1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrillarin-like pre-rRNA processing protein
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
4K11A 5CANA 4ZS0A 2J9MA 2RGPA 1PXJA 1BKYA 4BCNA 2YACA 3OROA 5DFPA 3DAEA 5C9ZA 3R9DA 5HZNA 4IX3A 2ETKA 3JWJA 3W8QA 3QZFA 1DL5A 1ZQ9A 3SSOA 4FEXA 2WAJA 3DXYA 1O9HA 3HNRA 4FT5A 1WCCA 3H0ZA 5AP0A 3S2PA 4ZOGA 3DTCA 1RJBA 3EVEA 4GG7A 4F70A 2UV2A 1X1DA 4Z9LA 3HP5A 1SZMA 4NM5A 3M11A 4QOXA 4YMGA 5HU9A 4ALWA 2WOUA 3DBCA 3UJCA 4MQ1A 3LKZA 3OCGA 4GYIA 5CVHA 3GRRA 4F4PA 3A7GA 2PSSA 1SKMA 2FSTX 5HVKA 4FKWA 3R9XB 3JWHA 3S3IA 4GVAA 4M67A 3MH0A 3ZLXA 3U87A 4H3PA 4QMOA 4CT1A 3T9IA 4XP0A 3ELWA 3GU5A 4TPTA 2DYLA 3C5IA 3RPOA 4L43A 2IH2A 2WTVA 4I6FA 5CU3A 5IKMA 2ZZKA 3WF9A 3NYOA 3ALOA 3CQWA 2VX0A 2XRWA 3V6SA 3TTJA 4JIAA 4X6QC 1W98A 2UUEA 2C5XA 4XNEA 4FX3A 3NYNA 3PJ2A 4FSQA 1YI3A 3EQCA 4JI9A 5BYYA 3MJ2A 4E2WA 1J91A 2BR1A 2JC6A 4O22A 5CZIA 4OGRA 1DAWA 3LMGA 3O8PA 2WMBA 3OWKA 3UZTA 4UZHA 5HESA 4GKIA 1GZNA 4G6LA 3KR9A 2IDJA 3C4CA 1J1CA 3MVJA 4PGHA 3RNIA 4U45A 3P97A 3LFAA 3QTWA 4YUQA 3H3CA 5CI7A 3HCDA 3W8LA 1PKGA 3DJ6A 4FGRA 3E3PA 3A7EA 4U5JA 4X1OA 1Q62A 2WMVA 5CSWA 4A07A 1Y8CA 3AC8A 2PZRA 4Y73A 2J4ZA 3MVHA 3QKLA 4LFIA 1WBOA 1UKIA 4PCLA 4N70A 3SX0A 2P3GX 2W9ZB 3OCJA 3V04A 2YXDA 2O65A 3DAJA 5C0OE 3P7AA 1XH4A 1P1BA 3NYVA 3JS2A 3D83A 4YZMA 2W5HA 2BFYA 2GU8A 4IWDA 2JITA 4PQNA 4X6RA 3BGVA 5E4HA 3FY2A 1J7UA 4GL9A 4BDBA 3UQGA 2VGPA 2VWYA 5KO1A 4FKPA 1ZRZA 4BC6A 4W4YA 4X2FA 2G2IA 3LCOA 1B38A 4CLJA 4FTKA 2ITPA 4YTCA 2AS0A 5CVJA 4BBEA 3UC3A 5HU3A 5CUQA 2HV9A 1URCA 3C0IA 1VIDA 1YI6A 2R3PA 4QTCA 2YCSA 1DI9A 4RTSA 3HA8A 3GU4A 4AQCA 4O7LA 4A6EA 5DRBA 4FOCA 3RK7A 3BGQA 4IADA 2FB8A 5GIPE 3HA3A 4NUSA 3MYGA 3VS5A 1FQ1B 3KF4A 3HP7A 4YHJA 4RJ3A 4G9RA 4WD5A 1H8FA 3A2CA 3E05A 3EB0A 2UYHA 3L8DA 5CT7A 5EIWA 3ZEWA 1KV1A 3B8RA 3FPGA 5DSXA 4BTKA 4U7ZA 3CJFA 4I4FA 5CVEA 1UKHA 4YP8A 4P4CA 3R00A 3ZXTA 3RCJA 4R5YA 4D0XA 5A4EA 1VQ1A 5IMXA 4XBRA 1R8YA 3R7IA 4GV1A 4EUUA 3PXQA 1JTFA 4G2FA 3PB3A 3GU3A 3I5NA 3OT3A 3R01A 3TM4A 5CIYA 2ZDUA 4ANBA 4R8SA 3UMXA 1K9AA 2A14A 2ZM3A 4G31A 5DR2A 4K6ZA 2F9GA 2X6EA 2Y4PA 4RQVA 5DH3A 4MNEB 2XBAA 5EZSA 4KS7A 3VSEA 4MWZA 2GSFA 3WF5A 3FBVA 5M08A 5HIBA 4RIYA 3BZBA 4H3BA 3G0FA 4PNKA 5KMNA 4NM7A 2FK7A 2V7OA 1XR1A 1Q3WA 2IFTA 3ZSHA 4AE9A 2VWZA 5IPJA 5DEYA 5EIFA 3NIZA 2HWOA 3QBNA 3X0DA 4RPVA 4KUJA 4I93A 5E91A 4MXZA 4BCHA 4ANLA 1MQ4A 3EMDA 3DUWA 1A9UA 2GQRA 2VTSA 4UEUA 5JZJA 3BBWA 4FSTA 5K0CA 4IAIA 4LGGA 4UYNA 4WRSA 2OFUA 2PLWA 2QONA 1H24A 4RIOA 1OECA 3QA0A 2BZKB 4HGLA 5EHGA 3UJDA 3HMIA 1X1CA 4O0UA 3GU6A 2W99B 4DTKA 4GC9A 4EHZA 3VBTA 5D12A 3GO4A 4XHKB 4GH2A 3Q5IA 2RG5A 2FPOA 4LWOA 4MH7A 2V5QA 4EH8A 4MBIA 2O0LA 5GIOE 3ZRMA 4XG2A 5ANIA 9MHTA 3EN9A 4UZDA 4BDAA 4YV1A 2QYOA 4KINA 3FDNA 3TJDA 1L9KA 2FCAA 3F5XA 2W1FA 5IU2A 3BYUA 5L8JA 3EFKA 4HGTA 3SRVB 1H1SA 1RW8A 4XS2A 1Q4LA 3OP5A 2HZIA 4QYYA 4I22A 5DI1A 3DBEA 2JH9A 4K77A 4S31A 5DT0A 3JVSA 3UOHA 5AP6A 4MTAA 5DWRA 2YIRA 3TRKA 3M1SA 4J99A 5BXYA 2WZJA 3O51A 4G56A 2VWXA 4BVUA 1CM8A 3GCSA 3ZZEA 4IZYA 3CKKA 4YJQA 3HMOA 2DPMA 1DM2A 3A99A 4FT7A 3EQRA 4YO4A 4KA3A 4FTUA 4IJPA 2P0CA 5T6BA 4J53A 5E8UA 5F2OA 5IEXA 2C0TA 3S00A 3LM5A 3LBYA 4DEDA 3ENMA 3B3GA 4RJ5A 5LCKA 3OWPA 3P71T 5B2KA 1YWRA 1OKWA 5L2TA 4FIHA 4MCVA 3SXRA 4OBQA 3CY2A 3O7LD 4QP8A 3DK7A 4YBKA 2Y9QA 1FPQA 4RIWA 4BYIA 3P9CA 2JDVA 4DFUA 3NNUA 4E31A 4DEGA 3D2IA 2ITQA 1FGKA 4DCMA 3TV4A 3QCXA 3DK3A 2OICA 1SVUA 4DFBA 2PVJA 3FSFA 4KW7A 4ANMA 4NECA 3ZO1A 2PVNA 2C5OA 2I7CA 2IW8A 3LX6A 4CZUA 4RTMA 5CEKA 3KRWA 1PY5A 3LKDA 3G5DA 3OY3A 4MNFA 5EQPA 3PFGA 2ZV7A 3KMMA 4PINA 3VBWA 1JKKA 1PXLA 4IDTA 2C7RA 3CP9A 5CU6A 5FQOA 2B3TA 1JSVA 1I44A 4D28A 5C03A 2UZWE 5ETIA 1KE9A 3JY0A 1M2QA 1Q8ZA 1JKLA 3RK9A 1OVEA 2PVRA 2JDOA 3U6IA 4QMTA 3V8SA 3H9OA 4QTEA 2ONLA 5AV0A 1Z3CA 3OC1A 5AUUA 2ITTA 3LPBA 5JQ8A 4H1MA 3UOLA 5E9QA 2K4MA 2J7TA 2WTIA 4DG0E 3GNIB 3R8VA 4NH1A 4XUCA 1HCKA 5LJJA 5FHQA 2GPHA 2UZEA 3G2OA 3OBJA 4B17A 3V8WA 3PWYA 4FTNA 3CVOA 1IASA 1S9IA 5FQDC 4JX3A 4FT2A 4GQBA 2PWYA 2DULA 4JDJA 5J87A 2B9HA 4GCJA 4EZ7A 3FXWA 2PX2A 2P55A 4MXYA 3PP0A 4LRJA 5FP6A 1N7IA 2IZSA 3GXLA 3FMKA 1OBGA 2ZV2A 1FBNA 5DSTA 1IEPA 3HVCA 3QD2B 4OW8A 4GC5A 1PMNA 4U81A 2VP3A 3HEGA 3O7WA 2G9XA 1XBBA 3F82A 3DMHA 2OGVA 4QQ5A 4J52A 3TQSA 3WARA 3UJBA 2JLDA 2WQBA 3E8DA 4S2ZA 2PX4A 4IANA 4RV9A 5D11A 3ELDA 3ZFMA 2XNMA 5HVYA 1J7LA 3ORLA 3ELUA 2QHMA 5CSXA 4C59A 1FOTA 3TL8A 3TI1A 2ITXA 3M6WA 2HY81 2UZBA 5K01A 1SNXA 4FSMA 4FEWA 4I23A 3D4QA 3QC4A 3MGYA 1RI2A 4MWIA 2VTHA 3N4UA 3OCTA 3PA5A 4YTIA 3MIYA 3FI2A 3LKMA 3D7TA 4FKUA 4FVPA 2Y4IB 4NW5A 2UVZA 2AR0A 3UJGA 3CTHA 1RQQA 1BUHA 3DB8A 3EVAA 2FUMA 3PVWA 3QXPA 4POOA 3C0GA 3S4QA 2PMOX 3JYAA 4GFMA 5C4KA 1R39A 4DFLA 3A60A 4WO5A 5DOSA 3KQTA 4QP1A 3KULB 4BGHA 3PE1A 1X8BA 1SNUA 5JEBA 2EJUA 4BZDA 1NT2A 4E30A 3G0EA 4GUAA 1H28A 3KXXA 4BDEA 2NP8A 3U4WA 3BQCA 3MGGA 4JG8A 4UBAA 4AT5A 1H0WA 4RTJA 3WOWA 3FY0A 3U51A 3IW6A 3A8WA 1NVSA 1PXOA 4RVHA 3UZRA 1J7IA 4FT9A 4AS0A 2P3QA 3GEQA 4FTQA 2X4ZA 5IDNA 2ONZA 3TLJA 