1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
b'KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrillarin-like pre-rRNA processing protein
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
4UZHA 2EG5A 3NUYA 3FMEA 3NW7A 3O96A 4I94A 4P58A 3V97A 4KIQA 3FZGA 2C3JA 1XDSA 4TPTA 1KOAA 5DSTA 2KULA 4TZRA 5E92A 4I6QA 1VE3A 4QP6A 4H05A 5AUUA 5GHVA 3ELWA 5LQFA 4NTSA 1RI2A 2VN9A 1Y8CA 2Z6QA 3ZBXA 2AN4A 4OT5A 3RW9A 3C0KA 2IH4A 1H24A 2WU7A 3LCSA 3DQWA 2C5YA 2BRGA 2OO3A 1NW6A 1NV9A 4ZLOA 4GJ2A 5KMMA 4I1ZA 3GCSA 5AP0A 4GKIA 5FXSA 2C6TA 10MHA 4EZ3A 3R8MA 2JFMA 3G9LX 1WBNA 2ZV9A 5DTRA 4FR0A 4YJSA 4FV7A 4ZTQA 2EX4A 1O9HA 4FZAB 3R28A 4AW0A 4OBWA 5DTQA 3LHJA 3VF8A 2ITXA 5F2KA 1ZGJA 4YPDA 5DH3A 4EK3A 1BYGA 3ETAA 5K0FA 4JBOA 1ZXEA 5JGDA 1UKIA 2C30A 2QO2A 3DB8A 4DLIA 3VS1A 3K54A 3QD3A 4AA0A 3QZGA 5HE2A 1CM8A 3G2QA 5CXZA 3C0HA 3FYKX 4NM5A 2W1CA 2VZ6A 4QMLA 2UW9A 3OUKA 4PTGA 1AQIA 5JZJA 2WMWA 4DFUA 4FZ6A 4CXMA 5HIIA 4AOJA 5DT4A 3T0IA 3V8VA 5IQEA 4ZSEA 4BDGA 5AP5A 3BGDA 4RC4A 2O07A 2ZM4A 2UYCA 4PYMA 3LKMA 3TWJA 3CTJA 1YWVA 4QVGA 4AUKA 3UJAA 5EQYA 3VW6A 4DHFA 3U4WA 3LL7A 3EL8A 2PMLX 3UIBA 4AN3A 3CKWA 1L3CA 3GRRA 1Y6BA 2BILB 3I79A 3VHKA 4U9AA 3Q6WA 2P8JA 3KR2A 3QAME 3QALE 4LL0A 2HY81 4RWIA 3BXOA 4KDRA 3QYWA 3PP1A 1TKIA 3W2PA 1QAMA 5CSVA 4JX3A 5LR6A 3KU2A 4EH6A 4C62A 3G88A 1ZHFA 5CTPA 1KP9A 5AP3A 5LQNA 3SV0A 2JBOA 3FSKA 1V0BA 2GCDA 2B54A 2XM8A 2JKOA 2BRMA 4GBED 4ANLA 4PDPA 3VVHA 4EH8A 4JLCA 5FULA 3N51A 3HMNA 4GYIA 4IHPA 5AFVA 3QFVA 3ZTXA 3SXJA 4BC6A 1J7IA 4RIYB 2IVTA 1ZY4A 4CFFA 3VBYA 4KS8A 3Q3BA 3GCQA 5DM2A 4MQ1A 4ZY4A 4BHZA 4P5QA 4RQVA 3A99A 1E1XA 4FC0A 3HV7A 3VC4A 3P5KA 4D0WA 3CSVA 3PSCA 5IMXA 2PT6A 3E7PA 4CFVA 3R73A 4UZDA 1H28A 2RFEA 1Y8YA 3FPMA 1FVVA 1OL7A 3OXTA 4FGBA 3LCOA 2XEYA 5DR9A 3RPYA 3KQPA 1ZWSA 2PWLA 3ALOA 4LOOA 5IQIA 4IFGA 4NM0A 1WXWA 1L3IA 3CY2A 3UPZA 2BZGA 2V7EA 3AMYA 3HVJA 4L3LA 2OZAA 2P35A 3PVGA 2AOWA 4U79A 4A9TA 3HDMA 3QOXA 4V0RA 4UEUA 2VDVE 5J9YA 2UVXA 4F0GA 3ORXA 4RWKA 3VS4A 2R3RA 3NDIA 3OW3A 2OW3A 5M08A 2WMXA 3QCSA 4MYGA 4YLJA 5DXAA 3TZ8A 3F2RA 2YXLA 2V62A 2OF2A 1MRVA 4FSQA 4CT1A 5A9UA 2WA2A 2XIKA 1M2QA 4IWNA 3PDTA 4GOND 3MA6A 3QX4A 5AAFA 1G38A 3DJ5A 3ME5A 3DDQA 4BCIA 2QHMA 2DULA 2CJMA 5KMIA 5IZFA 3W32A 3ANXA 1T46A 1YXVA 4KA3A 4F63A 1JG1A 3NWWA 3W18A 3D4QA 3WE8A 4FV2A 4Z16A 3OC1A 4DCEA 4DN5A 5EOLA 1NW7A 5CVUA 3FZPA 4FKJA 4JRVA 4G6OA 5KQSA 3V5JA 2QOKA 4NCTC 4Q5EA 4FKOA 4ARKA 1TQPA 2JHPA 1NKVA 5CQUA 1XH6A 2XK7A 3FTDA 4R7HA 3BZ3A 4XG4A 4FKWA 2JG3A 2Y1XA 4U7TB 5CU4A 4FS8A 1VP9A 4D58A 5FHQA 4WO5A 2PZ5A 4DFBA 3R30A 1VEBA 2NRYA 2PVJA 4TYEA 3KHKA 2HZ4A 4E32A 1VYZA 3EQRA 1VZOA 3LSTA 3QOWA 5IEXA 1JG4A 3A7HA 3KMWA 4QMWA 4NCTA 4KBCA 4RTQA 5U4XA 3POZA 3ATTA 3WF7A 3R71A 4IB1A 1M14A 3VS3A 4IB5A 2PX8A 3AWIA 2O65A 3WIGA 1ZZLA 1FP1D 5E91A 3NYVA 4HGLA 4AAAA 2W1IA 3F69A 3GEQA 2B9IA 4H58A 2YIWA 4RA5A 3E7VA 3KXHA 3P7BA 3MPMA 2ZM1A 1Y8GA 1FP2A 3PVCA 4HCTA 3VS2A 4RVKA 3PJ2A 4FSRA 2BDJA 5EMMA 3LVPA 2J5FA 4CTKA 4FEUA 3AC8A 3FC1X 2R5TA 5C4KA 3DH0A 3G6HA 1VLMA 5LVMA 2YISA 2O57A 3EFKA 4ZMEA 2G1TA 1Z57A 3RCJA 3GQLA 4DAWA 1JG2A 3EL7A 2O5KA 5JKGA 3RWQA 3NAXA 2JHAA 4OTRA 2HAKA 2Q83A 5A14A 3UVQA 3RHXA 2LGCA 4UN0C 4PDSA 2XBJA 2PZYA 2VX1A 5K09A 3NW9A 4Y5HA 3FLWA 3NRMA 3E8DA 3T9IA 5A4LA 5EPEA 4FKIA 2A0CX 3RK5A 4NW5A 4FX3A 4NWMA 3D14A 3PJ3A 2G2IA 4GF5A 3WYXA 1H07A 3ERKA 4C4IA 3T8OA 3FL5A 3U6IA 3WARA 3OZRA 2QR7A 3NUNA 5JUWA 1UWVA 4BR3A 4FG8A 4MBJA 1BX6A 3TTIA 4ER6A 3NPCA 3TKHA 4DZRA 3MY5A 2XK4A 2F4JA 2RFNA 4EBVA 3RM7A 2W4OA 1VR2A 4JBPA 4B8LA 3NJRA 2PXXA 2JBPA 4M37A 4EOQA 4HVDA 5FGKA 3SW7A 3ZO4A 5KYGA 1O54A 5E9JA 3QRIA 3DP7A 4D4VA 1JSTA 4PIMA 1WBOA 4GG5A 5I9XA 3MH0A 4N70A 4ZIMA 3EB0A 4Z2YA 4I24A 3HRCA 3R21A 1XH7A 2GHGA 3OZ6A 4V0QA 3R7UA 1R18A 4EK8A 2OXTA 4HTFA 1LEWA 4XP0A 4PWNA 3E93A 5HEZA 3LHDA 2W1HA 1Q8WA 5CEPA 3IOKA 2VTQA 3F66A 2YHVA 2DS1A 5CEOA 5M44A 4E73A 2FH9A 3D5XA 4PNIA 2ZZNA 4KSQA 3OT3A 3G5TA 5JRSA 2QURA 1WFCA 4OBOA 5I9ZA 1FVTA 5EHGA 2IBSA 1YI3A 4AGCA 5FUBA 4DG2E 4YZNA 3KGAA 2WTCA 3MGGA 3A7DA 3UQGA 2QOFA 2BRNA 4WG5A 5JK3A 3PIYA 2ITPA 4QMTA 1QL6A 2HMYB 3ODYX 3MH2A 3MVLA 2ERZE 1INLA 4E4LA 3DXQA 3MYGA 3H0YA 5HI2A 1NVSA 3ZXTA 3DXXA 4M69B 3IHTA 2C3LA 3VUIA 2QVSE 4FNYA 4QT1A 2I6LA 1Z5MA 4XV2A 2IP2A 3KQOA 3GRYA 4ENXA 1IM8A 3M6UA 4RFYA 2PE2A 5DXJA 5FQOA 3EQHA 5LQJA 2QOOA 2HTEA 5CVFA 5K03A 5ICGA 2GPHA 4F1MA 3Q87B 1YHSA 2P55A 5ANGA 5HU9A 4YC8A 4YNEA 3G7UA 3QUEA 4H36A 5CALA 3S00A 5CCBA 4XG7A 3HV3A 1U59A 2ERKA 4J98A 4JR7A 3HZTA 4PMSA 1QYRA 5F1ZA 1SUSA 3MBLA 4V0GA 4GIIA 3MB7A 4FZVA 4IX5A 1ZYCA 5IQHA 4R8RA 4EH7A 5CF8A 3Q52A 3AJDA 3TRKA 2PT9A 1QPDA 2GTMA 1H1QA 3ZM4A 2JKMA 3TL8A 4RX5A 4E5BA 3SSOA 3GFWA 2QNJA 3JXWA 5AAEA 3ZUTA 2QE6A 3TLJA 2XCHA 4BDBA 1H1WA 1OL5A 5LARA 5C8KA 5KS2A 3JVRA 4FK6A 4FGZA 3BQRA 4YUYA 4QMNA 3JY0A 4MWHA 5H9BA 3A4TA 3FZSA 3ZSHA 2VO3A 2OZOA 5IA3A 4D0XA 2IGTA 4AGDA 4EK9A 1L1EA 3FUVA 2PXCA 4MQ2A 3UG1A 3O31A 3C51A 3O7WA 3KMUA 1M7QA 5KMNA 4PONA 2WOUA 4CKIA 5GIOE 4M38A 1Z3CA 1M17A 3OFKA 5CUQA 5DRTA 2HZNA 