1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
molecule keywords Fibrillarin-like pre-rRNA processing protein
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
3OVVA 4BLWA 4XNEA 4D1XA 4ZMEA 3TNPC 1KIAA 3FTCA 4O29A 4A6EA 5FXSA 2VO7A 2YQZA 2HXQA 2PPQA 3LPMA 2QRVA 3R04A 1EH4A 1M52A 2J50A 3D5VA 4IFCA 5EDPA 5B0XA 1IAJA 4JR7A 2P3LA 3B5IA 3LCCA 1ZMWA 3BLQA 4LV5A 5LWNA 4PF4A 3HECA 4K2RA 4CMOA 3QWJA 4ZLZA 1YZHA 2HNKA 4CVAA 2YABA 1XJ5A 2B9EA 3AC5A 5LMKC 3IW7A 4G3FA 3VF8A 3LDGA 5L8JA 3ZLWA 4YMHA 4GC9A 4RX7A 4RTNA 3DB6A 3RODA 3FMHA 4BLVA 4EH8A 5IH6A 4FODA 4KIOA 3UBTA 2BDFA 3DT1A 3ZO2A 4I4FA 1JAMA 2YUIA 4PYQA 3AG9A 4RGJA 2YDKA 4UZHA 1LR4A 4ASXA 3TIZA 2HWKA 3CGGA 1XH7A 1KPGA 3P9IA 4YC3A 4FKIA 1H01A 1NY3A 2IWIA 5CU6A 3S00A 4WD5A 5B1SA 3OT3A 3IS5A 1KE9A 3DZOA 3MQ2A 1YWNA 5DR6A 1H1SA 3OCTA 5D7VA 4CFVA 4LRJA 4U80A 5ANJA 2QG5A 4E4LA 2JFLA 3EPPA 3KR9A 3THSA 2PSQA 4XUFA 5K0EA 3P08A 4X7QA 4NM7A 3P7CA 3EHAA 3IECA 3HDMA 3K5VA 4FX3A 3DMHA 5IDPA 3EVAA 5HKMA 3PIZA 4FR0A 2I7QA 3LCUA 2BHEA 4OGRA 5EYDA 2FH9A 3T7TA 1NVQA 4EOQA 2ETKA 3UP7A 3AMYA 4EKLA 3V04A 2A27A 4NUSA 3PRIA 4MCVA 1Q8TA 5DNRA 3D2LA 4LMNA 3KF7A 3ZLSA 4C06A 4RFMA 1YXSA 4WT6A 2IBSA 2VUWA 3PVBA 2CKOA 2OZAA 4QMZA 4TYEA 3COHA 4N70A 1L3IA 2AOVA 4IZYA 4NM3A 3V6SA 5K4JA 2QOHA 1O6KA 1XH6A 2PMLX 3C51A 3FKNA 2UUEA 3LFQA 4CFWA 4J98A 2B78A 3ORNA 3DV3A 4D5KA 4MNEB 5ICPA 4EEVA 3NZ0A 1IA9A 5K0FA 3UQFA 5FD2A 3WILA 3TM5A 1G5SA 1W8CA 3HP2A 5LXMA 2BUJA 4X2JA 3SXRA 2LD4A 1YHSA 3OY3A 5FQOA 3R71A 3EKNA 4IZ7A 5DM2A 2UW4A 4NZWB 4PDSA 3BGZA 1QAQA 1CDKA 1KSWA 1SVHA 3D9VA 4PCLA 4FSZA 4QQCA 4KIQA 3O4FA 4BCHA 2BDJA 5A46A 4WRGA 5LSAA 4R77A 3VJOA 4U40A 5EI6A 3QD0A 3QOWA 4OBWA 5HE0A 5HGIA 4BTMA 2LAVA 4EOIA 3FUVA 5HE2A 4CNHA 5FHQA 1FGIA 4JVGA 1UVRA 3QKLA 2J90A 3VJNA 4D1ZA 3BU5A 4D58A 4RV9A 3LFSA 1UNGA 4JX7A 2PMNX 3VHEA 3OP5A 3OU2A 3EVZA 5HO7A 5IH3A 1YXVA 4CLJA 3TNWA 2BDWA 2R9SA 4ZZMA 5JMSA 3ULZA 2C5NA 3A7JA 1CKIA 1BKXA 2ZV9A 2YACA 3LJ1A 4OBOA 2FSMX 4RFYA 3R7UA 2OYRA 2B7AA 4KD1A 4E73A 3AXSA 1X8BA 3R8MA 2GPYA 4APCA 3UYSA 4FIFA 2R6ZA 5F9EA 2VTLA 5D41A 3ZDIA 4C2VA 4YUVA 3UGCA 4CKEA 3FL4A 2R3QA 3ZBFA 3FUUA 4ONAA 3PB3A 4AT4A 4CFXA 3LCOA 5F95A 2P40A 3NW6A 5EPEA 4FSNA 3FLWA 4FKRA 4TYIA 3MTEA 2OXTA 2GDOA 3U9CA 2WMWA 3C4FA 3MH2A 3IKAA 5HLPA 3ELWA 2PE1A 2AYPA 2CKEA 3H2BA 4HG2A 1DAWA 5T67A 4DLJA 2YWPA 3QGYA 3KKZA 4EKGA 4IM2A 3U81A 4FTKA 3HUBA 3U6JA 5LR6A 4W4XA 4EK4A 1FJXA 1WY7A 5ANIA 1RE8A 3IG7A 3C13A 2OJGA 3TKIA 3PJCA 3SDJA 4EH2A 5E8ZA 2WTKB 3RPSA 2IBTA 2VWUA 2Y0AA 1IASA 1IR3A 4KSPA 4X6QC 2UVXA 5JGBA 4C7TA 2NXCA 3P97A 1GY3A 1URWA 1MQBA 4TNBA 4WNOA 3P2IA 2ZCJA 3EN7A 4ZXTA 5G02A 3A7DA 3EFWA 4FG8A 4FK6A 3BWJA 3ETAA 1OKWA 1X1DA 4FL3A 3LCVB 5ETCA 2BR4A 1FPUA 1G3NA 1ATPE 4M67A 3P7BA 3PXQA 4WG4A 4BCOA 4QTDA 3TJCA 1IEPA 1OZ1A 4HPUE 4MKCA 4DH1A 2YIXA 5HILA 4OTIA 4BCNA 4YSMA 4HGYA 3P1AA 2UW0A 1DAYA 4M7IA 4C33A 4EHGA 5CAQA 1WXWA 2I7CA 3O17A 4ANMA 4E33A 3F82A 5IQHA 4X6RA 4FGZA 3UIUA 2I9KA 3DOGA 3FAAA 5D7AA 2DPMA 4RTOA 8MHTA 3TKYA 4CTKA 1OUYA 4FTIA 4E5WA 2WMVA 4BI0A 1VJYA 1Q3WA 3ZUVA 1NKVA 5IQFA 4KWCA 3FEGA 4A6DA 2IZUA 5M07A 3UJ7A 5JT2A 5E1SA 1JQDA 3GENA 4ZTBA 4R6WA 3ZYAA 2A2AA 4MD9E 4RA5A 3OW3A 2H6DA 3PXZA 3QHWA 2GS7A 3S4QA 1L3CA 4R05A 5ICFA 1NE2A 3OPNA 5K8VA 4PRJA 3BV2A 4EC9A 3AC2A 4BN1A 4DA5A 3ANQA 4DEHA 4FBXA 5TO8A 2FPOA 3NUNA 1OL6A 5CTPA 4A06A 1PY5A 4FTQA 3DH0A 4I6BA 4L00A 1O9HA 3AOXA 3EQBA 5BNJA 2AOUA 4F7JA 5IQBA 5LVLA 4TPTA 4GW8A 2WTIA 5E8UA 2GHGA 3B89A 4EUUA 2GS6A 2ESMA 4LV8A 2ONYA 5ANOA 1PMVA 4I1ZA 1YOMA 2C7RA 4PMMA 5FP5A 4BBFA 4C37A 3V5WA 4EK9A 4O0VA 1SVEA 2OBFA 3TRKA 1QPEA 4NECA 3Q32A 3AC8A 4BDCA 2ITYA 4POOA 3VW8A 5JFWA 4BCGA 2V0DA 4E5BA 5CCBA 4GL9A 3N4TA 4AAAA 2GS9A 3W18A 5IQGA 2ZDTA 2V74B 3MH1A 1MJFA 4P90A 5EM6A 2I0EA 5HCZA 5CENA 4FG7A 5ICEA 2OJJA 3E92A 5KMIA 2G1TA 5J9ZA 1HMYA 4NW6A 2F9GA 3WI6A 4A9TA 3BWMA 4PYNA 1H4LA 4FV3A 4CTBA 4C59A 3QLFA 4NW5A 3TXOA 4AT5A 3OWLA 1Q3DA 1KE7A 4BC6A 4ZSLA 1O54A 1XH9A 3ODZX 3QRTA 2B3TA 3I81A 2FK8A 4GOOD 2E9NA 4IJPA 1TW2A 3CVOA 3LAUA 4FTTA 1J1BA 2NP6A 2GS2A 5BVFA 2DULA 1OPKA 3M33A 5E90A 3OZ6A 5FA8A 4PUZA 1NW7A 3JWIA 4KDRA 2B9HA 4KRGA 2W99B 2X39A 4YJSA 2QYOA 4B17A 4FTMA 3NIEA 3W2PA 4IWNA 4LYNA 5I9YA 2ERZE 4RVGA 4BDBA 5FEDA 5C4KA 1IG1A 1XDSA 3GNIB 2G8NA 3DQWA 3QZGA 1V39A 2A19B 1GZKA 4HJOA 1BC5A 2UZDA 4Y30A 5BW4A 1PMUA 2UYCA 4WA9A 3FRIA 5BVKA 1RDQE 4DFXE 4UZDA 5HD7A 3AGMA 4ER7A 5CCXA 3E8DA 3MGYA 4JOAA 4BDHA 3FYJX 3HYHA 5C01A 2W17A 5M44A 4OQEA 2R4BA 4D4VA 3OT8A 4QYHA 3I0QA 4CCBA 4U7PB 3VSEA 3T8OA 1RJDA 1E9HA 3GT8A 3MSSA 3G90X 4BDGA 3D83A 3A8WA 5BYZA 3UVPA 3BI6A 4FT2A 4HSGA 1HNNA 5K3YA 3U4UA 2FYTA 2P4IA 1OR8A 2PT6A 4EVIA 1XBAA 3TNQB 2HV9A 2QI8A 3D5WA 2JH8A 1V0OA 2ZZMA 3CD8A 5CQUA 3MIAA 3UTOA 5E1EA 4HVHA 3C4WA 1OPJA 5E7RA 3QCQA 4YUQA 5DYJA 5M4CA 5HIMA 3ORTA 4YJUA 2WIPA 2C1AA 2C6KA 2Q0NA 2HENA 3NWWA 2GU8A 3D4QA 3IK3A 3NS9A 1FP1D 2IPXA 1WBNA 2OO8X 3GU4A 2ONZA 3UIXA 4FSDA 2B53A 3L8PA 2X9FA 3MCZA 3O7LB 1ZYDA 4FV0A 5C0OE 2PYWA 5C1QB 3SSNA 5AP5A 3I5UA 4QP7A 1UKHA 