1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
molecule keywords Fibrillarin-like pre-rRNA processing protein
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
3QL8A 3PVBA 5IEXA 5LCJA 4IZAA 4PX6A 4QTAA 4I0SA 4BHZA 2WTKC 2ZTHA 2ZWVA 5E8SA 3EVAA 4YBJA 2Z02A 2Q83A 2BIYA 1FOTA 3MPMA 3HVCA 3QCXA 2PMIA 4FV9A 3DB8A 4GT4A 3E8NA 2IP2A 5DTQA 1QPCA 2PVLA 2QOLA 1ZMWA 4RJ3A 4QMUA 4U80A 3MCZA 2W1ZA 5AA8A 1HOWA 2QY6A 5ICEA 3UTOA 5HNIX 2ZV7A 4MQ1A 4KW7A 1SVEA 1H08A 1KP9A 4UWBA 1JPAA 5E8YA 5EI6A 4L52A 5ANKA 1LEZA 3UP7A 3UJCA 2I6GA 1PHKA 5HI2A 5DOSA 2JFLA 3GXLA 3FY2A 5FXSA 4F7SA 1X1BA 4BZNA 3WZEA 4GSBA 5CX9A 5DX8A 3R01A 4AOTA 3E8CA 2BTRA 1MRUA 5CXZA 3H3CA 1QZZA 2C3LA 3RK9A 5IH4A 2WTJA 3TJCA 3B2WA 5J9LA 1NVRA 5AP4A 3KPWA 4PYJA 3GU4A 5FXQA 3ACJA 2W1GA 2PVCA 4J8MA 1OVEA 5HZNA 5IU2A 5EW9A 1SQGA 3NUXA 4IANA 1XXLA 2B25A 4ITJA 4L53A 5DH3A 4FZAB 1W82A 3FZRA 4L6QA 3V5QA 2YDIA 1XDUA 3PXZA 2EJTA 2N47A 1P1BA 4CFNA 3V8VA 5CCXA 2NP7A 4BCHA 1U5QA 4FTNA 4G34A 4X21A 5CSHA 4NCTA 2QKRA 5M44A 3FI2A 4KS8A 3HRFA 2UZVA 2C69A 3QQKA 4DFLA 3P2KA 4X60A 3BHVA 5EOLA 4E31A 1OL2A 1QMZA 4B8LA 5EK7A 2AC5A 2YWVA 3CGFA 5J1VA 3F9NA 3O23A 4YNOA 4D4RA 3O4FA 2Q41A 4PINA 3A4PA 5FDPA 4AACA 4AW0A 5ANDA 3UG2A 4RJ5A 2XVAA 2CGUA 3CP9A 5DG5A 3R9OA 3KMUA 3UZTA 3OY3A 4FG8A 1WZNA 3FLZA 3DTWA 1DAYA 2WIPA 3C13A 1Q99A 4QTEA 5DX0A 3KPYA 1STCE 3GCUA 3R02A 4WBOA 1TPYA 3AXWA 4UWCA 2VTIA 1KE6A 3QRJA 4ZJIA 2WQEA 2DULA 2YISA 2QOFA 5LMKA 3EKKA 5L8LA 1YQJA 4E32A 2P35A 2WMWA 1PXNA 1TQPA 3AD6A 4NW5A 5FXRA 4O83A 3DDPA 4ZJJA 3F3TA 1QAOA 2WD1A 2O2UA 5JRQA 1T43A 4YTHA 4NM3A 5C4LA 3OF0A 1M7QA 4DC2A 3NJRA 4E70A 3R9NA 4GEOA 3IGGA 3SOAA 4ENXA 2A14A 2EB3A 3DT1A 3NWWA 2QG7A 1P4OA 4MXYA 4YJQA 4E20A 4NK9A 3C50A 3L9LA 2WMXA 2FSOX 5T68A 4OLIA 1NBIA 2R0IA 3VWAA 4F0FA 3R6TA 4LI5A 3F5PA 3K2LA 3POZA 4IFGA 4ACGA 1D2HA 4KIFA 2UVYA 3VVHA 4KKEA 3R24A 5AM6A 3EN4A 4X2FA 3GU5A 1WS6A 4YJRA 3E93A 5KX8A 2Q0NA 2ZMCA 4Y95A 2QLQA 2B1PA 2HIWA 1ZMUA 4NYEA 3FI3A 2DUVA 2IVVA 2QOOA 4U42A 5K3YA 3UOKA 3VBVA 3X0DA 2IZSA 2PVFA 4O0VA 3MIYA 4O7RA 1GJOA 3UQFA 1L3IA 3GCVA 2W9FB 3DDQA 1V0PA 3EQDA 4KKGA 2WMAA 1SUSA 4RWIA 4IM2A 3VS6A 5E9JA 4GJ2A 3UVPA 2VZ9A 2C68A 5EMMA 3C6KA 2G15A 5GP1A 3GC0A 4DA5A 4WSYA 2X39A 3PIXA 5DM0A 4QQJA 1NW7A 2NRYA 3KRLA 2C5VA 4USDA 3PG3A 4FOBA 4FA2A 3U6HA 3A27A 4ACHA 1R00A 3HCDA 3UJ6A 3DK3A 4O0YA 5DTRA 2P33A 4I20A 2OK1A 4QO9A 2X8DA 3OWKA 2BDFA 4KBCA 4RIYA 4TY1A 4CFWA 5B7VA 4JDJA 2A2AA 4EH7A 2BZGA 2XYQA 3AJDA 3VSEA 1AD5A 5AP3A 3BGQA 2NXCA 3DTCA 2R6ZA 4OBWA 1H24A 3EQCA 1PYEA 4B8MA 3MW1A 4M7IA 5EYDA 3TDVA 2VP3A 4RTPA 3GQIA 2Y6MA 3AC1A 3SDJA 3ZFMA 3ZM4A 3PXKA 3KVXA 4DE4A 2XIYA 2F7ZE 5C26A 2QG5A 3EYHA 4I94A 5AADA 2R3IA 3VN9A 1WXWA 1X1DA 4C61A 2ZVAA 3ATSA 3Q96A 4O0XA 3LL7A 4EMSA 3KK8A 5AUUA 1VJYA 4RJ4A 5E8VA 4UV0A 1WY7A 4PGHA 2AR0A 5KS2A 4FZDB 2C6LA 2PV0A 3NNXA 2W1CA 1H1RA 4FUYA 3NUAA 1UVRA 2UYOA 2B9FA 3KCFA 3MWUA 3UPZA 2FPOA 2C7RA 3FSKA 2C5YA 2UZDA 2AOTA 3LDUA 3LDFA 2XKCA 1OIQA 5EC8A 3OTVA 1HMYA 3KN6A 4FNYA 2CMGA 3M4XA 4P7JA 2BPMA 3E5AA 1FMKA 1NT2A 2UW6A 3L1SA 4Y8DA 5CF4A 1UKIA 2WTVA 3OCGA 4IAAA 4FL1A 4YTIA 3ROCA 3QTUA 5BVOA 4ZK5A 4RYLA 4AN3A 4L3LA 2W5BA 3R00A 5DE2A 3RW9A 1XH8A 3BV2A 4PNIA 5HIBA 4DGLC 3PE1A 5GM2A 3UVRA 3BGVA 1T45A 3ULIA 4LOOA 3RPVA 4QP8A 4GRBA 3P0MA 5LWNA 3TM5A 4QQCA 4J1RA 4YHTA 3PY0A 2OB2A 1ZMVA 2O0UA 2VTOA 4WHZA 3SA0A 4O0RA 1ZKDA 4NECA 2UUEA 1Q41A 4P90A 3JYAA 4GK2A 3EL8A 2W5HA 4IFCA 4EEVA 4EH5A 4FTAA 5M51A 2RGPA 1P39A 3D5WA 4GH2A 4BIEA 1KV2A 5AUZA 3VBQA 2JD5A 4G6LA 4ACCA 2W5AA 4FK6A 2X1NA 3WI6A 3RINA 1PMNA 5B2LA 4GW8A 3T3VA 2ZDTA 2AZTA 3MFTA 4PDYA 2B9IA 3IONA 4JVGA 5HTCA 2G8NA 1FVTA 2IIPA 3NWBA 1R78A 3RK5A 2ZBPA 5H2UA 5HEKA 1J91A 1O9UA 3PG1A 4EJ7A 3RPRA 5BXYA 3E87A 3NX8A 3R28A 2R3GA 3V8TA 4PIPA 2YQZA 3QXPA 1RJEA 2CL5A 3Q60A 1ZY5A 3EVCA 4YJPA 4N6ZA 4E4LA 3ZBXA 2YUIA 3H30A 4EYMA 5CZIA 3F82A 3MA6A 3O17A 4II5A 4YPSA 4E2YA 2PSQA 3H0YA 3AC2A 2JDSA 3W2PA 1WFCA 10MHA 1JR4A 4LMNA 2LD4A 4F7LA 4FEUA 3P79A 2HMYB 2BR3A 1RI3A 3JVRA 4X0MA 2KULA 2BRGA 2HWKA 3G0EA 4FSWA 5HESA 2YM3A 3ZHPC 4BZDA 3KR2A 2J5FA 2X0GA 4E2XA 2FGIA 3TEIA 2GNFA 4BZOA 4HGEA 2BILB 3KU1A 4EQMA 3NIEA 5JFWA 3ROYA 2CGWA 3IGOA 1FP2A 2PXXA 3KULB 3NW6A 4YJUA 5CT7A 2YACA 3TMAA 2SRCA 4RIXB 4X3FC 2UZUE 4WNKA 5E4HA 5HBHA 3R7UA 4B99A 1JG4A 2WXVA 4FTLA 3ELWA 3EN6A 3WBLA 1BKYA 3W18A 2CDZA 5EHOA 3KEXA 4PMMA 3R22A 4ZIMA 3UOJA 2I7CA 3FPHA 3D5XA 3H9FA 1WBNA 4NUSA 1JLUE 3HEGA 3E23A 4JBOA 4DFUA 2OIDA 2G2IA 2UZTA 5CQUA 5BMMA 5A9UA 4L45A 3Q2MA 5A4TA 3DJ5A 3PZHA 2VTJA 3MVHA 2C7OA 3SRVB 3QYWA 4FKSA 5DGZA 4YLLA 4E73A 1AF7A 3PJ2A 5FQDC 2HZ4A 1R8YA 3G7UA 3RHXA 4QTDA 5ETIA 2B54A 4A9TA 2G9XA 1Q61A 3QTZA 3IPHA 5LVOA 2DWBA 2ZBRA 3DAKA 2B4SB 3RZBA 4EK4A 3GP0A 5L8KA 3AXSA 4AZEA 4CVAA 3B3JA 4BLUA 4C36A 2HR1A 2PZ5A 3PJ1A 5F94A 1PYXA 2OB1A 2QYOA 1YZ3A 4ANQA 3LMGA 2R3OA 4HGYA 2BDWA 2PMLX 4JG6A 3O2MA 4O0UA 1OB3A 4TWPA 3QGWA 4TZRA 3MAGA 3N51A 3QA8A 4FBXA 3C7QA 5EDRA 4YU2A 3UVQA 1L9KA 3GC8A 1JKTA 2PKWA 2ITYA 2WU6A 3EQBA 3L8SA 4A4LA 1R8XA 3BZ3A 