4ALWA 1XVAA 3GP0A 3GU3A 3I0OA 3FXXA 3GC7A 2WEIA 2R9SA 1X1CA 2ZIGA 2XBAA 4XRLA 2X2LA 2YQZA 5ANIA 3GT8A 4J96A 4ZLZA 4GK4A 4TNDA 5KZIA 4U3YA 5DSXA 5EHLA 3OU6A 5ETFA 5EGSA 3LOKA 2ITOA 3HTXA 2HIWA 2QLQA 3SX0A 1KYWA 1OITA 3CTHA 3T7RA 4YUZA 3KPWA 3G2MA 1IAHA 4ZJIA 2P3GX 2A19B 5FLFA 2NP6A 2UZWE 4GU6A 3UIMA 5EM5A 4KINA 4J95A 2CKQA 3SOAA 1YKRA 5B2MA 3DDPA 1VL5A 4D9UA 4TL0A 3NX8A 3U54A 2VUWA 2FHPA 3AXTA 4G34A 2B78A 3MIYA 3VUDA 3ZU7A 2FA2A 3MWUA 5FQNA 2CDZA 1P4OA 3ODZX 1WZYA 5FA5A 3UNZA 1Q41A 3DS6A 3DK3A 3H10A 4EH4A 5KHWA 2XCKA 4KRDA 4AXAA 1ZOHA 1CSNA 5DE2A 5T3QA 2YWPA 4OA5A 3QKKA 4G5PA 4F09A 5E90A 3VBVA 3OCTA 1SUIA 3A4OX 3MVJA 2F2UA 2O0LA 4RA4A 2ONLA 2YIXA 3BV3A 2YACA 3I5ZA 4AT4A 3HV5A 4RJ4A 3BYOA 4XG6A 1R3CA 4XV9A 3FBVA 4MH7A 4N0SA 4FUYA 5EW8A 4XHKB 4ZK5A 3MN3A 3EFLA 3CJQA 4WA9A 4M3QA 1IASA 2YX1A 3Q9ZA 3KQSA 5E2BA 3NGAA 2A14A 3D5UA 5FTGA 3EKNA 4EH9A 3P9NA 3KPYA 3P2KA 1P39A 2VWUA 3PXZA 5JQ5A 4A06A 4R1VA 4JS8A 1DL5A 4GUEA 4GC5A 3TMAA 1KR5A 3U8WA 2QY6A 3LFSA 1RI4A 4QMPA 2FK8A 3ORTA 3UBTA 3ZXZA 4AFEA 3THRA 2W1EA 1KE5A 5EYMA 4EKLA 3KULA 3W16A 3VBTA 5CVHA 2WQEA 5JSMA 5IQBA 1KPGA 1H27A 2JEDA 4QP4A 1JSUA 2OXYA 3FE3A 4OTGA 4AS0A 2YTZA 4KWPA 1WBWA 3TUCA 3MAGA 4ANMA 4ZP5A 5JGBA 4A4OA 2OIBA 1I44A 3UJ8A 5A6OA 3BU6A 4K8AA 4EK4A 2HWOA 3ROYA 2NYUA 4F4PA 2XK3A 4K2RA 4F7JA 4PYKA 4EOMA 1H25A 3G15A 1B39A 4CFUA 2UW8A 3QC4A 5HEKA 4D4YA 3BLQA 4D1ZA 4ZJVA 2AN3A 4EH5A 4H1JA 3VSEA 3V6SA 3ULZA 4O7YA 2VTIA 4FIGA 4QVKA 3FWQA 3PTGA 2PZPA 2X2MA 5HBEA 2OH4A 4BRXA 5A4QA 4I22A 4V04A 3P79A 3LQ5A 3V8SA 2BALA 4FV9A 4ZTLA 5ANJA 3TN8A 3KN6A 4MD8E 3B8RA 3QRKA 4IWQA 1JKTA 5A54A 2JDSA 2OJGA 2XIXA 3G33A 4OGRA 4BCOA 4YMJA 1DS5A 3GCUA 4EZ5A 4XG2A 1NBIA 2CN8A 3DTNA 3UNKA 3S3IA 2YIQA 4PQNA 1NW5A 2R0IA 4GVAA 4IWOA 3PJ1A 3DK7A 1JTEA 3E92A 4YJTA 3CS9A 3UOJA 3AD5A 4HVGA 5DIAA 3GBZA 3E23A 3BGIA 2W4JA 1J1CA 2Z7RA 2ZFUA 3DOUA 4HGEA 3OVVA 4C61A 4OTHA 4U8ZA 3TT0A 4UYNA 4QYFA 5HQ0A 2OBJA 3W2CA 4E8AA 2C6EA 3FPJA 3AMAA 2RL5A 4A9UA 5JFWA 5CXHA 4AQCA 4IC7A 5LQRA 4E4NA 5P8WA 3LMGA 4E7WA 3OTVA 3KB7A 4B8MA 2R0UA 5FXQA 3R0TA 3REOA 2UYHA 1R00A 5HIBA 1XDZA 4JDJA 2BAKA 5BP7A 3QKMA 4EUTA 4PL4A 1P91A 3EYHA 5HZNA 3EQFA 2GNGA 3BYMA 4DCGA 3O51A 4F86A 4E5WA 5FTOA 3A27A 4MAOA 2H1RA 4ZZOA 4KW7A 3R24A 3KR9A 5KKRB 4IW0A 3DAKA 4B17A 3JUHA 3OG7A 3ROCA 1H1DA 3R8PA 2P7HA 2N47A 4RJ5A 3UO4A 1KE8A 3FMDA 4G9RA 4MVFA 4JQEA 2R3HA 4MTLA 2BFXA 3GOPA 5CAPA 3LBFA 4AW2A 4X2GA 2VWXA 3SDJA 2GA9A 3OF0A 5JFSA 1N2XA 5FWAA 4FT3A 4EOIA 4DF3A 3NW6A 3H30A 4EORA 4F84A 2R3JA 3E87A 5AP1A 2R3IA 4C37A 3E8SA 2VV9A 4RV9A 4F0FA 5AEPA 3L8XA 4I93A 4M7RA 2PUNA 2VD5A 3TNQB 3ANRA 5IH6A 3PZEA 3OBJA 4I23A 4TKSA 5LCJA 4RTKA 2PL0A 1YRPA 4DH1A 1XKKA 3SXSA 3C5UA 4CKRA 5KE0A 1YOMA 2PULA 1UKHA 4RTNA 1RJBA 4O7NA 4DFNA 4EKGA 2XBMA 4FSXA 4JXJA 4U41A 5FEEA 5A4EA 4GL9A 4XLIA 5DN3A 4HYIA 2JITA 2VTAA 1G60A 5H02A 2WEVA 1SVUA 3KKZA 5IISA 4Z7GA 2Y9QA 2OYRA 4PIPA 4OX9Y 3LQ8A 1PYXA 4FTLA 3DTCA 4C3RA 4PNEA 2UUEA 3EVDA 3AOXA 1KV2A 2W9FB 5EI2A 2ETMA 4L3PA 2X2KA 4E6QA 4FSMA 2WMQA 3R7EA 2W5HA 4E4MA 2WQBA 2UW3A 4FTNA 3KQTA 3E3BX 5CY3A 3LBYA 4I5PA 5EH0A 2I0EA 2BTRA 4ASXA 5J5SA 4W4YA 5KO1A 3C4FA 4BI2A 3G2FA 3JWJA 4X2FA 4FT2A 3OP5A 3IONA 3E62A 1JQ3A 2UZEA 4U7ZA 3LJ0A 2R64A 5HIMA 2QRVB 2VWIA 2YCFA 3QQJA 4G3DA 3DXYA 3LFQA 1JLUE 3KL8A 4RBLA 4CFWA 5K9IA 1IR3A 1CTPE 4BZOA 3SSMA 3LCTA 3C4CA 1TW3A 3FMHA 2OFVA 4DGGA 3P23A 4YC3A 3HVIA 1NW8A 3WF9A 3KF7A 2C5NA 2OG8A 3UJ9A 5ANOA 1KE6A 4GK2A 5CU0A 4RJ3A 4O0UA 3TQSA 4UWBA 3UJGA 3JPVA 1KPIA 3KU1A 2CLXA 4UX9A 4Z9LA 4I0SA 5ICEA 3VAPA 4X1OA 3AGMA 1V0PA 4NU1A 3KRWA 3I5NA 4TYHA 5AP2A 3POOA 3BRBA 3I6WA 4ER7A 4ACDA 4DH3A 4OBXA 2UZTA 3KXXA 4ERWA 1KE9A 5FTWA 5L2TA 4L53A 3W2RA 4C04A 3Q32A 1W98A 2WGJA 2YIYA 4DTAA 3ZO1A 4YLKA 2GTNA 4DGNA 5DEWA 4LWPA 5TT7A 1UWJA 2AZTA 4XP3A 2WIHA 4YHTA 4WIHA 2WQOA 3LQ3A 4C0TA 4LV8A 2BRBA 3EZRA 4O21A 3FYJX 4E30A 1YDTE 1YZ3A 3GU5A 1WZNA 5E9QA 2GS9A 5C01A 4X2JA 5AUYA 1M0EA 2P3LA 2CMHA 3CR0A 4HYSA 1RE8A 1KXZA 2P2IA 2XIYA 5B0XA 4YHJA 5H3QA 3VJOA 1XCJA 4ISCA 4IX4A 2GFCA 5HBJA 5M09A 3RAWA 2HW6A 3D2KA 4WRGA 3RNIA 3QUDA 3L9LA 4WG4A 3GRVA 1PXLA 3DZOA 4EMSA 4EONA 5GIPE 2C1BA 3AY0A 2GDOA 3DLSA 3LM5A 5D7VA 2LAVA 5AA9A 4O0SA 4LYNA 2BDWA 3VF9A 4IX3A 1GZKA 5MHTA 4A07A 5E8ZA 5EKUA 3GU6A 4RFMA 4IAFA 4XNEA 5TKDA 4W4WA 3QTQA 1RI3A 3HECA 5FRIA 3NDMA 1W83A 2IBTA 2W05A 2XNBA 4GKHA 3BE2A 4AN9A 4C05A 3NYNA 3EMGA 5EVJA 3CJRA 3RHKA 2PSSA 5EW3A 2NXNA 2QODA 2E9OA 2ZJWA 3ZEWA 2CCHA 2PVRA 4D9TA 3A7GA 4KUJA 2P3QA 3FEGA 2VTHA 4EK5A 2FVDA 4JQ8A 3FI4A 4FICA 2QOQA 1FMOE 2O64A 4QP1A 2HR1A 3R63A 5EOVA 4WXHA 4OQDA 5ANEA 2CGXA 5IMEA 1BL6A 4HTFB 2X7GA 1XBBA 4B4LA 5CI6A 3GXOA 3OCJA 3HVKA 1ZY5A 5J9LA 5HG8A 1FINA 5HE1A 3MERA 2IH2A 1SVEA 1J3HA 4CKBA 3O71A 4DM3A 1O6KA 3MH1A 5EDRA 3DXNA 4MXOA 5BMSA 1OM1A 4TXCA 3QTZA 2UZ4A 4K18A 3BZBA 5EM7A 5L8KA 2VDUE 3FZRA 3RPSA 1YI4A 1OPKA 2PMOX 4MXXA 4YMHA 5K8VA 2XH5A 4YJPA 2QI8A 3ATSA 2VTSA 2W7XA 4NKSA 3Q4UA 2CNUA 4HC4A 4IQ6A 3S2PA 5DPMA 4EZ7A 2IIPA 1WVYA 4ID7A 4MHTA 4MEDA 5DRBA 5IH4A 4ITIA 