2XVDA 3FI8A 3PYYA 3KPJA 4CG9A 3B3FA 5EHOA 5HO8A 3FMKA 2YM7A 4DTAA 3FPQA 4MXZA 4JXJA 5IEVA 2AOTA 3QQLA 4ERWA 4YP8A 4YNOA 4FL1A 4G2FA 3PWDA 4DQ0A 4FKWA 1XKKA 4QDKA 4USDA 3VYWA 2R3JA 2O5KA 3P5KA 4IIRA 5FDPA 5E2AA 4WHZA 5G6VA 4M8TA 2OGVA 4JT3A 3ORZA 4GCJA 5LCKA 2FO0A 2UV2A 2V55A 4B0GA 3JWHA 3NCGA 3FQHA 2HW7A 3DAEA 4ZSEA 4AT3A 4AW5A 5C8NA 1EG2A 1Q0TA 2IG7A 3P71T 2EXCX 2GTMA 3RVGA 3TEIA 2AZTA 2NRUA 3QCSA 1QAMA 2BALA 3EN9A 2IVTA 2NP8A 2F4JA 3ZDUA 2PJDA 5CU3A 3R8UA 3JR1A 3SG8A 3M70A 4EZ7A 3P86A 3K2LA 4I94A 4IWQA 4CV9A 2CMGA 3VULA 2W05A 3QTRA 5MHTA 2BAJA 4TRLA 2RFNA 5E8RA 4BBEA 3E8CA 4V05A 1AV6A 4EYMA 5CU4A 1T46A 3AMAA 3E23A 4UXLA 2QR7A 4RRVA 5J87A 4QRCA 3DDQA 4R7HA 3BBTB 1RI5A 1KOBA 1ND4A 3DZQA 2XBAA 4B4LA 1G8SA 4A4LA 4ANLA 2PBFA 3ELDA 4E2WA 1Q8ZA 2OLCA 4GS6A 5E1BA 4W8EA 4DG2E 3LMGA 3X0DA 1Q8WA 2CLQA 4D0XA 2BZKB 2F49A 5HIEA 4E20A 1AD5A 2FCAA 1N2XA 3PJ2A 2JAMA 2HZNA 4EHVA 4EH4A 3PSDA 4XUEA 3MAGA 4M84A 2UZUE 3O50A 4FKGA 5KNJA 4O82A 3DLZA 4HYIA 2WMSA 1QAOA 5F2KA 1P4OA 4YTCA 2X7OA 2HCKA 2R3PA 3DBCA 4B7TA 2ITZA 2J2IB 4AZEA 4EOPA 4ZAUA 5A14A 1QZZA 5E8JA 4DCGA 2I40A 3SVZA 3D5XA 5BXYA 5KBRA 2VZ9A 2IW6A 1T43A 2OFUA 3F3TA 2JHCA 4FSQA 1U54A 5B2MA 4BP1A 5FP6A 2R3OA 1FVRA 4FTCA 1W7HA 3GU7A 3W2QA 3WZUA 2Y4PA 4FTNA 4O7LA 4E7WA 4X3FA 1PXMA 4HYUA 2OK1A 2XF0A 3UVRA 4BCKA 4DH7A 2H00A 4DFLA 2ZFUA 3K54A 5CSXA 1YI6A 3EB0A 4I3ZA 3FZRA 2YCQA 4WNMA 3WARA 3HA7A 5DTQA 4DLIA 4FIEA 3GU6A 2VTAA 4R78A 4MQ4A 1OVEA 2CGXA 3MFSA 4KKHA 4I41A 3DLCA 2J7TA 3QRUA 4WO5A 3RINA 5FQDC 3NUUA 5L2TA 2OO3A 1A48A 3P9JA 3JS2A 3LJ0A 4FNYA 3SHEA 2FYSA 2V7AA 2XNOA 4FI1A 3M11A 2XYQA 3OTVA 4ZY4A 3EL8A 3EH9A 2PZPA 4AP7A 5C26A 5AUXA 2OF4A 2VWYA 1QANA 2R3FA 3I7BA 2VTQA 4MWIA 2QU5A 3PTGA 3NAYA 4QTBA 5IZFA 9MHTA 4S33A 3BU3A 1N7JA 3KPYA 2GB4A 2CNVA 4AF3A 2XCHA 3G2OA 2VTJA 4AFEA 1OB3A 1SNXA 2WMBA 2J5FA 4J52A 3HNRA 2OB1A 5EOVA 4IE9A 3CP9A 4E30A 4BDFA 2WTKC 2XB7A 3ERKA 3NYNA 2V7OA 2IDKA 5G1XA 5AUTA 2QOQA 2C6DA 2QM3A 2YA9A 2P0CA 3PLAE 4GSBA 4L6QA 2W4JA 3RWQA 3KGAA 3GWZA 5DEWA 3W32A 4I0SA 4CKIA 3KULB 5AP7A 1D2HA 2FRXA 4JIAA 3F3UA 4R3CA 4BZOA 5LARA 3CKXA 3H30A 5LQUA 4WG3A 2G2IA 2CGWA 4KRDA 2E9PA 1WBOA 5I9UA 5EEHA 1S9JA 5D11A 5C8MA 5CZHA 5GJGA 5CVFA 3VS6A 4AS0A 1Q8UA 2E2BA 3PIXA 5BVNA 4U8ZA 3L8XA 4D9TA 3KXMA 3VBQA 3ZXTA 4XG2A 5EMJA 3TZMA 4UYNA 4S2ZA 3WE8A 3CPBA 5GM2A 3NNVA 3HVJA 4NKSA 2Z7SA 4AE6A 2ITUA 3VUDA 2Y4IC 3NYVA 5AV0A 1UIRA 2X7FA 3P78A 3KL8A 1U46A 3FMEA 4FIIA 2FA2A 4PMTA 5HVJA 1SQFA 1SUIA 1N7IA 4CXAA 3EIDA 4HRAA 3KXZA 3VIDA 2BRMA 5HX8A 1UNHA 3I5NA 2NXEA 4ZJVA 3R22A 3LX6A 4FV2A 2FHPA 3ZSGA 2R3SA 3DKCA 2W9ZB 1EIZA 4QMTA 3HCFA 5KS2A 1YOLA 3DJ6A 5E1DA 3RW9A 3CTQA 4RTRA 2C7QA 1WXXA 3HM2A 4KSQA 4O6LA 2WGJA 2X4FA 4DT9A 2FGIA 2BR3A 4I4EA 2V62A 1H08A 3FPMA 3CE3A 1NW1A 2E9UA 4G6OA 3O8UA 4Z55A 3FLQA 2PULA 2PY6A 4X61A 5I9ZA 3LHJA 5JGAA 4E8AA 4QO9A 4L67A 3QRKA 5E91A 3RJCA 3GCUA 4PYJA 2YM8A 3KA0A 3FHRA 4N6YA 4AGCA 4UX9A 4QVKA 2ZMCA 2VX1A 2WMAA 3LCSA 4E2YA 3A4OX 4GFOA 3LFEA 4OTQA 4YHTA 4IX6A 4FKVA 2Z02A 3COIA 3FMLA 3VS2A 2WZJA 4C03A 1W84A 2B1PA 3SRVA 5KMOA 3LFDA 3E3BX 3FMNA 4RJ8A 4U44A 5BP7A 4RYLA 3NVMB 4ZSJA 2VTNA 3MTFA 3WZEA 3FUXA 4DAWA 4EONA 3GEQA 4O84A 3LLAA 4RIYA 3EGVA 2JDTA 3FY0A 3CR0A 2YZAA 3FI2A 3UOLA 4BBMA 4PMSA 3C5IA 3HCEA 1WAKA 5HE1A 4F99A 2C3IB 3EWHA 4LOPA 4QYYA 1YI4A 1Q24A 4GVJA 1DUSA 3W55A 2B9FA 4EWHA 3UA4A 1ORHA 3JWGA 4HNIA 5T64A 3P23A 2PVNA 4OTDA 4XEYA 3VS7A 4EK5A 4FV5A 5M53A 3VVHA 3BKXA 3MGGA 4HVSA 5D12A 1VEBA 4BCPA 2EB3A 2W1GA 3AC4A 5KBQA 3P7AA 1Y91A 2QOKA 3ANRA 4KKEA 3FPGA 4ID7A 4RTMA 2BRNA 4QPNA 4L68A 5IEYA 4X63A 3NUYA 5AV4A 5KE0A 4DGNA 1CTPE 2Y9QA 1UFKA 4GFGA 3THBA 3MVLA 3PWYA 3VN9A 5FXRA 2BKZA 4YUXA 2PV0A 4F1MA 1H00A 3BLRA 3Q60A 5M4UA 4BIBA 4FEUA 4G9RA 3V3VA 4RZWA 5JFSA 5AV1A 3SW7A 2J0MB 4NFNA 3UQCA 2BM9A 3SOAA 3MFTA 1NVSA 2X2MA 3NUAA 4UB7A 1ZRZA 3R8ZA 1B38A 4XUCA 3GQIA 3KRRA 3QQHA 5IMXA 3WYYA 4RJ4A 3A4PA 3U6HA 4RVHA 3FPHA 2WMRA 2SRCA 4EOKA 4MWHA 2ORED 1RI1A 3W8LA 4Y83A 3HTXA 1BI8A 5M09A 2OIQA 5AA8A 1GZOA 3NNWA 4BI1A 2YEXA 2F2CB 4U41A 3PSCA 5TF9A 3ZLXA 4J71A 4D4YA 4S31A 3PXYA 3SOCA 5ICCA 1IY9A 2YXDA 2ONLC 1P91A 1Q99A 3DQXA 4FKJA 3S3IA 3Q7EA 1OIRA 2Y7JA 2ZB1A 3KULA 3QQKA 4DE4A 4BYJA 3FUWA 3M6VA 4UOEA 3FPJA 3QOXA 4M97A 3TDWA 4MAOA 2H1RA 2WQBA 3I5ZA 2X8IA 3GIWA 4DMGA 5DG5A 2VX3A 4AZVA 3PFQA 4ANBA 3D2IA 4MD8E 4LGGA 5FG8A 2WD1A 3QRJA 1TKIA 1V0PA 3F88A 3KXHA 2HY81 4B8MA 3BIZA 4IC8A 4MXXA 1IM8A 2VDUE 2P2HA 1M14A 2B55A 4X41A 4JAJA 2VWVA 2O2UA 2R2PA 2ZJWA 4CSVA 4E31A 3CJTA 3ULIA 2YM4A 4YO6A 3P8ZA 1R0EA 3I79A 3GRVA 4FGRA 4EORA 1I44A 1UU8A 4IB5A 3I0OA 3COKA 4FZ6A 5J5SA 4XV9A 4X3JA 4A9UA 2ETMA 4G3GA 3F66A 5E8TA 4FGBA 5HQ0A 3A4TA 1W83A 1PJZA 5E8VA 5BVEA 4G6LA 3UZPA 2BR1A 2GHLA 2C6TA 3FWQA 3QWKA 3M42A 4HGSA 4XP2A 2J5EA 4Y73A 2XK3A 2IGTA 2UVYA 3HV3A 4K6ZA 3QFVA 4YHFA 2JHPA 2JDSA 2Z7RA 3U8WA 3P9KA 1U5RA 2FVDA 5E8YA 3MW1A 4GEKA 1SUSA 3IW5A 3RWPA 3FUTA 2BH2A 4LUDA 4Y5HA 1VYZA 4YBJA 4QMUA 2Q0BA 3PFHA 3GNLA 5DM1A 2WEIA 4GBED 4E4NA 4YR8A 1H07A 4QP4A 1BKYA 2XNMA 