1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Fibrillarin-like pre-rRNA processing protein
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
4RTPA 2NPQA 4IAFA 4A4XA 2YEXA 5EW3A 1VPTA 3BWYA 2G01A 4IDVA 4A9UA 4DAWA 5GINE 2OIDA 2QNJA 4S2ZA 3EGVA 2JJQA 3KULA 4FT4A 2W1IA 5M5BA 4KRGA 3E8EA 1BI8A 1OECA 3KRWA 4BHZA 2R7IA 2HY0A 4LFIA 3PY1A 3S0OA 3C4EA 1JAMA 2WTIA 3LKDA 3NUUA 2OIBA 3MVHA 4F9YA 4MNFA 1ZYCA 2VO7A 2PGXA 2YDJA 3Q04A 5BUIA 3ELDA 3G7UA 3G2QA 3O51A 4ZTMA 3NW5A 3EIDA 3LVPA 1IAHA 1LEZA 1KXZA 1R3CA 4DBXA 3AWIA 5CY3A 4CKCA 4O7NA 1ZZ2A 2JKMA 4HW7A 5BNJA 2BVAA 2DPMA 4E4NA 1JQEA 2WTVA 4QYEA 1PXKA 4C08A 4E31A 3PJ8A 2GQGA 5F4NA 4E2XA 2P3GX 3FYKX 4DM3A 2QC6A 4G9CA 3QHRA 1Y8GA 4OTQA 4I22A 1RJGA 3V6SA 2QOKA 3JYAA 5DHJA 3QGWA 5C9CA 5LVNA 2C0IA 4HZRA 1YDRE 1EG2A 3M6WA 4KIGA 3DAEA 4YJVA 3H10A 2XKDA 5FEEA 2G2IA 5H2UA 2HWKA 2G71A 4O27B 5TF9A 3POZA 2IH4A 4FV8A 3AOXA 3B7PA 1ZYDA 2YCSA 3FZRA 3K3IA 3QYZA 3MI9A 3AD5A 2W05A 2ZIFA 3BIZA 4RZVA 2A4LA 1Z57A 1QPEA 5FTQA 4M0ZA 3CTHA 2BR4A 1H0WA 4PX6A 3UDBA 3ZONA 4WUNA 2PVMA 3DJ5A 5EDPA 4PGGA 3PFHA 2RFNA 3GWZA 3GU4A 3UPXA 3CTJA 1WG8A 1TQIA 3VULA 2I6LA 3Q6WA 1WZYA 2B9HA 1SUSA 3ALNA 5FEQA 5ICEA 1UVRA 4XOYA 4FKLA 4LOOA 3ZM4A 1Q24A 4J95A 3SAYA 5HNIX 3P79A 2EJTA 2IZSA 3RCJA 4J8NA 4Z2YA 4QMZA 4FKPA 4FSWA 5ETFA 3ATTA 4RTJA 5KZ0A 4PUZA 3RAWA 5EKOA 3TN8A 1W8CA 3S1HA 3A7HA 4G6LA 2H1RA 4RX1A 3BGZA 4FTJA 5AFVA 1U46A 3QQFA 5CT0A 3QAME 4DKJA 4UWBA 2WAJA 2GLUA 3KC3A 3R6XA 1FOTA 2UVYA 4YUZA 3LM5A 5D9HA 2RGPA 3FMLA 2RFSA 3SC1A 3VUDA 2P1DA 4F1MA 1YI6A 3K54A 1JQDA 1L1EA 1ZY5A 4HGZA 3R9HA 4E5WA 3M1SA 3HA6A 3DTCA 4YTCA 1H00A 4Z7GA 4RTQA 4C4FA 3NVKI 4QRCA 5HICA 1O6KA 3AGLA 4EL9A 3MTIA 3ZO3A 4FEWA 4E2YA 4YUVA 4HGSA 3MH3A 4QMLA 5K0CA 4UB7A 5LQNA 3CCNA 2BIYA 2UYOA 3EYGA 4L7SA 5K0GA 3SA0A 3HECA 4LG4A 1OL2A 1Q0TA 3TV7A 2XF0A 5AP2A 3LCUA 3RK9A 2H96A 4D0XA 2DWBA 2BTRA 2VTTA 3W33A 3LFSA 3QLFA 2AC3A 3QA8A 5AWMA 3PJCA 4LM5A 4PGHA 4V05A 2C0TA 4IKPA 4EKIA 4PIMA 3OFKA 4L44A 4PF4A 2PSSA 5AX3A 1Y57A 4K11A 4QTDA 1E1XA 3VUMA 4OUCA 5CU0A 1IASA 4RX5A 2OJGA 3W1FA 4F85A 1XDZA 4JX7A 1Y6BA 2J6MA 3HMIA 1KP9A 4F7NA 1ZGAA 4X61A 3BWMA 4FKUA 3T3UA 2ZFUA 3LCTA 3GRVA 4CTJA 3FSFA 2QY6A 1FVTA 2YX1A 1NVRA 3WBLA 4X41A 5HVJA 1FQ1B 2BUJA 2GQSA 5JN2A 4FKWA 2E9VA 3FZOA 1RJFA 3JS2A 4PDOA 4ANQA 3M2WA 3I0QA 4QQ5A 3TZ7A 3GQIA 2QU6A 5D1NA 3G33A 5DM4A 1H1RA 5DX1A 2IVTA 3FZSA 4K6MA 1APME 3II5A 5HU3A 4I5CA 2C5VA 4IWDA 3E63A 2PMNX 1W82A 5HOQA 2HXLA 3NJRA 3M6UA 2JHAA 5DH3A 5AUWA 4IC8A 3SG8A 3SR4A 1T46A 2PTKA 3LPBA 4NKAA 2Y6MA 3I0OA 5HE3A 1UU3A 2NP8A 4XP3A 3BQCA 3EWHA 5D1JA 2QONA 3CJQA 4DG3E 2PVYA 3EL8A 4BP1A 4O83A 3E87A 3ATSA 3H0ZA 2OFVA 2X2KA 1M52A 5EIFA 5IEVA 2JLDA 3HV3A 1Z5MA 3R9DA 2ZBPA 3EVGA 2OI4X 3FMKA 4EKGA 2XM8A 3ZS5A 3CY3A 3GB2A 2GNHA 5CUQA 4WO5A 4CV8A 3QQGA 2IZRA 5FD2A 4U7ZA 4WRGA 4LOQA 3TZ8A 2BPMA 4UXLA 4XHKB 3IS5A 3E5AA 5BQ0A 2EFJA 3LCDA 3A25A 4RTSA 5L2SA 1UU7A 4ATNA 3KXNA 1T45A 2QOLA 4H05A 2O0UA 2YM6A 1Q5KA 4W4XA 5LXMA 4UALA 2BZIB 4W8EA 2WTDA 4ZSLA 4BY9E 5DT3A 3MBLA 3L9MA 4PDSA 2ZVAA 3ZEWA 2AVNA 2XBAA 3P2KA 3Q4UA 3Q96A 3G51A 5CAQA 2OZOA 3FMNA 1J7UA 3SX9A 4BLWA 3MS9A 5EDRA 1I44A 5IISA 3TR6A 3NMUF 4UEUA 4Z16A 2XIKA 3LQ3A 2R7BA 4LRJA 1WXWA 4GVAA 3BELA 3S68A 4JT3A 3HRCA 4WBBB 3GCUA 4QP2A 4IAIA 5EHGA 2PZPA 2ITZA 3EVFA 4DEDA 3I64A 2GNJA 3HNRA 4R8SA 5EZSA 4ZAUA 5LJJA 1MQBA 1JKLA 3O7LB 4FVQA 4U81A 4RVLA 3KB7A 3BU5A 2QCSA 2PJDA 1YDSE 5IQDA 3RP9A 3EVBA 1ZYJA 4RPVA 4DH1A 5LARA 5KMKA 4YV1A 4I6FA 1GZNA 1SQGA 3GU3A 3BYVA 1NVSA 4FGRA 4PMMA 4ALUA 4OGRA 4FZFB 3LLAA 5IDPA 3LIJA 3HM2A 1UFKA 4RV9A 2XVMA 2VO0A 3IDCA 4UYNA 2IPXA 4JR7A 5GM2A 5M06A 5M07A 4WSYA 2EVAA 3MH0A 4IFGA 4FV6A 2C3KA 4Y5HA 3LBFA 