A 1QCFA 4H36A 3FI2A 4I41A 4EQCA 4EKIA 1YB2A 3DBEA 4OUCA 4YV1A 1ZMWA 3H3CA 2R3FA 3TM4A 5IQDA 3R1NA 2YZAA 2VTMA 1NT2A 4QTUB 2F4JA 1TQPA 2PZ5A 2ZV9A 4AW0A 4Q2AA 3UJ6A 3HLLA 3TDWA 2ZZNA 2A4LA 1L8TA 4DCGA 2WKMA 1YZHA 2OGVA 5JGBA 4JJRA 2R0UA 3C6KA 3HTXA 2QOLA 1UWHA 4FTTA 4BHZA 2OI4X 2XA4A 2E9OA 2FRXA 3W16A 5K03A 2YM4A 5LARA 1Y57A 4MTLA 1RDQE 1P1CA 3KXHA 3QCSA 4TYJA 2B2CA 3I0OA 4IEBA 3VAPA 1JVPP 1WBSA 2BZHB 4H58A 2ITOA 2C6MA 3VF8A 4O7LA 4AOIA 5AX9A 5AV3A 3DFCB 2NNWB 4YHFA 2OKRA 3R9HA 4EBVA 4RC3A 5EI6A 5DEYA 4IKPA 4TWCA 2Z7SA 4QPNA 5LSAA 4YUYA 4I3ZA 3C7QA 5DM4A 2ZM4A 4W8EA 5EI8A 2HYYA 4RWKA 2BIKB 2GNLA 3CC6A 2FO0A 3Q2MA 5L3AA 1YXXA 3NR9A 4GVAA 3FPQA 3K2LA 5E8UA 4RGJA 4TY1A 2ZV2A 4UWYA 3G15A 3EMDA 1P4OA 5G1XA 4XG8A 3OC1A 4UXLA 5EYMA 1LP4A 3UBDA 4CVAA 4CZTA 3UIMA 2VNYA 2QR8A 2W1HA 3UA4A 4H1JA 1A48A 5EFQA 4EH3A 4C33A 4M8TA 1NW7A 3BHUA 2QR7A 2VTNA 3FC1X 5CY3A 3RAHA 5HE3A 4E8AA 4HGYA 3RK7A 1FP1D 2QRVB 3JWHA 3BWMA 4P5ZA 1GIHA 3DOGA 3LFFA 1TKIA 1WVYA 3PP0A 4FKIA 4KD1A 3MFTA 4U7PB 2XNNA 3COIA 3LPBA 2EB2A 2W05A 5HG9A 4B4LA 4H39A 4AAAA 3CQWA 4EOJA 4U41A 3UC3A 5BVDA 3N51A 4I5CA 4FI1A 4ONAA 5HVKA 5JSMA 3CCNA 3P7AA 5EKUA 3ETAA 5HVYA 3Q9XA 4U45A 3G88A 4YBJA 3IHTA 3E8DA 4RC2A 3KULB 5FQOA 2PUUA 3QL8A 1VR2A 4WBOA 3VWAA 4BCGA 1XH5A 3DK7A 4OTWA 4F7JA 2XM9A 4A9RA 4S33A 3EL7A 5AP4A 4DEAA 4LV8A 4EC9A 5LMBA 5TOZA 2RG5A 1PRYA 1ZYDA 3P7BA 4KNBA 3KC3A 2AN3A 1APME 2EB3A 1WG8A 3ORLA 3ANQA 3UWPA 2ERKA 3MSSA 2VTPA 2P41A 3RAKA 4F85A 2J5EA 3TN8A 1SM2A 4KIGA 3KRJA 2CGUA 2C6DA 2JKMA 4M13A 5HO7A 3QD4A 1G3NA 1KIAA 3DK6A 3AG9A 3QTSA 5GOZA 3TKIA 3PXYA 4RVFA 5EQEA 3DKOA 2YWPA 1TW3A 