5IISA 2QLUA 4M12A 2ZZNA 5JZJA 4HVGA 1JPAA 2JITA 3O71A 4S30A 3TV7A 3ZO1A 3ZRMA 3H9OA 1ZMUA 4CWAA 4ZTMA 2BTRA 2PVMA 1J7LA 4MHAA 3NDJA 3G5TA 4C4HA 5A6OA 2W5HA 3GOKA 4A07A 4R6XA 4N6ZA 4C07A 2XIRA 5F2NA 4WG5A 5DN3A 5EQPA 3S68A 2XP2A 2UZOA 4ANSA 1JQHA 1TVOA 4FSTA 5HHWA 1FVVA 5CEQA 4ACGA 4KIGA 4DC2A 2WU7A 3HDNA 2PVKA 4GU6A 3GC0A 5EOBA 5AP3A 2V7EA 1QYRA 3GDHA 4YBKA 1H28A 4FT4A 3IQ7A 3GC8A 2C7OA 4C4JA 2XBJA 4BTJA 3DOUA 3V5QA 4AU8A 4RIXB 3NUXA 3KQMA 4GOND 5FUBA 1KE8A 2X2KA 5CALA 3EEOA 4ZSAA 3KK8A 3EVFA 3IYLW 1MRVA 1QPJA 2W4KA 1RI3A 3A25A 5H3QA 2CHLA 3R01A 4H36A 5KYGA 5KX8A 3PT9A 5DEYA 2JBOA 4MYGA 4QMXA 5CX9A 3LE6A 5F1ZA 3R7EA 4BHNA 5J1VA 3A26A 3EGEA 4QTTB 5ERGB 3FKLA 3CJQA 3TJDA 4ZTRA 4X1OA 4E4XA 3QAME 3KU2A 4RSRA 4RLLA 3A7EA 1W0XC 3QZIA 3WIGA 5CLPA 3OXZA 3DXYA 2J0KA 2UW7A 4RTQA 5CVUA 3IHTA 3OG7A 1L3BA 2QLQA 3SMQA 5HZMA 3LQ5A 3PG1A 4KBKA 1IA8A 3E3PA 3B3GA 3FJQE 4FNXA 4A4OA 1R00A 3UBDA 3S2PA 4L01A 4QTUB 2IN6A 4F86A 2HOGA 2UZVA 3BRBA 3MFUA 4GIHA 4KINA 3BYUA 4YJTA 1JBPE 4B99A 4ZLOA 4APPA 1ZOGA 3P2EA 2WIHA 4GOMD 4ZTHA 3G5LA 1BUHA 2AOXA 4BGGA 2X8EA 3VS3A 4PNKA 1OBDA 4WSYA 2R7IA 5IG1A 3LMHA 3SRVB 3BKBA 3C9WA 3EVEA 4FT7A 5DRYA 2JIVA 4H1MA 5CF8A 4MTLA 5EHGA 3Q04A 3MH0A 4PYKA 1OKZA 3C0GA 3EMDA 2R3IA 4KB8A 3L8DA 3FZGA 1RJGA 4EWQA 2R3NA 1SQGA 3HA3A 3OU7A 1YDTE 4TT7A 3IDCA 5JRQA 3DFAA 4AN2A 1GJOA 3A62A 4GRBA 4K8AA 3S95A 3OZTA 3ALOA 4NL0A 3CJRA 4YSJA 4KDCA 4C3RA 1J91A 1ZGJA 2BRBA 3N51A 4RJ6A 5LMAA 2GMXA 5LWMA 4DCEA 2NXNA 1I4WA 2G71A 4PYLA 5GOZA 4ER3A 3T3VA 2QO9A 4M68A 1G6Q1 3LCDA 4FSRA 3DDPA 4NSTA 3F7ZA 4P7KA 2YHVA 5DM4A 3L8SA 5E9QA 5LCJA 4F7SA 5FUTA 1OBGA 3LLTA 3NW5A 2P2IA 3IONA 5EYCA 4BZNA 2I0VA 1E1XA 4QMQA 4ZLYA 3UO4A 4FZDB 3SKCA 1PW2A 3UNZA 2CMHA 4FT5A 4GEOA 4C2WA 2R3GA 1XWSA 4KRCA 4GG5A 3SXSA 3WF7A 2WMXA 2O65A 1BHJA 1O9GA 3NUSA 4RTPA 1GAGA 5CY3A 5DWQA 1JKSA 2XVAA 4F08A 2AUHA 4YJRA 2PXAA 4H3BA 4GVAA 4F7LA 5BVOA 3K5UA 5M4FA 2XKDA 3QX2A 2C6EA 2PL0A 5HG9A 4B6LA 3FZPA 3VBXA 4F0FA 3BWYA 2ETRA 2WPAA 4QQKA 2VD5A 2JAVA 3ZUUA 3Q4UA 2C30A 1RQQA 4WBOA 2Y4IB 1SVGA 2YVLA 5DSTA 2OPBA 2Z6AA 3PA4A 1Q41A 3SM3A 1B42A 3DNDA 3IO7A 3E8NA 4G3EA 2ITTA 3DPKA 4ZOGA 5BPYA 3TLJA 2BKKA 2YZLA 4RQVA 5HZNA 3PVWA 1OITA 3G2QA 5CXZA 5FXQA 3ME5A 2WMQA 3NGAA 4U79A 1OL1A 2F2UA 3TNIA 3Q53A 1R8XA 4IWPA 3R8VA 4KNBA 3DLIA 1ORIA 5BMMA 4BDAA 5IUIA 4J8NA 2CKDA 2XIXA 3CBLA 3ITZA 1REKA 4RC4A 3QQGA 3ZSIA 3DK3A 4ZZOA 3I58A 2CMWA 2E9VA 4HYHA 1JQEA 1JR4A 3HRBA 2JDRA 4ZK5A 1JKLA 1LP4A 2OSCA 3QRIA 4Y5QA 1FBNA 4ACMA 3PP0A 5DT3A 3W16A 2X9EA 4X21A 1X1BA 2F8LA 4FP9A 3MI9A 4ORKA 4P7EA 3R9DA 5JGDA 4HC4A 2OW3A 4YPDA 3DS6A 4IANA 3FRHA 4QPPA 3PA3A 2WQNA 4GJ3A 4XX9A 5JKGA 5AX3A 3ZZEA 2BZGA 3QC4A 2JD5A 3VBVA 4F9BA 4KBCA 5AAGA 2PSSA 3ZSHA 4G56A 2YIYA 1IRKA 2R0IA 4IJ9A 1P2AA 2PXXA 1M7QA 4MBLA 3QALE 2PMOX 4RVTA 2PWPA 2ZBPA 3EVCA 5LQNA 2C6OA 3R2BA 4FV1A 3KMWA 4TWOA 5IH4A 1R78A 3GRYA 3UJ9A 4XLVA 3PLSA 1ZOHA 3K3JA 2EVAA 2YERA 2JG3A 2NO3A 3A7FA 2HIWA 5T3QA 4AUKA 3EYGA 3CC8A 2ZVAA 2JC6A 2CCHA 5EQYA 3TPZA 1KV1A 4BY9E 4UEUA 2YIWA 5L3AA 1OPLA 1WFCA 3Q6WA 4F9CA 2AOTB 2Z6UA 5F2OA 1OM1A 3DA6A 5BYYA 4E6QA 4AGUA 5JZNA 4O7TA 3AC1A 4JBQA 2ZOQA 5F94A 3R9HA 3QYZA 5KCVA 4N57A 1Y57A 3UNJA 2O0UA 1KYWA 4OTGA 1MHTA 4FEXA 4NM0A 1OIUA 5CSPA 4WRSA 2CGVA 4C34A 4FS8A 4F9AA 3ELYA 2QO2A 1KP9A 1UV5A 3E62A 1FINA 2REIA 4RA4A 2PZIA 5FTQA 3GO4A 3DAJA 1M0EA 3DU8A 3WZJA 2VS1A 3JXWA 5ACBC 1ZHFA 4OA8A 2WHBA 3HEMA 2QKRA 2WB8A 3QX4A 2Q83A 3W33A 1VZOA 1WCCA 5HOQA 3QKKA 2JKOA 4C04A 5K5NA 2JEDA 3OTUA 4NJ3A 5ACKA 4IB3A 5L6OA 3U6IA 2JDVA 4O7NA 3PY3A 1CSNA 4HGEA 2BRHA 3UE4A 3OEZA 4I5HA 4C3PA 3VC2A 1ZYJA 4QMWA 2J0LA 4F1TA 1GIJA 1JNKA 2KW5A 4BCMA 4F84A 4G3CA 4M14A 3BT7A 3TI1A 1Z57A 4F0IA 4O7RA 4CT1A 3O2MA 2W1HA 4WUNA 5H8BA 5K4IA 4V0GB 4W4YA 1R8YA 4BDEA 3UPZA 4BGHA 1UWHA 4QYGA 3OROA 4JRVA 5HCYA 3UO5A 4PIPA 2XA4A 1G8AA 2QD9A 3G33A 3HV7A 2VWIA 3QC9A 2ADMA 4FT0A 5EIFA 2A14A 4D4SA 3HA8A 3FMJA 4J1RA 4EBWA 3KEXA 5K0NA 3CY3A 1WBVA 3G15A 4IVAA 4AACA 1OKVA 1NW3A 3U9NA 4X2FA 4CQEA 4XRLA 1PYEA 5TOZA 2VDVE 3H10A 4W4WA 5EH0A 1E1VA 2ONLA 2UVZA 5F4NA 4F65A 2QCSA 4KABA 4UWYA 3ZH8A 2H9VA 4X2GA 4ALUA 4OBQA 4K33A 5IA5A 2WXVA 2VGPA 2DS1A 3BKWA 3FTEA 2PMIA 4LMUA 5JN2A 5KHXA 2YTZA 3ZFYA 1WMKA 2OKRA 4PX6A 2CGUA 1JG4A 4WXHA 2QHMA 3F6XA 2C5OA 4U81A 5FBNC 5KQRA 3RK5A 4CTCA 4O0RA 4C3FA 2X6DA 4CRLA 3BGQA 3LXPA 4ZY5A 1JOWB 1F3MC 5JSMA 2Q41A 3C3PA 5U4XA 3FYKX 3MERA 4ZS0A 5EOLA 4PTCA 2XNNA 2B0QA 4YTHA 1VIDA 4CKRA 5DX1A 1JWHA 1QL6A 3PXRA 4Y2HA 4DKJA 4RC3A 4J53A 2NRYA 4ACHA 2RF9A 2P7IA 3KQSA 3FQEA 4RG0A 3V97A 4XV2A 4XG8A 5EYKA 4FKPA 3DBQA 2OKCA 5JK3A 4L7SA 1P1BA 1VYWA 4DGOA 3FPFA 2P55A 3N4VA 5IMEA 2Y8OA 4E6CA 5FWDA 4EZ3A 1PHKA 5C27A 1OI9A 5A6NA 3LL7A 3DLSA 3A8XA 2OBJA 1YI3A 4EOMA 4F9WA 4EOLA 2ZAZA 1OL2A 2QURA 3PS9A 1M2RA 4IMYA 5ANKA 2Y1WA 1SM2A 3G51A 5EEGA 2WMUA 3TKUA 5C1IA 4XP3A 3G0FA 2ERKA 4FT3A 2AOWA 4RTSA 3MY0A 3DY7A 5J8IA 1Q5KA 3PIYA 3RZBA 2ZB0A 4AFJA 4D55A 5J7HA 1YWVA 4YPSA 4D0WA 2P3QA 4OA5A 4GJ2A 2OH0E 2BIKB 3U54A 4QMNA 5JFXA 1RJEA 2IP2A 