2JAMA 3SOAA 3DGKA 1R8XA 3P9JA 4F70A 4DEAA 4FNYA 4GG7A 4GBED 1NW6A 3PXRA 1YDTE 4DITA 4O86A 4XCXA 3F5GA 4I6BA 4Y30A 1UIRA 3TUBA 3SVZA 3FBVA 4P2KA 3FZPA 3P86A 4AT4A 1B42A 1PF8A 3C3PA 4QYYA 3G6HA 2GHMA 2B9EA 2YM7A 4YZCA 1YI4A 2VTPA 5B1SA 3RW9A 3QRUA 2UZUE 2I7QA 1TKIA 2FYTA 3O4FA 4QTBA 3BQRA 2VX0A 3FQEA 2GNLA 1H01A 2Q83A 3ROCA 4U7TB 2PHKA 1W0XC 1ZKDA 4FIJA 4GIIA 3Q2JA 4IV8A 4XLVA 3REOA 3OWJA 4DA4A 1SNUA 3FY2A 4QMPA 2PVRA 4IBMA 3W18A 4E6CA 3MFUA 1IA8A 3E7PA 2ZWVA 4YUQA 4RTRA 3U6JA 4JBOA 4CFFA 1Q99A 3MCZA 4O0RA 3LCSA 4C05A 1L3BA 4HC4A 4FV3A 3V5JA 4C02A 5M55A 3ZM9A 3OZRA 3BZBA 4QMTA 4XV3A 2W17A 5CVHA 4A6DA 3I4BA 4PWNA 3T3VA 3VWAA 3IECA 4P7KA 3UJ9A 3IOPA 2V62A 3UBDA 3WF6A 3KXXA 2J51A 5CM2Z 4GL9A 3TTJA 1BMKA 4ZTLA 4IWNA 3CQWA 4PNKA 1FVRA 1ZY4A 3T0IA 2WTCA 5LCJA 3MA6A 4AOIA 5B7VA 3UP2A 1DAYA 3ID6C 1UV5A 1VP9A 3AMAA 3TIZA 1H27A 1M0EA 5CXHA 4QT1A 4XV9A 2ZMDA 2G9XA 4D1SA 4C36A 3TNWA 3I53A 4ZY5A 3BBWA 5EC8A 4CMTA 3KQOA 3EQGA 1N7IA 2VGOA 5CEQA 3MA3A 5JQ5A 4AS0A 4I4EA 2PE1A 1RJEA 2PMOX 2GFCA 2GAFA 3OWLA 2VTQA 2ETRA 5FQDC 4Y2HA 5B0XA 4FE2A 1BX6A 5IA2A 5K3YA 3EVDA 5EKUA 3SXSA 2YIYA 3OEFX 4FVPA 3MY0A 3M6XA 2B2CA 5EMMA 4GUAA 3WE8A 4YTIA 4X2KA 3C13A 3ER8A 2PULA 2CMWA 3CD8A 4IJ9A 3DBDA 1NY3A 2JH8A 2W1FA 5IQEA 5HIKA 3JVSA 3Q7EA 3DJ7A 2GDOA 5KBRA 1JLUE 3FMDA 3I5ZA 4C62A 3PXYA 4BDAA 3QGYA 5ETCA 4RZWA 3ITZA 4AW0A 4R3PA 2R0UA 4DTKA 4FKJA 1UWVA 5FXRA 5CF4A 1JR4A 5BYYA 2PXCA 1D2CA 3GCZA 1FP1D 3VAPA 2WELA 3NCGA 4O6LA 2WMRA 2RG5A 3GT8A 5F94A 4MBLA 4G9RA 3OZ6A 1FVVA 4M36A 5EZQA 3ER9A 4XYFA 4PYLA 3G8BA 3ROYA 2WOUA 4FSQA 4L8MA 4J52A 2ERZE 4M7RA 4M12A 3TNQB 3ORIA 4GOMD 5I4NA 3PJ2A 3HRBA 4EBVA 2AN5A 2VTSA 1ZQ9A 1Q8TA 4FT0A 5I9XA 1R00A 5HCYA 4P7FA 4JAJA 3ZMMA 3A7FA 4UZHA 5LVOA 4FODA 4AFEA 5FM2A 3FUUA 4RX7A 1WVXA 3L8XA 2WZJA 4IM3A 3NIZA 3N4UA 2ZULA 3E23A 1Y91A 3FPHA 5K01A 1L3RE 3KRRA 5LQKA 5KCVA 4ZLYA 2GPHA 4O91A 1FGKA 5FXQA 2P55A 2W5BA 1RI3A 3SV0A 1IAJA 4E32A 1G6Q1 3KQSA 1F5QA 3PSDA 2G2HA 2YM4A 5CNNA 2W5AA 4AA0A 3S95A 5JSMA 4NT4A 3E8NA 4X3FB 3LKMA 4YO4A 2F7ZE 2BAJA 3PS9A 2J9MA 4IEBA 2GTNA 4P5ZA 5G1XA 4N57A 5E2BA 3DB6A 1JQ3A 3GVUA 3Q53A 2HYYA 3ODYX 4X2GA 4R7HA 3RM7A 2XYNA 4EQZA 3IOKA 4U7PB 1YOMA 5KQSA 1G8SA 2R3GA 4J97A 2OW3A 3VS1A 2CKQA 3BRBA 3DMGA 4RJ3A 2B53A 3VIDA 4EH6A 4DFZE 4RQKA 5IA0A 3R3HA 1JNKA 1XDSA 4FZDB 5C26A 4QP7A 4YJTA 5C8MA 1XBAA 4IANA 4GU6A 2QHMA 2XIYA 4DEGA 3OE4A 5ERGB 3L8VA 5J8IA 4RC2A 4FKTA 4D4YA 4FTUA 3DQXA 1VYZA 3TTIA 2HAKA 3HCCA 3KK9A 3CPBA 2W1EA 5L6PA 4N6YA 3OU7A 4G3FA 3R02A 2PZIA 3ENHA 3ULIA 3HCBA 4C7TA 5CNOA 3WIGA 3GU8A 4TY1A 2QU5A 4YBKA 2UW8A 4QMOA 4DEHA 4LMUA 4CWAA 4KIPA 3EFLA 2UYQA 4BZDA 1FPQA 4AG8A 4BCOA 3BGVA 5CVDA 4D28A 1P1BA 4YURA 2O3PA 5ANJA 5BUEA 3UJAA 3E05A 3MCTA 5BVWA 3PLAE 4QTTB 2GHLA 5A46A 4EYJA 3HP2A 3CLYA 4OTIA 1GY3A 4IJPA 2XRWA 2IW6A 1Q3DA 2X1NA 3OPNA 4BTKA 4ZLOA 3DDPA 2BHHA 4EOOA 1YOJA 4IWQA 4IADA 2PUUA 4MK0A 3TFWA 4PONA 4HCTA 1TQPA 4YMJA 3N51A 3MH1A 4DT9A 4RVHA 2AZTA 4E7WA 3NVMB 4Z55A 2VN9A 1KOAA 2UW0A 4IDTA 3NYVA 3AY0A 4GC9A 3QCYA 2PY6A 3WZKA 2XNPA 3QXOA 5EW9A 1ZHFA 3UE4A 4IW0A 5IPJA 3KF4A 4UWCA 4XG7A 3SLSA 3QD4A 4ENYA 3P23A 3LDUA 2BROA 4WG3A 2HY81 5DR9A 2G15A 1XCLA 1JSZA 3B3JA 2GTMA 2WA1A 4D1XA 4FNWA 2WMXA 4M37A 4RG0A 4GMYA 1G60A 3ACJA 4EOLA 3DBEA 3A99A 2A0CX 5AUTA 5E8UA 4O0SA 3PDTA 3DJ6A 1WS6A 3VS7A 5A6NA 3RZBA 4S31A 3WYXA 3DXNA 4GT4A 2VWZA 5CCXA 4ACGA 3MIYA 2YCRA 3UZTA 3IQ7A 1GOLA 4A9TA 1GNGA 3SSOA 3OW3A 4MCVA 3NEWA 1O9GA 2ZV8A 3SQQA 2V22A 5FTOA 4MH7A 3GC9A 4J98A 3MTLA 4FG8A 2YJRA 3NWBA 3G5TA 2X2LA 4F7SA 3BU6A 2JIVA 3KQWA 5CVFA 2EJUA 4EK3A 2ZMCA 5K0NA 3CR0A 2BZGA 3SW7A 2HMYB 2XJ1A 3V8WA 3FY0A 3TM0A 3VRZA 5CALA 1J3HA 1URWA 5ANEA 4H0NA 2WKMA 3COKA 5BYLA 