3HDMA 4X61A 4IX5A 4AZFA 4QQCA 4FSWA 3EQBA 3U9CA 2P3LA 3GCPA 3ATTA 1E1VA 3P86A 3E8SA 4FMQA 4QMLA 1MHTA 3PDTA 5ETCA 5FWAA 4I5MA 2GH1A 4Q9ZA 1DAYA 4XOYA 1FPUA 5HO7A 2WMWA 3QZHA 3KK8A 4Y46A 1YHVA 5ANJA 1OIQA 2ITNA 4X21A 3R3HA 2WMQA 4P5ZA 3QTSA 2C7OA 1JAMA 3JXWA 1XDSA 2YAAA 2X4FA 4OA5A 4GOLD 2OIDA 5BMSA 4EJ7A 4HTFB 1RJEA 3R1SA 4YJUA 1O6YA 4I94A 4QMMA 2JIUA 1YWNA 1O6LA 3DMFA 5ICPA 5IH3A 5EW8A 2W9FB 3G2MA 4MVFA 5M09A 4W4WA 2G72A 4O96A 5AV1A 4PDYA 3Q2MA 4R3RA 1YFJA 2IP2A 4UXLA 3PFQA 2CDZA 5DWQA 3A7FA 4YUWA 5DT4A 3ULZA 3RM7A 2R3GA 5AP7A 5FCDA 4IEBA 3A4TA 3EN5A 1I9GA 4IVDA 4WUNA 2VWUA 4FZFB 4QP2A 5KHWA 4QQNA 5EMKA 4XH6A 5I0BA 1ZYJA 3KREA 3QKKA 4E2XA 2V7EA 5JSMA 5K09A 3LQ8A 2FYSA 5KMIA 5FA8A 2PU8A 1D2HA 1WBWA 4EZ5A 5EHYA 3DKFA 3F3VA 2PXXA 3EQHA 1X1AA 3CTJA 3HEMA 3ORTA 1XCJA 4ZSGA 2HY0A 3KCFA 3PPZA 5IA3A 3EFJA 4XV2A 2WGJA 1UNLA 2YCRA 5A46A 4MHTA 3G8AA 4JVGA 5A3XA 3FQSA 3O50A 2VTRA 5LVPA 4BI0A 2QO2A 3LJ1A 4ITIA 3F5GA 2J5FA 4BBMA 2O63A 3P08A 4IB5A 2QURA 5CF5A 2B2CA 2OF2A 3VUMA 3OWJA 4JBPA 3BHHA 2YJRA 4IE9A 5L6PA 5LARA 3OHTA 1ZOEA 2ZDTA 4EH6A 2W1DA 4WT6A 2IG7A 3Q9YA 4Y2HA 2XYUA 4CTCA 5KBQA 1CDKA 2X81A 1XDZA 3KQQA 3IQ7A 5DX1A 5EQJB 1OIRA 1ZG3A 2ZTHA 4WIHA 4RZWA 3BBTB 4D4SA 3DA6A 2PMIA 2RFNA 3SGCA 3ER9A 5CVDA 3O17A 3QCSA 3V51A 1FMKA 1Y91A 3MFUA 3UGCA 3SW4A 2I6LA 4LG4A 3E88A 3LSTA 5BVEA 5FXRA 4L46A 3RIEA 5FEEA 2XCKA 3SOAA 1VP3A 3DBFA 4ASZA 3NUUA 3HV3A 4H1JA 2YQZA 2JKQA 3UIUA 3R2YA 4NL0A 3EYGA 3CJRA 3W33A 5E1BA 5EQEA 5CAVA 1NBIA 5CF8A 5E92A 3DDQA 5KMKA 4X2NA 4YZNA 1OL5A 2RIOA 3PSDA 2EUFB 2ESMA 4E4MA 4KWPA 2YABA 2QQ7A 4EK8A 4AW5A 2LAVA 2IO6A 3DOUA 2XYNA 2ERKA 4FKLA 5H8EA 5JGBA 4HNIA 3K5VA 4GT5A 4FZDB 3NUPA 1AF7A 3SMQA 4RJ4A 5AIRA 3KY2A 1NA7A 3E93A 3MA3A 4YPSA 2Z6UA 3WZKA 4E8AA 4RSRA 2YIWA 1B39A 2OF4A 2GNIA 3SHEA 4IACA 5E1DA 5H3QA 4E93A 3LFNA 3AMYA 3QQGA 2FHPA 2C3LA 4R6XA 2W4JA 3H0YA 3QQFA 1WBNA 3HCCA 3FZSA 5CF6A 5EW9A 3UVPA 4FK3A 3F3TA 1XHAA 3T3VA 2OIBA 3Q4TA 4JT3A 2ZIEA 4PIMA 4KD1A 3TV6A 1PYXA 4D4YA 5IH4A 4FYOA 4DQ0A 1OBDA 3RAHA 4C02A 3PIYA 3LOKA 3ZOSA 4F0GA 3MN3A 4AU8A 3FLWA 2BZGA 3SXSA 3MV5A 1BKXA 4FBXA 4O7NA 3MCZA 4WBBB 4RFZA 5DYJA 3BRBA 3P9KA 5HNIX 2XNBA 2O0UA 2AOUA 4YV0A 3BGZA 3HMPA 3RGFA 4FK6A 2BAQA 3KHKA 1NW7A 2CN8A 4RIXB 3V3VA 4YTHA 3COMA 3Q9XA 4B7TA 4NCTA 3UJ9A 3A7DA 4CTKA 3CD3A 2VO6A 2CN5A 5JFWA 2WIPA 2UVYA 1YZ3A 1PMEA 3TOSA 5T64A 3HKOA 4QYGA 2HMYB 4ANQA 4F6WA 4E1ZA 4P7JA 1VLMA 3TACA 3ZDIA 3ET7A 4YJOA 3TDWA 2XVAA 5DLSA 5J8IA 2VTNA 4RVFA 4U44A 2VX1A 4HSGA 3FLNC 2GNJA 4XV3A 3D2LA 3QC9A 3V5QA 3B3JA 2RF9A 2HOGA 1FGIA 2QOOA 2YZLA 4W8DA 2B54A 2J51A 3KRXA 3DOGA 5CS6A 3FE3A 3NCZA 5E90A 4WXHA 1VYZA 3K5UA 3FLYA 4ZY5A 2ZCJA 2C5NA 2WXVA 3ZS5A 2FSMX 2BIKB 2SRCA 5EDRA 4TZRA 4RJ6A 2PX8A 2XNOA 4KB8A 4XMOA 2OXTA 3GIWA 4QNYA 5FEQA 2QOFA 1EQAA 4FC0A 3P5KA 3FI8A 2BH2A 3E3BX 4RWJA 4RVGA 5E8SA 4TWCA 2YERA 1OMWA 5LMKC 4BGQA 5DRTA 3SV0A 2W05A 1ZZ2A 4XRLA 3UJ8A 4L8MA 3R1NA 3TV7A 5A4LA 4YJNA 1B42A 2CCHA 4BDJA 4N57A 3VAPA 4O7TA 3QTUA 5K3YA 3NW9A 3ZFYA 4PL4A 2WTKB 2ZJWA 4H0NA 2UYOA 1KOBA 5T68A 3DFCB 5KCVA 3A4OX 2VX3A 3QLFA 5D1JA 3FYDA 1PMVA 3BYOA 1YXXA 4AGCA 5E1MA 2WK1A 2PWPA 3GQLA 5EEHA 3OY1A 3NPCA 4QTBA 2YCQA 4D9TA 1IA8A 1MUOA 3R83A 3FXXA 4WG5A 2WMAA 3G88A 4IFCA 5L6OA 4Q5HA 1GIHA 3E87A 4F99A 4E5AX 1UNHA 1KWPA 2OXDA 3D9VA 3AY0A 2YXEA 4DBNA 5AP1A 2ONLC 2FYTA 1G38A 5FBOA 4QMVA 4AN9A 4EQMA 3CCFA 4J1RA 1WG8A 4O7ZA 3MA6A 4DFXE 3ORKA 3GC8A 3QXOA 4O81A 5E8YA 1QAQA 4A9TA 4M38A 3VS6A 4DH3A 4AOTA 2C6EA 2H1RA 2WQNA 2ZVJA 1DS5A 1CKJA 4CMOA 1U54B 2VDUE 1REJA 2R3HA 3GWZA 3R7VA 4JDKA 5L2IA 3GCVA 2W1HA 5CCXA 1W7HA 3W1FA 3VN9A 2BR3A 4H58A 2F4JA 3I79A 1UWJA 1GY3A 3ZU7A 3LFBA 2JFLA 4RSSA 2QE6A 5JRSA 1AQIA 4HCTA 5HNGA 4PYJA 4ZIMA 1XKKA 4DGLC 3D0EA 4X3FB 5HBHA 4A7CA 3BEAA 3LLAA 3AXTA 4NFMA 3ZBFA 2ZBPA 5GM2A 2O3PA 5B0XA 3JY9A 4JBQA 2R5TA 2W06A 2B0QA 4C58A 4P7EA 4L00A 2VNYA 3QFVA 5M55A 3G2PA 3AMAA 4J97A 3OCBA 3DXPA 4GJ3A 1GJOA 3U4UA 3VO3A 5DLYA 4K9YA 4TYEA 2B9FA 4PP7A 4NK9A 4TYGA 3MJ1A 5HLWA 1H1PA 3MY5A 2IBSA 4KDCA 1YZHA 2YDIA 2VTMA 1FVVA 3IKAA 4ATNA 4Z55A 1D2GA 4G9CA 4BDFA 3M2WA 3M70A 2UZ4A 3OTUA 3QV2A 5DTQA 5DBXA 1Q3DA 4FA2A 2F7XE 1Q41A 3F2AA 4CMUA 4AP7A 4P5QA 3PJ3A 3T3UA 3VW8A 4MHAA 3FMJA 4GU6A 4PL3A 4QPNA 4CCBA 3LFDA 4FSXA 4MD9E 1O54A 2R3QA 2HZNA 3NNVA 3Q9WA 1P91A 4HNFA 2JG3A 4OX9Y 2QODA 3SRVA 3IOPA 3FRHA 2X7FA 3GC0A 3O71A 5FUTA 1Q8WA 4IAKA 3ZO3A 5HIJA 4QMSA 3KK9A 3KB7A 4TYHB 3BGIA 5HX8A 3FZTA 2VTQA 5L2SA 1JLUE 2PTKA 3O4FA 4PDPA 3QQLA 4JR3A 2B53A 4GG5A 5BUIA 5ICCA 3UODA 4R6VA 4BI1A 3BU6A 1OM1A 3VS3A 3FKOA 4BTFA 1JQ3A 2QLQA 4PX6A 3HA5A 1MJFA 3GI3A 4BF2A 2BDJA 3GFEA 2CMGA 3FLSA 5AX3A 4C33A 5J5SA 3Q32A 2P3OA 5FUBA 3OCSA 2YM6A 2OO3A 3PVUA 3UO5A 4KKEA 4MK0A 2PBFA 2QVSE 5IDPA 5CT0A 4CQEA 4S33A 5EGSA 3KQWA 4HRAA 3ZXZA 4AA0A 5EMLA 3A8XA 2CMWA 3MPMA 4YHFA 1RE8A 3UC4A 5IH5A 5HBJA 5AM6A 5GWXA 3ZRLA 4JLCA 3LCKA 3MH3A 3KQYA 2J0JA 1L3RE 5MHTA 3EVDA 4CKEA 3NR9A 5DEWA 4M0ZA 4DH1A 2YIXA 5K0LA 2B9JA 2QOLA 3PTGA 5HTBA 5M4CA 5JFVA 3TUDA 3TWJA 2AZTA 4PTEA 