4D1SA 4C08A 4JDIA 4GFOA 3NUAA 3S1HA 1YVJA 5DFPA 1PRYA 1H8FA 3UGCA 4RPVA 4JBVA 4BLWA 1OECA 2RG6A 2ETRA 5M55A 3GCPA 3P86A 3HMOA 3VQHA 4IB0A 5ITAA 8MHTA 2GNIA 4QQ5A 4ER3A 3NUSA 4TYJA 5EKNA 4ZTNA 2YAKA 5HIJA 4RJ8A 4YUXA 2WB8A 3NNXA 4DLJA 2I9KA 4DTBA 3CEKA 3OOMA 4IH8A 4V0GB 4R5YA 3B3JA 3EVAA 4C4AA 4HGYA 2EUFB 2OO8X 1G5SA 5FBOA 4NH1A 2I40A 1VPTA 4ZMFA 4PP7A 1X19A 3QTRA 3IYLW 5LCKA 1R74A 5E1MA 3WZKA 2VNWA 4L6QA 4N4SA 3C9WA 4UV0A 5BMMA 1FVRA 5KVAA 5IA1A 1XBAA 2B52A 4LOPA 2H34A 4FTOA 5M56A 4LRMA 4XG3A 2XK6A 3NVKI 4EWHA 4CZTA 3VBQA 4YTHA 3BU5A 5LVOA 5IDNA 1RJEA 4RGJA 5LMBA 2J2IB 5FDXA 2CKDA 3M1SA 5JMSA 3UVPA 4C07A 4LRJA 5J9ZA 4EHGA 3AC4A 2A2AA 3WZUA 2NRUA 2PSQA 3V5TA 3R9XB 3HEGA 4KKHA 2FSLX 4AOIA 2QG7A 3CCFA 4OUCA 1M6YA 3IDBA 3TIYA 3RPOA 5M4FA 4KBKA 4RX9A 4MCVA 4BLVA 4ERKA 3FLZA 4CNHA 1X1AA 4EUUA 3K3JA 4Y8DA 2DPMA 5EYDA 2Z7LA 4E93A 3C1XA 5HIKA 4IADA 2I7CA 1Q0TA 1OGUA 3ZC5A 4C35A 2PHKA 3FLYA 3SG8A 1L3RE 4KKEA 3HAMA 5E1OA 4A4LA 3BWFA 3CKXA 4JBQA 2OB2A 5D7AA 3VBXA 1JQEA 3SSNA 1REJA 2E9PA 4RIXB 3W1FA 1PXKA 1PW2A 3WF5A 2PE0A 3QV2A 5H8GA 3SGCA 4BCKA 3FKNA 4X21A 4FA2A 5AX3A 5KMJA 4TRLA 3SMQA 4DA4A 3GXLA 2IFTA 4FVRA 3A7JA 1JPAA 1FGKA 5JFVA 4ER5A 3MA3A 1A9UA 5B2KA 4X3FA 1H00A 4CKJA 3LJ2A 3OW4A 2F7EE 2YJSA 3R1NA 4F9YA 4GT5A 4IANA 4FTRA 3QF9A 3H2BA 2Q0BA 4PMPA 5HG5A 2JJQA 5ETCA 5KMOA 7MHTA 3UZRA 2UW0A 4YV1A 4RJ7A 2VGPA 4Y2HA 2F2CB 1YWNA 1RJFA 3FY0A 4IDTA 4GEKA 4XOYA 1YDRE 4ACMA 2CN5A 4D28A 3AC1A 5HIDA 4GIHA 4HJOA 2R3QA 3MVHA 4FV1A 3H4JA 3NR9A 3FPFA 4R6VA 3EVBA 1PY5A 5G6VA 4CMTA 2CSNA 4QQNA 5EEGA 2BTSA 4ALVA 4MD9E 3COIA 1FOTA 3ER8A 3HUCA 2FRXA 2VTRA 1EIZA 4V01A 2C47A 3LPBA 4FODA 3H9FA 4AX8A 2C0IA 3SX9A 3KXZA 3V04A 4P5ZA 1EH4A 4OBQA 4YC6A 5KBRA 2KTYA 3SRVB 1KUTA 1ZZ2A 4FT9A 4RC2A 2UYOA 3AC2A 4U7PB 2XJ1A 2ITWA 1O6LA 3DY7A 2UVZA 3IECA 2Z60A 3ITZA 1Q3WA 3LPMA 5DOSA 3FMMA 3I0QA 4NFMA 3VUGA 3KULB 1ZRZA 2X9EA 3WZDA 2J51A 2QKRA 4RTRA 2PY3A 5K0CA 2ZB1A 3R9RA 4DGLC 3S4QA 4BI1A 2F57A 4FV0A 1YHWA 3GCVA 2AOUA 4FVPA 2AOTB 3FC2A 3LFFA 3QZHA 1PJZA 3U4UA 5EIFA 4MD7E 4GUAA 5EHOA 2QOCA 4GH2A 5CEIA 4AF3A 3CD8A 5CD1A 3PYYA 5FM3A 1XJ5A 2RFSA 3B3GA 2CLQA 3IW6A 3BBWA 4FEWA 2WZJA 5F9EA 3VW8A 2V7AA 5H8BA 1RDQE 4Q2AA 3V8WA 2PV0A 4OW8A 3QD2B 3Q9WA 1GIJA 3U87A 5I5ZA 3NNUA 4PYNA 2FSTX 4F9AA 4WNKA 3IGGA 2I7QA 2P41A 5BVOA 4FTMA 3QRJA 3MQ2A 1ZYDA 4K1BA 5E2AA 3ZUVA 3OPNA 2PGXA 1F5QA 4DTKA 2DYLA 3FZ1A 3BPRA 1RI5A 2OKRA 2VTOA 2PVNA 5E1EA 3DUWA 5HLNA 4C4EA 2Z6AA 2A27A 3P0MA 3BHTA 5K5NA 2J0JA 2PE1A 1UA2A 5DWQA 4DC2A 4DFZE 3KFAA 5IG1A 3R02A 3DXZA 4JJRA 2QCSA 3TNWA 5M07A 1PMEA 4CFXA 2X9FA 2NXEA 1CDKA 3MB6A 4O0TA 2BVAA 2X4FA 2R3KA 4KABA 1SG9A 3TUDA 3OCGA 3QTWA 4PDOA 2IZRA 5FP5A 5HVYA 2WOTA 3RPVA 1FPUA 4CD0A 5T68A 2PLWA 4J8NA 4BBEA 3AXWA 1LR4A 2ITYA 2REIA 4QMSA 4P7FA 2YA9A 5ICPA 1HMYA 4KIOA 4RJ6A 5CI7A 4ZSLA 4PDYA 4PYLA 3FI2A 5CM2Z 3GC8A 3BWMA 3TZMA 1WBSA 5M4IA 5CVGA 4PL3A 2RIOA 2WMVA 3QA8A 4AT5A 2ZM3A 2WXVA 3EPPA 5DR2A 3NLBA 4FR4A 3G8AA 2ESRA 5E8UA 3PA3A 4II5A 3AT4A 4C03A 1GIHA 4FT4A 4X6RA 5EG5A 2P40A 4FGRA 3VS0A 4EQUA 4MHAA 3ZRMA 3LFCA 3CCNA 4IBMA 4K33A 5ACBC 3ZBFA 3QXPA 5BVDA 4E6AA 3DLZA 4E6CA 4MXAA 5TOZA 3VN9A 3E5AA 3B3FA 4RSRA 3PFQA 3KPVA 3NTVA 5CVVA 3RTPA 4FKQA 1H08A 4E26A 5LVLA 5BW5A 5FG8A 3EQIA 4D4SA 2C7OA 5DT0A 2OWBA 1TW2A 2I0HA 1P1BA 1YXUA 5AA8A 4L52A 4FI1A 2XJ0A 3QKLA 4RVTA 5AP4A 4O0YA 3R7YA 1A48A 3K6RA 4G6NA 5IQCA 4S30A 3COHA 4KD1A 3CC8A 3ZSGA 3FMKA 3ZZWA 4DBNA 1STCE 2BFYA 4DQ0A 4QMYA 4H3BA 3FMNA 3RAHA 1OB3A 1WBPA 1PXPA 1LEZA 3A8XA 2XJ2A 4E33A 4QYGA 3G2PA 4I5CA 3UJCA 1OPJA 1DI8A 1B38A 1JWHA 4A7CA 5KHXA 3OU7A 5H8EA 3DTWA 5LWMA 3BGZA 1L3BA 3TKYA 2WHBA 3BT7A 2R4BA 2OXDA 4YZDA 3O0GA 1QANA 3BGVA 3BHHA 4DA5A 4TWOA 4BCNA 4DYMA 4GEOA 3DA6A 2UZUE 2C69A 2ZMCA 4D4RA 4CEGA 5IH5A 5DLSA 3P08A 5HESA 3DBQA 3V8TA 3Q04A 3EVEA 4L46A 2B9HA 3VC2A 2GNHA 2OPBA 3KQVA 4UWYA 3UTOA 3OOGA 5JR3A 2VO0A 4ZSAA 2EU9A 4HZRA 5EDPA 3O7LD 2X8DA 4JVGA 4M0ZA 5DX8A 4W8DA 3ZUUA 2YWVA 2GAFA 1APME 3UVRA 4BZDA 4NL0A 3KXNA 5IA4A 2UZLA 2X81A 3TZ9A 1JKSA 5K0JA 2WK1A 3LKDA 2XKDA 1DUSA 4C4FA 4NK9A 2AC5A 3EMBA 4FTUA 5D12A 4XG9A 4IEBA 3I9FA 2NP8A 4RIYA 4A9YA 2QYOA 4AU8A 3FY2A 3WOWA 4YV2A 3GUBA 4QDJA 3GB2A 1JAMA 2VS1A 4U81A 3R6TA 4C4GA 4EHVA 4J97A 5IPJA 3UMXA 3E88A 4QMVA 3UO5A 2Y0AA 2ZZMA 4XCXA 4C2VA 5L2WA 2J6MA 4QO9A 4TWPA 3JYAA 3HA8A 4U5JA 5AUWA 3F3ZA 2QD9A 4O0RA 1AD5A 2W06A 5ANKA 4ZTHA 1QZZA 2YFXA 4YTCA 3MSSA 3NCGA 5CLPA 4Y5QA 1XWSA 3MH3A 4PX6A 2BMCA 4LFIA 3FTCA 3ZLSA 5CSHA 4LUDA 3F9NA 4LG4A 5CS6A 2ONYA 3LX6A 4YBKA 2OF4A 3CD3A 1R8YA 5KX8A 4HVHA 5EKOA 2JAVA 1ATPE 4ZY6A 2R2PA 5K3YA 5CVEA 5FEQA 2W1FA 5E9EA 5HD7A 3CGGA 1DCTA 4AZWA 4M97A 5J7HA 2XA4A 3L9PA 4I4EA 4TYHB 4NM7A 3MY0A 3TNPC 2C6KA 4Z7HA 4BKJA 3PSBA 3PRIA 4X60A 4P7KA 3W8QA 4DCAA 2J50A 2WTIA 3TV4A 3D0EA 3PXYA 2OK1A 4QYYA 4EC8A 4YNOA 2OFUA 3P9KA 3F61A 2ZWAA 3MJ2A 2W1GA 4L8MA 3GIWA 1O9GA 5GM1A 3WZEA 3KVWA 5DX0A 2G70A 2QU5A 4FOCA 4JXFA 2GS7A 4XEYA 4C06A 3MCZA 2BZHB 1OUKA 3RINA 4IV8A 4QP3A 3C3PA 4WSYA 3SG9A 2G71A 5C27A 3UOKA 4XX9A 4DCMA 