1H07A 3PFGA 3CQUA 3QV2A 4IZYA 1BHJA 4KVZA 5TKDA 1EAMA 2EFJA 3I53A 2WMUA 3MVJA 1YWNA 2OKCA 5DRTA 3SVZA 4F85A 2GLUA 4GKHA 3TLJA 4RZVA 4S34A 5EMLA 3LJ0A 3DBEA 2GS6A 2WAJA 4EORA 3KQPA 2BMCA 1HCKA 3P7AA 4DEGA 2OG8A 4J97A 2I62A 2O05A 3ETAA 2OZOA 3HVJA 3FHRA 4HVDA 4P7EA 5BUIA 4NFNA 1VEBA 2YEXA 5CYIA 4RIYB 4I0RA 2IWIA 5LMAA 4KWCA 4PYNA 3ORHA 5DFPA 3A7FA 2DQ7X 4CD0A 2ERCA 3FMMA 4O7ZA 3GCSA 3RPOA 5LQKA 3ORIA 2AYPA 2DYLA 5CEQA 3L8VA 3TIZA 3OZTA 2VRXA 3EQRA 4X63A 2P3QA 3QC9A 4R6WA 3FAAA 3FPGA 4RIWB 3FUUA 5K5XA 3CPCA 4FC0A 4GF5A 3PA5A 2W1EA 1P4FA 4EOLA 5IA3A 2UZ4A 1V0BA 4G3EA 3EQGA 4TPTA 3ZS5A 5CM2Z 5FD2A 2RFDA 3FPEA 5M55A 5K01A 3LJ2A 1TKIA 4F6SA 3DBQA 4O7NA 4I6BA 4IVCA 3G2MA 1PXIA 4GS6A 1OBDA 3CKWA 4A9UA 3D5VA 4C0TA 3LHJA 4ORKA 3TKHA 3FV8A 3A8XA 3R1YA 4I21A 5BUJA 4Q5HA 3IV6A 5IH3A 4NIFB 2CNQA 5HU9A 4ZS0A 1Q3WA 4HPUE 2XKFA 5FP6A 4DYMA 4YZMA 4D2RA 5CAPA 2C7QA 2YR0A 4DMGA 3CJRA 3QHRA 3G90X 5EZSA 3HYHA 5B2KA 2HY0A 2LGCA 3K3IA 3TUDA 4C06A 5A46A 1M6YA 2UV2A 4FNXA 5DRDA 3HDMA 3JWGA 3M6VA 4DFYA 3ZLSA 2PXAA 4D0WA 3V3VA 4USFA 3ELDA 1SUIA 1DL5A 5KMKA 1WVWA 1NW8A 2XCHA 1Q8TA 4O38A 4BN1A 3CY2A 2CPKE 4YZBA 3TZ8A 2AN5A 2HV9A 2PUIA 4FSMA 5M4UA 3E3BX 5E1EA 2YM4A 2OXYA 4EWHA 4PTGA 3ZYAA 4DQ0A 4JQ7A 5C4KA 3KQTA 2VO3A 4RTJA 4FKRA 4J96A 5HG8A 4TN6A 5A4QA 5KMIA 4O96A 3GWZA 3R8UA 2ZAZA 2XYUA 4AZWA 4YC8A 3RTPA 3VJNA 4KDRA 3AMBA 4DGMA 4RC4A 3SW7A 3NTVA 5EHGA 2XNBA 2IVTA 5K9IA 3EEOA 3LXPA 3O96A 5HVJA 3UG1A 1UA2A 4HGTA 4BF2A 4DG0E 5K0BA 2OF2A 3I9FA 2VTHA 4BGHA 3VULA 3MJ1A 2JLDA 4O2PA 4PL4A 2C0OA 3W8LA 2OJGA 2RIOA 4R7HA 5CU0A 1YOLA 4RTLA 2G1PA 4IC7A 4EOSA 3KMWA 5DEWA 1DUSA 2AOVA 3PX3A 1FBNA 2PMNX 4QMZA 1UU3A 1H0WA 2GNLA 2QM3A 2F9GA 3P5KA 1JQEA 3GGDA 4XUFA 4ZY5A 3LW0A 3GU8A 3ACKA 3H9RA 4EWQA 2CHLA 1BL6A 3FLNC 3KREA 3IW8A 1LPUA 3OFMA 4J53A 3EGIA 4MF1A 5GIOE 2OZVA 4U81A 4LQMA 5HLWA 1KYWA 4TWNA 3FMLA 4JDIA 4KKHA 3ZEWA 4PTEA 5BYZA 3RPSA 1L3BA 3GNIB 4TKSA 3WZUA 1WVYA 3DMGA 4EKGA 4IH8A 4O21A 2JJQA 5AAFA 3P4KA 1K3AA 4ZY6A 3E8DA 4ANSA 4DG3E 5BMSA 5JUWA 2F7EE 4MWIA 1KXZA 4BCMA 2YM7A 5F1ZA 4DTKA 5M57A 4R3RA 2ITNA 2PU8A 4L68A 3SC1A 2QOBA 5CCBA 1JSUA 1Y91A 3LMHA 5K0EA 3RHKA 1BUHA 4H1MA 1ZYDA 3ZO1A 1JKKA 3OT8A 1RI5A 4QQKA 4BCFA 5M08A 4FNZA 2CLXA 3TTJA 5CU3A 2I0YA 3IDCA 3DAEA 3A7HA 3QZHA 4FKUA 1WBPA 1V1KA 4MH7A 3P9JA 4C35A 3OHTA 5AM7A 3F3ZA 1ZHFA 5ETAA 4TT7A 5M5BA 1H25A 2IZTA 4YO4A 5CSPA 3UGCA 4WD5A 4OUCA 3Q7EA 3F66A 1Q97A 4BIBA 2E9OA 3GRVA 4XG7A 4A4OA 4BCJA 4FIEA 3FZTA 1ZGAA 2ITWA 2GS7A 2EXCX 5HO8A 5C27A 2J9MA 4PF4A 5I9UA 1H00A 2VWVA 4L7FA 4NW6A 3UDBA 1OI9A 3ZFYA 2UZBA 4FKQA 5JFVA 3LMIA 3VBYA 4GG7A 3CR0A 2XBAA 4HYSA 3M6WA 3UO5A 2XNGA 4OR5A 4EI4A 5KYGA 5K0GA 1IA9A 5BVKA 2XVDA 4F0IA 4ZS4A 3W55A 3O7LB 4AGCA 3AWIA 4C4FA 3B5IA 3KMMA 1Q0TA 3AC3A 1VE3A 2ETMA 2HW7A 3C5IA 4LRMA 2EJUA 3OCTA 4DKJA 2Y4IC 5T6BA 4MEDA 3LAUA 3VF9A 3RWQA 5DA3A 2PVKA 3UJ8A 3P2EA 4FIFA 1O6LA 5CSXA 4BCNA 4B4LA 5L6WL 2WFYA 3G8BA 3R8PA 4HGLA 2PLWA 3U54A 2EWAA 1SVUA 4QMNA 1Z3CA 1YI3A 4R3CA 4TWOA 2HTEA 4Y85A 1ZYJA 2Y0AA 2R3HA 3QQFA 1ZXEA 3UMWA 3FMJA 3ZUVA 4QNAA 3HV7A 3ZDIA 4D4VA 4BY9E 3P9KA 3MB6A 2IO6A 3Q32A 4ANBA 1YXTA 2R2PA 3EFKA 3Q9XA 4CRSA 4F9BA 3OU7A 1KOAA 2IG7A 4P5QA 4XMOA 2F4JA 1RJDA 4JIAA 4JAJA 3VW6A 2ITOA 4ZTLA 5I9WA 4QTTB 1QCFA 5BW5A 4NTTA 3UO6A 3TJDA 2ITVA 2Y7JA 4IAFA 1YOJA 2X2MA 5H8EA 2GU8A 3FYKX 3U9NA 1UNLA 5CANA 2V74B 3LX6A 5DTMA 2IBSA 5FWAA 3BT7A 4ZAUA 5IUIA 4HVGA 2XK3A 1FGIA 2Z2WA 4TYGA 1CKPA 1SVHA 3R7YA 3FXWA 3GFEA 3FTCA 1U46A 2C1BA 2XKDA 4KNBA 4H3BA 3FRIA 4CTKA 4C05A 3QD2B 2WU7A 2ORED 2C6TA 3OCSA 3FPFA 3Q4CA 3OMVA 3PS9A 4F4PA 4PCAA 4YSMA 3OEZA 3HA7A 5G02A 3AMYA 4YURA 1UIRA 5CVEA 3AQVA 5CEOA 4ZMEA 3GRRA 1KOBA 2XK4A 2J7TA 2OH0E 5EEGA 5FLFA 3D2IA 4YP8A 4AN9A 1XDSA 4G1WA 1VBFA 4DITA 4C04A 3ORNA 4F6UA 2ESRA 3B3GA 4RTQA 5HFJA 3JVSA 2P3LA 3HCEA 2BFXA 2Q0BA 3BGPA 3LCKA 2P0CA 4U45A 3UZRA 2VS1A 3HKOA 1BI8A 4EK6A 4I1ZA 2P2HA 2OXXA 3HA3A 1PXPA 5IA0A 3BE9A 2R9SA 3UP2A 5IF1A 5KMNA 4IWOA 1SQFA 1PRYA 2BCJA 3FZPA 4RFZA 5AUWA 2IPXA 4A9RA 5J95A 1YF3A 5KMMA 3WZJA 3LZBA 5AUTA 4JBQA 5HHWA 3FSFA 3PXYA 1RI4A 4FSDA 3NDIA 3F69A 1K2PA 1T46A 4FI1A 5IQDA 4TWCA 1Y8CA 3FZOA 5E9EA 5FBNC 5I4NA 1VZOA 3CSVA 4IKPA 5HIMA 3UNJA 1JQHA 5AEPA 2OU7A 2CWWA 4U9AA 2K4MA 3R9XB 3QKLA 3BWFA 1JWHA 3NCGA 2UW8A 3UQGA 2V7EA 2OFUA 2R5TA 2X7FA 4EOIA 4PWNA 2R7BA 3F7ZA 2PVNA 1H01A 2CKOA 2UZLA 4M0ZA 4CZTA 2KW5A 4ZP5A 4C3FA 3BKWA 3F5XA 3IHTA 4BTMA 1Y8YA 4ITIA 3EFLA 5E2AA 2QO9A 3QD4A 1H27A 2HXQA 4CFVA 4X1OA 1WBOA 5ETFA 4LECA 2B9JA 4OA5A 2C6EA 3H9OA 4YJVA 5AUXA 3ZONA 2ZULA 3I6UA 5HIDA 2BHEA 4RBLA 4FZVA 5C9CA 4XRLA 5HORA 5ITAA 3DFAA 4KBKA 4K11A 2W4KA 2QRVB 4U40A 5F9EA 4J99A 4HGZA 4RX5A 4L67A 3IW7A 5KCVA 4IM0A 3P23A 2HENA 3C4FA 4MD7E 5HCYA 3H2BA 2EB2A 4G5JA 4ZOGA 3ZRMA 5L6PA 1PJKA 3KXZA 4S33A 1XWSA 2XNEA 3PXRA 3P9IA 4ZTBA 2YHVA 3K5UA 4QPNA 4BTJA 5KQSA 3DKOA 3VRYA 4MXAA 1F3LA 4CKRA 3KPJA 4YJOA 2OJIA 3KFAA 4RC3A 4FV4A 5T6KA 3OW4A 2QCSA 1IA8A 3M42A 3C4WA 5IMXA 3IOKA 2ZIGA 3ENMA 5DM4A 4FGZA 1UU7A 4BP1A 5A14A 2ONYA 3G5LA 