3EQFA 4GC9A 5C1IA 4O0YA 5K01A 3CE3A 4X60A 2YACA 3C4XA 1YZ3A 2VN9A 3D7TB 1DAWA 3DAJA 3U87A 4DTKA 5BUJA 3L9NA 2PMOX 4HNIA 2Z7RA 3LMIA 5JFVA 2PVYA 3KMWA 4EC8A 3TTIA 4J1RA 3LHJA 4FEVA 2CGWA 4H3QA 4YTHA 5EG5A 4FTRA 4FZAB 4FSWA 2XH5A 1VBFA 4E6CA 3FMJA 3R1QA 2AYPA 3F3UA 2PVLA 2FA2A 2V55A 3RWPA 5LWMA 2C6IA 4EKKA 1YKRA 3E8CA 5F95A 4PONA 1INLA 3R9NA 1VZOA 4DT9A 1YWRA 5AA9A 4FKQA 2ONLC 2QLQA 2AUHA 1R39A 3H0YA 2XF0A 5C1QB 4EHZA 5E2AA 4BYJA 3HVIA 2IO6A 4CTJA 2B9FA 2VO6A 3G2QA 3EQCA 1R0PA 3IG7A 3LGAA 4FTQA 2YHVA 5CIYA 4S30A 3COKA 3HVJA 2J0LA 2DS1A 3R71A 1KE6A 3QQJA 3UOHA 4BP1A 2VO0A 2GPHA 3FQEA 4F0GA 1XDZA 4JIAA 3SG9A 1U5RA 3Q4ZA 1XH4A 5TO8A 3O0GA 4G34A 2VWBA 2XVMA 2HZNA 3C4EA 1JBPE 2I9KA 5LJJA 1OGUA 2RG6A 4UOEA 2UYQA 3T7SA 2ZM1A 3Q96A 3MIAA 3FMHA 5F9EA 4C59A 1O6LA 4AACA 1DUSA 1MQBA 5F4NA 5FHRA 4JDJA 5GWXA 4CZUA 2ONLA 4GIIA 3CGGA 3ZM4A 3DKCA 4JLCA 3FXZA 5FULA 1RI4A 1YHSA 3PPJA 5KYGA 1W8CA 3R1SA 3MTEA 1G60A 5CVFA 3QC9A 4YV0A 1YXSA 1P2AA 3OZTA 2O8YA 4JRNA 4GUBA 4E30A 4BDCA 5B1SA 4HJOA 4MD7E 5LMAA 2ERCA 2YX1A 3BBTB 4Q9ZA 5LCJA 4MTAA 4O84A 1Q8TA 3CIKA 3KQPA 3NIZA 2G01A 3UZTA 4FTJA 4UXQA 2OXYA 4IFGA 4DFNA 3A7HA 4HGSA 3ODZX 4I4FA 1GAGA 3NSZA 2J0MB 2C3KA 4Z3VA 4PYIA 3KRRA 4RIWB 4IC7A 4AG8A 2XK3A 2FVDA 2RFDA 2OZAA 4GQBA 1NVSA 4M38A 1W82A 2YCRA 5A6NA 4LL0A 1EG2A 4FOCA 2UYHA 3QTZA 4WA9A 2BDFA 4IBMA 1Z5MA 5DWQA 2XJ2A 3QTRA 1JPAA 3GNLA 5DVRA 3NW5A 10MHA 4FNYA 2UZUE 4ACMA 3E7OA 3NDIA 3T9IA 3PE2A 4MIKA 2ZDTA 4PIPA 2YQZA 2F7ZE 3FV8A 2F2CB 4O96A 5DLYA 3QCQA 5KQRA 2ZZMA 3RODA 4AGCA 3EN9A 3D83A 2PTKA 1NW8A 4LYNA 2C5YA 5LQKA 2NO3A 5KX8A 3SGLA 2G72A 4V04A 4IWNA 3LXLA 5DTQA 