4Y73A 2C47A 5BX0A 5IA3A 2JDSA 4BGQA 3O0GA 4BB4A 4HTFA 1L3IA 1SQFA 5DX8A 4NM0A 2C6LA 2QLUA 3DBFA 5J87A 4R6XA 3VBXA 4MTAA 4B7TA 3VO3A 5CEIA 3EQIA 5M4UA 3RCDA 4IX4A 1YXUA 4WUAA 4M69B 1QYRA 3FRHA 4ASXA 3R0TA 1G38A 4NJ3A 3DV3A 3VC1A 3IG7A 1Q41A 4WA9A 3AC5A 4KIFA 4AW2A 4MIKA 4XUCA 2XKEA 2G70A 3BLQA 2ZSUA 3W8LA 3KRXA 3OBJA 2QRVA 4QYHA 3VBYA 4CT1A 3BEGA 5IG1A 2UYCA 4K6ZA 2V74B 3FTEA 1KE7A 3HDNA 5L6WL 2PVFA 1R74A 3C7QA 4FIGA 2VTLA 5AUUA 4LUEA 2YCQA 3QCXA 2C30A 3KU2A 2O06A 1XJDA 5CSVA 4C35A 5EM8A 4ERKA 4CFVA 4EH8A 5DXJA 4G2FA 3ORMA 4Y72A 4KB8A 3KREA 3CIKA 3FI3A 2XIZA 4FKOA 2FYSA 4I1ZA 1JQHA 3KPUA 4HVGA 1JG1A 2REIA 1O9UA 4ALWA 5HEZA 2ACXA 3VS3A 2XK4A 1KHHA 1YZ3A 3IW6A 5FBNC 4A06A 5HU9A 1MP8A 5CYIA 5DRBA 4LWOA 1ZMVA 2XM9A 4M15A 1ZZLA 5HI2A 4FK3A 1P2AA 3AMYA 3BV3A 1O54A 3UNZA 3GRRA 2YERA 3QOXA 4IQ6A 4QPNA 4K18A 5AP5A 1H28A 5DBXA 2W96B 4R8RA 2ESRA 4BYJA 3BCEA 3D2IA 3DBCA 5E8VA 4OT5A 4L46A 5CAPA 4KWCA 4YJNA 3V01A 5DM0A 3TEIA 2ZV7A 4I4FA 1REKA 4ITHA 3QA0A 3OT8A 4M14A 4U3ZA 5FRIA 4BTFA 2BIKB 5EQYA 4BI0A 3F61A 3OY1A 1NV9A 4IVDA 3NLBA 2J0JA 5E9EA 1JBPE 5BVOA 4IZYA 3GCVA 1OZ1A 4E2WA 4PV0A 5C03A 3LFNA 4JDKA 4F6SA 4FSDA 2VTHA 4P90A 5DPMA 4Y5QA 3VW8A 4JRVA 5E8YA 4QTEA 4P7GA 3UJDA 4GC5A 2OWBA 4L3JA 3GC8A 3HUBA 2F4JA 2IZTA 4ITJA 2PBFA 4XUDA 3LFQA 4EK6A 3KPVA 4QMQA 4QQCA 5JFXA 3F5PA 5HCXA 4J7BA 2NYUA 4LQMA 3HMOA 2QG5A 2WMVA 1OVEA 2QHNA 3OS3A 4Y83A 4YMHA 5M4IA 2YUIA 4C06A 5CTPA 3KN6A 3BT7A 3R8LA 5ICFA 5DM1A 2Z7RA 2Z6AA 1ZAOA 3FPGA 3M4XA 1DM2A 3PVCA 1INLA 2ZM4A 1WBOA 3EOCA 3JR1A 3A8WA 4KRDA 1K2PA 2NP7A 4QP4A 4FSNA 2ITXA 4F6UA 3UZPA 1OM1A 3N9XA 3CEKA 5HG9A 3FRIA 3QWKA 4BHNA 2FSTX 4XRJA 3LXNA 1PJZA 4DGOA 5FGKA 2EG5A 1XDUA 3EN4A 1H1PA 2PX2A 4LV8A 5E1DA 4TYIA 4E93A 5LMBA 3U4WA 3C6KA 3LHDA 1Y8YA 3PTAA 4EH2A 4V0RA 3VBQA 3GIWA 3FHIA 4YO6A 1W83A 2IJMA 4ZEGA 5CZIA 1VEBA 4XG8A 3FXZA 2E5WA 3NYXA 1AQ1A 4F1TA 5DEYA 4BR3A 3AC8A 1H8FA 5AP0A 3RALA 5AP3A 1ATPE 1A48A 3F9NA 3OXIA 1Q8ZA 1WBVA 5AX9A 1WBTA 3FV8A 4FBXA 2GHGA 4BDBA 4YC6A 3DUWA 4BCQA 1OUKA 3A4OX 3AG9A 3VNTA 4HNIA 3F3TA 2UZTA 4E6AA 2ZB1A 4TNDA 4RA4A 4CKEA 2CDZA 4LGHA 5EKXA 2VWYA 4HH4A 3IPHA 4EH9A 3W32A 4OTFA 3GU5A 3SSMA 4AZEA 3C0KA 3L9LA 3VSEA 3VW6A 2YDKA 1JKKA 3R28A 4HVHA 3A27A 2UVXA 3DA6A 4RX8A 1YF3A 5LMAA 1JSXA 2ZBRA 2EU9A 4DCGA 3CJGA 2QOFA 4TW9A 5GM1A 1UNGA 4BCMA 2OY0A 1L9KA 1G3NA 1DS5A 4TNBA 2NNWB 2W9FB 4EKLA 3TMAA 4EQMA 4V0QA 2PVLA 4RVKA 4AA5A 2W4KA 4FTMA 5E8SA 1AQIA 4EH4A 4L68A 4Q9SA 3TV4A 4IX6A 4RT7A 4CZUA 4CLIA 2OF4A 1EJ6A 1AF7A 5K5NA 2F2CB 2BALA 3R1SA 5T6KA 3MPTA 4F9CA 3KRLA 1H4LA 4AOTA 3LDGA 1IG1A 3TACA 5DX0A 4TWPA 2EWAA 2AVDA 5C0OE 4TTHB 3MJ2A 2IG7A 4X3FC 2RFDA 4CSVA 1G8AA 2P3QA 4DH7A 4KDCA 4QYGA 4NW5A 4HYUA 3TT0A 3Q60A 4FZVA 4ZZOA 3UIMA 4AUAA 2UW4A 3ZSHA 5E4HA 3BZ3A 5JZJA 4TWNA 5AMNA 4FG9A 3UIXA 1BL6A 3LJ1A 4N70A 1I1NA 3O8PA 4Y46A 2WQMA 3DLSA 3R7OA 4D5HA 4TRLA 4PMPA 4KS8A 5BPYA 5A4EA 1YXSA 4NL0A 4TYJA 4FVRA 5EEHA 2F7EE 4PTGA 3BI6A 2YABA 1PMEA 3UO5A 4ZTBA 3A26A 5HE1A 2W1CA 3D7ZA 3VS6A 1U54B 4BBFA 3Q3BA 1M14A 1Y8CA 4PTEA 4L01A 5LWMA 1WBSA 1PYXA 4ZTSA 4K8AA 3HCEA 3GXOA 3QYWA 4CG9A 3NSZA 2CMHA 4GOOD 1YFJA 5IA5A 4ER6A 4MEDA 5HBJA 4AZTA 5JT2A 2OXTA 4IZ7A 4NJDA 2J5EA 4D2SA 4BDGA 1FJXA 2ZZMA 4YZBA 4FEVA 9MHTA 3C0HA 4MAOA 3K0BA 2XYQA 3F3VA 4XCUA 2B78A 3KPJA 4F08A 4I23A 2XUUA 4I93A 4BDCA 1XBCA 5I9YA 5JRSA 1XWSA 4AN9A 3W8QA 4NSTA 5GJDA 3UJ6A 4O38A 3G9LX 4NM7A 2CNUA 3P1AA 3ZBXA 2CGUA 3R21A 5T64A 2GH1A 4MWZA 1XHAA 4L6QA 5IH5A 4PYQA 1NE2A 3KR0A 1B39A 4YSMA 4MD8E 5JK3A 3LMIA 4POOA 2HELA 5HIJA 4QMVA 4BN1A 5LQAA 2BR3A 1J1CA 4BZOA 3BHTA 2WA2A 4IM0A 3KXGA 2OLCA 3JXWA 2ZYBA 4R6WA 2G72A 2GS2A 3BYUA 4G56A 4AF3A 2QOQA 2OBFA 3KU1A 4YV2A 3GGFA 3DFCB 3UGCA 