3ZO4A 4D1ZA 4TNBA 1YVJA 3A99A 3DLSA 2AS0A 4RGJA 3V5PA 4AOIA 1VQ1A 3BKXA 4AQCA 5IQEA 3ET7A 4E2ZA 2ITPA 3PDTA 3Q4UA 3V01A 1U5RA 5CTPA 4DINA 4Z7HA 3T9TA 1K9AA 3MQ2A 3TTIA 5AAGA 4RX8A 4M97A 3OXTA 4XV1A 3AGMA 1YFJA 3B2TA 1BYGA 1ZAOA 3CBLA 3VC2A 1X1CA 4PYLA 5HG7A 3PLAE 4K0YA 2C3KA 2C0TA 4CFMA 5LJJA 5HX6A 3GCZA 4FSYA 4D5KA 3F2AA 3REPA 3TNHA 3R8VA 4C7TA 5AMNA 3TV6A 4DLJA 3G2QA 4QP9A 2IDJA 3EZRA 2UYQA 4I6HA 3E7PA 2QOQA 5M4FA 4FR0A 2VNYA 2QOIA 2QODA 4MBJA 1Z9XA 5D11A 3IS5A 4GT3A 1WG8A 3JXWA 5EGSA 5LXMA 2VDVE 1ZOHA 3VUMA 3BE2A 1U2ZA 4PONA 2GTNA 2RG5A 3OROA 5AAEA 5ICFA 2P2IA 5A3XA 2WQNA 3EH9A 2V62A 2ONLC 5DHJA 3W10A 3LFSA 4EH3A 2LAVA 3FQSA 4QRCA 5CF6A 2XJ2A 4R5YA 2P7HA 2BR1A 2BAQA 2UZNA 3OWLA 3SXRA 2OY0A 2BAKA 3REOA 2HK5A 5CVUA 3ORLA 5D41A 3BWYA 2OXDA 2F49A 3MH3A 5ACBC 5GIPE 3G88A 1JTFA 4BC6A 2ZM4A 3PXQA 3HMOA 4IZ7A 2ZW9A 3B3FA 4OBQA 5E2BA 1DAWA 2GQRA 4FVRA 4JG8A 2FK7A 3S1HA 4JBPA 4EK5A 2AVDA 1YXXA 3NNWA 1R18A 5EIWA 3OT3A 5CF5A 1PF8A 2W05A 4YPDA 4IV8A 4WG5A 4RA4A 4B6LA 4Y72A 3FTFA 3EPPA 2NP8A 3CIKA 3QZFA 2QOKA 4D4SA 3U4UA 3OXZA 4OW8A 4EH2A 4F1TA 1J7UA 2QRVA 5FEQA 3TI1A 3FBVA 3GUBA 5TR6A 4BLVA 4J95A 3A61A 5H8BA 4E8AA 2JITA 5DR9A 5DIAA 5ACKA 2V55A 4NT4A 4PDPA 3QD3A 3KPUA 4IX3A 3GCPA 2NXJA 3KR0A 4U6RA 2WK1A 5HBJA 5IA2A 4JG7A 2ITZA 4WO5A 4FKJA 4R7IA 5D7AA 3VAPA 2PWPA 2XP2A 3EQHA 3VBWA 3ZZWA 3RODA 1J3HA 3VYWA 2WOTA 2QOHA 2WTKB 4XJ0A 2O65A 4AAAA 3EN5A 4JBVA 5GWXA 4FV8A 5JFSA 2ZZMA 3OPNA 5GJGA 5AUYA 4XP3A 4DCEA 4Z2YA 2UW7A 3G5DA 3PIZA 3G2OA 4V0RA 5JKGA 4IMYA 4GOLD 4XLVA 3GOPA 4W4XA 3C6MA 4JDHA 4M14A 5DT4A 3FUTA 4QTBA 4ZLOA 1OECA 4RQKA 5AV2A 3ZFXA 3NWEA 2ZJWA 3SM3A 4MHAA 4FVPA 4YJTA 4UALA 2BAJA 3RAIA 2CMHA 3GCQA 4JL9A 5IZFA 3FUVA 3GFWA 4UEUA 3FZSA 4JXFA 4CQEA 4F7JA 1GNGA 4ERKA 3QZIA 4FTUA 5CSVA 4WVLA 4A9SA 2XJ0A 4KAOA 2YABA 4DFBA 2GHLA 4FKVA 4X2JA 4OQEA 4TYJA 4MX9A 2P7IA 2W1FA 3DXQA 3OOMA 3LFFA 5K0CA 4ZZOA 2YWPA 3NAXA 1VLMA 3PUPA 3QCQA 2C5OA 3LFCA 5EHIA 2DS1A 1Q62A 4IAYA 4BB4A 5JZJA 1G6Q1 5BX0A 4UYNA 4CGAA 1M6EX 4AS0A 1N7IA 3ELJA 5E8ZA 1NV8A 1HNNA 5EMKA 3QOXA 3QCYA 4LGHA 4BICA 4FK3A 4NL0A 3C3YA 3HP2A 4GYIA 4D1XA 4DH1A 1URWA 3BU3A 3E92A 3PPKA 1D2CA 3EKNA 3K54A 1GAGA 4AN2A 3ZC6A 3OCJA 4A6DA 1JOWB 2O0LA 2Z7RA 3IQ7A 4I6QA 2W17A 2PBFA 4LV8A 4BTFA 3FLQA 2OICA 2PHKA 4U8ZA 4ZZMA 3LCCA 3CGOA 4C08A 4XS2A 3ME5A 2Y9QA 3NDMA 4Z55A 3TL8A 3NNUA 2Z6AA 4L43A 3LCOA 4U97A 1M2QA 4XV2A 2HZNA 3OEFX 2VNWA 4UXLA 3SAYA 3QYZA 5CAQA 1ORIA 1XCJA 3DOUA 5E9QA 2J0IA 1I09A 5ANJA 5GJFA 4BCIA 2ZBQA 4YV0A 3V5TA 3AD5A 4JR3A 2JGZA 2X9FA 3F5GA 1XH7A 3F6XA 4LYNA 4FEWA 4MTLA 3FEGA 2O06A 3FJQE 3A8WA 3LVPA 4RLLA 4WNPA 2OH4A 3L8PA 4X6RA 4YZDA 5AP0A 4UXQA 4ZXTA 4L9IA 3VNTA 4FUXA 5HX8A 1HCLA 5KNJA 5FDXA 4U3YA 1G55A 4KSPA 4FE2A 3DPKA 3I5NA 2O63A 2AOUB 2GNIA 4R8SA 4RTNA 2OKRA 3C4EA 4HW7A 4FV1A 3ZOSA 4A06A 4FT5A 4ZSAA 2BRHA 3DMHA 2PYWA 3RJCA 1JQDA 3D15A 4Y30A 2XB7A 3W16A 4EHZA 2C5XA 4FNWA 4NTSA 3S95A 3LM5A 1OR8A 4XG6A 4AXAA 2JKOA 5TOZA 2ZMDA 4EHGA 3RIEA 5LSAA 5AP7A 2VTMA 2PWYA 5M53A 2I40A 4JT3A 4OTFA 4PTCA 4KUJA 5AJQA 2R0UA 3DQWA 3GVUA 4X3FB 4AA0A 4FL2A 4EOKA 3KHKA 3M33A 5BVEA 3DJ7A 4DT9A 4HZRA 3R2YA 4X6QC 4CLJA 1EQAA 1I1NA 5GM1A 1QPEA 3PA4A 2PZRA 3L9PA 1OPLA 4CLIA 4AZSA 4RQVA 3AY0A 1INLA 4XNEA 1L1EA 2YIYA 3KN5A 2A27A 3CPBA 3F5UA 3HV4A 2XUUA 5CIYA 4BDAA 3KQSA 4FV2A 4EJNA 2Y6OA 4OA8A 3ULZA 2ETRA 4I92A 2B52A 8MHTA 3D5UA 3N4UA 3DBDA 3C9WA 5DN3A 3I7CA 3HA5A 4EC9A 4MXXA 3TG1A 3OG7A 3QKMA 2XK9A 3NAYA 5EYCA 4CNHA 2PE2A 4WNMA 4IB3A 3TDWA 1B6CB 2WQOA 4N0SA 2OXTA 3G5TA 3EMGA 3HV5A 3PJ3A 4EVIA 9MHTA 3K0BA 4OTRA 4RV9A 3HLLA 4HVSA 2WQBA 4R6XA 3DZQA 4YLJA 3GI3A 4D55A 2QLUA 3CCNA 3MTFA 4FV5A 2IBTA 1YXVA 4AX8A 2OW3A 1XTPA 4FKGA 3QZGA 4Q9ZA 1YKRA 4YTFA 4G3GA 3MDYA 3FQEA 2VTAA 5DPVA 1KPGA 4CWAA 4FSRA 2C4GA 2H6DA 1WBTA 5JK3A 2UW4A 4EBWA 4U7TB 2ZCJA 1JBPE 3I79A 4HGSA 4RVMA 4BHNA 4X2KA 5B1SA 3DQXA 4F86A 3CY3A 3OD6X 4AGUA 2VN9A 4GFOA 4CV8A 2PY3A 3FUPA 4EYJA 4YMGA 4YO6A 1Y6BA 2ITUA 2NO3A 2YIQA 3FMNA 2JKQA 3HP5A 3IECA 5DT0A 3O8TA 4DEIA 5JEBA 4LWOA 4QDKA 4WA9A 5FTWA 5LVPA 4M13A 4M15A 4DF3A 5EKNA 4P7FA 1U54B 2W96B 3DNEA 2WA2A 3QRUA 4IACA 3F7WA 1ZOEA 1PMEA 4OTHA 4AT5A 5LARA 3R83A 2P3OA 3KQVA 2VGPA 4H3PA 3W32A 3BELA 1QANA 4LFIA 4D0XA 1SNXA 4YLKA 2QR7A 1PXKA 2NXNA 4LL0A 4CKJA 2NXEA 2OBJA 2I0HA 5LVMA 4E5WA 4G3CA 4EOPA 2WO6A 3KR9A 2BZKB 3TR6A 4D9UA 4DFXE 3PFQA 3OWPA 4HNFA 4TXCA 5FQOA 3CGGA 2AOUA 1N2XA 2PWLA 2A4LA 4EH9A 2QD9A 3EQPA 4DH3A 3KQWA 2VX0A 1XJDA 3G2FA 3TKYA 4I5PA 3TUBA 2YJRA 2FCAA 3RALA 3BLRA 5BVDA 3ATTA 3CTJA 4JRNA 5HE0A 5LQNA 3KKVA 5E91A 4PNEA 3E62A 3WYYA 4RJ7A 2VDWA 4FTOA 3UNZA 4AE6A 2YX1A 1XH6A 2OI4X 5EEHA 4RX7A 5EM5A 3E63A 2WKMA 2XNOA 4HG2A 3B89A 1VIDA 3V5WA 3QTSA 1DCTA 5FTGA 3UJDA 1WBVA 3D7TB 4FIHA 5CT0A 1ZWSA 1EIZA 4L3JA 3QAME 4L8MA 4LRJA 5G6VA 7MHTA 1KIAA 2YZLA 3Q6UA 1W84A 3BXOA 5BUEA 1WVXA 1Y57A 4HSGA 4MKCA 4H1JA 1G5SA 4P7KA 2GQGA 2ZSUA 3T7TA 4V04A 1M2RA 3HMIA 2ESMA 2VWBA 3QA0A 1YI4A 4HCTA 1UWHA 5FG8A 2V5QA 5TO8A 3VUGA 5IH5A 3FQHA 3OZRA 4DEEA 2WIHA 3QTRA 3TT0A 