3G90X 4JI9A 4MX9A 3QQLA 3EN6A 4CLJA 2B0QA 2IW8A 3FI3A 4HZSA 3DLCA 3L9NA 4XUCA 1EJ0A 1KHHA 3N4UA 4M12A 5EI6A 4FEVA 3HVHA 3BCEA 2ERCA 4PUZA 3NMUF 3RIEA 4IM3A 3VHEA 3UPXA 3D5WA 3CGOA 3UIXA 4BB4A 3OY1A 3W10A 4MXYA 2O63A 4AN2A 4WUAA 2AS0A 2YAAA 4L7VA 4P7GA 1U2ZA 1OKZA 4ITJA 3NWEA 4O7SA 2NXCA 3ZO2A 4BDHA 4P7EA 3KY2A 3ZOSA 4RWZA 2OICA 3C4ZA 5CT7A 1EJ6A 3HCAA 3KPJA 3MPTA 4BIBA 3Q4ZA 3EGEA 2JDVA 4S33A 3PX3A 4GMYA 3DCVA 3EJ1A 5EYKA 5L6OA 4EL9A 3RP9A 4L7SA 2AR0A 3HA3A 5BUEA 2Y7JA 4BCQA 4AACA 3EEOA 5HX6A 5EQJB 3BWCA 4EQZA 1OIRA 5IA5A 3LE6A 2PJDA 5DG5A 2BUJA 3FQEA 4FP9A 2E5WA 2Q0NA 3MI9A 4DH7A 5CAOA 1Q4LA 2Z2WA 4EHZA 3M6VA 5KQRA 2V55A 4X2KA 1CMKE 5C0OE 4N57A 4K6MA 4G2FA 3QYZA 5C03A 3SD0A 4YLLA 3SHEA 1RQQA 5K4JA 3CQEA 3D5VA 2OY0A 1BKYA 3BE9A 3EQDA 5DEYA 5FDPA 4NFNA 3DULA 1KSWA 4ANBA 5EZQA 4YSJA 4HYUA 3O7LB 3S68A 4BBFA 4QQCA 3P2EA 4ZSGA 1SQGA 1ZOEA 3NSZA 4BN1A 1SVHA 3AMBA 3I7CA 1BMKA 4RIWB 1I9GA 3VS5A 2B1PA 4ANQA 1H0WA 3REPA 3UG2A 2CCIA 3FDNA 1Q62A 3ZFXA 4GOMD 1OUYA 4J71A 2BR4A 4YGAA 2VO7A 5I9UA 3QTXA 4X3JA 5J1VA 2YZAA 2GMXA 4QTUB 2ZVJA 1GOLA 3A2CA 4FIFA 2GQSA 3Q60A 1H0VA 2P4IA 3LIJA 3EKKA 3A4PA 4RVLA 3AD4A 3HL7A 1OBGA 3G8BA 1SNUA 3W2QA 1W84A 3UWPA 2UZOA 1Q8ZA 3GRUA 4LV5A 4X63A 3F5UA 5CZIA 4BCHA 2ZSUA 3ORPA 4ZTRA 2PKWA 3LLTA 1JBPE 3OZTA 2E2BA 4G3GA 5BVNA 1EG2A 2Z6UA 2ITTA 3AT2A 3P9JA 3MGYA 5DNRA 4Y72A 3QWKA 2XNGA 3MIAA 4O2ZA 3CXWA 2DWBA 4Y95A 1QPJA 3FSFA 3W2SA 3QCQA 4NTTA 4GOLD 1F38A 5CZHA 2CKPA 1TPYA 3CJFA 2X8IA 3ANQA 5EHYA 2OSCA 2IPXA 4EOJA 3PY0A 3TV7A 5C1IA 4KS7A 4QOXA 3QQUA 4O83A 5DHJA 3AD6A 5AWMA 1J91A 3D2IA 1IEPA 2B9FA 5CQWA 4FIEA 2FCAA 3QA0A 2IN6A 2BKZA 4G56A 3P9IA 4CTJA 3E7OA 1PXIA 3FLSA 1B6CB 3RZBA 1BC5A 4L68A 3TM5A 3LMIA 5D1JA 4LMNA 4GK3A 4E70A 4RLKA 3HA6A 5AV2A 3C5IA 3RWPA 3HYHA 4BTKA 1R39A 3ZC6A 2W4KA 1DAYA 5GM2A 4L43A 4FNZA 5E1SA 1Q8UA 1Q99A 2XYQA 2GB4A 2R3LA 3DV3A 4FNXA 4P4CA 3MTIA 1OIUA 3PVWA 1OMWA 3OFJA 4CCUA 2PYWA 4K11A 4EVIA 3R1QA 1YHVA 4FTQA 1QAOA 4AUAA 3EFWA 1ZGAA 4PV0A 2PZRA 5HILA 3ZLXA 4AZTA 1HCLA 2JD5A 3KN5A 2PY6A 3WYYA 2WELA 4L01A 4O6LA 1LP4A 4ZEGA 4QRCA 2DUVA 3PXKA 3RGFA 3H9OA 2GNJA 3ZDIA 3OS3A 2QO9A 4MNEB 1OPLA 1FMKA 4G17A 4K0YA 4BGHA 4KBAA 4L42A 3U9CA 3Q4CA 2PVFA 3C6KA 1O6YA 2HOGA 2VWYA 4HPTE 4DEDA 5CF5A 3DK6A 4X7QA 2ZDTA 3DQXA 1AGWA 2GSFA 4PY1A 1EAMA 5K0EA 3IKAA 4BDEA 4UY9A 5FA8A 4GRBA 2C7PA 4ZTSA 4R3PA 4F1TA 3WILA 4MXCA 5BVFA 3GJYA 4NJDA 1KYZA 2XNOA 4E20A 1BI8A 1NXKA 3IW7A 2PXAA 3I60A 3TOSA 2OJIA 3D7TB 4QPSA 2ITNA 3KRXA 3PXRA 1AV6A 3PE2A 3HV6A 4B7TA 3IGOA 5CNOA 5LMAA 4EKKA 2EB2A 5E9WA 4PCLA 3BI6A 3UODA 3QRUA 4BTMA 1E1VA 4QQTA 3IEIA 3M11A 2X1NA 1WVWA 5HICA 4FEQA 3EEYA 1PJKA 2RGPA 4CGAA 2UZDA 5CU2A 4CWAA 2O06A 4FSUA 3LCKA 2J5EA 5IA0A 4UXLA 2WMAA 4M14A 3KQYA 2UW6A 3B2WA 1BUHA 2UVYA 4R8SA 4DEHA 4O0WA 5E8VA 5EZSA 3V5PA 3ACKA 1N7IA 3DBFA 3QZFA 2RG5A 3SC1A 3I7BA 5EMJA 4EH2A 5EEHA 1WVXA 4G1WA 3CLYA 2C7RA 4F99A 4O29A 2JKKA 3DPKA 2X6DA 4LRKA 5AM7A 1RI1A 5E8RA 4J7BA 2J0IA 4QMZA 2ZZKA 2ITZA 4FTJA 4HNFA 3ORLA 5LQUA 4F7LA 3JWHA 3R8LA 2G1PA 4IJ9A 3QQFA 4DH5A 4QP8A 1CKJA 2OJFE 1YOLA 2BR3A 2WMTA 1MRYA 3B8QA 4GQBA 4F7SA 1Y57A 5T6BA 1UU9A 4JOAA 2QC6A 3DXPA 3ZCLA 4G3EA 4PINA 2F7ZE 4IVAA 3B2TA 5CEQA 5CU6A 3F7WA 2BIKB 2BHHA 4E2YA 5BPYA 2XYUA 4ASDA 2QU6A 3ORMA 5HE3A 3O8PA 4WG3A 2EVAA 4F9CA 2E9UA 1YZHA 5D1HA 1G8SA 4XUDA 3CE3A 4ZTMA 1ND4A 3WZJA 3MJ1A 2AOVA 4ITHA 3KEXA 4BDCA 4M7IA 1QPCA 4FSYA 4H1MA 2CNVA 2X0GA 2P3OA 3ORIA 3LFAA 4L7FA 5A4CA 1RJGA 3PJCA 5GP1A 3HVCA 4TW9A 1H1SA 3F3VA 2XNNA 2GFSA 3GFEA 4YJQA 5IDPA 4IAAA 3G51A 2VX3A 5T67A 5CAVA 4FYOA 3JS2A 4BI0A 1PKDA 4ATNA 3VUKA 1V1KA 3KXGA 4HW7A 4CMUA 3UMWA 3II5A 1YFJA 3D2LA 3CY3A 5DX1A 4X0MA 1ZQ9A 3FHRA 5A46A 3D9VA 3R1YA 3PY1A 4F85A 3KRLA 1H01A 3L9MA 4GUBA 1UNHA 3MVMA 4XUFA 4JAJA 5K0LA 3DZQA 4ONAA 4MBIA 4D2SA 3V5LA 3NW5A 3F2NA 5E8YA 1TQIA 3AC5A 1K3AA 2ITQA 2FO0A 3C4WA 2BZIB 2HCKA 1YW2A 1S9IA 3ZO3A 4L00A 3Q5ZA 1ZMUA 1U54A 1JR4A 2ONLC 1GNGA 1OKVA 3M2WA 4C58A 2BPMA 4RTJA 1JTFA 4FSWA 5F95A 3PXFA 1B42A 1F3MC 4OQEA 5K05A 4R7BA 3BHUA 2ADMA 2YM3A 5ETAA 2XK9A 2PK9A 4LM5A 4GFMA 3KMMA 2JKQA 4JAIA 2OJ9A 5HOQA 4EQCA 4FG7A 3EQCA 2HWKA 2OIDA 4KRGA 1PKGA 4OTWA 1YUBA 2WU6A 2H00A 2FYSA 3TZ7A 4BLUA 1JQHA 5L2IA 3C3YA 1OKYA 2HENA 3CBGA 1MQ4A 3IK3A 3GGFA 2WD1A 2WTKC 4ER0A 2W0JA 3IO7A 4FG9A 4RSSA 4QQJA 3DT1A 3M6XA 3CQWA 5LXMA 4C4JA 1ZKDA 3L8PA 4G9CA 3OTUA 2WTDA 4RZWA 5HG7A 2PX2A 4TWNA 2JIVA 4E2ZA 4C02A 4ACGA 3F4KA 3RMFA 5CSWA 4LMUA 4O81A 3P9CA 2H8HA 4DG0E 5HU3A 1XTPA 2H96A 4RVFA 4FIHA 2R3MA 3FUTA 4I92A 3ZM9A 1PHKA 3F3UA 5ERGB 3DNEA 2F7XE 3BHYA 4D55A 4J8MA 4MKCA 3DJ6A 4C3FA 4NKAA 1XDUA 3EH9A 5M4CA 2R3PA 3A7FA 3A26A 3BX5A 4I0RA 1BL7A 1NBHA 1ZLTA 2W5BA 5E4HA 4EHEA 1XH4A 5KKRC 3OWLA 3UP2A 3E8NA 2H9VA 3G6GA 3LCUA 2EJUA 4DMGA 2XRUA 3UO6A 3QGYA 2PBFA 3C4EA 4NYEA 2HK5A 4M36A 4XBRA 3ZMMA 3OE4A 1N7JA 1SZMA 3PA5A 1PXMA 2YCSA 3LECA 2JIIA 3QTIA 1UU3A 4KAOA 2PUPA 4ASZA 3NVMB 4OA8A 3EVGA 2FSOX 2GH1A 3G5LA 3CJGA 2BCJA 3UYSA 3ZEPA 1XJDA 3TJDA 4YU2A 3DJ7A 3K5UA 4O7LA 2XVMA 5HKMA 1JVPP 1SM2A 