3U55A 2AOTA 3MN3A 4IX4A 4F86A 4FEXA 4Y5QA 2ZLBA 3FL5A 3BBWA 3R8MA 3V51A 2WELA 2CNUA 2WU7A 5KMJA 4PWYA 2PGXA 1OL1A 1GZ8A 4JBQA 4FR4A 3ORPA 5HZMA 2WK1A 3UG1A 2YCQA 3ATTA 1NE2A 5EIWA 3DV3A 4U0IA 3I53A 3V8TA 3CCFA 4QMZA 4BCQA 4MYGA 4C02A 4LFIA 4PDSA 2BAKA 2G2FA 1Q3DA 2YIQA 4IX6A 2RGPA 5T64A 5BYLA 2HZ0A 3ZBFA 4JQEA 4YMHA 4AW2A 4RFYA 3IQ7A 2WEIA 4UZHA 3GU6A 3MV5A 3NUUA 1CKIA 5FTWA 3TKHA 5BMSA 3WZUA 3G89A 2PUPA 4FSTA 2XM8A 5E8RA 2CDZA 3GBZA 2F57A 2QKRA 2XIKA 3VBWA 4BDFA 2XYUA 2ZCJA 4P7FA 5J9LA 5LR6A 1ZGJA 4A9SA 3ERCA 5AV2A 4MQ1A 5L6WL 2R3NA 3IK3A 2ERZE 3ZXZA 3WZEA 4EOQA 3UJDA 2B9HA 3UOJA 4QDKA 3I6WA 2FYSA 4RVGA 2I0VA 1MRYA 5KBRA 1U2ZA 2BZKB 1MRUA 4I20A 3WOWA 1JSXA 4MWHA 2O2UA 3IECA 2ZMDA 3MVMA 2AOVA 4OTIA 4Q5EA 4HVIA 4IVBA 2X0GA 2WNTA 4H3BA 3SD0A 3SVZA 4M36A 2IPXA 4IWQA 2UW7A 2BZJA 3BYOA 5DTRA 4LG1A 4R6VA 3G5DA 3TTJA 3HCFA 3C4FA 2JEDA 3CSVA 4AT3A 5JUWA 2IVTA 1BI7A 3L8SA 1QAQA 4EUUA 3LCKA 3MY1A 4FT3A 4BC6A 4B6LA 1Y91A 3Q32A 1RJDA 4RX7A 4KSQA 3ATSA 4HRAA 3WF5A 3RPVA 3QZFA 1JNKA 2JBOA 5ICPA 4PP7A 2CGVA 1YOJA 5E8XA 2E5WA 2NP6A 4C2VA 4AE9A 2XZSA 2BRGA 3M11A 4DFZE 2IZRA 1NXKA 2XP2A 4GRBA 1UNLA 1ORHA 2C30A 3ZC6A 3ZLWA 3BLHA 4G3EA 3HV5A 2J6MA 5FQDC 1WBWA 3QV2A 3AC1A 2W1CA 5BVNA 3HEGA 1RI1A 1YDSE 4M3QA 4OBOA 4NKSA 4I1ZA 3O2MA 3ZO3A 4JX7A 2R3JA 3OCTA 4R5SA 3M2WA 1XDSA 1K2PA 4EK8A 1N2XA 3CBLA 3PVCA 4G3DA 4KABA 3SM3A 4U40A 4DEDA 1PXIA 3FPJA 4CRLA 5P8WA 5LOHA 3RPOA 5DPVA 1YXUA 3PLSA 1KOBA 2BR3A 3EYHA 4BI2A 4RTOA 1Q97A 3RK5A 3QKLA 3LLTA 3NNVA 5DM1A 2XKCA 4IC8A 3RPRA 4XBUA 1M7QA 3PY0A 4L3PA 4CXAA 5A4LA 5CUQA 4DFXE 2ZOQA 2O05A 4YLLA 3DPKA 4IADA 4I4EA 4B8LA 