1JSVA 3D9VA 3KQYA 3D14A 3B7PA 3MB5A 4Y2HA 2C3JA 1PXOA 5HGIA 4PUZA 3FUWA 4HTFB 2ZDUA 3HRBA 3DKFA 4XV3A 3FLSA 5EG3A 2F2UA 2CN5A 4IJ9A 5CVFA 1NKVA 3SHEA 3BWJA 3IO7A 4PMSA 3VJOA 4PP9A 3BYUA 3B8QA 5EVJA 3OFJA 3KKZA 4P4CA 4C4EA 4E4NA 4CKEA 2HY81 5EW8A 1JSXA 3L8XA 3MI9A 3P7BA 3DXYA 4XP2A 5CEMA 1ZG3A 2JKKA 5EFQA 1N7JA 2JDRA 1OL5A 1P2AA 5EDQA 4R7BA 3EVBA 3HRCA 3Q53A 3LGAA 3SXJA 4R05A 3MH0A 1MRVA 2B55A 5BW4A 1ZQ9A 5DM2A 3LQ5A 4FEXA 3FLWA 1XR1A 3HV6A 3RP9A 2RG6A 1U54A 5BYLA 3A26A 4QTCA 3THRA 2QR8A 3R7VA 5I0BA 1XBCA 2B3TA 1YI6A 3MA3A 1KE5A 1REJA 4MXOA 4C03A 2ZFUA 3PVCA 2GCDA 1LEWA 1UU9A 3ZZEA 5CLPA 2WELA 3KK9A 5EW3A 1WXXA 3HNRA 3AT4A 3I64A 3WE8A 2OF4A 4YHFA 5DI1A 4FOCA 3S2PA 4ISCA 2FK8A 3G51A 4RVLA 3JS2A 5LQFA 4KSQA 3U51A 4JJRA 4YBKA 5DSTA 4RIXA 3P97A 2AOXA 5HIJA 4XUDA 4YC3A 3I0QA 2CNUA 3EFWA 4F84A 4X2NA 3QHWA 3NCZA 2I0EA 3W8QA 3M6UA 4BCOA 3TNQB 2C3IB 2BROA 2CKQA 4WUAA 4BGGA 4C59A 4EONA 4HVIA 2CNVA 2AN3A 1IRKA 3HP7A 3VW8A 3N4TA 5DLYA 3NGAA 3MVMA 3LCUA 5EMJA 2AN4A 3NNVA 1G38A 4I22A 1FPUA 2WMTA 2WMSA 1YB2A 3U6JA 5E8JA 4IIRA 5IQGA 4RA5A 4M12A 3SW4A 2FHPA 1OUYA 4FYNA 4ZTQA 3GGFA 2XYNA 4U41A 3FXZA 1O54A 2XH5A 3BHYA 3EHAA 3GC9A 4YJSA 1TW2A 5GNKA 4E26A 3SXSA 3BEGA 1Q5KA 1S9IA 3EQFA 3QUPA 4IQ6A 5IUHA 2IDKA 4MXZA 4HC4A 3DK6A 3ANQA 4FTQA 4M68A 5HD4A 4PYKA 4X7QA 2YFXA 1J1BA 1YOMA 3BPRA 4U7ZA 1YHSA 3UA3A 3C1XA 4NM0A 1CKJA 2ITTA 4RJ8A 4BKJA 3I81A 5J9YA 4ID7A 3C3PA 3LBFA 2PL0A 4S31A 4ZLZA 2UW3A 2G2FA 3C0HA 4NJ3A 3WF8A 1G60A 4BI0A 1H0VA 2PVJA 3NUSA 4K18A 4PL5A 4BDHA 4KRGA 3E3PA 3A4TA 4F0GA 4RT7A 3MCTA 2UYHA 4XUCA 4E5AX 5HLPA 1FPQA 3ANRA 1SKMA 3BV3A 5JQ5A 4HRAA 5I5ZA 5HICA 5K05A 3DBCA 1NW6A 4XBRA 1OPKA 3E64A 3MFUA 3FKOA 4IHPA 3GQLA 3Q5ZA 5DBXA 4IAZA 5C03A 3VS1A 4BDEA 3C0IA 3OS3A 5JGDA 1O6YA 5LCKA 2GHGA 1NBHA 4V05A 3HCFA 2QKWB 2XMYA 3HVIA 5U4XA 2VUWA 4CMTA 3MB7A 3KU2A 2RFNA 4RFMA 4K33A 5IEYA 3R3HA 5EKOA 1ZY4A 2JDTA 3ELUA 4YV1A 2FSLX 4QP3A 4Y46A 4ONAA 3MFSA 3LHDA 4GQBA 3T7SA 4IWPA 3GEQA 3TKUA 3TZ9A 4TL0A 5KQRA 3VC1A 2BR4A 2GH1A 4DAWA 4F70A 4JX3A 2J0JA 5D1JA 4IAIA 4P2KA 4MQ2A 2GHMA 2ZOQA 4E5BA 2C6MA 2B9EA 4IX4A 4XP0A 2J5EA 3JR1A 2BH2A 4DH8A 1AQIA 3LCSA 3FMKA 4AZTA 5J8IA 3RMFA 5EI8A 2PT9A 4BP3A 3FI4A 4UX9A 4NM7A 3D0EA 3QLFA 1SYKA 2O57A 4BLWA 2OLCA 2AUHA 3CKKA 4RWKA 3TQSA 3E05A 2FO0A 3VS4A 5CD1A 5CNOA 3DXZA 2VV9A 2R3RA 4DH7A 3M6XA 3CD8A 2W1DA 4PY1A 4HCUA 3SX0A 5C1IA 3MY5A 2HWPA 5HCXA 5DR2A 4CXAA 4MNEA 3RCJA 4D28A 3SRVA 5BVFA 2XIKA 3CE3A 4PGGA 3OFKA 4YUXA 2YAAA 3S3IA 3LSTA 2VGOA 5IISA 3IOPA 4FYOA 3R0QA 4GV1A 4XCUA 1SMHA 4N57A 4PYIA 3U6IA 3UC3A 2ZIFA 2ZWAA 3H10A 4K6MA 3HM2A 2J0KA 2YIWA 4BDBA 5AV4A 5HZMA 4GFGA 4XG4A 4GKIA 3PPZA 2X4ZA 3HVHA 3TZ7A 2I1MA 4AFEA 3I0OA 3WSTA 2QI8A 4BI1A 5CVVA 3NS9A 4O84A 4EK8A 2B7AA 3F2NA 3G9NA 3C4CA 4J98A 4TNDA 3PPJA 4UBAA 3BGIA 5D1HA 3HNGA 1F38A 3OC1A 3A2CA 4FTTA 3GC7A 4BI2A 1VP3A 2WQMA 2WB8A 3BWBA 4MIKA 4RVGA 4Q2AA 5P8WA 3VQHA 1XCLA 3EVFA 3IG7A 5E92A 4ER6A 4F63A 1R0PA 4QMOA 4NKSA 4X3FA 2WZJA 4LUEA 1PW2A 4IJPA 5CENA 2DPMA 3MN3A 3PP0A 2YIXA 3EIDA 2JDVA 5KMLA 2PE0A 3GU7A 4EK3A 1D2GA 4ZY4A 3AT3A 1SNUA 4KWPA 4Z9LA 4ZLYA 4AUKA 5HBEA 2W4JA 2O64A 1FQ1B 4QMWA 4TYHB 3LCTA 3P2IA 2PUNA 4XH6A 2QU5A 4GVJA 1NV9A 1B39A 1M52A 5L2TA 1QAMA 2O3PA 2QU6A 1YUBA 3IDPA 2C30A 4W4VA 2JHPA 4CKBA 4XG3A 3ZSIA 1E1VA 4X41A 5H9BA 2XS0A 5H8GA 4RPVA 1QPDA 5CQWA 4R1VA 3RCDA 3Q52A 4OT5A 4QYEA 2A19B 3W1FA 4RTKA 2P55A 2BRBA 3LOKA 4FKPA 4DEAA 4I5HA 3ZMMA 2X81A 1FGKA 5K03A 4L42A 4U5JA 4LG4A 4MCVA 3BLQA 2Z7LA 3A60A 3RK7A 3G6GA 5DR6A 4KIPA 2I0VA 4ARKA 2JFMA 4OBPA 5L6OA 1MHTA 4GL9A 5E90A 4CG8A 1SVGA 1QPJA 4NSTA 2I7QA 4EH4A 4A07A 2QO7A 2BUJA 4G16A 1CMKE 1F5QA 3O50A 5IQCA 3S00A 5C0OE 1OIRA 5IG1A 3OBGA 4MD9E 3M70A 5GJDA 1IAHA 3COMA 3UIXA 4P5ZA 4RSRA 4CT2A 3FZ1A 3LFBA 2X2LA 2QHMA 3R1NA 2PVRA 4NZWB 5LVLA 3LFDA 2RFSA 2P41A 4LRKA 2YM6A 3KR1A 2GB4A 4FV0A 5J7HA 1Q8UA 1UNGA 1JQ3A 4ITHA 4WRGA 5HVKA 4F9CA 4I0TA 1WBWA 3P7CA 4KABA 1V39A 4QPSA 2IJMA 1BX6A 2ERKA 4L46A 1RI1A 3JWJA 5AIKA 4KRDA 3IW6A 3R9DA 2PX4A 5CALA 2J0LA 4HYHA 3NUUA 2WEVA 2WTIA 1Q3DA 3BYOA 4G6NA 4YJNA 4YGAA 5DEYA 3ZXTA 4DN5A 5FA5A 4CCBA 3DXXA 4UYAA 4UY9A 3CJFA 2JH9A 3WF6A 1RQQA 5FQNA 3BYMA 4IB0A 1JVPP 3V51A 3K5VA 4I5CA 5AP6A 2PVMA 3C0GA 4MBIA 3PYYA 2PTKA 4QYYA 5IQAA 3MTLA 5A4EA 5EQEA 2PXCA 4APCA 3HTXA 2QC6A 4RLKA 4C2VA 3G15A 3OU2A 2VU3A 4FTCA 4JXJA 3QRTA 2NP6A 3DXPA 2XEZA 2B53A 4O0SA 4QOXA 1OKYA 4J7BA 4KD1A 1RJFA 3PY1A 4YUWA 2J0MB 5IUGA 4OBXA 3TRKA 3R9RA 5DPMA 3HX4A 4WRSA 3HA6A 4FZ6A 2OPBA 1YHVA 3VBXA 2RFEA 3PZEA 4PP7A 2WMBA 3EJ1A 3NYNA 2JEDA 4EOMA 2ACXA 3DTNA 4QP6A 1DM2A 4RFYA 3EVGA 5DXAA 3AGLA 4PL3A 2UW9A 3JY0A 4DTBA 3ORTA 4PQNA 2BRMA 4QMSA 3D2LA 4GBED 5HNBA 4CFXA 3QCSA 5I9ZA 4YSJA 3ZSHA 3PB3A 3HMPA 3ZM9A 4Y83A 5C9ZA 1B38A 3OOGA 4MWHA 3A62A 3P1AA 3PLSA 2AVNA 2VTPA 3FC1X 3JUHA 3WIKA 1ZYSA 5HE2A 4AW1A 4AF3A 3GOKA 4EUUA 2XVMA 2R3FA 3IKAA 3TNWA 4JIKA 2YXLA 2FB8A 1R39A 3NW7A 4BYIA 3EOCA 4LUDA 3BKBA 3MIAA 3HAVA 5F2OA 3CJQA 3NR9A 4BDGA 2P40A 3IW4A 4BBMA 3VF8A 1EJ0A 3PSBA 3BLHA 3UIUA 