2ZOQA 4M36A 2JKKA 3FMEA 4EWQA 1PW2A 4F9YA 4Y5QA 4XG4A 3Q7EA 1KE5A 4FICA 3JR1A 3FUTA 4O0SA 4WG4A 4WUAA 4WA9A 4G3EA 3BHTA 3U55A 3MPTA 3KKVA 4EKLA 2EX4A 4YJPA 3W32A 3BLQA 1XO2B 3KR0A 1YDTE 1Q0TA 3WYXA 4RQKA 4FV7A 4QMPA 2CHLA 4EOKA 3DK6A 2RL5A 2ZIGA 5AAGA 4RWZA 1OB3A 5EPEA 2Q0BA 3TXOA 5AA8A 1ZZLA 3KU2A 1O9UA 4JAJA 5DM2A 3BPRA 5LQCA 4C35A 1AV6A 3OXIA 2HENA 2OZAB 4O6LA 3C6KA 1RJFA 5HZMA 4L45A 2G15A 2W17A 4I1ZA 3MIAA 4FL2A 1OUYA 3EN7A 1VPTA 3IW5A 4IWPA 2AN4A 4HVDA 2XK9A 3CE3A 3OMVA 4L53A 1LP4A 3OZSA 3ZYAA 4IBMA 3PLAE 2X8DA 5F2NA 5AUYA 5LMAA 4KKGA 4F08A 3MTLA 4YGAA 3FUVA 5CQUA 3KF7A 2LGCA 2XNEA 2YM8A 3TT0A 3BU3A 1EG2A 4Y5HA 3HAVA 4APPA 5FD2A 3UNJA 4UYAA 5EI6A 4CFUA 4RTKA 5AUZA 3C4XA 2UZDA 1NV9A 4FTOA 3V8TA 4DA4A 4I3ZA 2IW6A 4TW9A 3NGAA 2ZV9A 3W2PA 5ICEA 1TKIA 2C3KA 2IZRA 3LGAA 1JQEA 3MFRA 2QU6A 3GU8A 5K0NA 3RPYA 3PUPA 5BVDA 5IUGA 3LDUA 3FUUA 2JFMA 3E63A 3EKNA 4FL1A 3O23A 2OLCA 3KVXA 1ZYSA 3FYCA 3FLQA 4OR5A 3MHTA 2PMNX 4EOPA 5EKUA 4O7YA 3BWYA 5L8KA 1QMZA 2OIQA 2ZVAA 1PXIA 4ISCA 2IWIA 2AVDA 2JBPA 3OU7A 3RKBA 3CJTA 2XIKA 4L7SA 4FSRA 4XOZA 3SC1A 1B6CB 4WRGA 5EQYA 4M7RA 2Y7JA 1H1QA 1ZXEA 5EM5A 4FT0A 3S1HA 4FKJA 4FKVA 1P14A 1SQFA 2QU5A 4HVIA 3R1YA 3GFWA 2IJMA 4EQZA 1ND4A 4PMMA 4F7LA 4M12A 3P23A 2HWPA 3PJCA 4N6YA 3KEXA 4ZP5A 3NLBA 5HTCA 3KXHA 3OFMA 3IDPA 4DFNA 3CC6A 4GK2A 3KRLA 3OPNA 4YJVA 3KULA 4ZY4A 3CQUA 4AN3A 2BALA 1SVHA 4LV8A 4YR8A 4EVIA 1JWHA 5HGIA 4AT4A 5IG1A 2CMHA 4YZCA 3BYVA 4CCUA 1E1XA 4IM2A 4L7FA 2W4KA 4EKIA 3ME5A 1CSNA 5CQWA 1NKVA 2R3JA 5DXAA 3QKMA 4FEUA 4PWNA 4O38A 2XRUA 2XKDA 2BZJA 4LRKA 4BTMA 4FKQA 4QTTB 1AQJA 4FI1A 4ACMA 3GDHA 4O21A 4C4IA 4WBOA 5K0BA 4Q5EA 3GRYA 1V39A 2ERCA 1OITA 4WNMA 1L3CA 5HE1A 2FRXA 2UW4A 5EKOA 4EKGA 3PY1A 4EQUA 3KPVA 2YDJA 2VWWA 2E9OA 1V0PA 3VS2A 1ERKA 5GJFA 5T3QA 3FTFA 3H9FA 3VQUA 4E26A 3V5JA 4FZ7A 2PYWA 3BLRA 2C5VA 3ZBXA 5HE0A 4HTFA 2AYPA 5EG3A 4QQTA 4OTDA 3I58A 1Q0SA 4NCTC 5IA1A 4RWLA 5AUVA 4MWHA 3M6XA 4F7JA 3SSMA 5L8LA 4UB7A 1RI1A 1OKZA 3LE6A 3H30A 4MBLA 4RVMA 2B9EA 3R73A 4JG7A 3P7CA 4DE4A 3U6JA 3PVCA 2BRGA 3KVWA 3I64A 3MSSA 4TL0A 2OU7A 5CASA 3TM0A 4PYKA 2YCFA 2VTPA 4XG6A 2C4GA 4EOLA 4U41A 4MBJA 3VJOA 5BYZA 4G3CA 5JR3A 3LVPA 2R0UA 1NBHA 4GS6A 4CKJA 1OKVA 4G3DA 3P8ZA 3EEOA 1M6YA 4C2VA 2OYRA 3OXTA 1KYZA 2H00A 3G5TA 3ZO2A 5D10A 5IQDA 1CKPA 2GNLA 5DT2A 2RG6A 3KR2A 3RPSA 3HP2A 3EVGA 4FV5A 2Y6OA 4L3LA 3R1QA 2AUHA 4EWHA 3VWAA 4GBED 4EOJA 1W0XC 1H4LA 1YHSA 4UXQA 4OQEA 3KQVA 3B2WA 5CVVA 3QX4A 4O2ZA 2ZYBA 2PVYA 5BQ0A 3EQIA 1IG1A 2IVVA 5AJQA 3NEWA 4QQJA 4D1SA 2UZNA 4L52A 5LOHA 3MQ2A 5FULA 3C0HA 1UNGA 2XKCA 3BKWA 1G8AA 5DNRA 3F5UA 4C38A 2XF0A 4Y83A 2PMLX 2C7PA 2NXNA 4PF4A 5KX8A 3SDJA 4CXMA 2F2CB 1XH9A 1U2ZA 5E8VA 3DJ7A 2PK9A 1KOAA 4J95A 4U79A 5I9UA 3MTEA 4U0IA 4PY1A 4KKHA 4IAFA 3PT9A 3DS6A 5E9WA 3G9LX 3G7UA 4CRLA 2BRNA 3CKWA 3OVVA 3RINA 1M52A 4OT5A 1YW2A 2ERZE 5HG5A 3FTCA 3UG2A 4U7PB 3JWGA 2WQOA 3R8PA 2OY0A 2CNVA 3E7OA 4A9YA 3UYSA 1PRYA 2WU7A 4O2PA 2P2IA 3W10A 2AN3A 2WMSA 5I4NA 5DR6A 4ENYA 4AZSA 4FTAA 4O7SA 4C36A 3G6GA 4M15A 3TNWA 3ZRKA 3QRUA 1TQIA 4CKIA 2PVCA 4WVLA 3EH9A 4QPPA 5A4TA 4EK5A 3BE9A 3LAUA 4YJRA 4FV4A 5E7RA 4DINA 3VQHA 4C37A 3ENHA 5K03A 2P7IA 4K6MA 5GINE 3KQPA 4PP9A 5HFJA 5FTGA 3RJCA 1VR2A 1W8CA 3G15A 4PYOA 1OIUA 3B7PA 5HO8A 3P79A 5HLPA 5AAEA 5A9UA 4DGGA 3CXWA 4HGEA 5U4XA 2G2HA 3I7BA 3NW7A 2V55A 4PYQA 2IVSA 4RGJA 4EOMA 1H26A 3B8QA 5LQFA 3IECA 1A06A 3C51A 1PXNA 2VO7A 3V5TA 4XLIA 1KE6A 5KKRB 4HGYA 3C4WA 5KBRA 1I09A 3QA8A 3KRRA 3OOGA 4CEGA 2WB8A 1DI8A 2QC6A 4JDHA 5AWMA 3V97A 4E5BA 4C05A 1QPCA 4NKSA 5AUTA 5LQAA 4H3QA 3Q4CA 4FS8A 3IW4A 3EQPA 5JN2A 4KABA 3MPAA 1R0PA 4PNIA 1I4WA 2Z2WA 4E6CA 3LECA 4HPTE 1IAJA 4WNOA 4XUEA 3QQHA 2Y0AA 2AOVA 4FV1A 5CEMA 4U3ZA 3FZOA 4JAIA 4RIXA 5BMMA 3P9JA 2JAMA 3UMWA 3AGMA 3FV8A 3QUDA 3HAMA 4F1MA 3DR5A 5F94A 2BRBA 4KNBA 1PMUA 4E4NA 3SXJA 1NW1A 3GRVA 4U40A 3KR1A 1RJGA 4B9DA 2C1AA 2F49A 4ORKA 4XJ0A 3QWJA 3HECA 3FMMA 2UZTA 3V5PA 4FTMA 3IGOA 3NUAA 1TQMA 3EGEA 4ALUA 4M8TA 1M0EA 3R6TA 4MXOA 1JKSA 3ZC5A 4FVRA 4FOBA 2Q0NA 3FHIA 3VF8A 5F20A 4AT3A 4ACCA 4M37A 3CPBA 1W82A 3F3ZA 2OJIA 2UW3A 3G8BA 3ODZX 5EM8A 3OUKA 3R9OA 1ZMVA 4R3PA 4DCEA 3SM3A 4YV2A 2EG5A 5JMSA 2IZTA 4AW0A 3EMGA 3ETAA 2YIYA 4BDCA 2IH5A 4S30A 4OA8A 4X60A 4DLIA 3ANXA 4TTHB 1UU7A 3LQ3A 4IVAA 3C3PA 2WD1A 4OBOA 2ZW9A 3HCFA 3MH1A 1BI7A 3D2KA 4EOSA 4CSVA 5E2AA 3PX2A 2I40A 3UE4A 4YZ9A 2NP6A 4J98A 3PXFA 1AD5A 3FUWA 2WTJA 4QPAA 4KS8A 4M3QA 1H0VA 4IZ7A 2H8HA 3WF7A 1Q24A 4MQ2A 3NDMA 5A4CA 3R0QA 1REKA 3QQJA 1M14A 1GZOA 1GOLA 2R3RA 5TT7A 2HAKA 1JTEA 5HICA 4MF1A 3I4BA 4C4HA 3RTPA 3PS9A 5G02A 2OJGA 2YWPA 4ONAA 4LUDA 4C04A 4MXXA 4ZZMA 3R28A 4X2GA 1BOOA 2ETMA 5AAFA 2G70A 4L7VA 2VDWA 2W96B 4OT6A 3AC3A 1VYWA 1VE3A 4J8NA 4O7RA 3VVHA 3ZLYA 4IMYA 2C0OA 4TWPA 1UA2A 4C4JA 5K5NA 4HG2A 3O2MA 2X7OA 2A4LA 1OL6A 3F69A 1D2CA 5FLFA 4YNOA 4YJSA 4V0GB 3GC7A 1WBVA 3R9NA 1F5QA 2HZ0A 5JFXA 4W8EA 4FG7A 3Q5ZA 3F3WA 4FR0A 5HLNA 4CXAA 4IIRA 3ZUVA 1Y57A 1LR4A 1RI5A 5M4IA 4E4XA 2VGOA 2JGZA 3T9TA 1FP2A 3QF9A 4BHZA 