5DXAA 5ICFA 4XV3A 2XKFA 3Q2JA 3F7ZA 5E9WA 4QQTA 4E6QA 3QA8A 2V5QA 3FPMA 3R30A 5J1WA 1NW6A 4EH9A 2P7HA 3MIYA 4YP8A 1O9HA 3D94A 3TUDA 3SG8A 1CKJA 5LXMA 4E4NA 3GU5A 3OEZA 3A26A 2NRYA 4KAOA 4ZZOA 5E1MA 4DG2E 3ER9A 4ZTQA 1VPTA 1I9GA 3GCVA 1D2GA 2W9FB 3SGCA 3HA3A 3NGAA 4ZMEA 4V0GA 4ZAUA 5HCYA 3RP9A 1YVJA 3UJAA 2PVNA 4K6ZA 1YRPA 4BZDA 3OCSA 3GRYA 4PGGA 3W8QA 2PVCA 3EFWA 3LFBA 4L52A 4G56A 5K3YA 4DA5A 3ZFXA 4YJPA 2O0LA 4HVGA 2JAVA 2HNKA 3HRBA 4EUTA 4NM5A 4ZY6A 4I21A 5LQRA 1OPJA 5IA5A 2OBJA 4U44A 4ITHA 4KWPA 2C5NA 5B0XA 1AQJA 4I5MA 4IAYA 5E92A 1QANA 3DDQA 3PXFA 4KKHA 2JH9A 5KVAA 3NEWA 2VS1A 4ER6A 3FPEA 4IWOA 5CEKA 1PMNA 4PTCA 3QUPA 4ZTSA 5HHWA 1YI6A 2GDOA 1IXKA 4BZOA 4FNZA 4G31A 1PF8A 4C05A 3KPJA 1X1DA 5IQCA 1PYXA 3VS4A 5B2LA 4E73A 3EQIA 1Q61A 3MVLA 3EIDA 3UNJA 4IMYA 1Q8YA 3KQTA 3M42A 5IQIA 3I1AA 4CFXA 2VZ9A 1EH4A 4WXHA 3V8SA 3LXPA 4FV1A 3WARA 4BR3A 5KHXA 3F4KA 4MBIA 3FMLA
chains in the Genus database with same CATH superfamily
4X3PA 3G9NA 2P6PA 3LJ1A 4EJ2A 4PFKA 1QQ6A 1T1IA 1OBCA 4DIMA 4CFUA 2XJ1A 5TVGA 5E2BA 5HRCA 4L8FA 2H9VA 2CDAA 1EGVB 1EZ4A 2FMUA 4LKOA 1HT3A 4CV8A 4NM0A 2YTZA 3FWZA 3LC1O 1XZPA 3QK7A 2Y4PA 2YUTA 2EJUA 2G1KA 1STOA 4CUKA 4WOCA 1UPBA 4BC1A 1IN6A 2PS9A 2UUCB 5GJGA 4MR7A 4PIVA 3C6BA 3UQCA 1FNDA 2UKDA 2F55A 4GP9A 4E26A 1ZM2A 2C7QA 1ZRZA 2H9IA 3LYUA 1DTEA 2FPIB 1WEHA 2R3GA 4D8XA 4RHTA 3DBHA 1KFKB 4AURA 4RVUA 4PBRA 3PUVA 3G2PA 1EE9A 1MUUA 4CODB 1JU3A 4EY6A 2QVZX 4PRJA 1XXLA 3FYUC 3THOA 4V38A 1M67A 5E6RB 3MWLA 5GADl 4C0TA 2B8JA 3VKHA 4HDRA 1XVLA 3T1YB 3FSRA 4HH1A 3FZRA 5JFGA 1V35A 1L3RE 1UNGA 3PRHA 1TXGA 4HYIA 3ROXA 3Q9YA 2GD0A 1UF9A 