4FT0A 4GYGA 1OGUA 3OE5A 4ANMA 2XK6A 5JN2A 2FYTA 5EQYA 4AW5A 2X7GA 2OWBA 3QC4A 5BVWA 2HOGA 3E88A 5HE1A 3LXKA 4DBNA 5JT2A 3T0IA 1IG1A 3U81A 4YNEA 5FCDA 5D10A 3PIYA 4YUZA 5ETCA 3IK3A 5KKRC 1WMKA 3OU6A 3BZBA 2QURA 1ZYCA 2EX4A 1OPJA 3NYOA 3MYGA 1G8AA 1GIHA 4O22A 4F08A 3ZUUA 2WEIA 3OP5A 4FT9A 5LQRA 3DBFA 3CBGA 2F7XE 3LKDA 4I4FA 3PJ8A 4ZEGA 4D1SA 2JHCA 4BCGA 4IEBA 1V0OA 1GIIA 2W1HA 5LMBA 4ZMFA 3QOWA 5L2IA 5CI7A 5C1QB 3FYJX 3Q5IA 4KBAA 4POOA 4IDVA 1OKVA 2RF9A 4WIHA 1OM1A 4RIWA 4GK4A 4HVHA 3E8SA 3LKZA 5EI2A 3LQ3A 5BNJA 3ZRKA 1OBGA 3VBTA 2BKKA 2PZYA 5HCZA 1P1CA 4M69B 4R6VA 3LFAA 2XNPA 4MNEB 4NM5A 1ZARA 4D5HA 1IM8A 4DFZE 1BC5A 2QO2A 3PXFA 4OTIA 4QVKA 5FWDA 3CTQA 1Q8ZA 1NW3A 3PA3A 5KZ0A 5FULA 4EC8A 5HIKA 1Z5MA 1MP8A 2JH8A 3R04A 1R6AA 1KE7A 2PY6A 4FSXA 3LLAA 4GJ3A 3S68A 2C6OA 2CLQA 3W2RA 4QQNA 3FI8A 1FINA 2WTDA 1Q4LA 3BYSA 2YJSA 2VTLA 4MBLA 4O86A 4XG9A 5CS6A 4M37A 2E5WA 1ZLTA 4XRJA 3CC8A 2X6EA 3R7OA 4G5PA 4O29A 3SMQA 1OZ1A 1KR5A 5CVDA 4BVUA 4FT4A 2IW8A 3L8DA 4XYFA 4YR8A 5A6NA 1G8SA 3HMNA 4RVKA 4U7PB 5GHVA 1M14A 2QHNA 1P91A 2XA4A 4E2WA 5AV0A 4IWDA 3NMUF 4O27B 2V7AA 4NFMA 3VS2A 4O7TA 3ZUTA 4ASDA 1Q0SA 2XIZA 2XZSA 3NYXA 4QP1A 2VTNA 3RKBA 3SKCA 5LWMA 3PSDA 3FXXA 5K4JA 3ER8A 4CTBA 3KQ7A 5AV3A 4ZTSA 3R8ZA 5LOHA 4OBOA 2XM9A 3H4JA 3EN9A 2VD5A 2BRNA 3GENA 4GC9A 3FTEA 3BHHA 4BRXA 3BUSA 1H8FA 3MJ2A 3EVEA 4X61A 3F88A 3TFWA 4GG5A 2IW9A 4UB7A 4O91A 4D4YA 3DH0A 1LP4A 4O2ZA 5KZIA 3R30A 4WKQA 4TRLA 2EXMA 2BZIB 1VYZA 1JTEA 1KHHA 1O9HA 4QQ5A 2GAFA 3BI6A 4EHEA 1TQIA 3NYVA 4EKIA 2OZAA 1OIUA 4FKTA 5AFVA 5FRIA 3WARA 4DG2E 5E9WA 4YMHA 3HUCA 4O7LA 3F3UA 5DNRA 3LPMA 3DS6A 2B0QA 3OBJA 1CTPE 3DCVA 3MH2A 3P86A 4CEGA 4EOJA 4FT7A 3U8WA 3ZH8A 5JMSA 3DLCA 5LR6A 2F8LA 4HJOA 3R71A 4F9YA 4GU9A 5IDPA 2YAKA 3UOLA 2AC3A 2JHAA 3O31A 3VHKA 4EOQA 3BQRA 1X1AA 1BOOA 3IYLW 5KKRB 2JIVA 2V7OA 3DLIA 4EZ3A 4ATNA 2IFTA 1KPIA 5K0FA 4C33A 5IA1A 2PSSA 4RJ6A 5DXJA 5EOBA 3U55A 2WTCA 3GRZA 2ZM3A 4X2GA 3FKNA 5E1MA 2Z8CA 3OZ6A 1MJFA 5ICGA 2R4BA 2BIKB 3O0GA 4WOVA 1PY5A 5TT7A 3ZO2A 1XJ5A 3ANXA 4C4JA 4FL3A 4O7VA 4L01A 5DX1A 4QNYA 4J71A 3RPYA 4V01A 1NVQA 1MRYA 2X2KA 4F1MA 3EEYA 5CY3A 2UZOA 3FTDA 2IGTA 3MERA 5K8VA 2BDJA 3CVOA 1EJ6A 2OBFA 5E8RA 4GFMA 1XQZA 2CKPA 4YC6A 4BCPA 3EVZA 1XHAA 4V0GA 1VYWA 5HEZA 2R3JA 3ENHA 3KQOA 3RGFA 3S0OA 1OIYA 2WPAA 3BHTA 1WCCA 2IW6A 2ONLA 2Z7QA 3F61A 3HGKA 4RX9A 4Y5QA 2XRWA 3MVLA 4W8DA 4G31A 3V5JA 4F99A 1IAJA 1M2PA 3DJ6A 2VTQA 5HIEA 2I6LA 4MK0A 3R8LA 3MGGA 3DFCB 1FMOE 4EHVA 1CSNA 4C4GA 3VS3A 2H96A 3AMAA 5DT3A 3P9CA 3Q87B 4K1BA 3JPVA 4A9YA 4NJDA 2GMXA 3LIJA 3PWYA 4PV0A 4DM3A 2REIA 3KXHA 3FKLA 2J4ZA 2JC6A 3A7IA 3DGKA 4K77A 1UWVA 5IMEA 4ER7A 4GC5A 4QMPA 4S2ZA 1B42A 2XJ1A 3E8EA 2JBPA 4MAOA 2J90A 2ZB0A 2GDOA 3UA4A 4PNKA 3VHEA 2XNMA 3UJBA 2OJ9A 2ZB1A 2OYRA 2BM8A 3ZTXA 4CMOA 1XKKA 5BVNA 2O07A 2R3QA 4FMQA 3DR5A 5K4IA 3QX2A 3DB6A 4FSUA 4WNOA 5E7RA 3ORKA 3RM6A 4PCLA 3BEAA 3UJAA 3EL7A 1E1XA 3HCAA 4IZ5A 5M4CA 5IKMA 4KINA 1XH9A 3NVMB 1WBSA 3GBZA 4O82A 3W2CA 5E1SA 2PMOX 2Y4IB 3LKMA 3QX4A 4LOQA 5F95A 3TACA 4EH6A 2C0IA 2UVZA 1JG2A 3GDHA 4BDKA 4CCUA 4LL5A 3TM0A 1WAKA 5LQUA 4N4SA 1IASA 3Q4ZA 4O0TA 2VWUA 1OKZA 4AGWA 4BBFA 1GZNA 4IX6A 1W83A 5JGBA 4MNFA 4GUAA 2IH5A 2UW0A 5HVYA 4RTSA 3BCEA 2VAGA 4IBMA 2I9KA 2JAMA 4FKOA 3AC4A 3TN8A 3V5LA 1ND4A 2GQSA 4M67A 4EZ7A 4BIDA 3OWJA 4FSZA 4JQ8A 4G6OA 4W8EA 2VZ6A 5DSXA 3ERCA 4ER0A 1A48A 3OTUA 1H26A 3QTXA 3QWJA 4FTIA 4IWQA 5CU2A 4U79A 3BBTB 5J5SA 2OGVA 2FSTX 4XG8A 5FGKA 2ERZE 3KRXA 1TQMA 4ALVA 4J8NA 3ODYX 1IY9A 5F20A 3NSZA 4I5MA 4E6CA 4XX9A 1AV6A 3P8ZA 5EH0A 3SG8A 3W2QA 4M38A 3ITZA 2FA2A 3BIZA 3QKKA 4G9RA 3VUKA 4DA4A 2JIUA 1J7LA 2ZZKA 4FSQA 3PRIA 4RVFA 3THSA 4JDKA 3DXNA 2R3KA 5DLSA 4IVDA 1I9GA 3A4OX 1W8CA 3SXFA 3TKIA 5FHQA 3W33A 5LVNA 5CEKA 5KMOA 4E6DA 4DCGA 4A7CA 3RI1A 2HXLA 2PZIA 5FEEA 3AC8A 3DY7A 1H1WA 3HA8A 3D94A 3OVVA 3VS0A 2PX8A 4E1ZA 5CNNA 2YDKA 4JS8A 3NPCA 5CWZA 4DCAA 5M09A 2CCHA 3SVVA 1X19A 2XYVA 2XYRA 1UU8A 3ZSGA 3IEIA 5LQJA 3GRYA 4F9WA 2RL5A 4FKWA 4CTJA 2R3MA 2XBJA 2VX3A 4FT3A 4H05A 5E1BA 3GU6A 2WHBA 4RRVA 5JRSA 4S30A 4EK9A 1BL7A 3KXNA 4KIOA 3ZO3A 4CFFA 3GJYA 4AE9A 4IE9A 5HKMA 3KXXA 4APPA 4GCJA 4XCXA 1ORHA 1GZ8A 3WOWA 4CSVA 3MFRA 5I9VA 4USEA 3GU3A 1OL7A 1RDQE 2JIIA 3AC5A 2O8YA 2R3PA 5FM3A 2G1TA 3DV3A 3NW5A 4BDJA 3FWQA 4JI9A 5KUPA 2BR5A 2H11A 2BALA 5HILA 1OUKA 2VX1A 4NH1A 4QTUB 4ZSEA 2YM8A 4D2SA 5E8WA 4WXHA 3VS7A 5FBOA 3QTQA 4AT4A 5IQIA 4AZFA 4EL9A 3A7EA 5EKUA 2C6IA 3WF5A 4G56A 1E9HA 4IM3A 3LECA 5GINE 4IV0A 4JR7A 3WE4A 3CD3A 3Q04A 3R21A 4IVAA 3KPVA 4OQDA 2ITXA 3UBDA 1EG2A 2W9ZB 3LFEA 2OZAB 4JRVA 5EZQA 4FG9A 1O6KA 3R63A 2ZM1A 2CGXA 2PJDA 2AOWA 3KF7A 3K3JA 3EZVA 3DMFA 3MTIA 2R3SA 5L3AA 4KDCA 4IVBA 1GOLA 2F2CB 2HCKA 4H58A 2YIRA 5AP2A 5HIIA 4DCMA 4GOOD 2RKUA 4IB5A 5CXHA 2PUPA 3UJ9A 3C51A 3R6XA 4W4WA 3V6RA 4ZZNA 5IPJA 3HEMA 3R73A 4GK3A 5EQJB 5G1XA 3EGVA 4A6EA 3P71T 2W06A 2OJJA 2YN8A 3PP1A 4HPTE 5HQ0A 3KVWA 3ZCLA 4ZTNA 1H28A 4HTFA 3BHUA 3LXLA 3ZBFA 4R1YA 1QYRA 1GIJA 5DYJA 5EKXA 4NCTC 5DT2A 3FYDA 3NUNA 2A1AB 