4RRVA 3D15A 1U54A 3R21A 2ZAZA 1JSTA 4U42A 5M56A 5A4QA 2AC3A 2J90A 3LXPA 1YOMA 2C47A 1BC5A 4R5SA 2OPBA 3MFSA 5EI2A 3LPMA 3FL4A 5P8WA 3QLGA 4N6ZA 1TPYA 1PXPA 5JKGA 1BI8A 3A4PA 2E9VA 4FT4A 2NRYA 3LXNA 3FPMA 5IH6A 1CTPE 5ETAA 2C6KA 2QKWB 4ZLOA 4PL5A 4EI4A 2VTAA 5EYKA 4E6AA 3RAWA 2E9NA 3GQIA 3SOCA 1TVOA 4R05A 2OH4A 1ZARA 4X3FA 4C4FA 4FNWA 5HIMA 3NWEA 4PRJA 2EXMA 5IQFA 3NUXA 3ZHPC 4CV8A 4OQDA 1ZLTA 4I6BA 3FYKX 3FZ1A 5JT2A 3LW0A 5JFSA 1H08A 2YX1A 5F2KA 4J8MA 5C27A 1JBPE 1VJYA 2Q83A 3QRTA 5D41A 2GTNA 2CLXA 1WBTA 4RA5A 2JD5A 5CENA 3I0OA 3BU5A 3RWPA 2JH8A 4K33A 3TZ9A 1QYRA 1P2AA 2IZUA 5K0JA 5GNKA 2Y4IC 4FIFA 3SQQA 3R30A 5FTWA 5FDPA 4QVKA 4O6EA 3VIDA 2IIPA 3UO6A 1M6EX 2Z7QA 4U3YA 3HV5A 3Q9ZA 4M13A 1WFCA 4OBXA 2W5BA 3ZEPA 1JG3A 2H34A 4IAYA 2XNPA 2DQ7X 3WIKA 2C0IA 3T8OA 3VUDA 4DEBA 4BDKA 3FQEA 3S0OA 4D4VA 1OGUA 3LJ0A 5AEPA 3R7OA 4ER3A 2BMCA 2I0HA 2X6DA 2IW9A 5AP4A 4ZTHA 4CRSA 4AN2A 5D1HA 2B52A 4HCUA 4DCAA 1T46A 4X2JA 2XK7A 2J6MA 1G3NA 2EWAA 3GRZA 1RJDA 3AD6A 3UO4A 4BP3A 3QQUA 4RVTA 2ZULA 2BHHA 4TYHA 4RX9A 3QGWA 2CGVA 1JQDA 3KMWA 1OIYA 5CF4A 3FJQE 1BYGA 2J0LA 5HD4A 4V01A 4ANSA 3I0QA 1XBCA 1KXZA 2HXQA 4F09A 4RTQA 1R6AA 3CSVA 3OZTA 3G6HA 2PHKA 4JJRA 3ODYX 2BTRA 3CR0A 2OK1A 4BCGA 2ZBQA 3FTDA 4ZMEA 2BDFA 4DH5A 5AA9A 3UJAA 3BYSA 2BZIB 3ROYA 4IWOA 2AN5A 1ZAOA 4MTLA 3BUSA 3IHTA 4RWIA 3NRMA 3MFTA 4LV5A 1QCFA 2JJQA 4CTJA 3L9PA 3CBGA 2XS0A 2FGIA 3R9RA 2G71A 2PPQA 1M2PA 3CBLA 5CI6A 3NDIA 1TW3A 4RVKA 3WF8A 4I5HA 1S9JA 3ZCLA 5HX6A 1W84A 3OU6A 2W4OA 5L6WL 4MD7E 3DULA 3FUPA 2Q41A 1YXSA 3WIGA 2B78A 3KQ7A 3QTRA 3Q53A 2XUUA 1KE8A 1V0OA 3FMDA 2YZAA 4IWQA 3ATSA 3CJGA 3O96A 3P0MA 3QRJA 3BWBA 1KV2A 3P2IA 3GP0A 2V0DA 5CVGA 5ACBC 3OBGA 2YN8A 4C4EA 1QANA 3NVKI 2VAGA 4FL3A 2XVDA 1HOWA 5LVNA 4PYLA 4YHTA 3NVMB 3MVMA 3PE2A 5LQKA 4RTPA 4C06A 4KIOA 2DUVA 3VBVA 4DA5A 3NIEA 2UW7A 1U46A 3HZTA 1WBSA 2WELA 4F6SA 3QUEA 2BM8A 3C1XA 3G33A 2JHPA 4O82A 2KULA 2OZAA 4ASEA 4DYMA 5DM4A 3UOKA 4XG9A 3SVVA 3A25A 4E32A 4G1WA 3PRFA 4LUEA 1OL2A 2WPAA 4GU9A 1Y8YA 2P2HA 2VO3A 4AFJA 5LMKA 1P4FA 3BT7A 2XNGA 3HV4A 3H4JA 3F7WA 5IQIA 4AXAA 1Q61A 2N47A 3TFWA 4Y85A 4FEVA 1YHWA 3A27A 4L44A 3VF9A 3PSCA 3K6RA 4PYMA 4NZWB 3RM6A 5IA5A 3OZ6A 4F1OA 2P7HA 4IHPA 3Q4ZA 4DEAA 3MB6A 4FV9A 3L9NA 3TNQB 3UP2A 2XIRA 3ORNA 2C6TA 1WAKA 4APCA 3D7TB 4ZAUA 5BP7A 4R3CA 5HIDA 1BMKA 4IM0A 5CZHA 5JRQA 2BZHB 3HYHA 2PVFA 3DXQA 2WO6A 3KFAA 4GIIA 3UZPA 5BVOA 2F2UA 3RODA 2R4BA 3PSBA 4ZS4A 4JRNA 3SGLA 4LL0A 3G9NA 3LL7A 3N51A 5LXMA 4D5KA 2X1NA 3HA7A 5I9ZA 3ORXA 3RAIA 5FDXA 1CMKE 3EYHA 1OPLA 3WZUA 5CVFA 1O6KA 5EH0A 3DLCA 2IVUA 1BX6A 3O8UA 4E6DA 2Z6QA 2NP7A 2XJ2A 5IQHA 1INLA 4BCIA 4PMPA 3AMBA 4YNEA 5AV4A 1T43A 3I81A 3E5AA 2A1AB 3K2LA 4NJ3A 2OJJA 3ZSGA 2O2UA 4R1YA 3W2SA 3OW3A 4G5PA 1IAHA 3ORPA 2OB2A 5GP1A 4AW2A 3VC4A 2VTIA 3RVGA 5EKXA 4FR4A 4FGZA 2OI4X 5E9EA 3ELYA 4BGGA 2UZOA 5AUWA 4EOIA 1U4DA 3QGYA 3E8CA 2IVTA 4WOVA 1PJKA 2X7GA 1ATPE 5CYIA 4F85A 3PZHA 2C6IA 3U8WA 4KAOA 5CU0A 3DKCA 4JRVA 2C7QA 4FG8A 4EH7A 5CEOA 3FMLA 5FM3A 2GDOA 3MB7A 1YFLA 2PX5A 2WMXA 2J0MB 3AD5A 3ER8A 2O06A 2VZ6A 3OFKA 3R24A 2VU3A 3BYMA 4KIQA 2FSLX 5EM7A 4HGZA 2NPQA 3L8PA 3HRBA 4H36A 2NRUA 3E8NA 5LQRA 4QT1A 4OTWA 3FUXA 2CPKE 2HTEA 2X2LA 3KMUA 4XP3A 1PKDA 3NAXA 4G6NA 2JDRA 4OTRA 4ZTQA 3C4FA 3CC8A 2EU9A 2ADMA 2GFCA 2QI8A 5EG5A 4G17A 2CKPA 3WI6A 5LWMA 2VWVA 4O0XA 3Q52A 3IO7A 3AG9A 4IKPA 4C3FA 4BCQA 2P40A 4GK4A 2XKFA 5H8GA 3ROCA 3HX4A 3KC3A 5DX8A 5DRYA 3THBA 5E1OA 3TN8A 2PWLA 2Y1XA 2CWWA 2UYQA 2BKKA 5AP5A 4CMTA 4PWYA 4GYGA 4JIKA 3PYYA 5BVNA 2CGWA 3PA4A 3UTOA 1OL7A 3FKLA 1XH5A 5J9ZA 4CFFA 4YU2A 4C3RA 4LMUA 4QQKA 3NWWA 3TNHA 1WVYA 2G8NA 3Q60A 2F8LA 5FA5A 2BAKA 4QMNA 2EJTA 5AMNA 1RDQE 4BDHA 4AGUA 4XUDA 1UIRA 2PUIA 3TIYA 3PXZA 3E8EA 2OO8X 4MIKA 3ZC6A 5AP3A 4BKJA 3OS3A 4BDIA 4X63A 4FYNA 3NZ0A 5CSPA 2CGUA 4D55A 4A9UA 4BN1A 5I9VA 3U9NA 5F95A 1QL6A 2PV0A 4YO6A 2ITOA 5D9HA 1M7NA 4PDSA 2NYUA 4HJOA 3C3YA 1R78A 3MERA 2PXAA 4Q2AA 2P8JA 1PF8A 4MXCA 4JQ8A 4ZY6A 4BIEA 2OWBA 2KTYA 3EL8A 3PVBA 2WTKC 4DG2E 4EK3A 5D1NA 3DLSA 3FPQA 1XCLA 5AIKA 4FIGA 4DFZE 4TWNA 3JWIA 4USFA 4DN5A 4HCVA 4ID7A 4QDJA 2PE1A 3OE4A 4TYJA 4HYSA 7MHTA 5M51A 2XB7A 5HG8A 2FK8A 3BV3A 3HRFA 3T0IA 3UVRA 5IA2A 5DX0A 1KSWA 2C5YA 2PXCA 3VUGA 3LXLA 4X3JA 3AJDA 3HV6A 3DV3A 2CNQA 3UZUA 2UW8A 4HYIA 3A7IA 4GF5A 4V05A 4RC2A 4ZEGA 1XH7A 4FGBA 3TTIA 2I0EA 4FKTA 2W7XA 2PE0A 4BP1A 1PJZA 3Q04A 4O0VA 4F9BA 2GA9A 3KCKA 1H1RA 1ZHFA 4B4LA 3ORIA 4ZJVA 3F2RA 3ANRA 5I9YA 3O31A 5CTPA 4EONA 5KQRA 1H1WA 5E8TA 3OTVA 3R7UA 3P9IA 3K3IA 5EW3A 4RX8A 4D5HA 4BIBA 5J1WA 4FTJA 5HCZA 2BHEA 1GAGA 1EJ0A 3HVIA 4EORA 5CY3A 1JSUA 3II5A 2YVLA 4OBPA 2VRXA 5A6OA 2HR1A 4RA4A 5DPVA 1AQ1A 1L8TA 4EKKA 3Q87B 4L67A 2AOUB 4X3FC 3IYLW 3CJQA 4DF3A 2Z7LA 1V1KA 2R9SA 2I0VA 4OTGA 3LJ2A 2X0GA 4G3FA 3C50A 3DLIA 1ZOHA 3F6XA 3UOJA 4GFOA 4DT9A 4ER7A 2Z02A 3SW7A 5AP2A 2GFSA 4YUXA 1Q8YA 5K8VA 4O84A 5AADA 5AV2A 5BVKA 1YXVA 2WKMA 4LQMA 3Q4UA 3U81A 3C9WA 1SM2A 2WTCA 4A06A 4L68A 1KYWA 3SXFA 1LUFA 3SR4A 4QVGA 4XG7A 1JNKA 4AWIA 3A26A 2OKRA 