5BT9A 4WL0A 1RW4A 4MD9E 2J5FA 4YJHB 4QP3A 2ACXA 4DKJA 5AJXA 1QO7A 2XUQA 2QW8A 4WAUA 2JZNA 3CLSD 4RIIA 3KUKA 1POXA 3KT3A 4ZVPA 2BKLA 3I58A 5AP6A 4H60A 4OJQA 3GLRA 3FIUA 2JB9A 6ABPA 3F1LA 2BZGA 2VSFA 2NTNA 4EBWA 1NSTA 2FP3A 3V34A 1USUA 2XJ4A 3NBKA 4ZI7A 3F3WA 3NBZC 2XNJA 4TL9A 3SAYA 3FZQA 1GRCA 3F7NA 1MGPA 4OQ4A 5D11A 1ACMA 3U2QA 4U02A 5LQNA 3IAAA 3ALOA 2GAJA 1JR3E 2AMFA 5M55A 3OE4A 1SU8A 2OO5A 3DBVO 2REQA 3F74A 4OKIA 1XCMA 4F4HA 2ZR0A 1ZITA 1K6MA 1PKDA 3JZFA 4ZSEA 2BTRA 1A71A 3MQ2A 3RABA 2JBPA 1BDMA 1P61B 3BBLA 2VTHA 1O4VA 2WSSD 3IYLW 1OTXA 3KAJA 3JZAA 3ILVA 2H2WA 1GZNA 2G15A 1ECJA 4UHDA 4L78A 1JBEA 5AAGA 2H0QA 4QMXA 4PPNA 3Q7PA 3BV3A 3TZKA 1WDWB 2J33A 3B6ZA 1J2EA 5JQWA 1JR2A 3AVWA 4I3GA 4B6FA 4O3FA 2OU7A 3GCXA 1YJCA 2SKEA 3W79A 3TNPC 3N0VA 1PJBA 2VK8A 2QRVA 2WKSA 4IAZA 2KULA 5EH0A 4EYOA 3SU8A 1T2NA 5C8YA 1V7PC 3TSOA 9LDTA 1KH2A 2ZRNA 1E64A 3BMQA 5M56A 2HI0A 4X6YA 4E2ZA 4P8RA 2VAXA 5IJ0A 1C0LA 1CMKE 5K0GA 2BMAA 4V01A 4LJ4A 4O2AA 2V58A 1I3CA 3URMA 4WEQA 3ZOSA 2X3UA 1FEZA 1HTTA 4DEEA 4V0QA 3MJFA 2WNHA 4QLOA 4CKEB 1M2VB 4YRSA 1JSUA 1EAMA 1M0EA 4WW0A 3PFBA 3Q0TA 5DW3A 4ABTA 4MJ3A 2H4HA 4F9EA 1D3AA 1GL6A 1PXJA 3NFYA 5M04A 3MCAA 2Q5FA 3DVRX 3WLKX 3K70B 2VUIB 3PHIA 1PYGA 4MGYR 3EQ9A 2BC9A 4FPXA 2FRVA 1PG2A 4OAQA 2UZEA 3CEMA 4N9WA 1G5SA 4AQ7A 4BRSA 2VF7A 3M8KA 2Z5GA 4M37A 2ES4A 2RJ3A 5JG7A 1ZAKA 1ZY2A 3DWGA 3U4IA 3ZDEA 4B7AA 3QKMA 1Y1PA 3K70D 2OT3B 5CURA 3ZH8A 1DFHA 1M2QA 3EXIA 2W99B 2CHVA 1ABEA 2BEVB 4UEUA 1QG0A 2EKPA 2P3OA 4KUEA 1T2DA 1RLIA 1UZLA 1JECA 2IYLD 2ZRHA 1DCKA 4Q7LA 4XV2A 2GCDA 5AM3A 3ZGYA 3E88A 1N5LA 2ITPA 4NENA 1G18A 3T0GA 3QQHA 3UYKA 