5HIKA 3PXKA 4RBLA 3V01A 4BZDA 3NYXA 2OB2A 4R1VA 5DXJA 2I0HA 3Q4TA 2IW9A 2YM3A 4I5MA 4E6DA 3VQUA 5KMNA 4LWOA 2ZWAA 3FHIA 4FICA 4EZ5A 5A4LA 3DP7A 3ELUA 3GU3A 3UJCA 3H4JA 4NU1A 1KE6A 5C8KA 1U54B 1V0BA 2RFDA 3FC1X 3DXPA 2X81A 1J1CA 2X8DA 3FMDA 1WZYA 4X3FC 3WOWA 3WZKA 4AZSA 4F6WA 4NK9A 4QNYA 2JKMA 3QTIA 2BCJA 3ZOSA 4G5JA 3FZOA 4RIYB 5E8XA 3R1QA 4ALWA 4HCTA 4O7YA 4OUCA 4CFNA 1FPQA 4JX3A 4X2KA 4EH5A 2PVHA 3MDYA 5DH3A 4FMQA 5P8WA 3HLLA 3B8QA 4D4RA 4H0NA 1H26A 4NJDA 3R0QA 4CKBA 4M7RA 3EOCA 1YKRA 2UW9A 3K3IA 2OZOA 4IEBA 4BIDA 1P39A 2BM8A 2P7HA 3SX0A 5I4NA 3FYDA 5L6WL 2VGOA 2R3MA 4L3LA 3QZFA 4QP6A 5AX9A 5EHLA 3RM6A 5HG8A 4I23A 3O23A 3KPWA 4K1BA 3KCFA 4PL5A 4QMVA 1P1CA 2OICA 3DBFA 5DM0A 3SX9A 2BIYA 5AV2A 3JPVA 1JSZA 4RFZA 3KC3A 4GYGA 1NBIA 5EM5A 1SNUA 4E6AA 2V5QA 4TTHB 3C1XA 4ZMFA 2ZBQA 3G9NA 4CD0A 2PY3A 3ORMA 2QOOA 2BZIB 4M37A 3T7RA 4GUBA 3SA0A 2QE6A 4AN3A 4USEA 3GXOA 4UY9A 3IOKA 4YU2A 3D0EA 3KRLA 1PXIA 3ORIA 4TXCA 1W98A 4ANQA 4BVUA 5A4EA 5I5ZA 3TR6A 3AY0A 2AC5A 4KIFA 2RIOA 3ELJA 5B2KA 4I6HA 3PTAA 3WF6A 4GUAA 2BFYA 4M13A 3RIEA 3T7SA 3I9FA 4RVFA 4NTSA 3MA6A 2WFYA 5AEPA 3G8AA 2C3KA 4DH5A 5IQEA 5FBOA 3R21A 3NDMA 5EFQA 5L8LA 1GZ8A 3KQVA 4DF3A 2GLUA 2WTJA 5JUWA 3VAPA 2OJFE 4GK3A 3KKVA 1BX6A 2WTCA 4RQKA 3DFCB 1YWRA 4O7VA 3HV5A 1GOLA 2BVAA 4KS8A 3D5UA 4PY1A 4RIWA 4JG6A 5JH6A 1H0WA 3C7QA 4QYEA 3DTCA 4FYOA 4GK2A 3TACA 3VC4A 2G1PA 4MXCA 3LFCA 5CD1A 3QKMA 4V01A 4FEWA 4IBMA 3Q87B 3ATSA 3UJ8A 5KMKA 2G72A 5LQRA 4FV6A 3LW0A 4O96A 1PYXA 2GQRA 2QOIA 3QD3A 4IB0A 2QHNA 1INLA 4CKCA 2PUPA 4AA0A 5CEKA 2C7PA 3LQ3A 3FE3A 1PXNA 3I64A 2G2FA 2BR5A 3HVIA 3IW8A 4E26A 2OJIA 2W1EA 4MTAA 1BL6A 3MH3A 3RCJA 1H1PA 3V8SA 4HVIA 5E2BA 2VWXA 4ENYA 2OY0A 4LQMA 2RKUA 3NNXA 4TWPA 4U42A 4C02A 2ZIGA 2EX4A 3D94A 3MFRA 5FTGA 3RCDA 3EJ1A 1R74A 4XG7A 3UO6A 3HEGA 4U97A 4ACDA 5DPVA 3BYSA 3CSVA 1KUTA 3Q2JA 4IHPA 4I6QA 1XH8A 4IQ6A 5CSHA 2OIDA 3QYWA 5GP1A 2YISA 5M56A 5IU2A 3ROCA 2VU3A 3IDPA 1Y8CA 4D2SA 2PVYA 5HBHA 3R9OA 4ZTLA 4LG4A 3FTDA 3SLSA 5BW5A 4MXAA 5FADA 3EVBA 5FM2A 4IZ5A 5DPMA 2CCIA 3V5PA 1BLXA 2AC3A 4L7FA 3FC2A 4BDKA 1R6AA 3OFJA 3KQOA 5EKOA 4CRSA 2VWZA 1FQ1B 5KZIA 4MXYA 1PXPA 3CGOA 3NYOA 4TN6A 4DFYA 1XVAA 5EHIA 4PYMA 3FKOA 3PE1A 5GM1A 4DFBA 4YC8A 3KU1A 4KAOA 4A9RA 4L42A 3PFGA 4O0YA 3OOMA 1MP8A 4F0GA 3H9FA 2GAFA 4DINA 3BQCA 2JKQA 2CKPA 3ZTXA 1PXKA 5JQ8A 4IVBA 4TL0A 2VO0A 2CKQA 4I0RA 1Q61A 4C35A 4ER6A 5KO1A 4MVFA 1XCJA 2O06A 3VF9A 4I20A 3I7CA 3MV5A 3VNTA 3ZMMA 2W96B 3AXTA 3BGPA 3G2FA 1UWVA 3LHDA 1UKIA 1Q97A 5F20A 2ZULA 3SD0A 3ZBXA 3GGFA 3ZCLA 1Q0SA 3EKKA 4ZIMA 4IH8A 3TUCA 2YM5A 3SXJA 3RAKA 4TKSA 3CS9A 4IDTA 3FI4A 3UG1A 2CN5A 3KPUA 3FSFA 3SSMA 2JBPA 4PMPA 2B9IA 4LFIA 3DUWA 4OQDA 4UN0C 3FLYA 3EFKA 4QQTA 1OKYA 2WELA 4G31A 3ORKA 1STCE 4O7SA 4HZRA 2BPMA 3C0HA 3F9NA 5LQFA 4R6VA 2IVUA 5JRSA 4ZEGA 4Z7HA 5EMLA 4IX3A 3OE4A 3HMOA 4L9IA 5IPJA 4GYIA 4KW7A 4EK6A 3TTJA 1ZQ9A 4HCUA 1DI9A 3BXOA 4GH2A 3HMIA 3CCNA 3OWKA 4FYNA 4H3PA 4MNFA 5CEIA 5LVOA 1VPTA 3ORHA 4CZTA 1YB2A 2G15A 4MQ2A 4FSUA 3BCEA 2XJ1A 5AWMA 3RPVA 4E2ZA 4Z2YA 4IDVA 4UWCA 3F2AA 5EZSA 5DTRA 1OECA 1LUFA 3V8TA 5CUQA 2BAKA 5EYMA 3OU6A 5EQJB 3QCYA 5FGKA 4AW1A 4U5JA 4PONA 5I9VA 5CF4A 2ZM1A 3IOPA 3C50A 3SV0A 1X19A 4DEEA 4ISCA 3EQIA 4AW0A 5A9UA 4U6RA 2K4MA 4RX1A 2IVVA 4PQNA 4O0WA 5I9XA 5J1WA 2R64A 3HCAA 2ITNA 5CWZA 3QXOA 5GWXA 3ORLA 2B9JA 5DI1A 3A7IA 3LCTA 4BF2A 2PVCA 3EMBA 3GRRA 3LXKA 3LFBA 3R1YA 1NT2A 3KB7A 3FXXA 4L43A 4ITJA 1U4DA 2PX2A 3OFKA 1OL5A 4QQ5A 4Z7GA 3Q9XA 3BHVA 4EH3A 2H8HA 2WNTA 3CJGA 4OTRA 3SC1A 5M4IA 3QBNA 2J9MA 2W1CA 4KKGA 4RT7A 2HWOA 4ZJIA 3LBYA 2H34A 1DS5A 3CY2A 5K03A 2Z2WA 4UYAA 1R3CA 4RWZA 2PU8A 1XH5A 1QPDA 5AUYA 2XEZA 4XYFA 2OFVA 2VO3A 3DAKA 3MVMA 5CXHA 1XTPA 3P9CA 4PWYA 4F6UA 3PZHA 3DK6A 4EBVA 3MJ1A 3LBFA 4EQMA 2OXXA 3RHKA 1V1KA 1WS6A 3RAHA 3TQSA 3EVDA 4MWZA 1AQJA 4D28A 3UYTA 3O0GA 2WO6A 4JDKA 1B6CB 3NW7A 4QP8A 3Q9WA 5AUWA 5DX0A 2WAJA 3F7WA 5L2WA 3NWBA 1M2QA 3Q52A 4UWBA 5EK7A 5DRDA 3LFFA 5HNIX 3KVXA 5DFPA 5CVDA 3CD3A 1M2PA 4M38A 2PUUA 4EQCA 1D2CA 2NYUA 4IAKA 3BHTA 3HMMA 2VAGA 2A1AB 2WQMA 2H11A 4JBPA 3VWAA 3CQEA 2YFXA 4PCAA 4Q5EA 2NPQA 3H0YA 4U3ZA 1O9UA 3R9NA 2QY6A 1YHWA 3AJDA 5A4QA 3NNUA 4OW8A 4CG8A 2I1MA 3QLGA 5CI6A 5AP2A 3SGCA 1L9KA 4U3YA 3LECA 1YF3A 4GC5A 5DRBA 3GVUA 5CIYA 5E1MA 3UWPA 3NPCA 4N4SA 1PXLA 3M6WA 2PWLA 2OXYA 1XDUA 5IA0A 3KR0A 4IACA 2PTKA 2XCKA 2C0TA 3VBTA 4A9SA 5M5BA 4BDDA 3MVJA 3OWPA 3PPJA 3QA8A 4FNWA 2ITOA 4WBBB 5CANA 2P33A 3JY9A 2X2LA 5L2IA 2VX0A 3QTUA 1MQ4A 5K0BA 4MBIA 3CQWA 3L9LA 4I5PA 3MJ2A 3EYHA 3C4EA 4FV4A 4Y95A 3ENMA 3Q9YA 4YV0A 1SMHA 1S9IA 4FKUA 4AZWA 2GFCA 1BOOA 2XK4A 3BZBA 3WBLA 5FDXA 5DOSA 4RC2A 2ZM4A 2W7XA 3OMVA 4IAYA 3RPYA 4GU9A 3ZXZA 5EG5A 3FLSA 3FDNA 2ITPA 4OTHA 4C08A 4DZRA 3HMPA 4C05A 3PZEA 5FULA 2Z6QA 4MX9A 1NW8A 5ANDA 3CGFA 2PT9A 5CF5A 3T3UA 5DLSA 3V5LA 3KQYA 2RFEA 4KIPA 2BHHA 3QQUA 1YXTA 1U5QA 4WNPA 3UC4A 4FV7A 4P5ZA 4DBXA 3RPOA 4IAZA 4PWNA 5A4CA 2ITQA 4LRKA 3C5UA 1CM8A 3M1SA 5FM3A 5FWAA 3TKAA 2HK5A 1SVUA 4FVPA 4DA4A 3G0EA 2XNGA 3RAIA 4EHZA 