2C6MA 2ZWVA 5KE0A 2QOCA 3H2BA 3FXZA 3ACKA 5EOBA 1UV5A 4OTHA 4AA5A 3HTXA 4TYIA 3DDPA 2GHGA 2HWKA 5BPYA 3I5ZA 2HNKA 4Z7HA 4Y30A 4AZEA 4AE6A 4Q9SA 4PNEA 5E8ZA 5FTOA 2I0YA 4DHFA 2F57A 4F63A 5HORA 4EUTA 4GUEA 3ACJA 3EVZA 4CFNA 4ITHA 4EOQA 3RK5A 4DCGA 3ZMMA 4F64A 3D5WA 4FV2A 1J1BA 4F65A 1XH8A 5GM1A 3EFLA 1VL5A 3GCQA 3FC2A 5DN3A 3R04A 3SSNA 2YFXA 4ASXA 3DB6A 3FZRA 3VBYA 4NT4A 3VRZA 3CY3A 5CX9A 5HOQA 5D7AA 3TUBA 2AC5A 3DQWA 3AQVA 4JDIA 3ZFXA 4XCXA 3UG1A 3R9HA 1UU9A 3D5XA 3ZLSA 2X8IA 3GU7A 2NO3A 2G1PA 3FSKA 3W2QA 1E9HA 1QZZA 5E8WA 2PVKA 3RMFA 4PYIA 2GAFA 3PXKA 3QHWA 4HOKA 4OLIA 1R3CA 4U9AA 4YLKA 2PZ5A 2I62A 2Y6MA 4AG8A 3QX2A 5HCYA 1MQBA 5H9BA 4QP4A 2EVAA 2XA4A 3GBZA 4KRDA 3RW9A 4IX4A 1Y6BA 3P78A 4KBKA 2WEVA 4AAAA 3M4XA 2X8EA 5HIKA 4IFGA 2YTZA 3NMUF 3LIJA 5CEPA 3VC1A 3LHDA 3QOXA 3E64A 4YC8A 3S95A 3WZJA 1TW2A 2VWIA 2ZZNA 3HVHA 3QZGA 5TR6A 3CIKA 4EH2A 4UV0A 5HE2A 2PJDA 4Y8DA 5JGDA 4A9RA 4IV0A 4FTIA 5JUWA 1LEWA 3AD4A 5ICGA 1R00A 5JZNA 3FPJA 4BIDA 1G6Q1 3MY0A 1K2PA 4DT8A 1JQHA 5HEKA 3RHKA 2X9EA 5KZIA 3OE5A 4FKOA 4CVAA 4FIIA 3PXYA 1YI4A 3Q6WA 3GT8A 5EDPA 5ACKA 5EI8A 3E62A 4A9SA 2C6OA 4TT7A 4V0GA 5K4IA 2WQEA 4BCMA 4I0RA 4YUZA 4R77A 4LMNA 3EJ1A 4RJ8A 4USEA 4IZ5A 4QMZA 4B8LA 1GNGA 2XEYA 5CXHA 3VW6A 3VJNA 3CKXA 3QYWA 2RFSA 2GNFA 2R2PA 2QOHA 3C13A 3Q3BA 2B9IA 3A7HA 2OKCA 4CKBA 1ZYDA 3KQMA 2C6DA 3U6HA 2PSQA 3N4VA 2OW3A 2VUWA 5C4LA 1OPKA 4BB4A 4ARKA 1LPUA 5JQ5A 3H9RA 3DNEA 3WE4A 4C34A 4HGSA 3JPVA 1JR4A 5KMLA 3ZDUA 5LVMA 5FADA 5HQ0A 2YAKA 4DZRA 3KXMA 1YOLA 5DA3A 2O57A 3FMNA 1YOJA 1MP8A 2I1MA 1H01A 4YPDA 1BLXA 4BZOA 2V7AA 1XDUA 3E7VA 3PVGA 4YC6A 2Z7RA 3UA3A 5HCXA 1OR8A 4UY9A 4IVBA 3LCTA 4G5JA 5FXSA 1EIZA 3ULIA 4D4RA 4D2SA 3KQSA 5CU2A 3ELJA 3UA4A 10MHA 4FTRA 2OXXA 3BXOA 4I5CA 3VUIA 5EYCA 3DXNA 4CKRA 4GT4A 2I6GA 1JSXA 5K0FA 3TM5A 3EN4A 5EVJA 2V62A 5DM1A 4NU1A 5FEDA 1FP1D 1WXXA 5IISA 5HD7A 4DEIA 2C30A 4F0IA 4M68A 3TUCA 5KNJA 2P35A 4HW7A 3W55A 4XLVA 4ZZOA 4YTFA 4BCJA 5K4JA 4IQ6A 1VZOA 5A6NA 1NVQA 2AOTB 3F61A 3REOA 4X0MA 4FIJA 4GIHA 3VBQA 4C08A 1RI3A 3BHYA 4PV0A 3RPRA 4F84A 3TR6A 1F0QA 4GSBA 4CWAA 2GTMA 3P4KA 3ANQA 2YM4A 4BICA 1UWHA 2ITWA 2HELA 3HV7A 5EFQA 2VNWA 4IV8A 2XYVA 2HW6A 4NSTA 4MNEA 1SUIA 5EDQA 3NJRA 1IM8A 1SG9A 3R0TA 4IZAA 3W2RA 1NVRA 1K3AA 3OU2A 5LVLA 1ZYCA 2GLUA 1ZMUA 2OJFE 3IW7A 5M4UA 4II5A 5C1IA 3UWPA 5E8JA 3CCNA 1FINA 1YDSE 2UYCA 4O0TA 1ZKDA 4PMSA 3H10A 2BVAA 5I9XA 3GNLA 5CSHA 3QHRA 3HRCA 1GZKA 4XG8A 2OB1A 4O0YA 1N2XA 3AT4A 1OZ1A 3RWQA 5CEQA 3WBLA 3BWMA 4R7BA 2XYQA 4ACDA 3JVRA 1XVAA 4PYNA 4Y95A 5HE3A 2A27A 4WG3A 3F66A 4QP9A 4B99A 3FHRA 4BDDA 4EK9A 5HI2A 4ACHA 3AC5A 3ERKA 2YA9A 3ZONA 4GMYA 2FSOX 3ID6C 3HLLA 5IUIA 3L9MA 2Y1WA 4DLJA 3QD3A 4YSJA 2ZMCA 4QRCA 3BCEA 3OXZA 1WBPA 5JH6A 4EH5A 4EHEA 1Y6AA 4DH8A 5FBNC 3THSA 3VS4A 2UZLA 3FWQA 2JIVA 4AGDA 2UZVA 3VULA 1X1BA 1H27A 3PPJA 4BY9E 3L8VA 4CLIA 4QDKA 3VYWA 2V74B 1STCE 4X7QA 3AXWA 2B4SB 5FHRA 1R18A 3HL7A 3QD4A 3FI4A 3MDYA 4E5WA 2XM8A 3GCUA 4RBLA 1U59A 5IF1A 4C03A 4KRCA 5A14A 4EH9A 4JOAA 3LDGA 1H25A 1H1DA 1DUSA 4TXCA 4F0FA 4HZSA 2DS1A 3OFJA 3RI1A 4U8ZA 3EHAA 5H2UA 4BCOA 1UU8A 3BKXA 4M97A 5CU4A 1KPGA 2ORED 3DZQA 2PUNA 2OH0E 2V22A 4C0TA 4BR3A 1KP9A 4RX5A 5IQGA 3R7EA 4ER5A 2NXJA 2O5KA 4B0GA 2CSNA 4HVGA 3R8MA 3EL7A 4FKSA 1UWVA 3HNGA 4E70A 3LCDA 4DEEA 1XH6A 2ITYA 3TZMA 1NW8A 4D0WA 1WS6A 4IVCA 4EL9A 5ERGB 3GCZA 4NTSA 3BIZA 5HNBA 2R3MA 4AACA 2ZB1A 1ZOGA 2BROA 4HVSA 5I9WA 4FSUA 2PUPA 3D7ZA 4FTCA 5FTQA 3UIXA 3M6UA 3W18A 4CFXA 3HCAA 4I0SA 4BZNA 4FEQA 5E1SA 4UWBA 4KIGA 4FTLA 3GB2A 4IDVA 3BI6A 1YXTA 3LLTA 3RPVA 3FPFA 3V5WA 4KSQA 2GMXA 5AX9A 3BE2A 5E2BA 3NDJA 2FA2A 1SUSA 4X41A 2QOBA 3IPHA 2QCSA 5KQSA 1Y8GA 1OI9A 3TJCA 2PT6A 4GRBA 4LM5A 1XJ5A 3AT2A 4LGHA 1V0BA 2VV9A 2CLQA 2VN9A 3PJ8A 4C61A 3R6XA 4HYHA 4IB0A 3MCTA 4EH4A 2W1ZA 5J95A 4NYEA 2F7ZE 3NTVA 4Z2YA 2Z60A 2HXLA 3QRKA 5FGKA 3BWCA 2WA1A 4P7KA 3OT8A 4M14A 4QMYA 4UOEA 1H00A 2GHMA 5CWZA 4C07A 3LCUA 2A19B 4D1ZA 1Z9XA 4H05A 3AT3A 5HG9A 4JXFA 2PT9A 2XYRA 3M6VA 3IONA 3FLZA 3OUNB 4DKJA 4I6QA 3KQOA 5DG5A 1P5EA 3K0BA 3BKBA 1F3LA 5E9JA 4RC4A 5CLPA 2YXLA 3WF6A 4CKCA 5CCBA 2BILB 4U97A 4W4XA 2BR5A 4E20A 5K05A 4DAWA 4F9CA 3CQEA 4R8RA 3QUPA 4HC4A 5F4NA 2QKRA 2OXYA 2WIHA 2HYYA 4F7SA 1WMKA 3BHUA 4I92A 2VO0A 1KPIA 3QD0A 4QP6A 3V6RA 3EVFA 2WQMA 1NXKA 5EKNA 1YB2A 2J0KA 3TNIA 4C3PA 2C68A 4PUZA 4MKCA 1UU3A 4EK6A 4UWYA 2QR7A 3ORHA 1QPJA 5KKRC 2ZWAA 5KVAA 2HW7A 2BR4A 4PDOA 2J5EA 3VUHA 2ONYA 5LWNA 1L3IA 1QAMA 5EC8A 4F7NA 3LFQA 4RFMA 4DFYA 3LCSA 2VD5A 4U6RA 4UWCA 1N7JA 4UALA 3HA6A 2IBTA 2R0IA 3B2TA 1UFKA 2P41A 3BLHA 2EFJA 4I6HA 5HG7A 5EMMA 2H96A 4EBVA 1Q8UA 4RT7A 4F86A 2ZV8A 4ZLZA 5M06A 4EH3A 3EN6A 3PPKA 1YF3A 3L9LA 4FKGA 5B2LA 4GOOD 2XK4A 1IR3A 2AOXA 5KS2A 1MRUA 4MAOA 4V04A 3V5LA 2RFDA 4FSNA 4DM3A 3RHXA 2Z6AA 3Q96A 5K9IA 4ZSLA 5CAPA 3EVCA 1GIIA 3IEIA 1P1CA 2GNGA 3MY1A 3B89A 4KBAA 3VC2A 1Z57A 2GNHA 2UVXA 5EMJA 5KYGA 3LDFA 4KVZA 3EEYA 2W1IA 1VBFA 3OW4A 4QNAA 2XEZA 1M17A 3DKOA 4EK4A 4FVQA 3SVZA 5E8RA 5BNJA 5FQNA 2VTLA 2ESRA 4E73A 2HZ4A 4O0RA 