2W4IA 4D02A 3HCPA 4XPIB 3P2EA 1YZYA 4Z8YA 4OKSA 5B37A 1KMHA 3OE7A 5KKNB 4G3XA 2XXAB 2EYUA 3DP7A 1JS1X 4A1OA 4RY9A 3I1FA 1Q7CA 5B64A 5A71A 3W5JA 4R1UA 1XU7A 3WGGA 3SP1A 5JS7A 1AA6A 3PVBA 4B3MB 5DBEX 4I5DA 4JOBA 3UJBA 4ZIRA 1JQ5A 3NHAA 4U7TB 4LGGA 3RT7A 2KBFA 3OLYA 2F7SA 3PUYA 4HEJA 4V03A 2DVMA 3UP2A 3BX5A 2XLBA 4NK4A 1SKAA 1D09A 4MS4A 1Z7BA 1T9GR 4ZU6X 3QQLA 2XYQA 4CKYA 4G0UA 4TNDA 4Z9FA 2X7HA 2Z4TA 2VXBA 4X3OA 2C84A 4BNZA 1T9GS 1RE1A 1HDGO 4DY6A 3FR7A 5I5EA 2LCIA 4JBLA 3G8AA 2R48A 3NYNA 4ZTBA 2IPOA 1YZKA 1U5AA 1GNGA 2QS9A 4OAPA 3DNEA 3PSBA 1ZIYA 2H2HA 5BO5A 2X6DA 3CNQS 4LRWA 2XAAA 4JGIA 4KR2A 4F1JA 4S1TA 2YXDA 1ICIA 4NONA 3LQKA 4DQDA 3DZIA 3FB1A 1BCRA 2J4CA 4ABYA 4QMTA 2EWMA 5JRQA 4HJRA 4AZSA 4GU6A 3KPVA 4QWMA 3LRPA 2O2EA 3ZM9A 4AS2A 2LWIA 4E22A 2UYYA 4MTCA 1EVZA 2EG5A 1XQXA 3D3WA 5FWYB 4AGDA 3LKZA 4CLRA 3MM4A 2HREA 4IIVA 1U8EA 5AVKA 3V8QA 3EG5A 1EM8B 2OP0A 5C26A 5JFWA 3FCCA 3BCUA 1TUEA 2XNGA 1PW5A 1J2YA 4J91A 3ETDA 3RS9A 1RZVA 3GEIA 4UE2A 3ZWMA 1Z0KA 4FLFA 3F2NA 3ZQUA 3WBKA 3GD5A 3TNDA 3L1KA 4DFUA 2G28A 5HF9A 2C5LA 1CY4A 3L02A 2VDMB 3CRQA 1U65A 1S01A 2PMWB 1X1RA 4Q4JB 2J6BA 2PRKA 3LOPA 2JLWA 3A2MA 1FUUA 3V2UA 2O54A 5IU2A 2GK4A 3E53A 3T4XA 1W2WB 3NYOA 4QEZA 3O4HA 2H1IA 1GG9A 1UBJS 2CNLA 1P5ZB 3AB7A 4KITB 4UDYX 5CLLA 2W90A 2VP4A 4O6EA 3PE6A 3WIGA 3QUBA 1G4AE 2GSWA 1K2WA 2D13A 4YHHB 2P11A 2PL3A 3NIDB 3UPUA 4D42A 3N9XA 1T26A 3EZ2A 1U9IC 4DDHA 1C4XA 3DQXA 1YXTA 4C4PA 2XT6A 4E14A 5CEPA 3OROA 3U26A 2XUJA 4R5YA 4DLPA 5F64A 3NANA 1GD1O 3VKWA 3DKVA 1KR2A 3A61A 2Q83A 1QZ3A 5L6MB 3IE1A 4B3BA 3HLYA 1QKIA 1PVOA 4M9ZA 4XE5A 4YGYA 4IUYA 1ES9A 3QD2B 