3UQGA 4CEGA 3QTSA 1BYGA 1ZGAA 4DGMA 4J96A 3S0OA 1GIIA 3C6MA 5JR3A 2N47A 4BYIA 1WBTA 4FV9A 4XOYA 1Y6BA 2IZTA 4GG7A 3RKBA 3RM7A 4HH4A 2DUVA 5IDNA 2OG8A 2XEYA 4QOXA 4YHJA 2B4SB 1P14A 4FZFB 4L44A 2C6IA 4OR5A 2AN4A 1ZYCA 2R0UA 2VNWA 3L9NA 1PRYA 2YM6A 4O0UA 2XKEA 3Q3BA 3Q5IA 3UP2A 3MBLA 2WU6A 3ZRLA 4AGDA 4DCAA 1JSUA 3CEKA 3VBWA 3MPAA 4BICA 1EQAA 1KHHA 5KMMA 5FQNA 3GXLA 4C61A 3JYAA 3Q5ZA 3LKDA 2ITVA 2ZTHA 1A9UA 1EJ6A 2R3LA 3QXPA 4ZP5A 1ERKA 4J8MA 2XNPA 3E7VA 4O6EA 3T0IA 4HTFA 1O6LA 3F61A 3IPHA 4NM5A 4L53A 2HZ0A 3H0ZA 5CEMA 1VQ1A 3MHTA 3KXXA 4Q9SA 2R7BA 4GFMA 5HLWA 4FK3A 5AM6A 4ZTSA 3HP7A 4PL3A 3R63A 4RLKA 1QPCA 5HIJA 3SAYA 4QMYA 1Q62A 2XK6A 4J97A 3QD4A 3W2OA 4F1OA 2UYQA 2UYOA 4NIFB 4YMGA 4CTJA 3OW4A 2JIIA 5AP6A 4E93A 4TW9A 3G6GA 3HRFA 4I24A 5DT4A 3WF9A 3UJAA 1KXZA 3UG2A 2YWVA 4HZSA 5LQCA 2CDZA 3HAVA 2W06A 3BWFA 3OFMA 3AT4A 3PG3A 3OCGA 4EC8A 4EOSA 2J51A 3RNIA 1RI2A 3MN3A 3F2NA 3VUIA 2OIBA 1KE5A 3PRFA 2C69A 4DN5A 4JIKA 3DTNA 4EK3A 2WOTA 2ZSUA 5I9WA 2OJ9A 5BX0A 3DJ5A 3KQWA 2YR0A 3CJFA 3FUPA 1DCTA 4OLIA 4RJ7A 2JHAA 4BLUA 5IA3A 3EMGA 3GRUA 2PVLA 4I5CA 3ET7A 4U43A 5IQAA 5CF6A 2Y6MA 4FKSA 5GIPE 3FXWA 2ZW9A 3KRXA 3FPEA 3KR2A 4EH9A 4FKTA 4Z3VA 2X7GA 2X6EA 2YXLA 4YMJA 4Y46A 2EU9A 5CVJA 3EZVA 3POOA 3PX3A 3A61A 3ZZWA 4FC0A 5BQ0A 2EG5A 3NAXA 5J95A 4YJNA 5EW8A 3EQRA 4PV0A 1RW8A 5ETIA 1X1CA 1EJ0A 5GHVA 2PK9A 3PJ8A 3THRA 4G6NA 5DXAA 4FOCA 4EJ7A 2B54A 4BHZA 4DHFA 1H1WA 1PMNA 1YDRE 5GNKA 4XG4A 4DYMA 5DT0A 3VW6A 1P4FA 3OOGA 3V8WA 3HZTA 4FOBA 3IW6A 3SXFA 2F7XE 4P5QA 1JSVA 5DLYA 3ER9A 3R6TA 4QTAA 2UZLA 3JVRA 4U7TB 5CT0A 4YURA 4NYEA 1WBPA 1H1QA 3OUNB 1J7IA 3NCZA 3BGIA 3MY5A 1JQ3A 1TQPA 5GIOE 3F2RA 3MPTA 3BHYA 4PNIA 4MF1A 4QPAA 3MS9A 4M3QA 3QHRA 3TZ8A 5HORA 1SKMA 4H1JA 3BEAA 5K01A 4YNEA 4QNAA 5DBXA 4AX8A 3GCVA 3NIZA 4GKHA 4DEBA 4JL9A 2BTSA 5CNOA 4IADA 4C38A 4E1ZA 2IVSA 1AGWA 2W1IA 4KS7A 3UMXA 3HVHA 4PTGA 2IZRA 4P7GA 1REJA 4YV2A 3MYGA 4TYGA 5A3XA 2GA9A 5CSVA 2GNIA 4ZTNA 3TTIA 5HVKA 5IUGA 4EL9A 3QD2B 2W5AA 2YJRA 4IWOA 1KPHA 4HYSA 3EQHA 1L8TA 2W4OA 3AXWA 3E8EA 2C68A 3LXLA 3DMFA 4PGGA 3D15A 5FTOA 1PKDA 2DQ7X 5ETAA 3W2RA 2ZDUA 2VTMA 2XH5A 2XM9A 4LOOA 3UA3A 4MEDA 4XCUA 3GP0A 3KCKA 2I0YA 4V0GA 3PE2A 2C6MA 4EJNA 5K9IA 5D1NA 2C0OA 2HMYB 4BP3A 4RTLA 4FV8A 4XV1A 1K2PA 3MWUA 3OC1A 5AA9A 2H96A 4FTOA 4PP7A 4RJ3A 3NDIA 2WEVA 2OWBA 3HA5A 2C4GA 4LRMA 2CN8A 3OE5A 4FEQA 1KOAA 3E8SA 4FIHA 1R39A 4WKQA 4AA5A 4BI2A 2XS0A 2PZYA 3UIBA 3LM0A 3LCKA 3AD6A 4MXOA 4QYFA 3UDBA 5HEKA 1PMEA 3FYCA 1Z9XA 3AMBA 2XBMA 2QKWB 1VBFA 3SQQA 1M6YA 3OWJA 2HAKA 4FKQA 3UOJA 4DBNA 2Z7QA 3LXNA 5ICGA 5IQCA 4EQUA 2OF2A 4HGLA 4AZTA 2AS0A 3GQLA 2GPHA 5TKDA 4B8LA 2CL5A 4WUAA 4PINA 2WTDA 2GQGA 1MUOA 1R0PA 4QMSA 2JLDA 2WTVA 2W0JA 3TM4A 4ER5A 5KVAA 3R7OA 1XR1A 4BCJA 1JG1A 3G7UA 3ORXA 3OY1A 4F64A 2XNBA 4OTFA 2C5XA 5KUPA 3RK7A 1A06A 4CGAA 1VLMA 4FSXA 3EQPA 5K0LA 2OU7A 5IQDA 2ZVJA 4IM0A 4NTTA 5AUUA 4WNKA 1PKGA 4O91A 4PNEA 5BVWA 3KN5A 2O57A 3LPBA 5L6PA 1ZY5A 2IO6A 1G60A 1JTFA 1YRPA 3A2CA 1YQJA 3MA3A 3K6RA 5HG5A 3P0MA 4FSYA 3EN4A 4XV3A 1GZNA 4MBJA 5M06A 5AADA 4DGLC 2P35A 3F69A 1G55A 3R24A 4JG7A 3P79A 4R5YA 2FB8A 4WOVA 4F09A 5E92A 3ZEPA 4AWIA 2JKKA 4ZJJA 3TM0A 5EDQA 3R1NA 3DMGA 1J3HA 3G8BA 2PVRA 5LQJA 2XNEA 4CXMA 3QQJA 2FUMA 4NWMA 3ZONA 4H39A 3LFAA 3P2KA 3TDVA 2W1DA 3BYOA 4HGZA 4O2ZA 4YV1A 3F4KA 5FCDA 3I1AA 4YUZA 3OUKA 1LEZA 3Q4ZA 5E4HA 2IW8A 2VRXA 3M2WA 2WOUA 4EHEA 1FMOE 3GCQA 2X1NA 4EMSA 3D2KA 2ZZKA 5EDRA 3TT0A 1L1EA 4ZS4A 4I21A 1XJDA 4CCUA 3G2MA 5GJFA 1YXUA 2P41A 3QTQA 3G6HA 3W1FA 4BTKA 4RIOA 3KQ7A 4YLLA 3PY0A 2XIKA 3HNGA 3SG9A 1XCLA 2Z8CA 3DKOA 1YFLA 4FZVA 1H1RA 1LPUA 4FIJA 3A99A 3E64A 3Q9ZA 4O27B 4EUTA 5IQIA 2CJMA 5IH5A 3TKHA 3QTXA 4Q2AA 4C4IA 3E87A 4DTBA 4EOOA 3GRZA 2BMCA 4ZTQA 3Q6UA 3EQFA 4UXQA 1K9AA 2I6LA 3OCJA 3WF8A 3F5XA 3E88A 3CBGA 4L3JA 3KQQA 1H1DA 4D1SA 4RWKA 4YC6A 4IX5A 4XG6A 3JY0A 2O8YA 3I6WA 3BQRA 4JI9A 2A0CX 3DR5A 2XJ0A 1NXKA 4AA4A 4HW7A 4MH7A 5AUVA 2YDIA 1YVJA 3FV8A 3LOKA 3H3CA 1ZWSA 3QTWA 4QTEA 3B2TA 2XRWA 3KFAA 2PZ5A 1NVRA 3PPKA 3VS4A 2QR8A 3R3HA 5T6KA 2BZJA 3ERCA 5AAEA 3AC3A 5H02A 4LG1A 3M6UA 5BYLA 3U55A 4F70A 4HNFA 3I60A 4FR4A 5AMNA 2IJMA 2W1ZA 5EZQA 2WQEA 3FSKA 4KBAA 2PZRA 5TT7A 3TG1A 3PY1A 4XBRA 3VQHA 5A4TA 5BUIA 1FP2A 2B2CA 5HU9A 3C4ZA 4BKJA 3B8RA 5IKMA 4Y8DA 1H27A 5HG7A 3GI3A 3DCVA 5JEBA 2VP3A 3F3WA 3EGIA 5HFJA 10MHA 4AZFA 3FQSA 3KRWA 5BVDA 4AOJA 3OBJA 3UZRA 4LI5A 4R3PA 4I6FA 4YTIA 2P3GX 5E9EA 3V51A 1NV8A 2ZMDA 2UW3A 1JVPP 2GHMA 5CAOA 1BMKA 5K5XA 1L3RE 4ASEA 2O64A 2GQSA 5FRIA 3R0TA 2VN9A 1M17A 3MB7A 3AWIA 3EN6A 1H25A 4RSSA 4L8MA 4DFUA 4P2KA 3TV4A 2J0JA 3SGLA 4FG9A 3DNEA 3LDUA 3NTVA 5C03A 3NR9A 4A9YA 5EW9A 2C47A 3UPXA 3VO3A 4EI4A 4DFZE 3JWJA 3JUHA 4X3FB 3UOKA 3ZM9A 4C4GA 5HD4A 3DBEA 4YZ9A 3OEFX 3QU0A 4S34A 3NUPA 5J9LA 2HW6A 2V22A 4UV0A 4IAAA 3PUPA 3NSZA 2VV9A 1T45A 3CTJA 2Y1XA 5AUZA 4CV8A 1GIHA 5DGZA 3VRYA 4EH6A 3TV6A 3MCTA 2O63A 5CAVA 3IDBA 5DRTA 4C4AA 3BE9A 3RMFA 4XJ0A 3D7TA 4LECA 3NX8A 4FZ7A 4XP0A 5ITAA 3DJ7A 1FOTA 3DXNA 2Z60A 4QP2A 3REPA 2GNJA 