3TCPA 4TL0A 4HOKA 3QZGA 4PL5A 3F3ZA 4J8MA 5JH6A 2DS1A 4ZJIA 3HMMA 5F95A 4HCUA 4AN3A 5HVKA 4H1JA 4NTTA 4ER5A 2JITA 3SXFA 3V8TA 5KVAA 5KNJA 4RQVA 4K1BA 4GCJA 1KOBA 2JKKA 2UW3A 4MBIA 3LOKA 2XNNA 5ETIA 2XYRA 2C3IB 4HCVA 2JGZA 2JEDA 4JVGA 4YNOA 4GOND 3R8MA 5FA5A 2FUMA 3GCSA 2PXAA 3GBZA 4E70A 5HTCA 3ZLYA 1YFLA 3QTWA 4FTTA 2JDTA 3RHKA 4FIIA 3OC1A 5KMIA 1EJ0A 2WGJA 3KRJA 1FINA 3GQLA 4YJSA 5ICGA 2JD5A 4F9WA 3EGEA 4EHEA 3EVEA 3BE9A 2CKDA 2B1PA 4JS8A 4CLJA 3SOCA 3UJ8A 4KBKA 1LR4A 3UJGA 3ETAA 4K0YA 3MTEA 4MNEB 2VX3A 3RKBA 1R78A 3HKOA 4E30A 5EKNA 5JR3A 4C0TA 2EUFB 4X2JA 5FTGA 2YZLA 1P1CA 1EIZA 4RVTA 2OXDA 3DK7A 1M2QA 3TZ9A 2CPKE 4QYFA 1Q97A 3AJDA 1Q62A 4RLLA 3P9CA 2ZDUA 4MX9A 3QLGA 3D2LA 4OBQA 1SNXA 5E8RA 3QRTA 3P7AA 4BCFA 5FULA 5K03A 3W10A 3C4FA 4FT9A 1OPLA 3DK6A 3HNGA 4YTFA 2J0KA 4FSRA 4ZSJA 4IIRA 3MGYA 3O71A 4ORKA 5E1EA 2H8HA 4BCJA 1PXIA 4B17A 4RIXA 4ZSEA 4GU9A 3HCFA 2CJMA 3R7UA 5HG8A 2XNMA 4AZSA 2YISA 1OL6A 1WVYA 5I9WA 4FV4A 5A4QA 2NRYA 4QMXA 3B2WA 4RIYA 3TV6A 3OY3A 1SG9A 4FEXA 3IW7A 5KHWA 3LCVB 2XZSA 2XB7A 3D4QA 1LEWA 5FXSA 3ZRKA 4X0MA 4I92A 5HIBA 4ALVA 2XNGA 3K5VA 4CRSA 3UOKA 4CTBA 1S9IA 3SGCA 3U55A 4FT2A 5AP1A 3A7DA 3OU6A 1JKTA 3WF8A 2HZNA 1QAOA 3O8UA 1J91A 4PDPA 5GP1A 3QTQA 3OXZA 3E88A 2OKCA 1H26A 5C8KA 3OE5A 4MXOA 3DBQA 3I6WA 4QNYA 3S2PA 2JBPA 2ITVA 3HVHA 1P14A 4EKKA 3ANRA 4CTCA 4FZ7A 1KPIA 3GDHA 4TN6A 3KMMA 4FUYA 3MIAA 4DLIA 5DT2A 3VUIA 4EOMA 5B2MA 1XKKA 3MGGA 3UO4A 3EQPA 5FA8A 1KSWA 3V04A 3BKBA 2B9JA 2Y4IB 2IDKA 3M42A 4HSGA 5DTQA 4KKHA 4GKIA 4DFLA 3FYJX 2ZTHA 1JOWB 4DCAA 4NM5A 3C6MA 3UPZA 4ZJVA 3R1QA 4KVZA 2IW8A 5D41A 2AOWA 3KXMA 4PYMA 1R6AA 4GK2A 5TR6A 5DLYA 4RTKA 3DKGA 3RK7A 3UC4A 3EVAA 3R01A 4J96A 2XK6A 2J50A 2W99B 3IYLW 1PRYA 4C3PA 3THRA 3DAJA 2R3FA 2C6IA 4A7CA 4X2NA 3GC0A 2EXMA 4O2PA 2VZ9A 2W06A 5IH4A 5IZFA 2CHLA 3PB3A 5E8ZA 2PMIA 2YZAA 3GC7A 3VC2A 4G34A 3OBGA 2PV0A 3EYHA 5J5SA 2HXQA 3ZRMA 2FB8A 3HA3A 2VX1A 3RTPA 3QC9A 5HD7A 4WIHA 2VP3A 2IH2A 4C4GA 2ZZKA 2OK1A 2JBOA 3Q87B 4IVAA 2GA9A 4I20A 3KK8A 4G3DA 4ZTNA 4YLKA 4QTCA 4FKQA 1PMUA 2YTZA 4EHVA 3WOWA 4C58A 3DZQA 3NAXA 5L8KA 4W4YA 3E92A 4JI9A 4BP3A 4PMTA 3WF5A 2ITUA 3KKVA 5FUBA 3RNIA 5K5XA 3NX8A 4AX8A 2IH5A 2HW6A 4E2ZA 5AV0A 4DYMA 3Q9XA 4AP7A 4E4XA 2B4SB 4YPDA 5EFQA 1WFCA 3U9CA 5EI2A 4FV9A 3FC1X 1ERKA 1Q61A 1YW2A 5K8VA 3O7LD 4FT3A 3KQMA 3V8SA 3FMEA 1U54A 3EN6A 4CGAA 5F1ZA 3DXXA 3L9NA 3OOGA 3V5WA 4YZDA 2I6GA 3MB6A 3R7EA 4E6DA 4XBRA 3KQPA 4FV1A 4YJPA 5BVFA 5KYGA 2ITPA 3FXWA 3EQBA 3VS4A 4O96A 1NVQA 3M70A 5AV4A 3VRYA 4JG8A 2ITWA 4MQ2A 3QCSA 3EN9A 1M7NA 3ORTA 3SX0A 2V5QA 4JJRA 1YOLA 5EEGA 1ZYSA 5K9IA 4C4JA 2CNQA 5FEDA 4XUFA 2B54A 2WU7A 4IM2A 4YBJA 3AC4A 3O31A 1SYKA 5E92A 4C59A 4KAOA 5BP7A 5EM6A 3G2PA 1SZMA 2R3IA 1PXOA 4V0GA 4RTLA 3DXQA 3BYSA 1VYWA 2Z6QA 5HNBA 3MPAA 4EK4A 2ERKA 3D7TB 1WXXA 4YZMA 4MWHA 2ZWAA 1XH9A 3LFDA 2B7AA 2VWBA 1BHJA 4MXXA 1ZLTA 4YC3A 1ZOGA 2AOUA 4M0YA 5GNKA 1DCTA 4DEIA 5AJQA 2RF9A 3CXWA 4AN2A 5LQCA 2E9UA 4I94A 5DOSA 1OKWA 2FO0A 2VTRA 2ZBQA 3FUVA 2P41A 5FADA 4DN5A 2FRXA 2AOTB 4FTKA 4UXQA 3PT9A 3MFTA 1V0BA 2R3LA 3R1YA 3DLCA 4BBMA 4GEOA 3S4QA 3NUNA 2VV9A 3N4TA 4O7ZA 3PG1A 3ZZWA 2RL5A 4IACA 5M56A 3FC2A 4RVGA 2HWPA 4GUBA 2IVSA 2OH0E 5AAEA 1VLMA 2KULA 3D15A 4ANSA 4ASEA 2N47A 4HVIA 1A06A 5BXYA 3P7CA 4V04A 4HRAA 3KKZA 4LRKA 5E9QA 3HRFA 3RMFA 2J0IA 4A9RA 3LE6A 3OOMA 4FOCA 4QMSA 5EHLA 4PDYA 5EDQA 1ORIA 4KRCA 4XV1A 3EB0A 1JSUA 4OBOA 3V51A 4G16A 2PWYA 3PX3A 1UKIA 3P9KA 4J1RA 3C4ZA 4EONA 3V5TA 3RPRA 4WVLA 4EOIA 3DZOA 2YAAA 2C7PA 2C5NA 2V7OA 3CPCA 4B0GA 4ZMEA 5DRYA 2VD5A 4OTDA 2CCHA 3DT1A 4I6QA 2PPQA 2PWLA 4FKSA 2UV2A 3FQHA 3LPMA 3KXHA 2WTKB 3ZTXA 5DWQA 3MVJA 2X4FA 4CXAA 3C4CA 3BE2A 3QV2A 1MQ4A 4BDIA 