2H57A 5TMEA 4LRQA 3R28A 4B44A 1BW9A 2UZTA 3ET5A 2LNDA 5REQA 4Q4HA 3CVWA 1K86A 4TV9B 5K0CA 4BGQA 4Q9IA 3KK0A 4JGGA 4LDRA 1E8DA 3QCYA 5D10A 5SV2A 1Z68A 3OWHA 4GO1A 1CM8A 2M6RA 1DMSA 2F3QA 4JP5A 2B8TA 2NYUA 3G59A 1KPGA 4GW8A 4X2FA 4L1KA 4F6LA 3CT6A 3DNMA 7REQA 5F3DA 1NTRA 2YV3A 3CXUA 2XVZA 3QLJA 3Q53A 4HTFB 3OF2A 4FX5A 1KMIY 3NAXA 3G0EA 3EXEA 1GKLA 5D6OA 1XHLA 3G0BA 1I33A 3HACA 3U3ZA 4OX9B 2XZLA 1A5BB 4RC4A 2C78A 4YU2A 4J71A 4G4SO 5DYTA 4AZ3A 1SIOA 2C9BA 4GD3Q 2B8NA 1ZX1A 5ALFA 5HE2A 1W4ZA 2HYIC 1KEWA 3DZQA 2M6LA 4D9KA 1ZM9A 1VM6A 3LVFO 4J1QA 5HKAA 2XBUA 3R2YA 1R3UA 1LDYA 2XKJE 4Y83A 4JDUA 2BAJA 2M6SA 3KU1A 3ZDXB 1R0BA 4IE9A 2OG2A 1DWOA 4NZNA 5JJBA 3NIEA 2D1TA 1Y4SA 2J4ZA 5A9RA 3BHVA 3ADOA 3I61A 1XX6A 4AZVA 1D9XA 1JFFA 4AZWA 1Z6GA 3HZZA 1PTJC 1NFFA 1PKXA 5KC9A 3F9IA 1PT9A 3FFXA 3L1JA 4RTQA 4NKAA 4QMNA 1RCTE 3FEGA 1T2EA 3HJFA 3GJ6A 3MJEA 3FDZB 4YX9A 2BJWA 4CNQA 2AJLI 2JLVA 5HJEA 4PNZA 4GVXA 4C2BA 2O64A 2NP7A 4RK4A 2ZW9A 2HLDD 2VHXA 2VX0A 3WZKA 4FGRA 4FT9A 2FETA 4MRNA 1UC8A 4UNSA 4Z0PA 3LLUA 3KXGA 1YE5A 2W43A 3KOMA 1GPMA 5F2OA 2GNIA 5BVGB 4MOWA 2QRKA 4NBSA 4DDGA 2PZYA 3AUFA 1YR6A 1A06A 4IIRA 3RG2A 3SIPA 4IDVA 5CNNA 4MMZB 5FFMA 5J5CA 2XTZA 4J29A 2OHHA 3TBKA 4EA8A 3RBVA 3KKPA 3B1WA 3OI7A 3SYKA 2OBFA 5EWJA 4B84A 2YVQA 2OO3A 3OQ1A 5DLEA 1R78A 1RPJA 1I3MA 4IM2A 1E7YA 1BDHA 1PJRA 1DC3A 3QMPA 4CCWA 4RA5A 1P80A 3MJSA 4FTAA 3E5MA 1Y8AA 5L8JA 2XWSA 1WBVA 3A27A 4KN6A 4UAGA 3RYTC 3RTEA 3KL4A 4CKWA 3UMWA 2VNSA 4JQ7A 3WYBA 3OLWA 5KCZA 2EKZA 1G9SA 2HMTA 3KCFA 3GC7A 3R04A 1I4DD 3U3OA 1NLMA 1R50A 4BV8A 3IESA 2RGNA 4XXHA 4O2PA 5K8JB 5JAZA 3C3CA 3UHFA 5DR6A 