3ZONA 1PXNA 4HRAA 3DKFA 2I0YA 4FT0A 4CTCA 2HZ0A 4IV0A 5CAUA 4F1OA 3G2OA 4FKSA 4QQKA 4UB7A 3TNHA 4V05A 3GNIB 1F3LA 2C6DA 2P0CA 1K9AA 4FSNA 2XEZA 3PIZA 4BVUA 3FLNC 4YZCA 4U42A 4F65A 4IE9A 4CRSA 3TACA 2C6OA 1UFKA 3ET7A 5M51A 5AX9A 3QTSA 4ORKA 1MQBA 2OJJA 3VIDA 2PX5A 2FYTA 4FV5A 3PS9A 2ZCJA 4EQMA 3ZS5A 4YO6A 2WMBA 4X61A 3ZZEA 4D5HA 3FZOA 1ZG3A 4FKRA 5D10A 3KR0A 3THSA 4APPA 4LUEA 4OTIA 4LQMA 3NS9A 4IKPA 4CMOA 4MIKA 2WQMA 4HCVA 4KRCA 5AADA 2XMYA 3JR1A 3TKUA 4AW1A 3UE4A 2ZBPA 3FRHA 1NV8A 5C9CA 4EOSA 2JGZA 2GPYA 4ZAUA 4OLIA 2GNLA 2QM3A 2WMRA 4WBBB 3OEZA 3BV2A 3FL4A 3PY3A 3DU8A 3EZVA 3KK9A 3VUMA 3F7ZA 4ZSJA 5BVEA 4YJOA 2UW5A 3IOPA 2ZLBA 2XYVA 3KKVA 5JRQA 4ALUA 2YM4A 1W7HA 5TR6A 3ELJA 4L9IA 3U81A 4R1YA 5E8XA 3GU7A 5DWRA 3BYVA 5LQAA 2QQ7A 3R9HA 1K2PA 1GIIA 1JSXA 2B9JA 4C3PA 1MJFA 3BQCA 4R5SA 4YBJA 1MHTA 3FQHA 3VJNA 2QRVA 5IA2A 2IVSA 2C6MA 3FQSA 3IG7A 1OR8A 3R2YA 3G0FA 2ZWVA 1P4FA 4RTPA 5E1DA 2VWZA 4YV0A 5DVRA 2EFJA 3ORHA 4CVAA 2BRHA 3BHVA 2PVHA 4EOKA 4TYGA 2GHLA 4HSGA 1WY7A 2XIZA 3R7OA 5AV1A 4BCFA 3CKKA 1UNLA 5BYZA 3NDJA 5CF6A 5DRDA 3EN9A 4Q9ZA 3OZSA 5EW9A 2QO7A 2Y8OA 1TVOA 1J7UA 5DPVA 3RCDA 3TM4A 1OIQA 1X1BA 3ALNA 3G0EA 4FKPA 1P5EA 4FMQA 1YWRA 4JG8A 4RYLA 2CGUA 2V74B 4JRNA 5HE0A 5IQAA 5M53A 4NUSA 2UW7A 3G9NA 5I0BA 3R04A 4GSBA 4TNBA 5ICCA 2A1AB 4A6DA 4HVIA 4FKVA 5I4NA 4L67A 1ZAOA 1HOWA 3ZHPC 2CPKE 3PX2A 3ENHA 5G02A 4FYNA 3PE1A 5J1WA 4O7RA 2IWIA 5BQ0A 2QOIA 4QMQA 4U97A 4D5KA 3KREA 4FV6A 3AGLA 2O2UA 4FKTA 5EKXA 2C5XA 3H3CA 4DKJA 2F9GA 1DAWA 5DM0A 4OT6A 4JNWA 5HCYA 1ZOGA 4CT2A 3VS6A 2OZAB 4WUNA 5EC8A 4JL9A 5HCZA 2WTWA 4HNIA 1G55A 3VS7A 3KRRA 5AUXA 4USDA 4XYFA 4HCUA 2W5AA 5F94A 2IZUA 3VRYA 4QTCA 1FPQA 1JOWB 4GJ3A 5FWDA 4FSZA 2W9ZB 4RX7A 3R7IA 2JH8A 3LDFA 3CGFA 5BUIA 5HHWA 2X6EA 3M6WA 4AT3A 4YTIA 1AF7A 2YERA 4WNOA 3RALA 4RVMA 1G6Q1 1Q61A 4R78A 1HCKA 4FL1A 1P1CA 3QCYA 2WA1A 3UA4A 1XH8A 3R0QA 2YZLA 4DEEA 4BTJA 1XHAA 3BKBA 1OL1A 3UFBA 3FJQE 1U46A 2QKWB 5DBXA 3L8DA 3VO3A 4U80A 5CSXA 2JHCA 5IEVA 3LXLA 3I64A 3OMVA 3HCFA 1YQJA 4YMGA 4YP8A 5K0NA 4GCJA 3CC6A 4C36A 1SKMA 3P4KA 3PWYA 4BYIA 5BVKA 4MK0A 4DGMA 4YZMA 4EWQA 1J7LA 1KOBA 4FBXA 3PG1A 4RVHA 3DMHA 4PTEA 4KDCA 3WIKA 4J99A 4TY1A 4EOOA 1SQFA 3RPRA 3A7IA 1WBTA 5CASA 3UJDA 3LCDA 3NIZA 5DT3A 3TG1A 3ZSIA 1GZOA 4MQ4A 4LWOA 3KQQA 4RTLA 4RWJA 3M33A 3LFBA 5IUIA 3QQKA 2LD4A 2QOBA 4O82A 4EYJA 3EIDA 3LGAA 4WNPA 3HCBA 3GC9A 2VTLA 3IW5A 4FZFB 4U3ZA 3PFHA 3UOHA 2C6IA 2IDKA 3EVFA 3V5WA 2WQNA 2WTJA 2OXXA 2IH5A 5AIKA 4W4XA 5IUHA 3NUXA 5L8JA 4APCA 2PVLA 5HIEA 3UZPA 3R6XA 3HP7A 4YJUA 4JG7A 3FKOA 3R83A 3SLSA 2R3FA 3LW0A 2VDWA 4C33A 3BBTB 2CHLA 3B7PA 1OKWA 3IS5A 3VRZA 4M15A 2JFLA 3P7CA 4AGUA 4AGWA 1NVQA 4IVCA 4BDJA 1KPHA 3CPBA 3UZUA 5EFQA 4OTFA 5EI8A 1ZARA 4DFXE 4E2XA 4UBAA 4A4XA 5HG9A 3BWJA 3TDVA 5J8IA 4QDKA 5CANA 3BKXA 3UQFA 4IVBA 2ITUA 1XXLA 5C9ZA 4PYJA 2JH9A 4BP1A 2V0DA 2FUMA 3VUHA 3QBNA 2NXJA 4MWZA 3QQGA 1W8CA 2I1MA 5C4LA 5HO8A 4HOKA 3O17A 4R7IA 1FQ1B 4A6EA 3R2BA 5CENA 4RFZA 4U0IA 5FQDC 4RTSA 4ACHA 2XYNA 4P90A 2XZSA 1I4WA 4QPAA 3EGIA 1Q8TA 4FTCA 3WI6A 2DQ7X 3TM0A 4QYHA 3NWBA 3ELUA 3DFAA 5CF4A 2J0MB 5HFJA 4J1RA 2YXDA 3C6MA 2B53A 5BVWA 3R3HA 1Z9XA 3UYTA 5HX8A 3FTEA 3T3UA 1D2HA 2C6LA 3UC3A 3WSTA 2PUIA 3QHWA 3RAIA 2B9EA 2NP7A 2W1DA 3ZRLA 1W82A 4CV8A 2VAGA 3FKLA 4M84A 2QLUA 4IAIA 2GNFA 4ZTBA 2Q41A 4KSPA 3PWDA 3ULIA 1ORIA 4BCMA 4QP2A 5HTCA 4FNWA 1FJXA 3OCSA 1IG1A 4FT5A 1AQ1A 4EOLA 4Z55A 3H9RA 4I3ZA 2XRWA 3LCCA 4M67A 3IDCA 4L45A 2Y4PA 4DBXA 3BGPA 4YURA 3UQCA 3K2LA 3MV5A 3F5XA 5CVJA 4XG8A 3V3VA 4AZEA 3R01A 3GGDA 3JWIA 4YZ9A 2CKOA 3SGLA 4QMUA 2FPOA 5DLYA 3BEAA 3ID6C 4FIIA 1YXXA 2XKEA 2RKUA 4O7WA 3HMIA 2C0OA 1CKIA 4EOPA 3LXPA 3R8ZA 4PRJA 2BHEA 4FSDA 1XBCA 3HX4A 4RLLA 5K0GA 1OZ1A 4QNYA 4PGGA 5CWZA 3FPQA 3SVVA 3LM0A 3FUWA 1YF3A 4BDIA 4LECA 2OBFA 5BW4A 5EHIA 2YITA 1DI9A 1Y91A 5EMLA 5JN2A 5K0BA 5FUTA 4RTMA 3DBDA 4WD5A 2C4GA 2YN8A 2RF9A 5HNIX 2ESMA 1V39A 3U9NA 3BELA 3SQQA 1RJDA 3OY3A 2BM8A 1VYWA 1V0OA 5HTBA 3UOLA 3PLSA 3R7VA 3I58A 4DG3E 3TXOA 3HAVA 4PL5A 3D83A 4BCJA 3UJBA 2ZV8A 5F2NA 3A8WA 5IH3A 3GDHA 3ZLYA 4U40A 2VTTA 1URCA 4IC8A 1PYEA 2BZJA 5K01A 3MTFA 3E3PA 5LVNA 2WMUA 4AOTA 5AV4A 3IQ7A 4O38A 3E63A 3EQGA 1R8XA 1IXKA 4S31A 2Z7SA 4M68A 5EG3A 4RIXA 3CTQA 3FXZA 2VTPA 5AUTA 2QOHA 4H0NA 4GT3A 3SKCA 3JWGA 3S0OA 3FAAA 2O8YA 3HRFA 1R6AA 5HO7A 4JDKA 3TTJA 4LG1A 3BWYA 5KCVA 5IKMA 1A06A 2Y6MA 4F6UA 2Z02A 4RG0A 5CEMA 1OL2A 3E05A 5CU3A 5BUJA 2HYYA 4AZFA 3K0BA 2VGOA 3QD0A 4EH3A 3PVUA 5HGIA 4ZJJA 2IG7A 4EC9A 5JT2A 1XR1A 4YJRA 5LSAA 3C7QA 3RKBA 4I6FA 1ORHA 5FEDA 3MTEA 2XUUA 3DKOA 4NSTA 3DBCA 4FT7A 2XVAA 3JVSA 4YJVA 2CMGA 3GC0A 4IAKA 3DB6A 3R9NA 5EM8A 3BWBA 1QMZA 2GQGA 1MP8A 1KV1A 3SM3A 2C5OA 4AP7A 3U51A 4IWDA 2VRXA 3FPGA 5DA3A 3O2MA 2ZVAA 2F8LA 4YHFA 5E7RA 3Q96A 2GQRA 2Z7QA 3OXZA 1FBNA 3H0ZA 4PCAA 4WHZA 4CRLA 5B2LA 4O7ZA 2BIYA 2O3PA 3AT3A 4FL3A 4F64A 3JY9A 3FMLA 3PZHA 4PMTA 3SRVA 4X41A 4AE6A 4IX6A 3GU8A 5ICFA 4K9YA 5DM1A 2GS6A 2WPAA 3QUPA 5C8MA 3TNIA 4O7TA 1VIDA 1YOJA 4R77A 4X3FC 4USFA 5IQDA 1WMKA 4D2RA 