4JX7A 3MPTA 5AUVA 4EKKA 3BBWA 4ASEA 3UMXA 4F7NA 5KBRA 3D2KA 3T3UA 3LBYA 1SG9A 3G8AA 4S32A 3WF9A 2GSFA 1VL5A 3TNIA 5HOQA 5KBQA 5CVJA 2PULA 4DBXA 2C47A 3TCPA 1KUTA 4JAIA 3SQQA 4AP7A 3GO4A 4PYOA 3SSOA 4H36A 1NW5A 3JWIA 4O7WA 5CF8A 3KCKA 2GNHA 4ACDA 3ZLYA 2UVXA 1PMUA 5M4IA 3PE2A 3DZOA 3FUXA 3NUPA 2WGJA 1PXLA 5F2KA 1ZGJA 2J50A 3ORPA 3U4WA 4FP9A 1Y6AA 2X4FA 3AT2A 3CLYA 3PJCA 1PKDA 2YCFA 3Q6WA 3QGYA 1RE8A 4QMXA 3SOCA 3TXOA 5CUQA 1W0XC 4YV2A 3FL4A 4Z7GA 4LOPA 3GT8A 5DVRA 2ZIEA 3G9LX 1UNHA 4FKIA 4AGDA 3OXIA 2E2BA 1KV1A 4LGGA 5CAVA 4V0GB 3FPQA 4N70A 1U4DA 4W4YA 4XOYA 1GZKA 5CU4A 2FVDA 4DHFA 2EU9A 4RG0A 1XVAA 5ANIA 2P4IA 5JFXA 3GXOA 2HAKA 1MUOA 2XEYA 3FY0A 4WG4A 3LFQA 3EQIA 4BTKA 2ADMA 4XOZA 1LUFA 4AW2A 2R3LA 3WILA 3I1AA 3EN7A 3SGCA 4FZ7A 4M7RA 3PVUA 2X8EA 4OTGA 2H34A 1JKSA 3ALOA 3D7TA 3R7EA 3TWJA 2FH9A 4CFUA 2Y1XA 3OZSA 4EQZA 3TKAA 3KQMA 5JZNA 3DA6A 3BX5A 3A7DA 2G72A 4ZTHA 2E9UA 2OJFE 2R64A 3LPBA 3HAMA 1ZOGA 4QMYA 2QE6A 3BWMA 2CJMA 3FPJA 5J1WA 1REKA 4L3PA 5CU6A 4MHTA 4CV9A 4TTHB 2W1IA 3VUDA 4M36A 1RJGA 2Z7SA 3VUIA 4AA4A 4BDIA 2ZLBA 4UZHA 3FMDA 5C01A 2UZEA 4IWNA 3EMBA 4QT1A 1W98A 3CXWA 3WZKA 5JGAA 3VRZA 4F09A 5FA8A 3EGEA 2X7OA 1UFKA 3SSNA 1BLXA 4CKCA 2OSCA 5EHYA 2W4OA 1QL6A 4FR4A 4MVFA 5AV1A 3LJ1A 2PVYA 3LFNA 4C58A 4C02A 2HNKA 4WBBB 3UZPA 4ANLA 2VWYA 2YXDA 4FEQA 5E1OA 3UWPA 2YERA 2FUMA 4HNIA 2ZYBA 5CVGA 2GFCA 4Z16A 3G6HA 5CSWA 4CKIA 2CKEA 4RMZA 4PDSA 3EB0A 4L00A 1O9GA 3ZXZA 3CS9A 5M06A 2ZV2A 2ZV9A 3CKXA 4Y5HA 4FS8A 3LCVB 2BVAA 4EOOA 2XRUA 4CG9A 4RSSA 3BGDA 1ATPE 2VTTA 4WUNA 3EFJA 5L2WA 4QPPA 3FLYA 3BU5A 4GIIA 5B0XA 3F2RA 1BKXA 3CC6A 3FC2A 4GMYA 4ER5A 4H39A 1OITA 2HW6A 3ODZX 3COIA 4B0GA 1XDZA 3NZ0A 1YZHA 3MH1A 3AOXA 4M3QA 5A54A 4FEVA 1NXKA 3THBA 3O7LD 3OUKA 1H1PA 2VDUE 1BMKA 5H3QA 1I44A 4JQEA 3CQEA 4Q5EA 3KB7A 4AUAA 1KYZA 3LCDA 2P1DA 2OFVA 4O7SA 1KE9A 4E6AA 3UIMA 4ZJVA 2ONZA 3Q9YA 3CQWA 3D4QA 4FV6A 2EG5A 3K6RA 2OO3A 3G33A 4G3FA 4IX5A 4MXCA 4BDCA 3LDGA 5K09A 4RTRA 1YXUA 5BYYA 4PMTA 3ALNA 2NNWB 3VUHA 3PVGA 3TPZA 3ER9A 5DWRA 4C62A 2YCSA 3CJGA 4J52A 5B2MA 3R0TA 1M17A 2GNGA 1CKIA 2C6KA 2XKEA 3G0FA 1GZOA 3LQ8A 4RZWA 3RM7A 1AGWA 4Y73A 3G89A 3FE3A 4GVAA 2VO6A 4E7WA 2GA9A 3FDNA 5IQBA 2QVSE 4C37A 4KA3A 2XBMA 3TUCA 4C4IA 5FUBA 2QNJA 4F1OA 2BTSA 3WYXA 1NA7A 5K0NA 1J1CA 4WT6A 2B78A 5DM1A 1ZZ2A 4EQUA 2XIRA 4K8AA 4EKLA 3SD0A 1Y8GA 4DEBA 1NY3A 4AFJA 3W2SA 5IDNA 5ICPA 3RAKA 2BHHA 2JBOA 1URCA 4FZFB 4QVGA 2QONA 1OKWA 3RVGA 3KY2A 3UPXA 3ZC5A 5A6OA 3V8SA 2X8IA 4FSNA 1YDSE 1JG1A 5M56A 1PKGA 4G2FA 2C1AA 3UODA 4DH5A 3PFHA 1XH4A 2JAVA 4LWPA 3IW5A 4NKAA 3GNLA 5FHRA 5D7VA 1YRPA 5AP5A 5EYKA 4UN0C 4Z3VA 3I58A 1P14A 5C8NA 4ZTRA 1APME 3D7ZA 5IA4A 4O81A 4BCQA 3TNPC 3P78A 5E8XA 4C38A 4HYIA 4E4XA 2GNJA 5L8JA 4YMJA 3MY1A 2XK7A 3PSCA 3Q4TA 4R5SA 3R8MA 2XK8A 1XH5A 3ZLWA 3P08A 5HD7A 5LMKC 4O7YA 4JNWA 2CCIA 2B9HA 3N9XA 1A9UA 5AWMA 3EVDA 4TYHA 1UV5A 3C4XA 4KRCA 3OCBA 4DEHA 3N4VA 2PPQA 4XV9A 3NEWA 3I5UA 5ICCA 2VWWA 3WZDA 3HVKA 4EUTA 4HYUA 1XBBA 3I4BA 3NUYA 4MTAA 4E6QA 3PTAA 3PWDA 4OTDA 3ZLXA 1JSTA 4FSTA 4HZSA 3UYTA 5FADA 1XO2B 2EVAA 2VWXA 5CAUA 4ER3A 4DGGA 4XBUA 2IH4A 1RJBA 2E9PA 3BU6A 4QYGA 4L7VA 4AG8A 4L7SA 2Z6UA 3MHTA 3OY1A 4GUEA 4BR3A 4P58A 1JAMA 2CSNA 2W0JA 3EMDA 1YXSA 2GS2A 3C5UA 3FHIA 4C34A 5HNGA 3ELYA 3QTWA 1GY3A 3V6SA 4BDFA 1OMWA 4FX3A 1FVVA 4UWYA 4AU8A 4BYJA 5JH6A 3QF9A 2ZV8A 4YZ9A 5KO1A 3IDBA 3OW3A 2J51A 4QYFA 4B17A 3BYVA 5HG5A 3SG9A 5KHWA 4QPAA 5CEIA 5E1DA 4PWYA 5HTBA 5EYMA 5HG9A 4U44A 1M0EA 2FYSA 2PK9A 4KS7A 3HCBA 3Q9ZA 4PRJA 3MBLA 3RAHA 4I41A 3CTHA 3TZMA 1W7HA 2PUUA 3A7GA 4LM5A 3AG9A 4DLIA 2Z6QA 4AOJA 1NW1A 3UJ7A 1WZYA 1OL1A 3DOGA 3O51A 4ZSLA 3I5ZA 4PMPA 3QXOA 3VIDA 2WMRA 5T67A 1IEPA 4JLCA 2BZHB 4FTKA 2XM8A 3QQJA 1CDKA 3HUBA 3I60A 3LLTA 3QQHA 3UQCA 3KC3A 3QD0A 4GIHA 4ZSJA 4KB8A 4UZDA 4U43A 1H4LA 3R7IA 4BBEA 4YUQA 5CEPA 3QTIA 5K5NA 1KSWA 2WOUA 3QQUA 4BCKA 4DGNA 5K0LA 4PIMA 3F4KA 4ALUA 4OX9Y 4UOEA 1CM8A 3QFVA 3A25A 4CZUA 1PXJA 3HDNA 5KE0A 3DULA 1PMVA 4PYQA 4RTOA 1JSZA 4FIGA 2YXEA 4BDDA 1H1SA 3PTGA 5T3QA 1G3NA 2XCKA 1R74A 4GU6A 1DI8A 5F4NA 2KTYA 3VS5A 3FZGA 4V0QA 4I4EA 4R8RA 3KULA 4ENYA 4IW0A 3DAJA 2H8HA 4XHKB 3UE4A 2PX2A 3M1SA 3MY0A 3ORZA 4QMMA 5EPEA 4YUVA 3UFBA 4RTMA 3D83A 5DWQA 4GOMD 3KRJA 2NPQA 3Q9WA 3M2WA 2NRUA 2IVSA 2HELA 4O0WA 4Q9SA 4AT3A 1XBAA 3DP7A 3OUNB 3NIZA 3PVWA 2XF0A 2IN6A 4EBVA 5EM7A 4QQTA 2J2IB 5A4CA 1RI2A 3MS9A 4BGQA 4DEDA 4MWZA 1L3CA 5CASA 2IZUA 4FODA 3V8WA 4FTMA 1FP1D 2FSMX 4R78A 3COKA 3DKCA 1JKLA 4CTCA 1M7NA 4DFNA 3V97A 2HZIA 4QMTA 4EH8A 2WMVA 4YHJA 3KF4A 3PRFA 4K6ZA 2Y8OA 5EDPA 4D58A 4F65A 5TF9A 2B2CA 2PX5A 2G01A 5D1NA 2YDJA 2VWIA 4GUBA 4QP7A 3S4QA 5LQCA 2BKZA 2VTRA 4DT8A 5HE3A 2CMWA 1R1WA 5I9YA 4DZRA 4LV5A 1PJZA 4FGRA 4GEKA 3PT9A 3KRRA 4H3QA 1YWVA 4ACMA 3O8UA 4RWJA 4XG2A 3HZTA 5I9XA 3R9HA 3WF7A 1F0QA 4C2WA 2GPYA 1L8TA 1Q8WA 1R3CA 3L9NA 5KHXA 3QRKA 4P7GA 1YFLA 3Q2JA 4U3ZA 2OO8X 5IEVA 3QUDA 3T7RA 3E7VA 2GS9A 2PE1A 4FGBA 4R77A 5CI6A 3ERKA 3LE6A 3QQGA 5K0JA 3NRMA 5E8UA 4K9YA 2WNTA 3BWCA 5H02A 4PYMA 3KQQA 4QMQA 