3DOIA 1RLMA 4CLJA 2OLKA 4JXJA 4GMFA 4ASXA 3CE6A 4PV0A 5ADWA 4AX8A 3WSWA 5DXFA 3JQFA 1CJBA 5ADVA 4M3NA 4LOAA 2H9AA 3ZBUA 1VE7A 1BRMA 5CVEA 1X87A 2R3QA 4NX2A 3DLHA 1XYYA 2EOAA 3IP1A 3K4HA 3FZGA 2GHGA 3TUBA 3NUSA 3GNTA 1ATPE 1DP4A 2XSZA 2HYDA 3EOCA 4DV0B 3UODA 3NXKA 1VPEA 5NULA 1YOBA 4R2IA 2C04A 1PNRA 4ZU1X 3WGZA 1RYYA 3QEKA 1KGSA 3GEHA 4HYUA 3WF8A 3AGQA 3BRBA 4L57A 2XKEA 2NVWA 2XE8A 3L7NA 1LJUA 3G5UA 5FTOA 3HFSA 3AHFA 4BZNA 5C4GB 3KV1A 4XUDA 4G09A 1V4VA 5L53A 1DJLA 3JZDA 5ECGC 4DCJA 3TNLA 1T8SA 4RZVA 2G2HA 1MAWA 1KRWA 3WVNA 4AKHA 3MPMA 2G76A 5COQA 2QTVB 4E3ZA 1LJ8A 4EG8A 1Q7EA 4MJ7A 2B1PA 5I7WA 2DPMA 1QRAA 1CNFA 1MX1A 4Y1RA 3DFMA 3DEKA 1I44A 2R11A 3K9GA 2H2IA 1EE2A 2ITTA 3K0BA 4TTIA 3RVJA 1T4CB 2F1IA 5AFSA 3SJZA 4FWTA 4MV7A 2XK6A 2X15A 4M9QA 3FNRA 4LWQA 8AT1A 1E1RA 2H8GA 2BROA 3GLIE 1YFJA 3KT6A 3ACCA 5LC1A 1V11A 4S0ZA 4G4JA 4D9IA 2UW3A 2WMRA 4I1SA 2AHRA 2WZBA 3QA9A 1KJNA 1QIMA 1WP4A 5HQTA 4IJKA 4EOLA 1R0CA 4R81A 4F5YA 1S2LA 2VYVA 3HJAA 1OLXA 3KU2A 3T9TA 1OITA 1PFVA 2X0EA 1EFCA 4F2DA 4D2IA 5I6DA 4BYIA 1U8UA 3N2NA 4DLSA 1K27A 1KY2A 3GEMA 1XWWA 1L7AA 1KJ8A 4RCYA 2YJ4A 2AHOA 4Y98A 4PNHA 1X2EA 3OX2A 3KY2A 4DH1A 2ZIXB 2JARA 2YYAA 2GRJA 3A2CA 2GN6A 2OZEA 3ZHVA 3CZAA 2WMBA 3W3AD 1F4LA 2EBFX 5K3BA 4ZOGA 3D7RA 2JC6A 4OFZA 1DKOA 4OHUA 3T54A 2JLZA 5GGYA 2DUMA 2J50A 1UKBA 2PU8A 4ZAXA 4IH1A 3OXIA 1LPAB 5DH3A 5JMPA 5ETJA 2QHMA 3V7YA 1SFRA 4ENQA 5EZYF 1HV8A 3GT0A 1E1VA 3BXOA 4FUXA 4JL9A 2EGHA 2ERXA 1GG2A 4F72A 4IRMA 1TM3E 4ADSG 4GL2A 4JQ8A 5EP2A 4TL6A 4BNHA 2GASA 1QMZA 2WYUA 1RE8A 1GCUA 3Q6NA 2NXJA 1YHVA 4EOKA 1HY3A 1AXGA 2Q1UA 1ZK4A 4ND1A 1QX3A 2IXGA 5IN4A