3UZRA 4AW1A 3EMDA 3T8OA 2HV9A 5D11A 1O6LA 3ZDIA 2C4GA 4LRMA 5DI1A 5H8EA 3TZMA 4F86A 1GIHA 3EKNA 5CEPA 3F66A 4ZS0A 5IQAA 3HP5A 1BC5A 3GRZA 3NS9A 4NK9A 5CCBA 3MQ2A 3V97A 2JHPA 4HNFA 3VUGA 4DC2A 5EG5A 2C7OA 2VWIA 3ALOA 4F99A 3FUTA 2VGPA 2XKCA 3Q9ZA 5E8WA 3TQSA 1OIQA 4DQ0A 4C3RA 4YMGA 3CS9A 4MHAA 2XP2A 1MJFA 1MHTA 3UP7A 1KE5A 2F9GA 2J90A 2WIPA 4GUEA 3GFWA 4FSXA 3HGKA 4FEUA 3QHWA 4C61A 4FSMA 4APCA 5HX8A 2PT9A 3E7VA 2WK1A 3FAAA 3EQRA 4IZ5A 4WNKA 1X1CA 4EH3A 2C6TA 5A3XA 5IDNA 1HNNA 4M84A 4KUJA 4U40A 1TQMA 5DRDA 4O21A 4EC8A 5A14A 1FGIA 4XG6A 1H0VA 2X2MA 4RIWA 1PW2A 5ACBC 1HOWA 3C9WA 3R00A 3C50A 3VBVA 3VJNA 4ASDA 4PYIA 1KE9A 2VO3A 4OX9Y 3TNIA 3ENMA 5L8LA 1URCA 4MXCA 5CI7A 2GSFA 4XP2A 3FTCA 3QQKA 1X8BA 1FMOE 4DGLC 2QLQA 3EMGA 5EG3A 3ORPA 1LPUA 2ESMA 3W16A 4DT8A 4FOBA 1OPKA 2BRBA 3E64A 4DH3A 5J9YA 1OKYA 4YJRA 2OB1A 4S32A 3NWWA 4XH6A 3D83A 3OZSA 2WFYA 3R71A 2X7OA 4MQ4A 5J1WA 1WCCA 2PY3A 3VHEA 3GRUA 3GCPA 4JG6A 4JRNA 4RC3A 3HA8A 2PVNA 3WF9A 5ANIA 1XH4A 4DFBA 1Q8UA 4FT5A 3W2QA 2YWPA 4BGHA 4QVGA 3R6TA 3Q4TA 3TWJA 3CKWA 3EN7A 5IQBA 4RX9A 1OGUA 4HPTE 4UOEA 4HGLA 4RBLA 3FI4A 1OL7A 5AV2A 3PZHA 3COIA 4EYMA 4EBWA 5BVDA 3R1NA 1OB3A 3UWPA 2HZ4A 3LAUA 4CKRA 5DE2A 3BPRA 3C4XA 2O57A 5BMMA 2W4OA 5EOBA 1RI1A 2IFTA 4GYGA 3UYSA 2Y1XA 5AP7A 2ITTA 5D1HA 2H34A 4FTRA 4OQDA 1ZXEA 5AUXA 3I7BA 3O8TA 2NXNA 3EFWA 1GIJA 1PXMA 4NWMA 3BLRA 3U9NA 5DTRA 2Y6OA 2OZAB 3RIEA 3TM4A 2WNTA 2VS1A 4KDRA 3TPZA 1NT2A 3WF7A 2GU8A 2WMSA 2JH9A 3JPVA 3QTSA 1YHSA 4F7LA 4TYHA 1JSTA 4BF2A 3HV4A 2JIUA 3PJ1A 3COHA 5I9VA 5CSWA 4B4LA 4O7RA 4QO9A 5DT0A 5EHYA 5K0BA 3F7WA 4ZTQA 3ZU7A 1XBBA 1YHVA 5HE0A 4FMQA 1V39A 3ULZA 2QKRA 1AGWA 2YXDA 4U8ZA 1D2HA 5ANGA 4XP0A 4FT7A 4LGGA 1H1WA 4IC7A 4KBCA 5LMKA 5HLPA 4JBQA 4BDJA 2A2AA 5LVLA 2C5YA 5CENA 3P97A 4DF3A 4YNEA 2UZNA 3IK3A 3SRVB 1J1BA 5JMSA 1SKMA 3PE2A 3KULB 3UIBA 2XK8A 4FGBA 2NO3A 4H58A 2G1TA 5MHTA 1JG2A 1CTPE 5CEOA 4XNEA 1QPDA 4D4RA 3I58A 2BRNA 3AXTA 3ME5A 3QRJA 4M8TA 3F69A 3BGPA 2XBMA 4QDJA 4EHZA 4U79A 3ANQA 4FV0A 3SXRA 3M33A 3P08A 3P78A 3HX4A 4EOKA 4DA5A 4QPPA 3TDVA 1VBFA 3T7SA 4NYEA 2G8NA 2Y4IC 1OUYA 2YM3A 4O0XA 4JL9A 3VBTA 4EZ5A 2HIWA 2PVKA 3BGIA 1KYWA 4PRJA 4XEYA 1UKHA 4U43A 3FXXA 3PE1A 4BI1A 3L8SA 2VTMA 4EH5A 3PZEA 3MFRA 1WMKA 1YWVA 5E2AA 4GK3A 2AOTA 1MRUA 4Y95A 4BLVA 2WMAA 2XEZA 3RAHA 2XH5A 5CF5A 5K09A 2G2FA 1P4OA 2OSCA 1VP3A 3HVCA 4YUWA 3BHVA 4OQEA 3I60A 3HEGA 5CVEA 5EM7A 5ANKA 5LQFA 2P3LA 3VUKA 5B2KA 5KMJA 1P5EA 3OCGA 1OIYA 4RWLA 3JY0A 3UVRA 2ADMA 3NGAA 3R8PA 4F64A 4PP7A 2QM3A 5JZNA 4L7FA 3QTUA 4NM3A 4PYOA 4WHZA 1RI4A 4GRBA 4FZ6A 3TUDA 2UZBA 4EEVA 2QODA 4FTLA 1F38A 2VU3A 2VDVE 4MHTA 1TPYA 2CLQA 2I0VA 2Q0NA 4WBOA 4DHFA 2WTJA 5A4LA 3A4TA 4TPTA 4NZWB 3ZO4A 3RAKA 1XVAA 2JC6A 3W2OA 3V6RA 4AT5A 1X1BA 4HVDA 3TKAA 5EPEA 4QVKA 4FNZA 1IY9A 2UZVA 4BCIA 1NBIA 4MKCA 4D1ZA 1OR8A 5KKRB 1NW8A 4FKRA 4YHTA 2QYOA 5LMKC 4ARKA 3VS2A 4IB3A 3SHEA 5EMKA 4IAKA 3RAIA 2OPBA 4BLUA 3UG2A 4X60A 2GQRA 4CFNA 3FL4A 3BWBA 4DFUA 3BEAA 3TKHA 2R0IA 4E5BA 1R1WA 1QCFA 4ENXA 2YM5A 4FSYA 4FTAA 5EI8A 4PL4A 4DEBA 2PVHA 4IB1A 4W8DA 5C1QB 1KR5A 4ISCA 3MJ1A 1JVPP 3VBWA 4EUTA 3NW9A 3ANXA 3RWPA 3T9IA 3SVVA 4B6LA 2PT6A 4CMOA 1H25A 2ZM3A 5M44A 5CSPA 4Z9LA 5HGIA 5IH3A 3QKKA 1VQ1A 3NCZA 4EQUA 4TWOA 4U97A 5LR6A 3DOGA 2QOBA 1H24A 5L2IA 4DEEA 3LMHA 1M17A 4GJ3A 2VWUA 4GT5A 2UYHA 4FZAB 3BX5A 2WOTA 1IA9A 4GG5A 4X2FA 5CAOA 2ORED 4ZS4A 3I5NA 5CIYA 3B3GA 1RDQE 4ZJJA 1Y6AA 4E8AA 1XCJA 2Z7LA 2J0MB 3GI3A 4D5KA 4BC6A 3F5UA 2HZIA 2WMUA 3PWYA 2UW7A 3DKCA 3I7CA 3P2IA 5FHQA 3ZBFA 3LMGA 4O84A 3HZTA 1BKYA 3LGAA 5IKMA 5F9EA 2HTEA 2F49A 4AU8A 2VZ6A 3R73A 4Q9ZA 1CKIA 5T3QA 1BLXA 1TW2A 4IH8A 2OH4A 4RJ4A 3ZLSA 3AXSA 2C6KA 2BILB 4OA5A 4FG7A 4E20A 