3HECA 3M11A 3SLSA 1IXKA 3O8PA 1SZMA 4RVDA 1MQ4A 5FP5A 5D12A 2VO0A 4G9CA 3QU0A 4TW9A 2GFSA 4L44A 2C6DA 5A4LA 2Y1WA 4M8TA 4QMVA 4YZCA 4AWIA 3DLZA 2IVUA 3UJGA 5KMJA 4U0IA 1SM2A 2V22A 4HCVA 4RX1A 2ITQA 1DI9A 5EIFA 3U9CA 4CXMA 1EH4A 4A4XA 4M0YA 2PGXA 2GTMA 2O5KA 5D9HA 4LG1A 2H00A 3UIBA 3R2BA 3QBNA 2PVHA 4TYEA 4KIQA 4YTCA 1FJXA 1BI7A 2X9EA 3VO3A 5FM2A 3E7OA 3T9IA 2UYCA 3O7WA 2C5NA 2AOTB 4E33A 5AIRA 1KE8A 2JKMA 4X3JA 5EQPA 3ZRLA 4RWZA 1L3RE 1AQ1A 2FRXA 3QWKA 5ERGB 3KA0A 5HU3A 1A06A 5EOVA 1F3MC 4FICA 3I6WA 3QLGA 3HL7A 1Q8YA 2UW5A 2VTSA 4G3DA 3LXNA 3KGAA 5CZHA 4WG3A 4ZSGA 4FKLA 5J9ZA 1TW3A 1YDRE 4C3RA 1RW8A 4O6LA 5BP7A 2IZRA 5JQ8A 2BZJA 4CRLA 2OIQA 2EUFB 3QALE 3I7BA 3KL8A 3KXMA 4IDTA 4QYHA 2G70A 2XIXA 4E4MA 3ZDUA 4C4HA 3HMMA 2X6DA 4FIIA 3JY9A 3SX9A 2J6MA 3ZU7A 3C4ZA 4ZTMA 1QAQA 3UZUA 2Z60A 3COHA 1S9JA 3EWHA 3KXGA 4IAKA 4QDJA 2H9VA 3OE4A 2G71A 1OL6A 1ERKA 1NE2A 4FV7A 3ORXA 4MYGA 3NLBA 4I3ZA 4RIOA 5AX9A 1X8BA 2H1RA 3MV5A 5DRYA 4OTQA 2CN8A 1LR4A 2HZ0A 3TM4A 1UWJA 2F57A 1MQBA 4YUYA 2YTZA 2P3GX 5ANGA 2YITA 4HOKA 4XUEA 3TV7A 4DTAA 1UKHA 4C4AA 1Q24A 4I23A 2WTWA 3F3WA 5GOZA 4QP2A 3ORMA 5FUTA 4OT6A 3FL5A 2A0CX 2V0DA 4RVHA 3DU8A 3A7JA 4F64A 4F6WA 2CKDA 3AD4A 2C7PA 2E9VA 3R1SA 5ANOA 1KPHA 2WA1A 3F3VA 3POOA 1FVRA 3DK7A 4GT5A 5C8KA 3JWHA 3VC4A 3QQLA 3C0KA 2QQ7A 3B8RA 2UZWE 4E93A 2P8JA 2R3NA 4OGRA 3II5A 3FMHA 3RAWA 4I6FA 3VQUA 3AXTA 2OIBA 1AQJA 3ZEPA 3DUWA 4GOND 5MHTA 4XEYA 4DGOA 2QOCA 5ANEA 4C3PA 4IADA 3UC4A 4D9TA 2YCRA 4MQ4A 3SV0A 3MPAA 5FTOA 4FIJA 1ZZLA 5FTQA 5L2SA 1I4WA 3CJTA 3SGLA 5KVAA 4CT1A 4M84A 4RWLA 4MD8E 5J87A 3BQCA 4AZVA 1H1DA 3CCFA 3FYCA 5T64A 5JR3A 5AX3A 4R3PA 2YA9A 4FV3A 3ID6C 3DNDA 2JDOA 5IQHA 2YZAA 4O6EA 4XLIA 4QP4A 4ASZA 3WIGA 5M07A 3QUEA 4FT2A 2IH2A 5C8MA 3FMEA 4ALWA 2Y4PA 4G17A 3T8OA 5EM6A 4HH4A 2ETKA 3QRIA 4I93A 4N6YA 4TYIA 3TV4A 5FEDA 2ZVJA 5HLNA 2YM5A 1P5EA 3TIYA 1VPTA 3UO4A 2VWZA 1H1QA 5IH6A 1KWPA 3R1QA 2W7XA 4CMUA 4AA5A 1R0EA 1JG3A 1DS5A 5LQAA 3UOHA 3HCCA 2JG3A 3W2OA 5AA9A 3SSMA 1JNKA 1VP9A 3MTEA 3Q3BA 4K2RA 3UYSA 2R7IA 1YWRA 3EYGA 5DRBA 5BPYA 5IQFA 3CEKA 3MSSA 4LMUA 4NWMA 5CVHA 1IR3A 5HO7A 3MGYA 1YDTE 3KRWA 4FTRA 3NDJA 4C07A 4KIGA 2ZZNA 5AP1A 3LM0A 1TVOA 5IA5A 4B7TA 3RWPA 5JSMA 2GPHA 3GRUA 3H0ZA 3V04A 3GIWA 4ERWA 3TOSA 1YW2A 3G2PA 4FVQA 1YHWA 3L9MA 1J7IA 1PXMA 2VO7A 2YVLA 4IB1A 4JOAA 5BQ0A 3BGZA 2HWOA 4PDOA 4RVTA 3UNKA 3BRBA 4F9AA 5F2NA 1U59A 3FPMA 3RNIA 4B9DA 1Z57A 3GB2A 3FRHA 4YZNA 3NW9A 2YCQA 4H0NA 2NYUA 4NU1A 2PT6A 2W99B 2XNNA 4I24A 2G2HA 3P9NA 3DKGA 5EG5A 1NVSA 3MESA 3UBTA 4OTWA 5CAOA 5EHLA 2HYYA 3HV3A 4ASXA 3SR4A 2E9NA 4E30A 2CGVA 4RC2A 3NVKI 3O71A 4FTJA 1ZRZA 4FG7A 4EQCA 3PX2A 2BFYA 5EM8A 2PZPA 3PY3A 4EZ5A 5E8TA 2BM9A 1VR2A 4IC8A 4QMLA 2WMQA 3U87A
chains in the Genus database with same CATH superfamily
3UGKA 1XQWA 5E8SA 1AZTA 2QL6A 3C43A 4GT4A 3E8NA 1BJTA 4DC1A 2EV9A 1U7HA 2QD3A 2B1JA 3FZQA 4OMCA 4WERA 4Z0HO 1LK7A 4CL0A 3ZGZA 2FX3A 1R8QA 3N0TA 1QDEA 1DWOA 3JR3A 3C6YA 2D7CA 5C7LO 4BATA 2OGSA 4LVNA 5LQMA 2PVCA 1OVEA 5HZNA 5CM9C 2B25A 2ON6A 5HXAA 5FXMA 2NP7A 1G64A 4CEJA 2W7TA 3IESA 4K8OA 3BHIA 1GITA 2W6JD 4CM4B 3O1IC 2RHMA 1C3XA 4RJ5A 2CGUA 2PT5A 4OMUA 3LY5A 5DX0A 1I7LA 3DB1A 1YCFA 2PZFA 3SYKA 2VHTA 2V96A 1I6MA 3R5KA 4CCAA 3UOGA 4K6FA 1I3KA 4HX9A 5C52B 4L73A 2EB3A 2OE2A 5IXYA 2WIKA 4O2LA 1XU7A 2PD4A 3A9TA 1PBNA 2LE0A 1ID8A 1IG0A 3T3PB 1OVMA 3PNLA 5GJBA 4MQUA 3VS6A 1YL6A 2C68A 1UWCA 3O0DA 4URVR 3KB2A 3NWPA 2JFYA 5EUQB 1R00A 4RIYA 3NNDA 4JDJA 3EG9A 3KUXA 2C4WA 3EQCA 1N9GB 4GEGA 4Y2YA 2BFCA 2Z9CA 3V32A 2YRWA 2JD1A 3PXKA 3KVXA 2F7ZE 2IXDA 1X1SA 1SK9A 2VBFA 3EYWA 3SDSA 1I4EB 2ZT6A 5KAPA 2A0FA 2UZDA 4DM7A 4R8MA 3A1WA 1P61B 3KX2A 3ROCA 3OCGA 4L3LA 3HXTA 5FWYA 4GRBA 1WW8A 1WMSA 3QX9A 4YHTA 1II9A 2FKAA 3H8VA 3ZDDA 4GK2A 1H1LB 4GH2A 2JLZA 3R3SA 3GLHB 3IONA 1YQXA 3PG1A 1M34A 4L3OA 5HVNA 2W6IA 3OQIB 4KIWA 1JA1A 5CZIA 1P74A 2C58A 4F4UA 2CMDA 4PHTA 2JCSA 1IG3A 3JPYA 4RQAA 2CXTA 2O8DB 3P4YA 5AHWA 1MRSA 4EQMA 3IGOA 1ZNQO 3ABSB 3H13A 3W6NA 1HRKA 4GKKB 4TMVA 3D5XA 3AR7A 4GUDA 3NHBA 1I30A 4JOCA 1D1TA 2QLFA 1RJ9B 4E73A 4PZ0A 3LF2A 4XD7D 4RZXA 1UP6A 4P5PA 4HMOA 4CVAA 1E4VA 3ACCA 2W2MA 3MAGA 3T9EA 1L9KA 4EDFA 2ZWPA 2Q3CA 1H07A 2VJBA 4WKPA 2B21A 3ZJ5A 3CR3C 1MB9A 2VWQA 2BMCA 3I76A 1GZ7A 4FYKA 3U61B 1SB8A 2E49A 4WBXC 3KHSA 3FCXA 3A7FA 1CV2A 2EZUA 1TK9A 5AOAA 1IVSA 2G67A 2Y77A 5DBEX 3QVGB 2W6CX 3CNBA 2DKOA 2M98A 4GS6A 5GONA 5JNTA 3AY3A 3LP5A 4GAEA 4NFHA 5FP6A 2YR0A 5B2KA 5KYWA 3HZRA 4FK8A 4DFYA 2A2ZA 1OXBB 1SUIA 1WVWA 3KYJB 1ZX1A 3LMKA 4ZCRA 2CW5A 2L42A 3PWKA 1TAUA 4RTJA 5KMIA 4UZSA 5A4QA 4YC8A 3V1TC 1AQLA 5EHGA 2X40A 3LXPA 2HC9A 1QU2A 3MJ1A 2JGDA 2OJGA 3VM6A 3PNYA 1T8WA 1CB7A 2CE7A 1DKUA 1WSWA 4L8FA 1GSOA 5FFFA 4M89A 1FBNA 4XOIA 3GGDA 4ZY5A 4QYTA 2TMGA 4Q3CA 1WVYA 3I52A 4TYNA 1TJPB 2ZWOA 4QOIA 1HY3A 1QKJA 4RA9A 1ZYDA 3IDCA 3P9JA 5ED4A 1XTRA 3UGCA 4LHZA 2OZLB 4WD5A 1G20B 2P62A 4BZOA 1JXQA 3ZFYA 4RSMA 3NBFA 4BZXA 3FPKA 2KBFA 1TQ8A 1CR1A 1HYQA 4Z4FA 2OFPA 2VF8A 3N05A 1OCEA 3ZBUA 1OXXK 1SXHA 3V42A 1X14A 