5EOLA 3DBQA 3TEIA 4AX8A 2IGTA 3UIMA 1SYKA 3GRUA 5IA0A 3FEGA 3OOMA 3KPWA 3I5UA 3LFEA 5B7VA 5IMEA 4IAAA 4GVJA 5EHLA 1BL6A 3ZZWA 3B3FA 4DBXA 3C0KA 1KHHA 2XJ1A 4DTAA 1IY9A 2QNJA 4HZRA 5G6VA 3KXGA 2XIZA 4LOPA 4AF3A 4XUFA 2P4IA 2YDKA 3PZEA 3CPCA 2JAVA 1Q97A 3LFSA 4ZSAA 3I6UA 4BYJA 2JEDA 4OTQA 5EK7A 4EZ3A 5LQUA 2EB3A 3HMNA 2OZOA 5M4FA 2X39A 4WSYA 4AZTA 3EZRA 5GHVA 4QTDA 1P39A 3I1AA 3LQ5A 3UQCA 2UZUE 3C5UA 4AW1A 3HVJA 2GQSA 4QTAA 2BDWA 3PIZA 5DRDA 2OSCA 4ITJA 4YLJA 1H07A 4YUYA 4U80A 5IQBA 5C26A 3G2QA 3ORMA 3KU1A 4XRJA 3DZOA 3BELA 2W1EA 1WY7A 3GGFA 3MTFA 2VTOA 4GK3A 3UDBA 3QOWA 2ITVA 5EM6A 2XCHA 3BGDA 2JDSA 5CVUA 3ZM9A 3NCGA 3ZTXA 2R7IA 1RI4A 3CTQA 4JG6A 2QD9A 2QO7A 1HMYA 3P9NA 3IDBA 3PY0A 3C4ZA 4K8AA 4U43A 5ANGA 3FTEA 3C6MA 1U5RA 3A61A 4EBWA 4GUBA 1SMHA 2YEXA 4E7WA 3GC9A 4FV0A 3T7SA 1VP9A 5CM2Z 5DGZA 2JIIA 4ZTLA 4TY1A 4ENXA 3EVBA 2PL0A 1NW6A 2QRVB 4L3PA 5ANEA 4QPSA 5I5ZA 3TIZA 2PULA 2J2IB 5C1QB 4QMWA 5DE2A 2YM5A 1NV8A 5CSVA 4A4LA 3S68A 4PONA 1OL1A 3COIA 3TDVA 1YKRA 2ZMDA 4ZSJA 4FODA 4LG1A 2XBJA 4CG9A 4ERKA 5K5XA 4FIEA 4JBVA 2OZVA 4P7FA 3D5UA 4IAZA 5M53A 3UBTA 4OBWA 4EMSA 4ZJJA 4IJ9A 5CNNA 2YISA 1JOWB 3BHVA 4D2RA 4E4LA 2ITUA 4C62A 4IH8A 4WNKA 2GB4A 3MWUA 3PP1A 3QRIA 4X2KA 2CJMA 3LBFA 4FSZA 5CAQA 3QCQA 2C69A 4ALVA 3VS1A 3R7YA 1J3HA 2E9UA 2O8YA 5C8MA 4BDGA 4TNBA 3UP7A 4R78A 1PYEA 2Z7SA 4EYJA 2YJSA 3ZLWA 1KPHA 3E7PA 4ZZNA 5LQNA 3ZUTA 4O91A 2REIA 1R8XA 4CNHA 2G01A 2R6ZA 3IG7A 5K0EA 2C6LA 2JKMA 4P58A 4XX9A 3RALA 4QMQA 4AFEA 5T67A 4R1VA 1UVRA 2IDKA 3PFHA 4BLVA 3EIDA 5F9EA 2A2AA 2GS7A 2WA2A 4O0WA 3DMGA 4MQ4A 3POOA 4XP2A 4ZXTA 4P2KA 4FSDA 4BRXA 3ITZA 1QPEA 2H9VA 3I9FA 2VDVE 4FT3A 2XM9A 4TN6A 3N4TA 3PTAA 4FZVA 2EXCX 5BVWA 1U5QA 2OJ9A 2RFEA 4E33A 3THRA 4C2WA 3PXRA 3KA0A 5IQCA 3UNKA 4E6QA 1SVGA 1WXWA 2YHVA 3PIXA 3HUBA 3LZBA 3WZEA 3NWBA 3QALE 3BGPA 4D58A 2B7AA 2CNUA 2KW5A 4ZLYA 4QO9A 2W0JA 4V0QA 3NUNA 2C1BA 3AGLA 3WILA 3EFWA 2DWBA 2CCIA 3CD8A 3UBDA 1IXKA 2QHNA 2XZSA 3EZVA 4RTRA 1OUKA 3KPYA 3QTQA 3F4KA 2X9FA 4IX6A 5DPMA 2GQGA 4QYHA 3QTXA 5KUPA 3BX5A 3CLYA 4AUKA 4G3GA 1DCTA 3D5VA 3LMIA 1XBAA 2C3JA 3NW5A 4CFVA 3K3JA 3DNDA 3EPPA 4ZK5A 2XVMA 3AOXA 4C7TA 4KDRA 5CALA 1HNNA 4DGNA 1W83A 4AGWA 3IW8A 5ANKA 2WTWA 1ZGJA 2XP2A 4MXAA 1JPAA 4WNPA 1ORHA 1F3MC 3AC1A 3BWJA 2CL5A 3UFBA 1FVTA 3TZ8A 3FAAA 5ETFA 4JQEA 1NE2A 4PTCA 3FYJX 3C7QA 1G5SA 3RP9A 3G89A 2J50A 3ZH8A 4FUYA 5FM2A 1WZYA 2QG7A 1A48A 4ZSEA 2ZZMA 5TKDA 3DBDA 1LEZA 3HGKA 4YLLA 2HIWA 3R8ZA 4OTIA 4YUVA 3D94A 3KN6A 4HPUE 3PY3A 4J71A 1R74A 4IB1A 1TQPA 2ZM4A 2NXCA 1FJXA 4ZTRA 1FMOE 4AZVA 4A6DA 2JHAA 2ITZA 1L3BA 3HMMA 4DMGA 4GJ2A 2ZIFA 3PG1A 4P90A 3PJ1A 2E2BA 2XK3A 5HEZA 2GS2A 3MAGA 2BCJA 1ZY4A 3EQDA 3EGVA 3VNTA 1G60A 3DH0A 3CS9A 5DTRA 4DTBA 3ZSIA 2OG8A 4AUAA 4LYNA 3FPHA 3MI9A 4QYEA 3A62A 4YMHA 3L8XA 3BWFA 3AWIA 5KMMA 4RTLA 4ZJIA 2QM3A 2YM7A 2QR8A 3P2EA 3TKIA 1PXKA 3UYTA 5TO8A 4TWOA 3FC1X 2IPXA 3IS5A 2XBMA 4PTGA 4ZTMA 2WEIA 4L9IA 4CZTA 4RZVA 2BRHA 1JVPP 4YZBA 2OBJA 4F6UA 1SVEA 2GHLA 3F88A 3KKZA 2P33A 4JBOA 4AOIA 3OWLA 4J7BA 1NW3A 1SQGA 5AM7A 2E9PA 2BUJA 4FTTA 4C4AA 3GOPA 4JQ7A 4QYFA 3F3UA 4F9WA 4RX7A 5AUXA 3KGAA 4M0YA 2XIYA 3TZ7A 2R3LA 5HIIA 1OPJA 3EQFA 4CT2A 3TKYA 5CAOA 3SKCA 3R8UA 5M5BA 5D7VA 4TKSA 4XCUA 5HVJA 4CFMA 3L8SA 4FNXA 5DIAA 1URWA 2YITA 2CKDA 2ZM1A 4W4VA 2P1DA 5C8NA 4O83A 1O9GA 5BUJA 2YIQA 4CD0A 4L42A 5ANDA 3GUBA 3ZO4A 4RIYB 3O8TA 1KUTA 3FI3A 2AOTA 3NUSA 4ER6A 4GOMD 4OUCA 4BLWA 3FPEA 3G51A 3R63A 3R71A 4NWMA 4PMTA 5L3AA 4BCKA 5C9CA 4CGAA 4G16A 3PX3A 2I9KA 1T45A 2LD4A 3GJYA 2OBFA 4O7VA 2Z8CA 3IOKA 5ICFA 2QOIA 1G55A 2ZFUA 2BAJA 3SA0A 2QG5A 3LM0A 4EEVA 4IWNA 3CGOA 4TNDA 1QPDA 3COHA 3TKHA 3FMHA 3UJ7A 3N9XA 3DAKA 4AZWA 3BV2A 3SG9A 4G34A 5M44A 2FH9A 3GXOA 4XV9A 5CEIA 2WMUA 2XKEA 1KE7A 5E1EA 3CEKA 3DJ5A 4NFNA 2CKOA 2VZ9A 3Q6UA 4Y72A 3SAYA 3MW1A 2UW9A 3ALNA 5LMBA 2QO9A 2E5WA 4CG8A 4JX7A 3MH2A 2O64A 4RWKA 4RG0A 4RFYA 1JG2A 4UX9A 3LFFA 4ZTSA 1XXLA 2XIXA 2R3NA 3Q2JA 4K2RA 5BX0A 3EMBA 2EB2A 2R3OA 5J9YA 4AA4A 4XBUA 4DG3E 4NTTA 4YZDA 4K0YA 3KRJA 1F38A 3MB5A 3IGGA 5H8BA 3R2BA 2JKOA 4EYMA 5JK3A 4RLKA 1X19A 3GENA 4MD8E 3VUKA 1I1NA 4FE2A 4HVHA 3WYYA 2RKUA 3KXNA 3IV6A 3KPUA 3DFAA 2WU6A 4FUXA 4AOJA 3PLSA 3NNXA 3DTNA 2UW5A 3HDNA 4MEDA 4BHNA 1OKYA 3G2FA 2F7EE 2PZPA 3TCPA 4YURA 4M69B 3QTZA 3KL8A 4IB3A 4EHGA 3I60A 3QCYA 4M84A 2JDTA 3CGGA 5B2MA 3R22A 2BM9A 4QMUA 3LMHA 4B6LA 4GFGA 4RIWB 5EHOA 3UJ6A 1BL7A 4YBJA 3I6WA 5CD1A 3QQKA 2GS6A 4V0RA 3AC4A 1KIAA 2FVDA 2WFYA 5DVRA 3QU0A 5C8KA 5J1VA 5TOZA 5HHWA 2PZYA 4DGOA 5M57A 1YUBA 3U54A 1EH4A 4NIFB 4NKAA 4O29A 4EHVA 3DGKA 2BTSA 5DXJA 4L3JA 5CNOA 1M2RA 5IA4A 2I7QA 1MRYA 5T6KA 3NS9A 4QP7A 3K54A 1G8SA 1JG4A 5L2WA 5KMJA 4RLLA 4KBCA 3POZA 4DC2A 2ZLBA 3SG8A 4I21A 4UN0C 5B1SA 2B25A 5IQEA 4FSYA 2A0CX 1R0EA 4RMZA 3G5LA 2J0IA 4Z7GA 4DGMA 4GKHA 3R8LA 2QOQA 2WOTA 4FG9A 3DXXA 2BKZA 4GW8A 4R7HA 4F1TA 3LXKA 3NNWA 2W5AA 3IK3A 2CKEA 2H11A 4H39A 5GOZA 3ZM4A 2QY6A 3HCBA 4EQCA 5IQAA 3OZRA 4I41A 4JS8A 5DTMA 1XQZA 3SLSA 4ZTNA 3VS7A 1YRPA 3TKAA 1L1EA 2JBOA 5TF9A 