3K5UA 2IN6A 3BUSA 4FV2A 5HKMA 3K6RA 3UJ7A 1WBNA 5JUWA 2Q41A 4E73A 2Z6UA 2W1HA 3UFBA 1TW3A 1KE8A 3CGFA 4L67A 3S00A 4ZIMA 5IA1A 4ZSGA 3AC2A 1U5RA 3LCOA 5E1OA 3KCKA 5DTMA 3AXWA 2ITOA 2OJFE 1W84A 5DT4A 2H9VA 2E2BA 1NW1A 4H3BA 4I0TA 2R9SA 2XEYA 3H30A 1DI8A 3LQ8A 1YXTA 2VWVA 4LL0A 3GP0A 2WTKC 4JR3A 1QAMA 5HO7A 2XJ0A 2P33A 3CC6A 4RJ5A 4PNIA 4D2RA 5M53A 3S3IA 4FTOA 3GEQA 5AEPA 3PX2A 3NZ0A 3QL8A 1M6YA 2BZHB 4U44A 3D5UA 4RRVA 2ZOQA 4EWQA 1ZGJA 2JIIA 2C3LA 3GJYA 3H4JA 3LKZA 4BDDA 4CVAA 2HENA 4JQ8A 3E8SA 3SMQA 2Y4PA 3H9FA 3T9TA 3U51A 5BW5A 4U45A 2P8JA 3GXLA 5CI6A 3UJBA 3DMHA 2Y9QA 2CGWA 1F3MC 4F0IA 2IZUA 3UVQA 5HO8A 4FKGA 3QQJA 4O2ZA 5DLSA 4E6QA 1ZOHA 3EN5A 5AUZA 5IUIA 4PIPA 3DY7A 2I0YA 5TKDA 4BKJA 3FLWA 4FIFA 5T67A 4N4SA 4R05A 3HP7A 2J4ZA 1UNLA 5A6OA 3FWQA 4NU1A 3EZRA 4NCTC 3SRVA 3QQHA 2W4JA 2O8YA 3PA4A 4FSUA 3H3CA 4QTUB 5HFJA 4FS8A 3WARA 3NWEA 4ACCA 3LXLA 2J5FA 4JIAA 2GNGA 1PKGA 2NP6A 5IUHA 3BXOA 5E9WA 2XCKA 3QTZA 4USFA 5CQUA 3PSBA 2WQNA 3P0MA 3V3VA 1SUIA 4GF5A 4DCMA 3CC8A 4L3PA 3V8VA 1MUOA 2UVZA 4OTGA 2UZDA 2PUNA 4RJ7A 5HIEA 2F7XE 4L43A 4D4SA 2RIOA 3WILA 3C51A 3P4KA 2YJSA 3UNJA 2F2UA 5LVMA 3KVXA 1N7JA 5FCDA 3ZEPA 5IH6A 2WQEA 5I0BA 3VVHA 3FL5A 3LCCA 3PYYA 4F1OA 3G15A 3Q9WA 4EI4A 1GZKA 5E7RA 3C0GA 5HBEA 2P35A 2BDJA 2EB2A 2BFXA 2V55A 3E3BX 4OA8A 2QOCA 4KW7A 4XX9A 2C68A 4BCNA 2UW9A 1R8YA 3T7TA 3TNPC 4O22A 3A4PA 2UZOA 5HHWA 4YZNA 5FP5A 1QPCA 3RM6A 4X63A 1B38A 3L8DA 4FTCA 2DQ7X 3R7IA 2XNOA 3EKKA 4BDFA 4HPUE 4ITIA 3K3JA 2R3MA 4UYAA 5J9ZA 3KXZA 3MWUA 3DPKA 5T68A 3MV5A 1SVEA 3HVJA 2YA9A 5GJGA 1MRVA 5KE0A 3DXZA 2PU8A 2FCAA 1XH7A 3OMVA 3ZUTA 3FI8A 4ACHA 2OYRA 2Z8CA 1KE6A 4XV2A 3HLLA 3UO6A 5KS2A 5EK7A 3G2OA 1Q8YA 1Q0SA 5CU6A 4CXMA 2BFYA 4R1VA 1WBWA 4C03A 2W9ZB 5AP6A 3QU0A 2HR1A 3UJCA 4FEQA 2H6DA 3R9NA 2W1ZA 2ITQA 2P4IA 4UX9A 3MSSA 5AAGA 4LWPA 3KMUA 5TT7A 1LUFA 3OP5A 4E26A 4FYNA 1D2GA 2IW9A 2YXLA 3PTGA 1R18A 1NBHA 5EGSA 3PFQA 5JKGA 5M4FA 5HIIA 2R3PA 4FIEA 4J71A 4CFWA 5HG7A 5DVRA 3DNEA 3DR5A 1I4WA 4RTNA 3JUHA 4JNWA 1ZOEA 4KIOA 3KQVA 3LQ5A 4FGZA 4C33A 5DN3A 3MAGA 3NDJA 3SGLA 1JTFA 4JAIA 2P7IA 5AUVA 2FVDA 4AA4A 2R3QA 4USDA 3FLSA 4QP9A 3KPWA 4C38A 1XJ5A 4A07A 3R2YA 2QOIA 4X7QA 5KO1A 3F3UA 4BIBA 5HQ0A 2QR8A 3KVWA 3ZO1A 2ZCJA 3A60A 2BKZA 3L9PA 1BUHA 4W4WA 3RI1A 2YIXA 5HX6A 5HILA 4AOJA 2ZLBA 2UZEA 5HLWA 3KQTA 4PYNA 2XBJA 3HV6A 2C6OA 3VN9A 5HCZA 3QTXA 4BRXA 3ORNA 4FV7A 4DGGA 2WIHA 4BYIA 2AR0A 2KW5A 2LGCA 4HVSA 2I40A 3ORLA 4JBVA 2W5HA 5DPVA 4XUEA 4O0UA 1VE3A 3ZO2A 2PL0A 3FKNA 3KPYA 5M08A 2OBJA 3OTUA 3DLZA 3PP1A 1RW8A 5LCKA 3H9OA 5IQCA 3GUBA 2Q0BA 3QWJA 4KKGA 4B9DA 4CEGA 3RPOA 3AT2A 3F6XA 3SXJA 3IGOA 4D58A 1QL6A 2WPAA 2XMYA 3LDFA 3RK5A 1CM8A 1KUTA 5FBOA 5CXZA 3ERCA 4RSSA 1KPHA 4KINA 3MFSA 4CV9A 5C4KA 3A7IA 2PVJA 5EI6A 3AD6A 4BDKA 1OBGA 3REPA 3QX4A 2GS9A 3JWHA 3R22A 3IKAA 3R83A 5E8XA 1VL5A 2IP2A 3UODA 2C6DA 4FX3A 4DBNA 1XH5A 4WOVA 5A54A 3EQCA 5LQRA 2FSOX 3KN5A 2PKWA 3FEGA 3O7WA 4EQCA 5KKRC 1SM2A 4IHPA 5IUGA 4YUXA 3ORHA 3Q5ZA 1ORHA 4E1ZA 3AGMA 4NFMA 5L2WA 3HTXA 5B2LA 5KHXA 4L45A 2XVAA 1G55A 4RA5A 2R3KA 4QTAA 4HGTA 3CVOA 4EOPA 4BVUA 3MPMA 4CFMA 5G6VA 2XYVA 3TKYA 2GS6A 1DI9A 1DL5A 1KYZA 4OW8A 4M67A 4S30A 3ZLWA 3WZDA 3TKIA 1RE8A 3D2KA 3CBLA 4EZ7A 2O05A 4O0VA 3W55A 1QMZA 4PWYA 2E9NA 1CDKA 3MVLA 3G8AA 2Z7SA 3MTFA 3JWJA 1BI7A 1XR1A 3G6GA 4N6ZA 4FR4A 5EYDA 1UA2A 4MYGA 4YP8A 2KTYA 3B2TA 3PRFA 4IZAA 3C1XA 1U4DA 2AOVA 2XKFA 5D12A 5K0EA 4AQCA 5HLNA 4B99A 3Q4CA 2Z7QA 4UZDA 4QPSA 5HEKA 4M13A 2CN8A 5HTBA 3ET7A 1IXKA 4IWPA 4O82A 3FDNA 4DLJA 4F63A 4EZ3A 3HMNA 2I0EA 5KQRA 4KA3A 4LL5A 3HMPA 2QO2A 4O29A 3ERKA 5E9JA 4R1YA 2GS7A 1NV8A 3ELJA 3HL7A 4R3CA 4I6HA 3BHHA 2LD4A 2YVLA 3HA5A 3G5LA 3FMHA 1N2XA 2E9OA 4KBAA 