3CQUA 4NCTA 5EI2A 5LVNA 2GH1A 5KHWA 3BYVA 5CEOA 2WA1A 4QDJA 4XOZA 4II5A 2XIYA 4FIGA 3UIMA 4RVKA 4C62A 4D2RA 1EAMA 4RJ5A 5AJQA 4V0RA 2QRVB 3C4CA 5AAFA 2CNUA 1WZNA 2C3JA 1WG8A 2UW8A 2IFTA 7MHTA 3FMMA 4Q9ZA 1ZOEA 1H8FA 2ITXA 3VS5A 3ZUTA 5CASA 4CFFA 3R7IA 4ENXA 4J95A 2PE0A 2FSLX 3HCBA 3GB2A 5EVJA 3SR4A 3QUEA 4X60A 4FA2A 2P1DA 4EQZA 4XS2A 4IFGA 5JQ5A 3FBVA 4M15A 4JQ8A 3POZA 5GINE 2QONA 5E9WA 2YN8A 3MIYA 5CAPA 2XK9A 4RTJA 2UZTA 1MRUA 2HZ4A 5JFVA 4JQ7A 4JBVA 1Z5MA 4IB1A 1ZAOA 3NEWA 4Z9LA 4S32A 5H8EA 1JSXA 2I6GA 3KQPA 4F85A 3CKWA 4L46A 3OXIA 2RG5A 1YXXA 4WVLA 2F7EE 5LVMA 3ENHA 4OX9Y 3DXQA 1PXOA 2JFMA 3HKOA 3HMNA 4MD7E 3HUCA 1F0QA 5GJDA 4XRJA 2OH4A 4C58A 1WBWA 2YAKA 1OIYA 4IVDA 5CAUA 3UZTA 3PX2A 4RVDA 5E8WA 4RZVA 1QCFA 3ZM4A 4P4CA 2IH5A 3DB8A 5B2LA 2PUIA 4JBOA 1R18A 3V5JA 3SVVA 3OBGA 5H2UA 2C3LA 4IVCA 4ASDA 5C9CA 3HCCA 4W4VA 1Q4LA 1BI7A 3QQFA 5EMKA 1G38A 4TWNA 3F5GA 4RWIA 1KPIA 4EKKA 4DCMA 2WK1A 4HTFB 1XBCA 4QP1A 3RHXA 4BDJA 1I9GA 4O22A 4FEVA 3LMIA 1KYZA 3GFEA 5ETFA 3TL8A 4JDIA 5KKRB 2IDJA 3I53A 3IV6A 3TIYA 5HEZA 1ZZLA 3SSOA 3OD6X 2AN5A 5EHYA 1UU7A 4MQ1A 4BCQA 4FE2A 5IEXA 4YUYA 3UNKA 3PVGA 4AGWA 4P7FA 1Y6AA 3KXNA 1F5QA 2O07A 4YJVA 2ZLBA 4FTJA 2HTEA 3BUSA 2PWYA 4TYHA 3ZFMA 5K0CA 4FTAA 1ZKDA 5D1JA 2KTYA 5DA3A 3WZDA 5CI7A 3CTHA 2O05A 3O7WA 3KR1A 1JG3A 3C6KA 3R00A 4J99A 4O7WA 3ZO4A 1ZARA 2HELA 3BU6A 2W5BA 1DM2A 2YITA 3BE2A 3AD4A 5M55A 1KWPA 3HP5A 5CVGA 4TZRA 5HBEA 4BGQA 2BRGA 3MY1A 1JG2A 4ITHA 2VTSA 3G2PA 5EKUA 1TQIA 3BGVA 3ODYX 3EQGA 4FT9A 2RGPA 2YCFA 4YJOA 3B7PA 2GCDA 3CPCA 1RJBA 1B39A 4M69B 4QVGA 5EGSA 4IW0A 4G1WA 1H24A 1OUKA 1TPYA 3UJGA 1OIQA 5HX6A 4LL5A 5L2SA 4YZCA 1YHVA 3HRCA 1ZLTA 4K11A 3VUKA 3EN5A 3KK9A 4IWDA 1Q8YA 2ZBRA 3EEYA 3UOHA 4FSMA 4DG3E 3R28A 4IZAA 4ZY6A 5HE3A 3HX4A 4Z16A 3C0KA 5CSWA 3W10A 1JKKA 2A4LA 2JDOA 2C5YA 2OI4X 3KMMA 3QCXA 4LOQA 4F9YA 1TQMA 4H58A 2HWPA 3GJYA 3UFBA 5C9ZA 1IXKA 2Z7LA 5CU0A 2EUFB 3WIKA 2PX5A 3JVSA 4OTWA 3U4WA 5CQWA 3CKKA 4E70A 4IKPA 3FLNC 3O8PA 2UZNA 3I4BA 5AFVA 2XMYA 4HCVA 4W8DA 4N0SA 5ANEA 3KXGA 3KVWA 4BDIA 4LM5A 2NP7A 1FMKA 1XBBA 4DGGA 4M36A 5DTMA 3U51A 3LZBA 3TOSA 4MNEA 4IAFA 1XHAA 5FEEA 3C4XA 2EXMA 1ZZ2A 2W9FB 3GU8A 4QMLA 5EG3A 2XK7A 3DKGA 4JRNA 2C1BA 1KV2A 2G9XA 3DGKA 2PUNA 2PHKA 5H8GA 3ZRKA 4L3PA 2ZM3A 3BX5A 3LFNA 3VUMA 4PYIA 1MRYA 2GFSA 3HVCA 2OZAB 3N4UA 4TYJA 3K0BA 3ZU7A 3BLHA 3AQVA 3LKMA 2AVNA 2KULA 4TNDA 4K9YA 3MB6A 5HI2A 2ACXA 3HVKA 2R3KA 4YJPA 4KA3A 2OXDA 4TYHB 2ZYBA 4JR3A 4F63A 5CVHA 4V0QA 1WVYA 2HZIA 3EZRA 5HTBA 3R30A 1SZMA 3AD5A 5DSXA 3EVGA 5CS6A 1NW6A 4R3RA 3VHKA 4FTUA 3MTIA 5E1OA 3OCBA 2GNLA 1UA2A 1YZ3A 2RFSA 2VO6A 1JTEA 1BL7A 1JKTA 3CXWA 3PJ3A 4YLKA 3UJDA 1VP9A 4DH8A 2Y6OA 4PDPA 3TZ7A 3R9XB 2GSFA 2XRUA 3QUPA 3ZLYA 3R7YA 5DR9A 4AE9A 4YO4A 2XYVA 2IH2A 2IH4A 2PLWA 3G89A 5CT7A 5CEPA 4O21A 4G5PA 3EFJA 5AV3A 4FKLA 5H9BA 4EK8A 1RJFA 3O31A 3S1HA 5EIWA 3FL5A 2HXLA 4HGTA 2PX4A 3R1SA 3HGKA 1YOJA 4QQJA 4RWLA 4F7NA 2ZIFA 4QQNA 3DULA 2NNWB 4LUEA 4I92A 4K6MA 5LOHA 3QZHA 2E9OA 4IM3A 4X0MA 5FLFA 3R8LA 4RPVA 3BV3A 2PX8A 4R8RA 5IA2A 4O7ZA 2GTNA 3BGDA 3VRZA 3BHHA 4LL0A 5C4LA 4JS8A 1LEWA 4ARKA 1O6YA 1WVXA 5CVVA 1J7UA 3RPRA 1QMZA 2O3PA 3LQ8A 4UALA 2ZIEA 4Y85A 3M4XA 3PDTA 4G3DA 4RMZA 4QT1A 3RGFA 3A7GA 2QOCA 3VUGA 3PJ1A 3MTLA 5A54A 2BAQA 5L8KA 4YJQA 1NW5A 1NV9A 3BHUA 1U59A 3UZUA 3VUHA 5AIKA 2BZHB 1HCKA 5ANGA 2VNYA 5EM7A 2XYRA 4RVMA 4U0IA 2P3OA 3CCFA 3FZSA 4AOTA 5K05A 5KKRC 3LM5A 3HL7A 4DEGA 2XYUA 3ZS5A 3QTZA 4F4PA 1XXLA 4R7BA 4XUDA 5EMMA 4GMYA 4JNWA 4U7ZA 3C0IA 2CLXA 2ZV8A 2XYNA 4I22A 5M08A 2GNFA 2EB2A 4JDJA 4M0YA 4RIXA 4DG0E 4DEDA 5HU3A 4ZSGA 3HV4A 4LWPA 3GCSA 3QUDA 5FEQA 5M51A 2YIQA 3KMUA 3IGOA 1NBHA 3KN6A 1ZMVA 4YZNA 5IA1A 3R83A 3LGAA 3TMAA 3FZTA 2YDJA 2WQOA 3A60A 5D9HA 3RK9A 4MIKA 4RTKA 4BR3A 3L1SA 2YX1A 5CU2A 3RAWA 5E9JA 4O2PA 5CZIA 3ZO3A 3DXXA 3NWEA 3KRJA 5T68A 3NRMA 4XG3A 1I1NA 3PVCA 2B52A 1UU3A 5EW3A 2PVJA 3PA5A 3O51A 4ALVA 5LJJA 3TUBA 2UYHA 4FTLA 4JG8A 3LVPA 3ZFXA 2AVDA 2EJUA 2UZ4A 3F3ZA 4J7BA 2CWWA 3BPRA 4YTFA 3T9IA 4ASZA 4RX9A 1HOWA 2FSTX 4MK0A 2BROA 4GF5A 3T9TA 1AQ1A 2VTRA 3UJ6A 2ZV7A 1YFJA 2AN3A 3GCZA 2LGCA 5KMLA 3GC7A 1NA7A 1M6EX 4DFNA 2XK8A 3QL8A 4K18A 3BYMA 4H05A 4L7VA 5D1HA 3DTWA 3PPZA 1U2ZA 4KWPA 4U9AA 3CLYA 4GT5A 4YZMA 5E8SA 1YDSE 3VS0A 2JGZA 2G2HA 4FTRA 4P58A 4M0ZA 5K0JA 4P7JA 1WVWA 3KPVA 2DWBA 2QVSE 4QMOA 3U87A 3QGWA 3GC9A 2X4ZA 2F57A 2YAAA 4PP9A 1ZG3A 2O0LA 1UWJA 3HV6A 4AN9A 5J9YA 1APME 3KY2A 3OF0A 3OCSA 4JQEA 4QP3A 3OHTA 4PDYA 3OZSA 4PYOA 4R7IA 4ACCA 3WSTA 3PSBA 3QA0A 4C4FA 5IUHA 2FSOX 2QOFA 2W1FA 2XIZA 4R5SA 4DH3A 3A27A 3KQTA 5DX8A 3DK7A 3ER8A 3AT3A 3P4KA 2QO7A 1I09A 3II5A 1JSTA 4G9CA 4GV1A 5AP4A 2PGXA 3GGDA 3C3YA 2X0GA 5HIIA 4H3QA 1Y8GA 4JLCA 5EC8A 4O38A 3L9MA 3GFWA 4ERKA 5K0GA 2C6LA 4CLIA 4A4XA 4OBPA 2YCRA 3UMWA 3AT2A 3TNHA 3VC1A 4EYJA 2VDWA 3ALNA 3FI3A 3DKFA 5HIDA 5DT2A 4XCXA 2XVMA 1M7NA 4CMTA 4XH6A 3R2YA 4RWJA 3GCPA 3FXZA 2J4ZA 5EI8A 2R3RA 5FHRA 5KMJA 4NKAA 3EQCA 3TUDA 1PXJA 4K77A 2R5TA 5AIRA 3IEIA 3UODA 4AW2A 3E7PA 5LMBA 2G70A 4XMOA 2WTWA 