4RYDA 2VPWA 4Y85A 3HCOA 4QFCA 3ZWNA 1RHKA 1J25A 1PUJA 1YXTA 2O8EB 2BZ0A 3IP7A 2ZBEA 1FJ2A 4RXMA 4QJ3A 1E6LA 4ZAUA 2ZUWA 1E1RA 4LF6B 1EBBA 4HDKA 2H1VA 2POCA 3FPFA 1FX0A 3PS9A 4F4PA 5TPZD 4UHJA 1UM8A 3V8BA 5LP1A 1E1CA 1OXMA 4ZOCA 4KPYA 4HWOA 3UQZA 2FWRA 3Q2OA 3JVSA 3LCKA 1KY2A 3W79A 3TIFA 2IPXA 3CZPA 3SX4A 3PXYA 3L8ZA 1X42A 5K3AA 3FZOA 5I4NA 5AEPA 1E9AA 3R9XB 2XWSA 3BWFA 1JWHA 2VOEA 2OFUA 1RWQA 5E2AA 2FZWA 4X1OA 3ZONA 3I6UA 1K5PA 4FFBA 1PCXA 1LPMA 1FXSA 2Y8EA 5ITAA 4KBKA 4UPVA 5E6UA 3IW7A 1REQB 5CDTA 5B58T 1UEXC 1IAVA 5LJIA 2NQTA 1BA2A 2HX1A 5KIAA 5KQSA 1RP1A 1X38A 2I1VB 1Z3IX 5DN9A 4BP1A 2ONYA 1IB6A 3BJRA 1T0IA 1JDVA 3JZMA 5HF6A 3A9RA 1VRCA 5A0VA 4AMZA 1A9RA 1YMVA 3EQ9A 3F2AA 2Y3IA 2HI0A 4QP9A 3EZRA 2NSDA 2R2GA 1I9CA 3ZK7A 4PONA 2JLVA 2GTNA 2HQOA 3FQSA 4UMVA 4Z4HA 5HK8A 2WE7A 1ZFNA 1LWOA 4FUTA 3C5WP 3EFBA 5GIPE 3QQPA 2CHFA 1AKQA 1NT4A 5HS4A 1ZUD1 2HA6A 4PLCA 5EIWA 2AVDA 5AVRA 1AK9A 5ITZA 5LLDA 4LRQA 3A2NA 2CMKA 2X8LA 3TI1A 2R1UA 5KDOA 5CB4B 2IE8A 4C6HA 1VYVA 1N2HA 2C2WA 3O84A 5IVKA 3RODA 1V9CA 3ONDA 1Y8QB 4F4FA 1MJHA 1ZIXA 1ABEA 2IS4A 3E0XA 5PNTA 3ZHVA 1P19A 5U1PA 4IF4A 4BB4A 1E7MA 4IFBA 4NBLA 1DT5A 6Q21A 5FL7D 3E6AA 1J56A 3LM8A 2N1BA 3PE3A 4HNSA 4CYMA 2O0LA 1TI7A 4LDRA 1NJFA 5EQFA 4C08A 2PHKA 2GXAA 1Y7PA 1MJNA 1ORIA 2FG6C 4AF7A 2ZBQA 1MTOA 4EGJA 3DV9A 4UTPA 2WIAA 2C5HA 4FYIA 3EXHB 3EVNA 4MQBA 4KSPA 3BD8A 4IDNA 2F1OA 1QP8A 2VOJA 2VQDA 3DUFB 2BRHA 3DMHA 2PYWA 4S24A 1FE8A 5F78A 1M74A 3RFCA 1CT9A 4KLCA 5L40A 3KHKA 4QL3A 3A2MA 1YQGA 2OXFA 4YROA 3KQSA 3AW9A 3CIFA 2A0XA 4I6JA 4C0SA 4MW9A 3DAYA 2WQOA 1GG9A 4MLZA 4YH1A 3HV5A 2YW9A 3K0BA 3CRVA 2GRUA 4YLJA 4X5OA 4FV5A 5J63A 2WMDA 3G9TA 2J41A 5JK3A 4GGMX 5I8WA 2UW4A 1SWWA 4BHNA 2R6JA 1KOFA 4YO6A 4A0QA 2YIQA 2OHIA 1PJQA 3FFXA 2BDTA 1RIFA 3A05A 4OV6B 2JK1A 5L9AA 4H3PA 3W32A 2F8MA 3EXHC 4R40A 1W9MA 2WMOB 2P2GA 2FOIA 2I3AA 3PFQA 3OWPA 2FPIA 1CJMA 4DH3A 5DH9A 2ZG6A 3RALA 3L4BC 2O4UX 1XH6A 4BJJA 1VIDA 3S1AA 2CK3D 4LQLA 5CT0A 2QNBA 3VC3A 4Q1VA 4X97A 4UC0A 2NADA 1AGPA 4RD0A 3WQRA 3FLMA 4IUYA 3VUGA 4D0NA 3IFSA 3ZDAA 2JVJA 5AJUA 4RESA 4Y2HA 5H83A 1K4MA 5EG3A 1GO2A 4UUOA 2XLCA 3RSCA 5IU6A 5KHOC 1NVMB 3MI9A 3VNBA 1N7JA 2A92A 3OOHA 1SZPA 4J2TA 2RGUA 1SG0A 2OF4A 1X1TA 4KSQA 3U51A 1KK1A 1PZFA 4D96A 4RVOA 3IIMA 3REQB 1SHLA 3DWEX 1DDIA 3AY7A 5K3DA 2WMSA 1S2DA 5CVCA 1WUJS 3OCWA 5CG1A 1GPJA 1A82A 4EI2A 3KG2A 4F2GA 2QBYA 1GTMA 4UDYX 4DZTA 4QFDA 4ETNA 1S8OA 1D2GA 2VT7A 4OFWA 2OOSA 1IZYA 4BMZA 3KU2A 2JDTA 4YV1A 2MYTA 1ZN8A 3U17A 4DAWA 5K2OA 2XRZA 2XZDA 4DH8A 4AZTA 5G0SA 2VAMA 4OQLA 1PK8A 2Q62A 1AHNA 5HUQA 4DH7A 2R3RA 2JGNA 3V1YA 4DSTA 2XGMA 3UC3A 3H10A 4L02A 3C5HA 5AV4A 1H65A 4RBNA 4GKIA 1EHYA 1QP0A 4JD5A 3FNEA 1ZW6A 2I1MA 3FGOA 4ALJA 2NZVG 2JAOA 4J98A 3HNGA 3F46A 3OC1A 3QRWA 3H9EO 3R5HA 5IJZA 3WKCA 4D5GA 3R20A 3HWWA 2D3TA 1NV9A 1B6TA 2NU6A 1GFZA 3ZSIA 5EJIA 4B3RB 1QPDA 1LXCA 3KLNA 4MRNA 4JI8B 1LSUA 3RK7A 2VEOA 4RXUA 5D7NA 3U9SA 1NLYA 3GJ4A 3PDJA 1DXYA 3JRWA 3RF6A 1OIRA 3N8IA 2J5QA 4XYMA 2ACEA 2Q5LA 4G0WA 3KR1A 3KE9A 4ITHA 5IS2A 3PGJA 3D2BA 3PK0A 4E09A 5CALA 1NI3A 4HYHA 4DW8A 3NHMA 4YJNA 1P1FA 5DEYA 2G9ZA 4S0ZA 2WKSA 1U8FO 4XD2A 2PTKA 4APCA 3HTXA 1RFLA 4I3FA 2SECE 3X44A 1XDWA 2OPBA 3VVMA 2RFEA 3PZEA 2JRLA 4L4UA 3NYNA 5DWDA 1IB0A 2VYND 5BPHA 2FSUA 4DTBA 4GBED 4CFXA 5A5FA 6REQB 4WEOA 4OGLA 3K9QO 3NHRA 4M76B 3GOKA 3IKAA 2BUCA 1DAGA 4URXR 3BB3A 4NPCA 3CVJA 4TS3A 2X7GA 4WVFA 2HPVA 4U4AA 3V1NA 1U0RA 3M0EA 3ZUUA 3OWHA 2R11A 4FT9A 3TDKA 4IEBA 3FCCA 3AKLA 1IVNA 1NJ6A 1S3GA 4IDVA 4P3OA 4BC1A 1ZN2A 2NZ2A 3GV0A 3LQ3A 4IFTA 4M69B 3SLGA 5DEOA 1V4BA 2HU5A 2CD9A 3PUKA 3LLAA 4BX3A 1AHPA 1FINA 2WTDA 4EH1A 3G3EA 4YBRA 1ZSVA 2BSQA 5IG2A 1JF8A 3VS2A 1Q0SA 2O2ZA 4BFSA 5AVWA 5LOHA 3Q3EA 2DY1A 3CX7A 3GGPA 1NFQA 4TYPA 1EUYA 5IWAB 5IX8A 1NG1A 4KI7A 4MICA 3F3UA 2EGGA 3LPMA 3Q5DA 2Z3ZA 5AKLA 1WB5A 4P3KA 3DLCA 4XTRA 5SY4A 5IDPA 2VDRB 4EHLA 1M75A 1USIA 1BXKA 1ZJJA 4Q24A 3IPRA 1GGFA 2D3WA 421PA 2WKWA 3S0JA 4O7VA 1FTGA 2VQEB 4XDHA 3HMKA 4B4OA 4BLRA 1QH1A 1EJ6A 2GD1O 4IDFA 5C37A 3LL4A 3ZYCA 2IYVA 1M2PA 2I6LA 1NXXA 4LIPD 2Y4OA 3BPSA 2Z2KA 1U0OC 4OXNA 3LIJA 2GK4A 1GPAA 4GE3A 3A6LA 2GEKA 4EY8A 4M0EA 2HSZA 2OYRA 2BM8A 1JR6A 4CMOA 3RM6A 1HSZA 4BFCA 3IEPA 4E1VA 4OAOA 3Q4ZA 1F1BA 1F9EA 3ZJ4A 2ZUUA 3F8WA 3K2IA 2OGVA 4JOBA 1TQMA 4NKRA 1H0SA 1V71A 1AV6A 4PZZA 1XCPA 4G4IA 3FDJA 4IVDA 3DNPA 4OREX 5FHQA 1KBZA 5A4AA 1KR5A 5BOSA 4B9AA 5M09A 2HA3A 2B8EA 4WXPA 1VJDA 1D3AA 1BRTA 4FKWA 3KJIA 3RS7A 4UVEA 1BL7A 4CFFA 2VYQA 4WV3A 3UAWA 1QLJA 4CSVA 1ODCA 3N2YA 4EQ6A 1MR3F 5IVHA 2VX1A 2X1MA 5EKUA 3U31A 4IM3A 1IZ8A 1WXEA 2QTLA 3KPVA 3R21A 2RK6A 4ABYA 1XZJA 3A4YA 3K1YA 1HPLA 1UZMA 4KIUA 2Z57A 4JP2A 4BWGA 3V6RA 2G76A 2OJJA 4ZI3A 1Y8AA 3ZGLA 3O0TA 3B7WA 3VMMA 2Z1NA 1PHRA 3SZLA 4M9XA 2QRZA 4CTNA 2C77A 4EL0A 2IK8A 2HMTA 3O1JC 3NUPA 1EDZA 1Y6AA 2YCFA 2FVYA 3E58A 1V1RB 4MI3A 3LI2A 5DVRA 4UNQA 1KV1A 4P35A 1G19A 4OGKA 1WIWA 5LKAA 4CMEC 3ACBA 2W70A 2H1IA 4D98A 3EQIA 2R3LA 4JCOA 4FZ7A 1PT8A 4REMA 2J4DA 1MV8A 1L5QA 1H6CA 4MYRA 2BTEA