3HCDA 4A9SA 4YR8A 1OBDA 4ZZNA 3QZIA 1JQDA 2C7QA 3ACJA 4YUQA 1W0XC 5IF1A 1M2PA 3Q9YA 1BKXA 3Q9XA 3TUBA 2PMIA 3BUSA 2FK7A 2B7AA 3GQIA 4JR3A 5EOBA 4I5MA 2AVDA 3KCKA 2CL5A 4M13A 2AOTA 2GS2A 4FV8A 5GNKA 4YZBA 1OVEA 1U54B 3SW4A 3W2OA 2XYRA 4ACCA 3HGKA 2BDFA 4GS6A 1S9JA 2WKMA 3P97A 4I5HA 5HCXA 1WAKA 4PYOA 3HM2A 4GT4A 3E8EA 4F7NA 1Q8YA 1JSVA 3ERCA 5KBQA 5KMKA 3OU2A 3O50A 2XS0A 3NYOA 2UZBA 1QAQA 4CKCA 2PX4A 2VTJA 4QTEA 1ERKA 3EMDA 5IUGA 3F3TA 3ZRKA 4NECA 4N6ZA 2XNMA 5FTQA 9MHTA 1XH5A 2WFYA 4FKGA 5AP6A 2R3OA 1D2GA 1JNKA 4PYIA 5T6KA 3OFMA 4CXAA 4IIRA 2PWPA 2WNTA 5M5BA 1H4LA 3RAKA 4JIAA 4AW5A 4XH6A 3UJ7A 1JKLA 4F9BA 3MFTA 1VP3A 5HVKA 3OUNB 1QPEA 5AUVA 3FV8A 4BGGA 5M57A 3W8LA 3HA5A 4TTHB 3IW8A 2IW9A 2CKEA 3TIZA 1R1WA 2HNKA 3DGKA 3BU3A 2JC6A 3FXWA 2PMNX 4IJPA 4EBWA 1L9KA 5D11A 1SNXA 2WTKB 4F0IA 3A25A 3Q2JA 5M4UA 3KF4A 2B4SB 5LVPA 1HNNA 5CCXA 5FADA 4BYJA 4IZYA 3PPZA 1XH9A 1D2CA 4ZS4A 4FL2A 3HMMA 3DKCA 4QNAA 4CG9A 3NUUA 2HY0A 2X8EA 2ZIEA 4J53A 3ER9A 2ZDUA 2EXCX 2PVKA 1NY3A 4CG8A 3BLHA 2ZMDA 4DEIA 1VQ1A 3EGVA 2VWBA 2EJTA 2C1AA 2BROA 1U5RA 2YXEA 3LFEA 4RRVA 4F6SA 2YDJA 3DMGA 3QLGA 1BI7A 5ETIA 2X7OA 4R3CA 4BDAA 1R0EA 3OROA 1WCCA 4F08A 2J90A 4QYEA 3UA3A 1YXSA 3SR4A 4XOZA 2PU8A 2WAJA 3P2IA 2V5QA 3QX2A 1Q3DA 5FP6A 5AAGA 2IVVA 3BEGA 3TDWA 2B2CA 1TQMA 1SYKA 3THBA 5L6WL 3LXNA 3DMFA 4USEA 1X8BA 4WKQA 1VJYA 3WF8A 2Y4IC 2ORED 3GO4A 1YI6A 4G6LA 4BZNA 3F5GA 2YJRA 3VNTA 4NIFB 4Y73A 4WT6A 4ENYA 3WF6A 3A7EA 5IQGA 3CQUA 3FRIA 3Q4TA 3QU0A 3BYUA 2I62A 2XP2A 4Y46A 4BCPA 2JIUA 5HNBA 3LFDA 3W55A 3IW4A 5K4IA 1Q24A 5A6NA 4ZY5A 3PA4A 2BZKB 4PTCA 3DAJA 3MCTA 2RFDA 3Q5IA 4KIFA 2Y1WA 4W4VA 4E4XA 4UWCA 5D9HA 2AN5A 1GY3A 3PRFA 4I4FA 3R00A 4U45A 4AG8A 4CZUA 2G2HA 1M7NA 4UYAA 5JGAA 3MW1A 2GHMA 5GJGA 2W99B 3G5DA 2IO6A 4O91A 4LGHA 3ZDUA 3R1SA 5G1XA 1WG8A 2ZULA 2PWYA 2BM9A 4JQ7A 2BAQA 3TI1A 3EHAA 4DEGA 4M8TA 2HXQA 5KZ0A 2G15A 4JT3A 1GZNA 2G8NA 3OWPA 3NAYA 3KRJA 4KNBA 1ZMWA 2ZB0A 2F49A 3MFSA 3MFUA 3KQMA 4ZOGA 1H26A 4CFMA 4GVJA 5EIWA 3SAYA 4ZS0A 4E2WA 2W1ZA 2SRCA 3F2AA 5D1NA 4XMOA 4B9DA 4YJNA 4C38A 3NZ0A 2ONZA 2YR0A 4IZ5A 2ZBRA 2CWWA 2XNPA 3MB5A 5CYIA 3QGWA 4H39A 2FB8A 4RZVA 2X7FA 3OT8A 1IAJA 2P33A 1Q5KA 3DFCB 5ACKA 5DRYA 4BGQA 1PMNA 2G72A 3RK9A 2PPQA 3C50A 4BF2A 2YM8A 4HVSA 1PMVA 4E1ZA 1OIYA 2VZ9A 5LMKC 5I9WA 1YB2A 1KWPA 1NA7A 2V22A 4E31A 5LWNA 3L1SA 4RWLA 2ZOQA 3IPHA 4DEBA 4YPSA 3QHRA 3PT9A 4NT4A 2ZW9A 4PF4A 1P2AA 3PSDA 3EN5A 4IZ7A 3OWKA 4CFNA 4IAZA 4CQEA 3RM6A 2ZTHA 4TN6A 1M6EX 3NCZA 5EQPA 3ZLWA 5HZMA 4U43A 3DKGA 4YSMA 4FIJA 4R3RA 4EKIA 3EQPA 3KR1A 1OL6A 5LMKA 3M4XA 3O8TA 3LDUA 2PVYA 3OBGA 4Z3VA 4FUXA 5GJDA 4BDFA 3LXKA 4XBUA 4EEVA 3K5VA 4XLVA 4I0TA 2HWPA 2R6ZA 1PMUA 4BDKA 5LQCA 5TF9A 4RVDA 3RK7A 3GOKA 3UNJA 5DR6A 4C4HA 3KPUA 2HELA 2R7IA 2XF0A 4GOOD 5BX0A 4PNKA 3EVCA 1QCFA 3NIEA 2X39A 2W96B 3R8UA 3C4XA 2OI4X 2R3GA 3RI1A 3MPAA 5GOZA 3TKAA 4YUVA 5E8WA 4AFJA 1VBFA 3PUPA 4XV3A 4GFGA 5HVJA 2J7TA 3Q7EA 2XK8A 4IMYA 2CGVA 3EFJA 4KB8A 2YUIA 3SVZA 2B3TA 4TYIA 5AIRA 3PB3A 2UZNA 3EVZA 5C8NA 3DBEA 4MNFA 1CKPA 2YVLA 5CVDA 3VULA 3MFRA 3ZH8A 2XNEA 3TR6A 1M2RA 2BR5A 2V7OA 3A62A 1NW1A 2QOLA 3B89A 3D15A 4WNMA 3F6XA 1KIAA 2H11A 1P14A 5AUZA 3FZTA 3EQBA 4FK3A 2IZTA 3T3VA 3P71T 2VP3A 4I21A 3FMJA 3HUBA 3SXRA 2E9VA 3ZFYA 5AJQA 4TWCA 3C0IA 4TT7A 3PFGA 3VWAA 1U5QA 2IW6A 4JDHA 3MS9A 5EQEA 4I41A 3PP0A 2O05A 3CJTA 5AV0A 2OZVA 5DYJA 1T45A 2XKCA 3Q53A 5LQKA 1EQAA 4MF1A 5CSPA 4NW6A 2PVCA 4PMMA 4LI5A 3UBDA 3B5IA 2YEXA 3UP7A 2QONA 3NUPA 3T9TA 4DE4A 4FKLA 3P8ZA 3N4TA 5I9VA 5HD4A 4HGTA 2VWVA 3VC1A 4F6WA 3DNDA 2ITVA 2AVNA 5DM4A 4A9RA 4FZ7A 2XM9A 5A3XA 4O84A 3HMPA 2PVMA 4QTAA 2QG5A 1UWHA 3CBLA 4LGGA 2G01A 2ZAZA 4H3QA 2J4ZA 4OR5A 3PG3A 3ELDA 4O6EA 3PPJA 4POOA 3F3WA 2J0LA 3F5PA 3V51A 4DFYA 3PIXA 3QL8A 4CCBA 3UC4A 2A4LA 3U55A 4FTTA 5TO8A 1BLXA 1ZYJA 1G8AA 5K5XA 1FGIA 4IDVA 3WE4A 3FUXA 4AZSA 4CTBA 3I4BA 4QMXA 5L3AA 1Q97A 1UIRA 2BH2A 3DR5A 4CKEA 3COMA 4RIWA 1SMHA 4WOVA 1E9HA 4R6WA 4GYGA 5ANDA 3KK8A 1NW3A 4QMOA 3ORNA 5GJFA 2G9XA 3IDPA 2OU7A 4R6XA 4EJ7A 4GC9A 3ORZA 3E64A 3MY1A 3SXFA 3RODA 2P2HA 4P7JA 1WBVA 4K6ZA 2IDJA 3C0GA 4X2NA 3MHTA 5AM6A 4IFCA 5CNNA 3LCVB 4KIGA 5E8SA 2Y6OA 3KA0A 5GWXA 2OH0E 3HP5A 4P2KA 4G3CA 5BXYA 2OGVA 1F0QA 4UALA 2K4MA 4BICA 4PGHA 2AUHA 1PF8A 3KC3A 2C3KA 3CP9A 3AG9A 3P1AA 1I09A 3QTUA 2UV2A 3ELYA 1NT2A 3BIZA 2C68A 4KKGA 3GVUA 5BNJA 3SOCA 5AP7A 5EK7A 2HW7A 3N4VA 1REKA 3D94A 3HKOA 3KXMA 3R22A 3N9XA 2HV9A 4EK6A 4FKUA 1G3NA 4FTKA 4FE2A 2B55A 3NEWA 3P7AA 5B7VA 1I1NA 2WIPA 3PLAE 2BAJA 3GCZA 3FLQA 4CLIA 4Q5HA 4RIOA 5CT0A 3OCBA 4O0VA 1WS6A 2BKKA 4WRSA 3K3IA 1YFLA 3OD6X 3HEMA 4DH8A 3PTAA 5BYYA 2E9NA 4QTDA 1JG3A 3KQ7A 5FCDA 4DEAA 5I9YA 4I6BA 2ETKA 3FPHA 4WBOA 2J9MA 2C3IB 3VYWA 4EI4A 3TFWA 3A60A 2YCQA 3GWZA 4AA4A 3R9DA 2EWAA 1Y6AA 1MUOA 3T7SA 4DINA 2I6GA 3GI3A 4J52A 4BTFA 4W8EA 4AE9A 2QHNA 1MRUA 4OTDA 4H3PA 4QP9A 4RT7A 3T7TA 2R3NA 3GRZA 3PXQA 2CMWA 4FSTA 4WVLA 2ACXA 2VU3A 4HH4A 3A61A 2FGIA 1IA8A 4MTAA 3QCXA 5AMNA 4IZAA 3COKA 1XQZA 4NM3A 2PUUA 2EXMA 4U6RA 4MXZA 4MWIA 5JZNA 