3BWBA 3ANXA 3RALA 3QV2A 4JXFA 5FA5A 1UU9A 5CYIA 3AGLA 4E2XA 4DTKA 3LSTA 4DM3A 3LIJA 4U45A 1GNGA 3KREA 2UZWE 2G01A 2QU6A 4GUEA 3TWJA 3WF5A 3WE4A 3ZHPC 4E5AX 4RX5A 1SG9A 3V8VA 5K09A 3SW4A 5DVRA 4OT6A 3R73A 4QMMA 4YZDA 4BIEA 5IF1A 4FZAB 4BCFA 4OT5A 4PDOA 4E32A 3FLZA 2JH9A 1OL7A 3UJBA 3PP1A 3IGGA 3QF9A 4XLIA 3EFLA 4TY1A 4Q5HA 1VR2A 2OZVA 1ZY4A 3O96A 4RIWB 3RTPA 4CFUA 4GT4A 2VWBA 4I93A 4L52A 5HNGA 5BUJA 4KUJA 4HVDA 2NXJA 4QMPA 2QOLA 4HPTE 3LJ2A 2VZ6A 2QOBA 2RG6A 2WKMA 3E7OA 2XJ2A 5CVEA 2HR1A 4XG9A 3DXZA 3VBYA 4C0TA 4C36A 3A7HA 3BELA 3R02A 4ATNA 4CKJA 2XKCA 3E93A 3IW4A 4I0TA 3ACKA 3EL7A 2CPKE 3OXTA 4E4MA 3I6UA 2C0IA 4XHKB 3PVUA 3G5DA 5EM8A 2XKFA 4DITA 2PE2A 5KZ0A 2GNHA 5TR6A 4DEIA 4HOKA 3LDFA 2QG7A 2ZV2A 1FVTA 5DHJA 1H0VA 2XZSA 3D14A 4O0XA 4AXAA 5I0BA 5LMKA 5EKXA 4IAIA 1URCA 4O81A 2IZSA 4NCTC 4IV0A 5LQAA 3BZ3A 3E5AA 4AUAA 3OS3A 5AM7A 5B7VA 5EKNA 2PVFA 2YIRA 3F5PA 4FVRA 1XH4A 2J0IA 4USFA 5HLNA 3R9RA 4KVZA 3FY2A 1ZXEA 4CZUA 3GBZA 3GOPA 4NT4A 2P8JA 3G88A 1YUBA 1CKPA 4EOJA 2ERCA 2PXCA 1CKJA 3TFWA 4B9DA 2C5VA 3D7TB 3R8PA 3TZ9A 5T6BA 2UZBA 4RVLA 1UNLA 4WIHA 4G34A 4EKIA 3ID6C 3PXFA 3LKZA 4V04A 4AG8A 3FZ1A 3GU5A 4G16A 4PTEA 4YUWA 3FTFA 2GNGA 5HESA 2JJQA 3F3VA 3ZC6A 4DEAA 2VTIA 2ESRA 2QODA 3NMUF 4UBAA 5DIAA 3NVKI 2AR0A 3E05A 3VS1A 4O83A 5HTCA 3HCDA 3ZC5A 4YLJA 3BEGA 3M6XA 2ZWVA 3MVHA 3W8QA 1RI4A 1JLUE 4JAIA 1DI8A 4YZBA 3KHKA 4ZZNA 4GKIA 1KR5A 4GOLD 2QC6A 1OMWA 1XQZA 2R3HA 3ATTA 4TWCA 1F3LA 4CT2A 3UVQA 2UZEA 4O0SA 2XUUA 2EJTA 5KQSA 1Z3CA 4FL2A 5BUEA 3G9LX 4NH1A 4O86A 5HVYA 5LVPA 1XDZA 1SYKA 3F5UA 4YGAA 4IV8A 5HBJA 3GUBA 1CMKE 2VTPA 3E63A 3ORPA 3ROYA 3H9RA 4IX4A 5DR2A 5DWRA 4BRXA 4PL4A 4AOIA 2VWWA 4MHTA 3B3JA 3W2SA 3P9NA 2XM8A 3TCPA 1XO2B 1PJKA 2ITWA 2VTOA 4IC7A 3ACJA 3RI1A 4BB4A 1K3AA 5EQEA 5BMSA 2YCSA 1TW3A 4FKOA 4G17A 4GIIA 3UC3A 2WA2A 4BCIA 1F38A 1DL5A 1ZYSA 3EQDA 5AP0A 2FK7A 2QNJA 2CSNA 4C4EA 5AP1A 3CC6A 3Q96A 1WBSA 4ITIA 4QTCA 4AQCA 4CFMA 1IAHA 4OBXA 3O7LD 3RP9A 2B25A 3R6XA 3NW9A 3L9PA 1X1AA 2VTTA 3DBDA 4FVQA 5HIBA 4F6SA 2PKWA 5FTWA 2J6MA 1VL5A 4R8SA 4O0TA 5M57A 1AF7A 3BBWA 4FSWA 3REOA 3ZEWA 3TN8A 1Y8YA 2F7ZE 2EWAA 3W2CA 3Q4CA 2WMTA 5IA4A 1VP3A 1P5EA 4FUYA 4JDHA 1FGKA 4X2NA 1AQIA 3BWCA 2I62A 3NJRA 4JJRA 5DE2A 3V6RA 3B2WA 4K0YA 5HICA 1D2GA 4FUXA 4FNZA 4L45A 4QPSA 5D10A 4QP9A 3L8VA 5LQKA 3V5TA 2EFJA 3MESA 4A7CA 1HCLA 2BILB 2HY0A 2YXEA 2QQ7A 4GK4A 4GQBA 4PGHA 3O8TA 2DYLA 2YJSA 4CMUA 3KF4A 5CNNA 4BTFA 1YW2A 4NFMA 5HNBA 3D7ZA 3WYXA 4ER0A 4LGHA 4D9UA 1OGUA 3COMA 4DT8A 2AOUB 3MB5A 2JIUA 3HAMA 4XBUA 2E5WA 4Y72A 3N9XA 1VE3A 2UW6A 5CM2Z 3Q2MA 1W82A 4EH7A 3HA6A 2IIPA 2CNQA 2BFXA 3R7VA 3CIKA 1R1WA 3OZRA 2UW5A 2VTHA 2HYYA 3MPMA 4R1YA 4RX8A 4D5HA 1PF8A 4PIMA 2RL5A 5HCXA 3NLBA 4GT3A
chains in the Genus database with same CATH superfamily
1SIOA 1R9NA 1YVUA 4HVTA 4X5OA 3WQSB 5I3CA 4H7PA 2HNKA 1PFGA 3SYLA 3H17A 3EK2A 3CRNA 4IXNA 2QJOA 4MGZR 1Y1PA 4RGJA 1LR4A 3WLMA 1XH7A 2H59A 1UFOA 5BMVA 3HDJA 1GTG1 4E4LA 4FDTA 4KGXA 3FZYA 4MLDA 5BSRA 4C7OA 1QK4A 2I7QA 1V8PA 2WIKA 2ATCA 2GO1A 1XVIA 2YMLA 3QK7A 6GPBA 4AIRA 3WO0A 3IMGA 4UUPA 4KLCA 1EQUA 5LXMA 3H5AA 1KSWA 4MVJI 4QQCA 2QYTA 1GGFA 2L17A 3DV9A 1C4OA 3VJOA 1FSGA 1RHUA 5HE0A 1ML4A 2X6QA 4JVGA 4Y9DA 2OO5A 3EX7C 4ZZMA 3K32A 2IFTA 2P9CA 3WQBA 4MCJA 4L28A 2F3PA 1PJSA 5EPEA 4AT4A 1Z4OA 4TKUA 4QGSA 3FPLA 2OCAA 1TYAE 4IDFA 2JBWA 3FNIA 2GJ4A 2ORIA 1QG4A 3UFXA 1EGQA 4P82A 4HZUB 4AO6A 3SDJA 1IASA 4C0SA 3EWAA 2QROA 3BWJA 5D84A 5DASA 2P2CA 5FR1A 3WWEA 4DH1A 2WVAA 3OX3A 1LKZA 5CAQA 2AKAB 3FJYA 4U6NA 2MMCA 2Z30A 2Q1TA 3KJXA 1KJIA 4ZXFA 1DV2A 4JGBA 4WLOA 1O95C 4ZK2A 3NUNA 1B43A 1XNGA 2H17A 2VNHA 1T8TA 3KP1A 4C29A 1ZP6A 3HE3A 4AJIA 2C7RA 4PMMA 3O8DA 4N82A 2PPVA 1GIAA 3VW8A 1JFFA 3SQXA 5IQGA 2XB4A 4BZQA 2Q4EA 3AJ9A 1W4LA 4E6PA 1XH9A 1VHLA 3U3OA 3E3AA 1DMSA 1XMPA 5BVHB 2ZM5A 3AKYA 2B9HA 2X39A 1SGWA 3WFJA 3EW7A 4HQ6A 3EXFA 2YYAA 3E8XA 3LOUA 3CT6A 2ZI6A 3R9IA 3OPVA 2I99A 2WWTA 4D4VA 1QNFA 1RJDA 3V1LA 4JVMA 3BI6A 4OCZA 1HNNA 2Q4DA 4DOMA 1GSHA 1OTYA 1V0OA 2VPXA 5J2UA 4ZVOA 1EM8A 3UIXA 3L8PA 2CFIA 4AJOA 1W49A 5C0OE 4X8LA 3UH0A 4Q0MA 4JBXA 2WJGA 4UUAA 4YJ3A 1HFWA 3DAEA 4ZYZA 3QCSA 4MWTA 1J00A 1UMBB 2RBEA 1MQ9A 2CMGA 1CUWA 3VPXA 3OIWA 1Y8RB 3WLLA 4QRCA 3DF7A 3VKWA 2WNHA 3STYA 5CT6A 4ZCLA 3SQMA 1G0OA 2JGFA 2F49A 3Q1KA 1LPBB 5JDIC 2VYQA 4H77A 4ZAUA 1A4RA 1BX1A 3SVZA 4NZNA 5FP6A 2R3OA 3EXIB 4DMLA 3W2QA 3AVTA 4ZRDA 4U5XA 5CXSA 2YCQA 2BFPA 3QA9A 4MDEA 3MBIA 3OTVA 3NAYA 2HHLA 5KO2A 1XO1A 3W0NA 4BZXA 4NLLA 2AEFA 3GN2A 3B6KA 1RNLA 5TV2A 3Q9UA 3PPVA 2FRXA 4ONEA 3F3UA 2X3UA 1WHSB 3S70A 2R6GA 2AHRA 1XD2B 2E2BA 5FOWA 3WB9A 4D9TA 3H19A 1EVKA 1S2LA 1PWHA 1QH0A 2ZIXA 1K7FB 1DWUA 3I6BA 1U46A 3FMEA 3KXZA 4PPYA 4BJ5A 3HCFA 4JFAA 3ZE6A 5KS2A 4LVNA 1YOLA 2DGDA 3ZIDA 1CNEA 4DCJA 4QO9A 4DLWA 1EFVB 5CX1A 3VNSA 5DLQC 3DCYA 4DMHA 1NMZA 1EWRA 4RYLA 3LX4A 3L93A 2FPKA 5J2TA 3CPJB 3TW8B 3FDXA 2IQIA 2OCKA 5JT1A 4UM9D 1HE5A 1HR0B 2JI4A 2OCPA 3RTDA 2E89A 3ZWWA 3VVHA 3FOZA 1FU8A 2GSDA 3BWVA 5ECWA 4ID7A 5IEYA 2O8BB 3VN9A 2HHJA 