3OF0A 3F2AA 3FUPA 4CTKA 3F5XA 2CNVA 2XYUA 3OUNB 4A4LA 4MXYA 3OWPA 4OTWA 4X3FA 4UBAA 1OBDA 5D10A 2WMTA 4MVFA 3G5DA 4WD5A 5DRTA 3NUXA 3ZLXA 3SM3A 2ONYA 3M11A 3I1AA 1UWJA 2J2IB 4C34A 3QFVA 1LP4A 4UWYA 4KKEA 4I5MA 4EMSA 4K2RA 3HCAA 3V5QA 1GZOA 1Z9XA 4QP6A 2VTIA 4H3QA 4UN0C 5H8BA 5E1SA 3V5PA 3OCJA 1P39A 2O5KA 3CJRA 3FMMA 2UZWE 3GGDA 1E1VA 1V0PA 3EQHA 3NNWA 2X39A 1RI5A 4I24A 3LFAA 4F0GA 5BVNA 5J1VA 2B3TA 2CN5A 3NYOA 4L7VA 3A61A 3WZEA 3UYTA 1O6YA 2VWWA 4GSBA 3BKWA 4FTIA 4P58A 3I6UA 4YLJA 2XNBA 3G2FA 4RGJA 4G31A 2IGTA 3KA0A 4L42A 3OT3A 5EOVA 2VUWA 4Q5EA 1SVGA 3F2RA 1VZOA 2B52A 3F82A 5H02A 1VIDA 4EJNA 2AS0A 3R63A 3CCFA 2R3RA 2ZVJA 4APPA 1ZMUA 2X8EA 4MTLA 1WY7A 4R6VA 5HZNA 4IWOA 4O6EA 4RWJA 2ZJWA 4GYIA 2Y0AA 3OW4A 3RGFA 4QMMA 4A9SA 1YUBA 4AGCA 4F9BA 2PYWA 4CKIA 1F0QA 5AAFA 2QG7A 3NPCA 4CMUA 4XS2A 4GJ2A 4LUDA 2WEIA 3THBA 3KR2A 3ORXA 5K05A 2RKUA 2A14A 3LECA 3HUCA 2IBSA 1U59A 4DE4A 5LQJA 1AD5A 4ZTRA 3OCBA 4PP9A 4XJ0A 3QRIA 2J7TA 4JIKA 1NW3A 4GH2A 4KNBA 4R7BA 5IEYA 3U8WA 5BVEA 3DP7A 4QDKA 3C3YA 4YGAA 3A7EA 3HEMA 3PSCA 3KGAA 3Q52A 3LFBA 5CSHA 2C6EA 3CKXA 3SKCA 4HG2A 3QXPA 3PVBA 1H1DA 2WQBA 4NH1A 3HVIA 4QP8A 3NIEA 5CANA 4HTFB 1WZNA 1SVHA 5ITAA 5JFVA 3BYOA 4YU2A 1M6EX 1CMKE 4RVFA 2UZ4A 1PXLA 4PCLA 4EK8A 4GK4A 2BKKA 5KBQA 5FQNA 4K77A 1NKVA 2CGVA 2R3OA 2HCKA 3VQHA 5K0JA 4IFCA 3O17A 3HAMA 3ZOSA 2QRVB 4NIFB 3PPKA 2NXJA 3G90X 4X3JA 3SD0A 2P2HA 3KCFA 4FK6A 2OF2A 4GEKA 1J7LA 4G6OA 1RJBA 3FI2A 2A19B 2ZZNA 2R2PA 3BV2A 5P8WA 4HGEA 2PK9A 1EAMA 2PX5A 5EQPA 3DTNA 4ANBA 3VS5A 5LVPA 3D14A 3PY3A 3RWQA 4F09A 4D0WA 4U41A 1UU9A 3P8ZA 3RVGA 3TIYA 3EHAA 3B3FA 1AV6A 1OKZA 4H36A 3OROA 3Q6UA 4A6EA 4DZRA 3HYHA 3NDMA 2WMBA 4JLCA 2O2UA 2FA2A 3CQEA 3P9NA 3CY2A 2B9FA 2DUVA 5J9LA 4TZRA 1R0PA 2YFXA 3QZFA 3QRKA 4AFJA 4BTMA 5F2OA 4YV0A 2ONLA 2R6ZA 4FR0A 4O81A 4KSPA 3EEOA 5JGAA 2V0DA 1IR3A 2Z60A 5ANDA 3AD4A 2ZW9A 3L1SA 4ZTHA 1UNHA 3FTDA 2BDWA 5DSXA 3R8UA 4RIOA 3CGOA 1XO2B 3DTWA 4JDIA 3O96A 1L8TA 2OZVA 3HCDA 3BGDA 1K3AA 3QKMA 1OI9A 5JFSA 5CAVA 4P4CA 2WQOA 4C07A 4C37A 3WSTA 4TT7A 2Z02A 3NW7A 3LFCA 5F2KA 5CEMA 2ZIEA 4CNHA 1GAGA 4ID7A 1IM8A 3ODZX 1GIIA 4ZY6A 3I79A 5FHRA 1E9HA 2IVUA 4GKHA 2A1AB 3FPMA 2F8LA 2WHBA 3TLJA 4GS6A 4JBPA 5BUJA 5AUYA 2WMQA 5IQIA 2P40A 5EYKA 2YN8A 2C5OA 2V7AA 2ITYA 4X6QC 4CZTA 1ZMWA 5FUTA 5JQ8A 4EORA 4QP1A 4WT6A 4R5SA 4BDHA 2JDVA 2CCIA 1YRPA 3PPZA 4TXCA 2YQZA 2BRMA 2UUEA 4FP9A 1H1SA 4AZVA 3B8RA 4CG8A 5M57A 3OD6X 3ZFMA 4K33A 3R2BA 5FWDA 5CF8A 5K0FA 2ZV9A 4ACMA 3ZH8A 2PE2A 1DUSA 3C5UA 2XRUA 3IEIA 1BL7A 3OG7A 3UOLA 1JKSA 4GW8A 4EUUA 3HV5A 1STCE 4IAYA 3WE4A 2H11A 4C2WA 3D9VA 3W2CA 3W2RA 5EHIA 4HJOA 2DYLA 2ZDTA 1REJA 3G9NA 2PZ5A 5E90A 1YZHA 3LJ2A 3LM0A 2K4MA 3A62A 2CKEA 4RLKA 1XH6A 3A2CA 4ER0A 3IV6A 4FA2A 5DSTA 1P91A 4HYSA 3UQCA 3VF9A 1P4FA 3LBYA 1F3LA 4E33A 1EH4A 3FYDA 4DMGA 5A4TA 5KMLA 3JVRA 3BWCA 4WNOA 4ZZNA 1SMHA 3OVVA 4R3RA 5DM2A 4MF1A 5CAUA 3RPVA 4OTRA 4UY9A 4XG3A 3R8ZA 1KV2A 5AIRA 4IX3A 5FDPA 3PP0A 1YXVA 3UQGA 3KQQA 2A27A 2BAKA 3GO4A 4EOSA 1IRKA 3CGGA 3NRMA 3DCVA 3CE3A 5AV3A 4CFXA 2ONLC 1Z3CA 2PSQA 1A9UA 3EJ1A 3FYCA 3Q2MA 2BRGA 3O23A 4C2VA 2FSMX 5CU3A 2O07A 4FI1A 2YIRA 4PYJA 5J95A 3D5WA 4IV0A 4XG2A 4U42A 5FTWA 3FQSA 1PXJA 4ZMFA 4L52A 4DFXE 1OL1A 1JG4A 3TXOA 4O7WA 3GU7A 4FYOA 1QZZA 4RYLA 3U4UA 1L3CA 4YR8A 3EGIA 2YACA 4X6RA 1R0EA 5E1MA 3IGGA 3NNXA 5EW8A 1YKRA 1BKXA 2GB4A 5C1IA 2XCHA 4G3EA 5H8GA 5DNRA 1UU8A 3G0FA 2JFMA 4WKQA 4QMYA 2YWVA 1KV1A 3R0QA 2PX4A 5LSAA 3R9RA 4ONAA 1WVWA 3Q9YA 5AIKA 3QD2B 4AUKA 5BW4A 1ZARA 2R4BA 3JWGA 5JEBA 2OXYA 4KD1A 4GIHA 5AM7A 3OEZA 3B8QA 4AGWA 3LL7A 5DEWA 1ND4A 4M97A 2I0HA 3I5UA 2OGVA 4EK9A 3PUPA 5GIPE 5EM5A 4GFGA 4CRLA 4C4AA 2PZRA 4B8MA 4J99A 3U6HA 4RWIA 3ORKA 