2XJ0A 2YUIA 2UW6A 1EAMA 4IW0A 4NJDA 4BCPA 2VTJA 4WHZA 3OG7A 3NAYA 3ERCA 4YC3A 5BYLA 2CGXA 4O86A 2H6DA 5F1ZA 4BBFA 4PGGA 4FZ6A 3DKGA 1AGWA 4FP9A 3C4EA 3I7CA 3QL8A 1HCLA 3FQHA 4HH4A 4FZAB 3V01A 2X2MA 1XJDA 2PGXA 2NNWB 5AFVA 2R64A 2G1TA 4OTFA 5LCJA 4R6WA 2PVLA 5EYMA 5IEYA 1JKTA 5KMOA 4RJ7A 2R3SA 4B8MA 2FO0A 5EYDA 4JXJA 4K18A 2GPYA 2PKWA 2PVHA 4FKRA 4F9AA 4ZTBA 4N0SA 4NM3A 5EEGA 4FNZA 2W1GA 4ZMFA 3VRYA 2ZBRA 5GJGA 2VTTA 4I5PA 4ER0A 1GZ8A 4GOND 2IH4A 3VHKA 5IEVA 2R3IA 4CV9A 3FL5A 5GJDA 4CTBA 5BW4A 3ZUUA 5HBEA 2ZSUA 1PXMA 2C3IB 3DXZA 2WTDA 4G6OA 2PZIA 4PIPA 2QLUA 1KR5A 1QAOA 4I4EA 4E2ZA 4GEKA 4I0TA 4TRLA 3W2OA 3R02A 1NY3A 4CFWA 5IUHA 3DTWA 4EOOA 2XK8A 5J7HA 3V8VA 3E23A 1XTPA 3G90X 1GIJA 5EHIA 1WZNA 2ZB0A 4LECA 3FZGA 3O7LB 2GCDA 1IRKA 5JGAA 5C01A 4IC7A 3L1SA 3REPA 5FXQA 5LR6A 1Z5MA 1ZGAA 3E92A 4QP3A 2CKQA 1YXUA 3F5PA 3B5IA 4KSPA 5J9LA 1APME 3W2CA 4D9UA 3HVKA 3HUCA 3TG1A 4J96A 4KWCA 4RTNA 3UQFA 3EGIA 1CKIA 2IN6A 3LHJA 1VEBA 4QTUB 3RZBA 1ORIA 3FRIA 4JL9A 3GGDA 5KHXA 2YM3A 4IM3A 5LQJA 1YQJA 3VHEA 3EWHA 4XYFA 3DY7A 4ASDA 3PG3A 5BUEA 3HCEA 3UPZA 5ITAA 4L01A 2QOKA 4IC8A 3F9NA 3TKUA 3KN5A 5M07A 3DLZA 3LCVB 5DR9A 3GOKA 3NUYA 3T7RA 1NW5A 3TNPC 4QMXA 2ACXA 3WSTA 2HK5A 4R7IA 4LL5A 2XH5A 3DT1A 4O27B 3F2NA 4USDA 3T7TA 3IDCA 1FVRA 3TMAA 5CAUA 3NYXA 4BTJA 3P7BA 5FP5A 3SX9A 4LRMA 1XWSA 5IZFA 3OD6X 5BW5A 3AC2A 4RC3A 4I20A 3QZIA 3EKKA 3QWKA 4E2YA 4KRGA 4S34A 2G2FA 4NW6A 4C4GA 3UIBA 3W16A 3CGFA 4KIFA 4NM0A 4O7WA 4DITA 3UVQA 2B1PA 2PE2A 1JG1A 3EOCA 3NX8A 3PRIA 5EOVA 2OFVA 4FV3A 4LWPA 3VBXA 3MVLA 1YWVA 5K0GA 3LCCA 5FWDA 2R3FA 5A54A 4PCAA 1Q5KA 4EC9A 8MHTA 3KXZA 5HILA 4LOOA 3GVUA 3OEFX 5CXZA 4ERWA 4P7GA 4D1XA 4M7IA 3MS9A 3EQGA 4U7TB 3M42A 4MX9A 4DH7A 5DT3A 4L6QA 4BLUA 1MRVA 3I53A 1ZMWA 3FKNA 4MYGA 2R7BA 5E8XA 4KIPA 3OF0A 3HM2A 3WZDA 1PHKA 4BI2A 2UW0A 2JHCA 3P1AA 3BEGA 3RAKA 2W1CA 3RCDA 4LI5A 3WE8A 3FZPA 3D14A 5KZ0A 3SD0A 1P4OA 4RX1A 4JR7A 3QTIA 3A7JA 3NW6A 3BZ3A 1WVXA 2WMRA 4Z3VA 2PY6A 1BHJA 4FKIA 2VS1A 2BIYA 4Z16A 4RTOA 5HIEA 3DQXA 2HCKA 2PUUA 3NSZA 4XEYA 4N4SA 2XMYA 4K1BA 3QAME 2Y8OA 4YSMA 4BCFA 1YVJA 2XK6A 2VWBA 4XG3A 2YWVA 4A4XA 2O07A 2GS9A 3DPKA 2NXEA 3F7ZA 4HYUA 2X2KA 2ETRA 2B55A 1M7QA 4GEOA 3DP7A 1IA9A 1Q8TA 4EC8A 5ANOA 2R3KA 4XV1A 2QRVA 5BVFA 4DEHA 3MTIA 5EZQA 1Q99A 3MESA 3UNZA 2BRMA 3MBLA 5DM0A 4YMJA 3OEZA 3TPZA 4LOQA 2BFXA 2PY3A 4YJTA 4RVDA 2AOWA 3VS0A 3KPJA 1ZWSA 4S32A 1WVWA 4WKQA 1JSZA 2YR0A 1YDRE 3O0GA 4ACGA 5LSAA 1R1WA 5G1XA 4RYLA 3AXSA 4A4OA 4FNYA 4RVLA 5FRIA 3UPXA 2BPMA 1ZY5A 3DCVA 2PVMA 3P2KA 2AVNA 4JNWA 2XNNA 4EJNA 3PWDA 4I24A 5LVOA 2WHBA 4FV8A 4GT3A 3M33A 3QYZA 5FG8A 2WMTA 5AV3A 3DU8A 3COKA 3PA3A 2WNTA 1EJ6A 5HKMA 5H02A 5DHJA 4FV6A 3JUHA 3LFCA 3ORZA 3BQRA 2O05A
chains in the Genus database with same CATH superfamily
5CANA 2JI8A 2RGPA 4YJ3B 1PXJA 1TKCA 2AFRA 3CVWA 3HV0A 2V4UA 3JYQA 2ZE5A 5C9ZA 2NV0A 3PTLA 4IIFA 2ZYGA 3AL2A 1VOTA 4MVCA 3JWJA 1S7GA 2G80A 4DCJA 1SMKA 5SYAA 3ILVA 1JH9A 1RCUA 1O9HA 1WCCA 4QUBA 1XRJA 3EVEA 4GG7A 4W1QA 1C3XA 3IMEA 1SZMA 4NM5A 1B26A 5HU9A 3GLKA 2QI9F 2WOUA 3DBCA 2ZK7A 2YVUA 4C0LA 3C3BA 3GLIE 3QLVA 5F5LA 2CV1A 3GUUA 3R9XB 2GYYA 4UFPA 3JWHA 4GVAA 2WY2D 1QZTA 4B33A 3ESZA 4H3PA 4CT1A 3HL0A 4MEJA 3T9IA 3F7NA 3E3MA 4XP0A 3BL5A 1W4ZA 3MAJA 1G5QA 2D1RA 4BBAA 1VECA 1WCV1 4XWKA 3RPOA 4PZUA 1V8ZA 1N8TA 1U5AA 3ZWOA 2YWRA 2W6OA 1CG6A 1Z33A 2XRWA 1K6IA 4KVAA 1L7BA 4C0JA 4F78A 3HYNA 4Q1VA 3NYNA 1E69A 3NFRA 4F12A 2XJ9A 1J56A 3OHSX 1UK8A 4TX1A 2F9MA 2J7KA 4BN0A 1J91A 5E6RA 2BR1A 4J8PA 1IXYA 4ZRNA 4FN4A 2EFGA 4LNUB 3RRXA 1Z6GA 3ZN2A 1VMDA 5I9IA 2KBEA 5BOVA 3E5RA 4EMUA 1BRTA 4LSZA 1J1CA 2R2GA 3F1KA 1BQ4A 1IYZA 1XVVA 3QTWA 4YUQA 1OWPA 3H3CA 4UEKA 2NSYA 3LY9A 3HCDA 3W77A 3RVOA 3DJ6A 2VBCA 2IKQA 3CF4A 4BMSA 2FW1A 5CSWA 5CB4F 5CJ2A 2XTJA 4Y73A 1U3VA 3QKLA 1UKIA 1YI1A 3OCJA 3V04A 4RF3A 2OWDA 4RELA 7REQA 1XH4A 4INJA 1P1BA 3HRIA 3NYVA 3JS2A 1G8PA 1TRHA 2BFYA 2HFJA 5IPFA 4JP1A 1IM2A 4FR2A 3L8FA 3FPAA 2GEBA 4LC9A 3DM5A 4GEGA 2X9LA 1I8TA 4JZYA 3HN6A 1J7UA 1ZUIA 2Z5FA 1MABB 1ZRZA 2WIAA 4X2FA 4YBZA 2W37A 3BXZA 3WP1B 2G2IA 3LCOA 1A5TA 3DAHA 4AJ1A 3H6GA 2VJNA 2P2DA 4FTKA 4FQ7A 3MUNA 4BBEA 5HU3A 2HV9A 1URCA 1Z4LA 4KU4A 4AKEA 5C3UA 3AINA 5BN1A 3BMQB 2YCSA 4RTSA 1UDXA 3PIIA 2RDMA 1X70A 5DRBA 4FOCA 4KFTA 1V37A 1Z7GA 5GIPE 3HA3A 3BQNB 3KEMA 3LQKA 2FVXA 2HOQA 3A9TA 3CLSD 1RZRA 4EMBA 4W9RA 3KF4A 3HP7A 1H8FA 4L76A 3AVOA 1ADBA 3L8DA 4QTZA 4KMSA 5CT7A 2GN6A 2BFBB 2J4FA 2BTQB 3VR4D 3AR2A 1KV1A 3IQEA 5DSXA 2HADA 4JX8A 2O19A 2HT6A 2WDZA 3H1PA 4RMNA 4XX0B 4MW4A 4G0YA 4COKA 1WHTA 4BVHA 3RCJA 5A4EA 1UBEA 2A5DA 1PVVA 4XBRA 3R7IA 4XFDA 3FVQA 4GV1A 3GLUA 3GU3A 2AN9A 4HEA6 3I61A 3DAFA 3D2AA 3OT3A 3R01A 4K1LA 5AW1A 3ADKA 2CEAA 1EX9A 2VYND 4R8SA 4ZQEA 3UMXA 1TGYA 2YVKA 3GFQA 3M5PA 3BJEA 4G31A 5DCUA 5H0IA 1JEAA 1G6HA 2F9GA 1IUKA 4MNEB 2HDHA 4R0MA 2IPMA 1C3VA 2HWXA 2O0HA 5EZSA 1GR1A 3VSEA 4Y9UA 2RHJA 1E20A 4QL3A 1BE8A 3T3DA 3RTGA 5A5GA 4RIYA 4DXDA 2IWHA 5CLIA 1USIA 4XCVA 1SXJE 1U3FA 3G0FA 1S4QA 1RQLA 3GA5A 1PX2A 4FXOA 