4DGOA 4BP3A 4MNEA 4RX1A 2VWWA 1UU7A 4ZZMA 1KE7A 5IQFA 5DT2A 4IB3A 5HLPA 3HCCA 3OHTA 3G89A 2HZIA 4RMZA 4KVZA 3TKIA 1LUFA 2IVUA 3HNRA 4JIKA 4K77A 2I0VA 4MBLA 3TCPA 1JKKA 2VNYA 4F70A 1H1PA 2YM5A 1SVGA 4KIPA 4DT9A 2CGWA 4IVDA 5J87A 3MDYA 5JQ8A 4RQKA 3CIKA 4IACA 3QQHA 4G5JA 2G2FA 3PVBA 4NZWB 2R3SA 2P1DA 5J95A 4G16A 3D7TA 2EB3A 2XB7A 4CV9A 4L44A 5C26A 1NE2A 4IM2A 4O86A 4QMMA 3NNWA 4OTQA 2PZIA 3QLFA 4FZDB 3DLIA 2J0KA 5KMLA 4ZXTA 5KUPA 1IA9A 4FVQA 2NNWB 3I6UA 3S95A 1Q0SA 3FYDA 3UIUA 5LJJA 3LAUA 2ZV7A 2AYPA 4XCUA 3CPCA 2AC3A 2QR8A 1GJOA 4DITA 4X6QC 3HLLA 3ZFMA 4HYHA 3OXIA 2YDIA 3V5QA 3GENA 1OI9A 1XCLA 2YABA 4C34A 4HG2A 2H6DA 4O0XA 3M42A 4FTIA 5HBHA 1ZYSA 3BGQA 1URWA 2OKCA 4B6LA 2R7BA 3QWJA 2ZBQA 5F2OA 2IZSA 2OLCA 4Q9SA 3TJCA 1RW8A 4E6DA 2WO6A 4QP7A 4I20A 5B1SA 1GZ8A 2NPQA 4UOEA 2JLDA 3L8SA 3L8VA 5FM2A 4O27B 3WBLA 3EN7A 2KW5A 5JFXA 3LLAA 4FV4A 4XV1A 4Y30A 2O0UA 4XUEA 2C0TA 5IEYA 3P78A 4PYQA 5E8JA 3KQWA 2P7IA 4GU9A 4BIDA 2HXLA 5F20A 5EMKA 3I1AA 1GAGA 4GV1A 4DFLA 3HRBA 4BY9E 3I81A 3O4FA 5FHRA 1M52A 3TV6A 4N6YA 2YCRA 3QC9A 4S2ZA 5LOHA 3UDBA 1BHJA 2PTKA 3VQUA 3V6RA 4PP9A 3LJ1A 4JX7A 2XIRA 3O8UA 2IJMA 3W33A 5JH6A 1H1RA 3EOCA 4ANSA 4M0YA 5DGZA 2AOXA 4FV3A 3LFNA 3LZBA 3NYXA 2OB1A 1PXJA 3UZTA 4XP2A 3IV6A 1JSZA 5HNGA 2B25A 4EYMA 3FUPA 3HV4A 1UNGA 3D7ZA 5T64A 1T43A 2X4ZA 5M06A 2XKFA 1IRKA 3VBWA 5DI1A 3FTFA 2BR1A 3E8CA 4BCGA 3UJ6A 5DTMA 4RTOA 4X3FB 3DAEA 2VTNA 4D1XA 4RVGA 2VTMA 4Y83A 3EWHA 3HA7A 1R0PA 4FTAA 4S34A 2VO6A 5FD2A 4XRJA 3U6HA 1UVRA 4IAYA 3M70A 5CX9A 1L8TA 3QD4A 3I53A 4GW8A 3SA0A 4UXQA 5CAQA 3PJ8A 3OEFX 1YXTA 3V01A 3Q2MA 4C7TA 3ORKA 5FBNC 3FUUA 2YIRA 2GU8A 5CEKA 2W17A 3R8VA 4U44A 4BIEA 4O96A 2WTVA 4F9WA 3LMHA 4FOBA 4G3FA 3I5UA 2UYQA 1UU8A 4IWPA 3U6JA 3QRTA 3FHIA 5D41A 2GLUA 4KWCA 3RVGA 3DOGA 4CSVA 2WMSA 4B99A 2UW4A 3Q6UA 3TEIA 1BOOA 3GNLA 3EYGA 4OBPA 1NVRA 5F4NA 4L3JA 4B0GA 1IY9A 2JDTA 3LDGA 2YM7A 5EDQA 4NJ3A 3ZYAA 5BYLA 5EM6A 5EYCA 4QTTB 2VX0A 2YDKA 4R05A 4RC3A 3NNVA 5A4TA 3CVOA 3MTLA 1XO2B 5HORA 1O9UA 3LKZA 1DM2A 3PPKA 5L6PA 5E8TA 4QTBA 4I6HA 4YUWA 2OIQA 1YDSE 4O2PA 2C5VA 4EJNA 5IU2A 5GINE 3HP2A 3KVXA 3EN4A 2AOUB 4HGZA 3BYSA 3BKWA 3OE5A 4O7VA 3AQVA 4XS2A 4C2WA 3X0DA 5E1BA 3C13A 3F88A 5CIYA 3FPEA 5L2SA 5C1QB 4AWIA 4BDDA 4BBMA 4DT8A 2NO3A 2JAMA 5FXRA 1ZMVA 5JEBA 3MESA 4HPUE 3HCEA 1WXXA 2JDOA 3R9OA 4RX8A 3F82A 2ZV2A 4GG7A 3BLRA 3FYCA 2ZYBA 3KCFA 3TPZA 3O23A 2FSMX 2XVDA 4HGSA 4QPPA 2JDRA 4AA5A 4YTFA 2CNQA 3OWJA 3HDNA 1U4DA 1PXOA 4XJ0A 4YO4A 4LOQA 3ENMA 3HNGA 4FEXA 5H2UA 4BHNA 5L8LA 4QPNA 4JG6A 3GU4A 4E5AX 2YM6A 1X1DA 4O22A 4ASEA 1LPUA 4S32A 4Y85A 2UZVA 3AXSA 5HLWA 4LL5A 3RJCA 1UV5A 1AQJA 4C59A 1J1BA 4IM0A 4AZVA 3AC3A 4PWYA 4ZLYA 2ZIFA 3QXOA 5AV3A 2Y4IB 4G31A 5KNJA 2Z8CA 1R78A 3FI8A
chains in the Genus database with same CATH superfamily
3NHZA 1VZ3A 2ID9A 2EL9A 3NUYA 5A5DA 2EX0A 2Z8YM 1FFWA 2V58A 1XDSA 4IFTA 4TPTA 1ZWKA 2I6UA 2XNDD 1I7SB 5E92A 1UL1X 1VE3A 3GZJA 4H05A 4HDNA 3ELWA 5LQFA 3OWOA 1CS0B 4NTSA 1TECE 4OT5A 3RW9A 3C0KA 1ZDMA 2IH4A 3R3WA 1NFQA 4N65A 3KOOA 2WU7A 1C14A 1I3NA 1XTTA 3R1IA 1GKKA 4F6RB 4G85A 2HF7A 3UV7A 1OTYA 2JI8A 1I14A 1JJAA 1BVUA 1HDRA 1DAPA 4PC7A 4O02B 4B44A 4URUR 1LBIA 5FXSA 4EAAA 3G9LX 1WBNA 5JH7B 2Y67A 1YONA 4YJSA 4FV7A 1CR0A 1XZJA 4Q4DA 2EX4A 4HNAA 4ETMA 3W1EA 4QTYA 2BIFA 1GL7A 3VF8A 3S2GA 2ZBFA 4PRLA 1G98A 1YI1A 3P2MA 4G01B 1BYGA 3K0FA 3QFSA 3GLGB 2FSFA 4MPTA 2X1HA 1ZXEA 4R2MA 3MN1A 3DB8A 4H7EA 3HLTA 1NXOA 5FFNA 3HUDA 3K54A 3ZIDA 4L4SA 3QZGA 1E3EA 4IKEA 4X7BA 4Y8VA 3G2QA 5CXZA 3H6KA 2W90A 1MRSA 4NM5A 2W1CA 1BXZA 1YE3A 2PWBA 2VZ6A 1WSDA 4TWIA 3NHRA 5TQ0A 4EMUA 1G8KA 2UW9A 4DDHA 2Q6TA 3UCEA 2FWPA 3C3CA 1OWLA 2WMWA 4FZ6A 1LLFA 4LDPA 4F8EA 5HMLA 3T1QA 1UPFA 2EYUA 5ABPA 4AOJA 3T0IA 3T1NA 1WP9A 5IQEA 4WKOA 4BDGA 5AP5A 4O4JB 3QWAA 2ZM4A 3OZXA 1G8YA 1CUSA 2OQIA 4RDHA 4QOSA 2W4MA 3BULA 4PYMA 3JQFC 1Q91A 3BL7A 3DB1A 1VXRA 4DUYB 3TWJA 3CTJA 4JCOA 1CBUA 3I4CA 2GPBA 4CGZA 1BCSB 3EL8A 3LL7A 2XCSB 1Z5ZA 3IDAA 5CM9C 2DPXA 3CKWA 3LUKA 1L3CA 1RJ9B 3GRRA 1Y6BA 4B1FA 2F55A 2BILB 3O2QB 2XZOA 3ZW9A 5JD5A 4FBLA 4HYTA 4NCAA 1NMYA 4PANA 3Q6WA 1W1UA 1DIGA 4IMRA 1NBMA 3FN4A 1QF7A 3EYWA 3R75A 2ZJFA 3BXOA 3NZEA 3QYWA 3SIXA 1QAMA 1O95A 3BDAA 1XN4A 3T61A 5AP3A 4D3XA 4ZCSA 2JBOA 7ADHA 1FFXA 2XHEA 3F7MA 3E7FA 3SN6A 1Y5RA 4FI3F 4RA6B 4HQKA 4EH8A 4JLCA 1U1IA 3ED1A 2EKDA 2PA3A 1TZ2A 2EWMA 5AUNB 5HR5A 3LVQE 3HMNA 4OQFA 5KHLB 4B6QA 3ZTXA 3SXJA 2ZUFA 5C52B 4D9EA 4OLHA 2GAIA 1HKHA 4ONEA 4ZY4A 3MGCA 4ARIA 4RQVA 4FC0A 3HV7A 4HUJA 1YVPA 1I32A 2OO5C 3P5KA 4D0WA 3CSVA 2TS1A 3DZGA 3MGKA 4EJSB 2BTQB 3SX4A 2YOHA 1H28A 2RFEA 1K0UA 3TIIA 2PMDA 2QUZA 3G3EA 3FPMA 1SRQA 1C8LA 1B2LA 1OL7A 2XQVA 4BFSA 1JHYA 3T1HB 3LCOA 5ECDA 5DR9A 2HSJA 1EHYA 1M2OB 3ALOA 1B0UA 1HYEA 3DONA 1UMKA 4KE6A 3PZBA 1NF8A 5IQIA 3RYTC 1ULSA 1MA3A 4OGKA 3WQBA 4ZQIA 4GBGA 3KAPA 1CUVA 4DPMA 1VB3A 5CIQA 3HDMA 4V0RA 3WBBA 5ECYA 2XVXA 1E2BA 2VDVE 4GS5A 5J9YA 2R7NA 3U7FB 4EYSA 1CERA 3I9LA 3L4BA 1NLMA 8AT1A 5IW8A 4H0CA 5FL3A 1T13A 2HA4A 3DVLA 4K8OA 5DXAA 3KZCA 4F9EA 