5M4UA 4DC9A 2V8OA 1TADA 1QB7A 1CZLA 4LDNA 3WYYA 2ZJ0A 3AF6A 3U6HA 4HGPA 4RVHA 4MWHA 2UZIR 4Y83A 2GK3A 4RLFA 5JSQA 3ZBUA 4QNRA 5JNSA 4FKJA 3KULA 1AUOA 2R60A 2PWBA 4W6ZA 1UBTS 3KKEA 3R5KA 3VOSA 5DG5A 1E2DA 3AKCA 3ZDRA 3QRJA 4B8MA 1P7PA 4N03A 3GAFA 4X41A 1TZJA 1KMHB 4MEAA 4CSVA 4E31A 3CJTA 1CEQA 1W35A 5COAA 1XG5A 3P8ZA 3ED1A 4JNKA 1CRPA 1X7HA 3THXB 5DGXA 3BH7A 3A4TA 3UJNA 4UAGA 4ZK6A 3M42A 4B7CA 2PKWA 4RK5A 2BH2A 3AEYA 4CCYA 1BKYA 4U0KA 2Z4TA 2JITA 4B7ZA 2CV0A 3NDJA 4IGIA 1C81A 1UEJA 2FSFA 1B0PA 1SFRA 5IMBA 2FPRA 4O4HB 2XP2A 2UZOA 1UBUS 1TVOA 4DMKA 2BHTA 2PVKA 5AP3A 1WTCA 3BH6A 4FT4A 1J5PA 4BTJA 3BSSA 2V97A 4MYGA 3A26A 3KO8A 1TIBA 3HYTA 2JI7A 2O7NA 2X23A 2WB4A 4UD6A 3UBDA 4KINA 4YJTA 2WIHA 3VS3A 2HHAA 1E9SA 1ZI8A 4FT7A 3IQXA 3UV3A 3IUPA 2ZIUB 3A9UA 5IJ0A 1FTNA 1HE3A 5JI3E 4DJ5X 2RONA 2HBZA 4C3RA 1J91A 4BTEA 4AXBA 2P9QA 2W2OA 3H0EA 4I1IA 4FSRA 4HEQA 1J5XA 3FKQA 4YAFA 1RZRD 3AVVA 4JBIA 1XWSA 3WF7A 2AYXA 1O9GA 2CNWD 1XSEA 3TKLA 4H3BA 1Z8DA 2EKPA 1IIRA 5GZ1A 1X1SA 2VUUA 4PLVA 4NBSA 5A3SA 4P6VF 3LWDA 1W8IA 4ZJYA 1Q41A 4OHCA 4C0WA 5HZNA 3F7OA 3G2QA 1KZ9A 3W5BA 1OL1A 2F2UA 1K2WA 2ZAIA 5B36A 4D8YA 1QHHA 4DLZA 4LZJA 4ZVNA 4ERKA 5D5PA 3PP0A 1X80A 2JD5A 2R47A 1KEZA 1IRKA 2HPVA 4J49A 1A04A 4UCWA 4M0KA 4GX0A 3W0PA 4UEUA 5EHZA 3IBCA 4CKBB 4G0YA 4N57A 2J3MA 2ZT7A 2ZSDA 4H4CA 5FTQA 4Q1CA 3DAJA 1AHIA 3QX4A 5AW5A 1WCCA 4I81A 2EIXA 3I5YA 2P5TB 3UE4A 3QHPA 4F1TA 4TXHA 1R27A 4G3CA 2XCRB 3ZZ0A 4BGHA 1ZMRA 3MNFA 5D5QA 1VC2A 4GGMX 1M1NB 5EIFA 3OLYA 4EBWA 2I3AA 1ZISA 4RV5A 3FD8A 4W9MC 2XA2A 1U0BB 3M4ZA 3S2SA 4FDMA 4US0R 2X0EA 3PIRA 4CTCA 4O0RA 4CRLA 1Q15A 3R3XA 4YTHA 4F21A 4N1AA 2H06A 1ICEA 1UQTA 5FWDA 5BPHA 1Q1GA 1OI9A 5EJAA 5A5FA 2JGKA 2OBJA 2R00A 1PGJA 2Q8PA 2XUKA 1EJ2A 3AZPA 4IXWA 4E5UA 4UPEA 1M67A 1IJBA 4R98A 3VO8A 5DXJA 3RS5A 2CCKA 4FICA 2OM2A 4UUQA 4HAXA 4X3FC 4AZSA 2GF9A 3QG1A 3OO0A 3PK0A 5E8XA 3H2JA 3T7IA 1QNLA 4IH9A 2DG2A 4M7RA 2AR9A 1YKRA 5AVVA 3H5VA 3FYDA 2R3MA 4KSBA 4TXMA 4UHBA 4HWGA 1GPH1 1NXOA 4BQQA 4CD0A 4IVRA 4GUBA 4CLOB 1BJKA 2H2AA 3NWPA 3ORIA 1W98A 1SOMA 2AC5A 3GJ6A 1BYUA 4K03A 2Q4OA 3MA6A 3NDBB 2C3KA 1DXQA 4QHYA 4QDUA 3R21A 3CX3A 3GEDA 1LLUA 4WPGA 3UG7A 4PGAA 3KKVA 1VIAA 4IIFA 1RZUA 1T3SA 4FNGA 2WAYA 3W6PA 1OXSC 2HYDA 5I9IA 1H1PA 3Q15C 5E2BA 3FMIA 1RWXA 1C7FA 4L1KA 4KXVA 3DQZA 4ZZ2A 3D94A 1BOFA 4MVWA 3IAUA 2FUNB 1KDZA 3BYSA 4MQFA 1H0HA 3D02A 3LP8A 3PL5A 4ZTLA 1X9HA 4J03A 1GG8A 4U7HA 1P6UA 1DXHA 1KKMA 3DMYA 1MABB 4V24A 1CZUA 2E4ZA 3SM9A 1W85A 1WNTA 4C3ZA 2RI6A 4RJTA 4OQ4A 3PXXA 5K5EA 1U4SA 1CVRA 5CEEA 2V0GA 4PXSA 4WVFA 4F9TA 3KJFA 4UN0C 4EPRA 2XSZD 2AC4A 4G31A 1STCE 2A9RA 3C0HA 1Z45A 5F21A 4R6VA 2VZ0A 3TAUA 2OHOA 4BN0A 4HRAA 5B3AA 1ZSYA 3TF5A 2JAUA 1QTQA 3BCEA 1ZVMA 2X6TA 4EJSB 4AD8A 1TZ2A 4DEEA 4O4JB 3Q3HA 2OV1A 3MZ0A 3GLIB 5GWXA 2KYRA 2B9JA 1L1FA 2JLSA 2B1JA 4HDSA 3SC1A 2W1CA 4UDNA 4ZJIA 1ZAKA 5K03A 1DS5A 4EGCB 3FDZB 5KX5F 3MJ1A 3ZR4B 5K0ZA 5B7NA 1PSZA 1MQAA 5AUWA 2PO7A 3HL0A 1Q1ZA 1P2TA 2JLCA 3B2EA 4QATA 5JSFA 5AKZA 3G0DA 1MJGM 4BX9A 1T8RA 3QLGA 3T7AA 2QE7A 4FQ7A 4QO8A 1TB4A 2A67A 2G1JA 3D7RA 3MWFA 1YFZA 2P27A 3NBXX 5C8YA 4D0LB 1C0KA 5J3JA 2GAOA 3C4EA 3LC2O 3ENMA 1N75A 5FDXA 5FH9A 4QU5A 5FULA 5B3JA 2P2ZA 5AI8A 3AZQA 2IYXA 1D7OA 4DIBA 4Q37A 3RPOA 4MYDA 2ITQA 4ARAA 4M54A 3EWNA 3DEJA 4KW7A 3S0OA 4QRHA 3D43A 4NYJQ 4JVNA 1CY2A 3Q5IA 1PJBA 3MPAA 4FHDA 5AVWA 1CQXA 1E1LA 2ITVA 2ZTHA 5HLWA 3I2IA 4AUMA 4ZTSA 4BX8A 1HLFA 4YRNA 1MU0A 4QFMA 4CTJA 3DMRA 4LOIA 3WF9A 3UJAA 2AFHE 1JDUA 3PG3A 1GQRA 5GQSA 3D7MA 3MQ4A 5CM8B 1NSTA 1LBSA 2D6FA 3ZH9B 3ISTA 1A9OA 2HF8A 2VPIA 3FXWA 1L1QA 4H2DA 4JVSB 4QU9A 5L3QB 4FC0A 2B8WA 2PD6A 2C1ZA 4TZ6A 3HS3A 3I62A 2UVDA 1OZGA 3SLRA 3T06B 1SY7A 4IRXA 2V5AA 1Q1EA 5CT0A 1WBPA 2ZRLA 3D4LA 4Y2JA 1W4ZA 4CIYA 2P9TA 4HH0A 4FI3F 4DEBA 1JU4A 5CNOA 1P9NA 2R97A 4PTGA 1ST4A 5HVKA 5CG2A 2BF7A 2P2LA 2W5AA 3I37X 3WG9A 3OJFA 2W4OA 5ELXA 2TMKA 2ZDUA 3HZOA 3JQ6A 3UA3A 3MWUA 3RC7A 5IPFA 2EXXA 2OWBA 1Z5GA 4AA5A 4LF9B 1MNAA 2QKWB 3DD5A 1KQPA 3KSDO 4AZTA 2AS0A 1R0PA 1JLRA 1H65A 4HYQA 3ZHZA 2UXBB 4WNKA 2FP4A 3LRPA 4IEIA 3K16A 2GILA 1E4EA 4YRLA 3P79A 3ND9A 2F2TA 3TM0A 1HPLA 1J3HA 1J0DA 5KMGA 3IA7A 2XOKA 3QY9A 4M1TA 3F4KA 5DXFA 4HPWA 3Q4ZA 4C4YA 4UXHA 2LP4Y 3ND5A 4WOBA 3LUPA 4FW9A 3G6HA 3RR2A 4AS3A 1XN4A 1EVLA 2C5HA 1X38A 3LQFA 1MB2A 4C4IA 3BRWA 4DMUB 3WLEA 4ZQCB 3TTUA 1U98A 3AF2A 3IP7A 4G81A 1S3IA 2YDIA 3K9HA 2XMGA 3B2TA 1CW2B 1AD2A 1PWEA 5TT7A 4D9CA 4BJ6A 3HPQA 2B2CA 4QD3A 3I45A 4AOJA 1EK1A 4LI5A 3L7AA 2IE8A 4RGYA 1OQAA 2ZR0A 3ZU5A 4RD3A 3VPSA 1V3QE 4J0FA 3T1NA 1QRTA 3U7RA 3WDLA 4ALLA 4CV8A 4PHCA 1PLLA 4C0LA 2V45A 2NU7B 3ZLJA 3DXNA 2I4TA 3LHSA 4A36A 5TPZA 3AIMA 3NONA 2XIYA 2FWIA 1QHEA 1OGIA 4F3NA 3DTVD 2C29D 3NI2A 4FHZA 1ULTA 2PE0A 3KLBA 4LE2A 3GB2A 4C7BA 1KQGA 3MIYA 2W6ZA 3BIXA 4Z7JA 2E7ZA 4RJLA 1I0IA 1YXXA 1RQ2A 1DQSA 3EASA 4P4CA 5BSTA 3GFQA 3QFSA 3H87A 1BI7A 4RCYA 1XBCA 2N1BA 3F71A 3HKCB 2YY7A 2E4UA 2OQ2A 5HEZA 3F47A 2WSBA 1EP1B 1UU7A 1T9DA 1XZLA 5IEXA 4HDQB 1F5QA 2Q3BA 1N5MA 3BA6A 1GGVA 3AD4A