3TAUA 2FK7A 1VHTA 4DLYA 1CSEE 3D9QX 3EXIB 4LF7B 2CCJA 4GM1A 1HO3A 2Y68A 3QBNA 4YP6A 4RPVA 4XA8A 3F3KA 3AI1A 2HUNA 4P36A 5D84A 2NU8B 2X15A 1DIOB 2GCPA 3TAXA 2GQRA 5CNMA 4LDTA 3NRCA 1Q11A 3LBNA 4UEUA 1YH3A 3A4NA 2H4YA 4IAIA 2EF0A 3CUTA 4UYNA 2PSEA 4KSBA 1GRRA 2QONA 2CV0A 2YICA 1OWMA 2ZAYA 3QA0A 1W59A 1XR3A 4HGLA 4D4JA 1X1CA 1KC1A 2J67A 3C8ZA 4MULA 1RFGE 4DLVA 3GU6A 1RPAA 4QLOA 2V65A 3K5WA 4LF8B 3HS3A 1HDIA 3BL8A 4BFTA 1YR2A 2RG5A 5EI5A 2FPOA 2V5QA 1GA4A 5IBCA 3JD4A 2PMWB 2O0LA 4L1KA 1I2AA 3ZZTA 3WO1A 4DMLA 2BEVA 2FPPA 4BFCA 3BD9A 3RGWS 2OV8A 1BCSA 5TPZA 3L77A 3BCSA 2PGDA 5TPWA 3FFBA 2QQ5A 3LHFA 4F1JA 3FDNA 1KK3A 5AMXA 4LYDA 3TJDA 2MWMA 3AONB 1P3DA 5HF6A 1GTRA 3F5XA 1G4UR 3S1AA 4TRNA 3BYUA 1SVMA 3T34A 4O59O 3PXUA 2I80A 2C5EA 4RXTA 4Q9JA 4RA6A 3PR1A 2JH9A 3E70C 4K77A 2PT7A 3SHTA 3JVSA 5AP6A 4MTAA 3TRKA 3D7SA 4AO7A 3K5IA 3DCJA 4HS4A 4I6JA 4XYMA 4J99A 1COWD 1BEEA 1JAXA 1K0FA 2I03A 4MNTA 2A0XA 3UG7A 4FT7A 3D5QA 4YO4A 2NVUA 4IJPA 2P0CA 4KQMA 3CR7A 3BHIA 2ZSFA 4HDRA 4DSNA 5E8UA 1QYWA 2DMRA 1RIIA 3BE4A 2NTNA 1Z37A 3LM5A 3LBYA 4DEDA 3J80A 3QIVA 1TKAA 5LCKA 3P71T 4A1OA 3F2IA 4QULA 3SNHA 4ND3A 2VPYA 1TYEB 5L2TA 3PC8C 3TSYA 1UEJA 2OSBA 4IL5A 1H93A 4YJ3F 5I7RA 3TKLA 3NNUA 3K6SB 5H8WA 3MGBA 1YK1A 4P7BA 3KIPA 2HSWA 1FGKA 4DCMA 3PT5A 5I6DA 3GZJA 3EF0A 4I55A 2OICA 1KVRA 1G1AA 1NRWA 2I7CA 2VHTA 5KTTA 4M53A 3SC2A 4MNFA 4XIGS 3VGPA 3LHSA 3O5AA 4PINA 1Z4QA 1IQ0A 1PXLA 4O2RA 3CP9A 5TEWA 1JSVA 2J59A 1I44A 4M0PA 2UZWE 1XLTA 5K8IA 4DAOA 4RFLA 1LVHA 1CDZA 3GV0A 1JF8A 1SQ0A 1PBNA 1JKLA 1AKWA 3MINA 3BE6A 3W90A 5GV7A 3LX5A 5KB3A 4MYRA 3D6HA 1XMIA 2QZ9A 2PVRA 2JDOA 3V8SA 5AV0A 3FFXA 3OC1A 4R2JA 3QOFA 5T3UA 3HKCB 2ITTA 4MRMA 3TJMA 3TTXA 5E38A 3RD5A 3PQDA 3H83A 2WTIA 2CN1A 2JFNA 1OAAA 1T1GA 4HDMA 3GNIB 4NH1A 2Q8PA 5FNVA 4J6FA 5LJJA 1ZXBA 4B2IA 4URFA 5K3FB 3G2OA 1SXJB 3IAAA 3GCDA 5U1PA 3CW8X 3V8WA 2ZS7A 3TVTA 2CHEA 1H6CA 3CVOA 4XTRA 3TSAA 5BN3B 5BWOA 2DULA 2XRZA 5A04A 2D06A 4E6PA 1F2UB 4XYLA 1FVXA 2WTNA 4EZ7A 3LFHA 1Q22A 3SEZA 4LRJA 3GXLA 2R7MA 2XUAA 4PF1A 1FBNA 4NVRA 4HYYA 2Q5EA 3KCNA 3MJTA 3HVCA 4ZMBA 1WQ4A 3MCVA 4YRIA 4U81A 1B8OA 1W75A 2VP3A 2IP1A 1NVBA 3EGDA 2HO4A 3TVDA 5ILOA 3CTMA 2R4UA 4FJVA 4WZBA 1GILA 2ZRFA 1V11A 4O08A 4I4TB 2OGVA 1DSSG 3RWMB 4EHLA 4NAHA 1AV7A 1SAYA 1DWUA 2JFBA 4RV9A 4NE9A 1MC4A 5CLHA 2CXNA 3ELUA 4B73A 5EUCA 3LX4A 2HF9A 4Q9NA 3ABOB 3C45A 3KWMA 1YS2X 4FZ5A 1Z0KA 4F9TA 3M6WA 3GI1A 2HY81 4HWGA 1PJSA 2UZBA 5K01A 1SNXA 4IRMA 4FSMA 2Y0CA 2BP7A 4I23A 4EG5A 5KVVA 5I9NA 4MWIA 4EHNA 3QU9A 4AIRA 4ZEXA 2VDKB 3LKMA 4FKUA 1CJCA 5JSUA 1Z2OX 3W0NA 4UDNA 2E49A 3STUA 2AR0A 1WXDA 2GKGA 3SYNA 1BUHA 3DB8A 3EEFA 1T1SA 3EVAA 3I5YA 2FUMA 3OQOA 1J5PA 3DWGA 3H9BA 4POOA 2PMOX 3AFMA 4GFMA 5C4KA 5DBOA 4ZK6A 3KULB 4BGHA 4EF4A 4LFBB 1P0MA 2WU3A 3R3UA 2A4MA 4XAQA 4Q9KA 1S2OA 4B34A 1NT2A 3M9XA 3G0EA 5HZHA 4ZWNA 4CL3A 4QJ3A 1R1DA 3U4WA 1K7FB 2WUDA 2GO7A 4LHVA 4YRKA 4UBAA 4AT5A 3WOWA 3KTFA 1T25A 3FY0A 1B3RA 2PS3A 3IW6A 3A8WA 4UXIA 1XVUA 4KFCA 1OAOC 4FT9A 1SBIA 4JI0B 2X4ZA 2ONZA 3TLJA 1CX9B 3PCXA 4AZFA 4R16A 5JECA 4FSWA 1FP7A 2P3LA 3MSCA 1UZLA 1E1VA 3P86A 3E8SA 3UMRA 4FMQA 2PH5A 5CDUA 4HLDA 4FB4A 1GKKA 1R3DA 1R4NB 1Y8RB 1YQ9A 1HDGO 3PDTA 2A2ZA 3R76A 3LA6A 3WLOA 4Q9ZA 4XOYA 3QLVC 5HO7A 4C6RA 2EDAA 2B8TA 4H1VA 2CB0A 3ANTA 5ALYA 1PGNA 2ITNA 2WF7A 1JXMA 1NJ5A 3K9GA 4G23A 1XI2A 3JXWA 1XDSA 3FFWA 1CY4A 3A1WA 3A1SA 2AI2A 2DQ4A 5BMSA 4EJ7A 4HTFB 4OTZA 1P73A 4BNVA 1RJEA 4NCAA 4R81A 3R1SA 3Q8XB 1JLMA 2WMNB 4I94A 5EWLB 3PNSA 2JIUA 4XTCS 1D2NA 2VR1A 2QGZA 5DGDA 4TN5A 1SRQA 3ZTWA 3PUZA 2ZUCA 1KJIA 5M09A 4C9BA 4WLOA 5AV1A 4UKDA 4JBXA 1YFJA 2IP2A 1CR4A 1MJGM 3QZUA 3L05A 2ZRGA 1QGZA 1KMQA 2R8XA 1ZH4A 4A0FA 1NQXA 3VO9A 1W2HA 1A5BB 2R3GA 4XWOA 4QASA 5AP7A 1TYZA 3CNQS 1YTUA 3U4DA 1ZK2A 2I4MA 3G2NA 1M0TA 3KYJB 1CEQA 4HD8A 5KHWA 4AXBA 1IQRA 3B6JA 2O0MA 2P69A 2PUJA 4GRIA 1AA6A 3KREA 3CZAA 3QKKA 1JVNA 2LDBA 2B9VA 2I87A 2M9MA 1V4BA 1GFIA 3Q0EA 1PG0A 4S1OA 1F4VA 3LQ8A 3QWIA 3V8MA 3RSLA 2A1UB 3IUSA 5FA8A 2ZRAA 4UD6A 5CH8A 4KQJA 1WTCA 3CX6A 3M1YA 3KLMX 5KNBA 2R1ZA 1K8ZB 4MUMA 3CTJA 2JGJA 3ORTA 4R1UA 1PLJA 4ZSGA 4EGFA 2WVJA 2OQRA 4I5EA 2HY0A 4EGQA 3IX7A 2OSVA 1TM2A 5IA3A 5ADUS 1UNLA 2PGIA 2XQVA 3G8AA 4JVGA 3SFTA 3N86A 3N74A 2VTRA 4BI0A 3N3BC 5E6UB 4P3KA 1W36D 2J5FA 3F96A 2TYSB 4M6WB 4BBMA 1SCQA 1CRPA 3O1JC 3K3PA 1IPHA 1BX3A 1L7QA 2C5GA 1I36A 3OWJA 3W8FA 2YJRA 5I7FA 4IRUB 2K7ZA 5LARA 2ZQ5A 4WH0A 4KHPB 4WT6A 3A1UA 3ETCA 1QYCA 4F6LA 1MQ9A 4AY5A 4CTCA 5KBQA 2X81A 3AT1A 4EUFA 2BRUA 4IUYA 3V4PB 1Q83A 4BVJA 4OHPA 3ER9A 3O17A 1Y91A 2RJNA 4TXMA 3IAEA 4PAOA 2WZBA 1HNXB 3AESB 4JT2A 3LSTA 5IU6A 2V7TA 3V3KA 5FEEA 1X7GA 1PVOA 3KL2A 3TR5A 1WKCA 3DBFA 1E92A 3NUUA 1IUPA 1OH7A 1WB5A 2TECE 3R2YA 3G9UA 3FCYA 4V24A 1XTJA 2DFVA 2QAJA 5EQEA 3VO2A 5KMKA 2EG9A 4ZYWA 2FW9A 3Q7RA 4EYKA 1P7VA 3PSDA 1JE1A 1ZCAA 3RSHA 2QQ7A 2A4KA 4ESVA 3QYAA 4EK8A 3EY9A 3M7IA 4RKFA 4AW5A 1PIWA 1NPTO 3U9TA 3QXXA 5H8EA 4W5JA 2GF0A 1MFPA 4O0MA 3AIOA 2BGRA 1KMIY 3VRHA 4J6EA 1NA7A 3E27A 3MA3A 4U2FA 2Z6UA