3ZE9A 4ZDKA 4TYQA 5SYNA 3DZIA 4DY4A 4FSQA 2BM0A 4LYHA 2XIKA 2QSYA 2PLFA 5AHXA 4ZD6A 3WTBA 2BT4A 5CLGA 4JLUA 4XSVA 1E99A 4MKFA 4JKIA 3HCNA 4C2TA 2JFVA 1FYWA 4S3MA 2CJMA 4ZAGA 3K53A 3W32A 1I4OA 5JI3E 1SVWA 3AF3A 4X8OA 3F9IA 1YCFA 3VJRA 4F63A 1JG1A 4BRSA 4Z0TA 1GQQA 5K6AC 2C7VA 1RACA 4P5EA 4DN5A 3FZPA 1KY4A 5JSZB 4FKJA 5B1EA 1TM1E 3W5AA 2QD5A 3NBQA 3V5JA 5LMZA 4ARKA 4JCCA 1TQ4A 3MF4A 1HT2E 5CQUA 2XK7A 1BX0A 2P69A 1WPQA 1RYYA 1E1LA 1ZUIA 1J8QA 5T3UA 3O1IC 4Q02A 3TD6A 1T2NA 1L7DA 4UBKA 3JRWA 3TW8A 3E9NA 2NRYA 2JGEA 1EK5A 3U3KA 1AQNA 3KHKA 3GGOA 2XJ9A 4QYSA 1VZOA 1GSIA 3ZCUA 3L4KA 5IEXA 1JG4A 5BR7A 3PXEA 3AT1A 4MUBA 4QMWA 4NCTA 2WF8A 4FOOA 4KBCA 3DHYA 3RC8A 2YASA 1GU1A 3POZA 2D4AA 1YRHA 1T5SA 2MSCB 5FBHA 3VS3A 2PX8A 2COUA 1CB7A 2B4QA 1ZZLA 1UK6A 4NOMA 1FP1D 4LQ4A 4KYIB 4AAAA 3F69A 4UUNA 1TA0A 2CXPA 1J09A 5KWEA 4Z3KA 3IDQA 3AEQA 1FP2A 3ORQA 4PC3A 1NVDA 4GM4A 1Y6FA 1FNMA 4HP8A 5EMMA 1YQXA 1W4AA 4CTKA 4B4UA 3UDTA 2JCSA 1P60A 1WSWA 1VLMA 1EJ2A 2R85A 4ZMEA 5C81A 4AG5A 2W2LA 1M0SA 1YC5A 1NVUQ 2GCNA 3IURA 1MO4A 5CM8B 2AQHA 2QX9A 4F9TA 2X8JB 5JASA 3I83A 5TLSA 3X2FA 3GFGA 2FF5A 4GE0A 4J7XA 2QZSA 4UN0C 2I2DA 3W0QA 5HKBA 5K09A 3VPGA 3FLWA 2UUOA 3T9IA 4WZBA 4FKIA 1ZL2A 2VUTA 3DDZX 3OJXA 4L5YA 3F7OA 1MABB 1E1YA 4NDAA 2G2IA 4M0EA 1XLWA 2DPLA 4IUYA 3FL5A 2QHXA 2GD2A 2WWTA 1H5UA 1TKRA 4FG8A 4MBJA 1OKKA 2QENA 3DWFA 1J42A 3HO6A 4DZRA 3MY5A 2PUDA 1OJ7A 4LRSB 3KYDB 2J0QA 1LK0A 2W4OA 1OXMA 3NJRA 3RK0A 4HVDA 4BJ3A 5FGKA 3AB3A 3FWYA 4M0LA 5JXGA 4M87A 1XKQA 3RASA 2HO4A 3ZO4A 4IZOA 5EJGA 1R12A 1Q1NA 1X39A 3UFXB 3NTXA 3DP7A 1QR6A 4RMGA 1EXVA 2Z2KA 4PIMA 3OQMA 5I9XA 2VYQA 4OOFA 3EB0A 2A0XA 3CF4G 2GHGA 4ARUA 3F5DA 3KV3O 5JS2A 3OZ6A 3R7UA 1R18A 4D8XA 1LEWA 4IW3B 4N8EA 3IBTA 2IEYA 3LHDA 2W6JA 3I39X 2O8EB 5JBIA 1Z08A 4NZMA 1Q8WA 1MD9A 5EE5B 4Q7KA 3UV3A 2YHVA 2FJPA 4KX5A 5BW8A 2FH9A 3D5XA 3S3TA 2YHUA 1IK6A 4TTAA 5IARA 4KSQA 5AKZA 3OT3A 3G5TA 1XO1A 1W85B 4AP9A 5DK4A 1WFCA 2XB9A 4OBOA 3DF9A 2IBMA 4AGCA 3HJNA 2GM3A 4N0PA 4DG2E 4C7BA 3ESCA 3HJFA 1KS2A 1PR0A 4IUCS 3MS4A 2C4MA 4JLNA 3I37X 1ADFA 1R0ZA 2BRNA 2Z5GA 4NCJA 1UPUA 4B46A 3PIYA 2ITPA 1QL6A 3LC1O 1YS6A 3WLTA 2HMYB 1BMFD 3TK1A 3MH2A 2BMVA 4C5CA 1UBMS 2CV1A 4DMRA 3T3MB 5KQMA 1XK7A 3CLHA 1Y3AA 3M82A 1VE6A 3AR8A 3IHTA 1GGMA 3KOMA 4F2DA 3VTKA 2D2VA 1P7WA 1RWBA 5IVDA 2I6LA 1CY6A 1U7ZA 3GRYA 2WE7A 4EG1A 1IM8A 4RFYA 1JLSA 2ECKA 4CIXA 2XUGA 1RRGA 4Q3OA 4FR2A 3BRWA 4Y2VA 2GPHA 4F1MA 3Q87B 3UGTA 4KPYA 1DE0A 3I2GA 5ANGA 1QO0A 4PEVA 4D81A 5U1PA 3NEAA 5B57C 3IQEA 2PO5A 1KAOA 5CCBA 4U5QA 3BEOA 1KYIA 3EBLA 2ERKA 3HZTA 2OORA 2QJWA 3MB7A 2B1IA 4H4CA 1ZUNA 4M9SA 2RHRA 4GP9A 5F3WB 1DIAA 5HTOA 4R8RA 4EH7A 2P62A 3KZOA 3DBOB 2VBGA 2PT9A 4AD8A 4BOYA 1H1QA 2JKMA 1PFWA 4RX5A 2X42A 4E5BA 5GJCA 2QNJA 1GTSA 1QORA 5AJYA 4UDYX 2E4WA 3TLJA 2X7XA 5G1NA 3SHWA 1FFHA 1PEAA 2QQFA 3WJ1A 2FPRA 1GZ5A 1BVRA 2IHVA 5EESA 5TE9A 3CRZA 2W43A 5AVVA 2QD1A 4FGZA 3TUIC 3DAGA 1NP3A 1XJWA 3AYXB 3HGMA 4HWPA 5FBKA 5H9BA 1JIJA 3ZSHA 2VO3A 2C8VA 4UTOA 2V8BA 5IA3A 4CEIB 1OTXA 1BEEA 1K3FA 4EK9A 4A03A 3N3BC 3UG1A 3TWOA 3O31A 1XGKA 2G1UA 1BS2A 2PLRA 1G42A 5GIOE 1C4XA 1PQ4A 1M2EA 5CUQA 1RQXA 5BWNA 1BIFA 4YJ3A 1GGHA 1IAQA 4R1TA 1J25A 2WSLA 5FT9A 1U0NA 1O4VA 5KIAA 5JT1A 4A7PA 3KE9A 3DLPX 2VJPA 3GC7A 1X1CA 1PT6A 2X2LA 2YQZA 3L1JA 3IUYA 1P3Y1 3OLCX 4PG6A 1TDJA 5ALEA 4D9JA 2RAUA 5KZIA 2A9KA 4U3YA 4IJQA 1OFUX 5DSXA 3OU6A 2B8WA 2ITOA 1ZNQO 1ZMOA 4B0PA 2J3DA 2VH2A 3PG5A 4INAA 1OXTA 4CR6A 2AZDA 1K06A 1NI4B 1U31A 2JAUA 1BDJA 1KI9A 2UZWE 4TPKA 3MK31 4I3GA 3T5GA 2BKAA 1GUZA 1GFSA 3KJXA 4J95A 1Z38A 1G5HA 4D5EA 4JI5B 3NX8A 1FQWA 4JVNA 4NK4A 3L5KA 4MJXA 4G34A 2VAPA 3VUDA 4LMRA 3ZU7A 1T2VA 5FQNA 1TOAA 3X1MA 5HSGA 7MDHA 1BE0A 2QEQA 1QGUA 1WZYA 2F4NA 1QCYA 4JEHA 4Y67A 5FA5A 1Q41A 4I4NA 4YMIA 4BNLA 5THXA 4AXAA 3EGCA 1QQTA 1J2JA 1K6EA 1NATA 4BBZA 4JAVC 1J21A 5E90A 4LPSA 1SUIA 2HU7A 3AH8A 2ZB8A 4S0ZA 2DLDA 4DVGA 2ONLA 4IDBA 2GERA 3IKVA 4DXDA 4KXMA 1ZA2A 3HV5A 1U0RA 3BYOA 1GLGA 3TKLA 3H3XA 4MS4A 2XADA 1G5TA 4C21A 3IVGA 4FUYA 4M1ZA 3KQSA 1YDEA 5KX5B 4W5QA 1DKQA 1GDDA 2G0AA 1AO0A 3W5JA 1GU0A 3P2KA 3PXZA 5JQ5A 4ESHA 3ODGA 3HKBA 1IJKA 1V16A 1MV5A 2R2AA 1X3LA 1UM9B 4GC5A 4CM7A 4Q93A 2YS6A 4GDMA 2HPAA 3UQZA 1TC2A 4NBSA 3ZXZA 4AFEA 3DOCA 1KE5A 2QTGA 2WJJA 1UJ5A 4EKLA 3W16A 3DZJA 2NTVA 3EZNA 1KPGA 1H27A 1MC5A 1JSUA 2OXYA 4OVKA 2P0AA 1RZUA 2I3ZA 1QZ3A 2QM0A 4ZP5A 2QZPA 5JGBA 4A4OA 2OIBA 4HVAA 3AEKA 3BU6A 2RK6A 4UHEA 3SX2A 5E38A 4DIUA 1QOQB 1FZQA 3WWEA 2WI8A 4F4PA 3IJRA 4F7JA 1LCIA 4EOMA 2Z08A 3G15A 4C3ZA 2QP3A 2QAGB 3QC4A 4JROA 1DUVG 4D4YA 4YH1A 3BLQA 4IGFA 4MDYA 5CRIA 1XRLA 3RS4A 2AN3A 4EH5A 4R5MA 3LRPA 2H16A 1AK1A 4IIUA 4EB6A 1TF7A 1I7QB 1H9BA 2A0YA 4QVKA 4K6HA 3RNYA 4G1VA 2X2MA 1LVHA 5A4FS 3HC7A 2TECE 1DXQA 2VRCD 2IS6A 3TNYA 1T1SA 5MF6A 3ESXA 4WFJA 2OXCA 1W0KA 1XBTA 2IUSA 3LDHA 3KUUA 3OQOA 3G33A 4CLOB 2OJGA 1DS5A 3SI7A 4DDTA 3HBNA 2VSXA 3KIOC 2YIQA 4PQNA 4OLBA 1JN0A 2GCEA 3AGQA 3E92A 4YJTA 3I34X 5DIAA 2H17A 1M8JA 1BWPA 3BGIA 4BE4A 1JR3D 2Z7RA 4TV8B 2ZFUA 1GPNA