1YWRA 3Q4ZA 3GU6A 4JXJA 4Z7HA 3A7JA 4AACA 3IHTA 2XIRA 4OBPA 4RC4A 5IF1A 4FIHA 5FWAA 2OICA 3QZHA 3MN3A 3H0YA 3PXKA 4TYGA 4Z3VA 3R04A 3NDIA 1JG3A 4I5PA 3W2PA 2WMWA 3KL8A 1MRYA 3MB7A 4JX3A 3AQVA 2C0OA 4GOLD 3LJ0A 2QO9A 3ZC5A 4D4VA 3IONA 2IO6A 1RQQA 3QKLA 4RJ6A 4EVIA 5A4CA 2GNFA 3E3PA 2HWOA 1WAKA 4II5A 5GOZA 4C4IA 3E8DA 5TOZA 3GCQA 1Q8WA 5K4IA 4YPSA 3BHUA 5CVJA 1CSNA 5HIDA 3DU8A 4O0YA 2IWIA 3PY0A 1JWHA 5CZHA 4F4PA 2WTWA 3I81A 4DTAA 4D9TA 3AMBA 4DGMA 4G6NA 5KMOA 3E8CA 4BDEA 5ICCA 3VS0A 3VYWA 3NYNA 3O50A 4ZLZA 3UNKA 2CMGA 4EHGA 5AM6A 5U4XA 3P71T 3TRKA 3ZRLA 4QP3A 5HVYA 5HBHA 4CT2A 4IE9A 4IAAA 3G88A 5JGBA 3FKOA 2C1BA 4BTJA 1Q3WA 4L9IA 3NUSA 1T43A 5IQGA 2X6DA 2YDIA 1QPJA 3MDYA 3DH0A 5DR6A 1ZRZA 3MERA 3AC1A 3MY1A 3HAVA 3FLZA 3FMJA 1OL5A 5DG5A 2X8DA 3UTOA 3V5LA 4E5AX 3D5XA 5CVVA 4X21A 3OTVA 3PVWA 5I9UA 4H3PA 3PXZA 4CCUA 3CJTA 5I9ZA 5CEKA 3PPJA 5IEXA 3PXQA 4QMUA 3P5KA 4EOQA 2EXCX 3OWKA 3KEXA 4NKSA 3PJ3A 2BHEA 2P7HA 3PVUA 4RFMA 3MY5A 5K0LA 3M6VA 2NRUA 2O65A 2WXVA 3UA3A 3U6IA 4F7JA 4PYKA 3EFKA 5D7AA 4YJUA 2CGXA 3BBTB 4DFNA 3IDPA 4C04A 3B5IA 5GHVA 2WO6A 5AA8A 3FLYA 4XRLA 2AUHA 2CL5A 4P7JA 2H00A 5FLFA 3QUDA 3FPQA 5EHOA 3UBTA 7MHTA 1OPJA 4U9AA 2JAVA 3OHTA 3P2EA 1H1QA 5ANOA 3TG1A 2YR0A 4QQNA 5HD4A 5AADA 2BAQA 4LV5A 4BIEA 3PXFA 5F20A 1M7QA 3ZCLA 4OLIA 3UZUA 1ZG3A 4IB0A 3BGQA 2VTJA 1KPGA 4BIDA 4TWCA 2CLXA 3TJCA 2VTAA 4X1OA 2C69A 3KQ7A 2XNEA 4F6WA 5IQFA 4AE6A 2C5XA 3GOPA 4RFYA 2BR5A 3QD0A 2C3JA 3Q5IA 3P7BA 2NXCA 3NUYA 4W4VA 2YITA 5A9UA 5CSXA 3FZTA 3ZZEA 3QBNA 1CKPA 2B0QA 3ZXTA 2W0JA 2V7EA 3LCKA 5E91A 2XK9A 4GT3A 4Q2AA 4DINA 1I09A 5LOHA 4AGDA 3A7GA 2JFLA 3WZJA 4S34A 5DIAA 5CASA 3DULA 5ACKA 2OU7A 1RI2A 5CWZA 3ZSGA 2R3JA 4CKJA 3QF9A 3DK3A 4LECA 1OIUA 3F7ZA 2QOHA 1NW7A 2PUIA 5H9BA 2QO7A 5HE2A 3ZHPC 1V1KA 3MW1A 3PIXA 2IDJA 3FPJA 3R8VA 3EZVA 4FSZA 2I1MA 2FK8A 8MHTA 3DS6A 4ZK5A 4CD0A 4FKVA 4N0SA 5FP6A 5FM3A 1VR2A 5FQOA 4QQJA 3DLIA 2CKOA 4YZ9A 1JSVA 3HDMA 1U5QA 2O0LA 5F2NA 3AT4A 4QPAA 4E4LA 3LFEA 3GENA 5DXAA 4NFNA 2BR1A 2P0CA 5EYMA 3HVKA 1OKVA 1PMNA 2X0GA 2YIQA 1HCLA 4BBEA 3DNDA 4RJ8A 3VC4A 3LXPA 3FHRA 3K2LA 4FV5A 4QOXA 1YXXA 3L8PA 3F88A 3VF8A 1ZWSA 3NUPA 4R7IA 3COMA 3IW4A 4FL1A 2OXXA 4RIXB 4S33A 3WIKA 2AC5A 4G5JA 4R5YA 4RTOA 2QI8A 4WNPA 3TOSA 3R9OA 4R78A 2BRHA 4ZOGA 2F57A 3UOHA 2XJ2A 4PY1A 4RIYB 4PINA 2R3NA 4CKBA 2XK7A 4EK5A 2O64A 2B9IA 3DAKA 4K9YA 1W7HA 3EQDA 4RFZA 4MNEA 3TDWA 5J7HA 2FK7A 4G3CA 3CSVA 1KIAA 3OXTA 4AW5A 4BCPA 2BDFA 5HG5A 2HZ0A 3ZYAA 1I9GA 2JKOA 4DG0E 2WB8A 5DWRA 3BU3A 1BOOA 4I0RA 1XH8A 3P9IA 5CS6A 1QAQA 5TO8A 3PG3A 5CLPA 4AZWA 4PL3A 1FBNA 4LMNA 4CFUA 3R7YA 4MD9E 4EWHA 3GNIB 3FZGA 5K4JA 2J0LA 4PTCA 2PMLX 4H39A 2VWXA 5GJFA 3NTVA 2ZM1A 3D94A 4CCBA 2VRXA 3C5IA 1OMWA 1PHKA 2CSNA 3CJFA 4FNXA 2AOXA 3ZUVA 5C4LA 1Q4LA 1PY5A 3DQWA 2XA4A 3LW0A 3RPSA 4KWPA 4AXAA 2ERCA 3QTRA 3R7VA 2QKWB 4QQTA 4P7EA 4DCEA 2QQ7A 1NXKA 4XBUA 2JDRA 3RPYA 1H07A 3KR9A 4M38A 4B8LA 2FGIA 3TUCA 3PA5A 4V01A 3BYMA 3CQUA 4L3LA 3VQUA 4JDJA 4DH8A 2R3SA 2P3OA 2X4ZA 4ERWA 3DFAA 4NECA 3D5VA 2OKRA 2C7RA 3ZDUA 4YUYA 2ZIGA 3OCSA 5JRQA 4I21A 1AQJA 3ZFXA 2GPYA 3VJOA 4MXZA 4Y8DA 4M68A 3C4WA 5JFWA 4ASZA 3PA3A 3KQYA 1NW5A 3TM5A 3TJDA 2CWWA 2FHPA 5GWXA 4OBXA 3QQLA 3TNHA 3KFAA 3FKLA 4JQ7A 3Q32A 5E8TA 4RTMA 4FUXA 4D9UA 3MH2A 4I3ZA 2VNYA 5CX9A 4DH5A 1QANA 2I9KA 3PWDA 3NR9A 4ZY4A 4AZFA 5L8JA 3ELWA 1CKJA 4XG4A 4L53A 3ACKA 2ETKA 5CVUA 2R5TA 3IW8A 2W7XA 4XOZA 2QR7A 4BZNA 5FDXA 4JG7A 2BH2A 3DB8A 5AA9A 2OB2A 4GV1A 3JY9A 2PXXA 3LX6A 2ZV2A 5L6OA 3FPEA 3GFEA 5IMXA 2C7QA 4HYHA 1V0OA 3QD3A 3MESA 4FSTA 2OG8A 4C4HA 4ZXTA 3VUHA 2WEVA 1JPAA 3SDJA 3UA4A 4JOAA 4O0WA 3PIZA 2OJJA 2ETMA 4U5JA 2PLWA 4IB5A 2EX4A 4R77A 3OFMA 4BCKA 4ER7A 1W98A 4FKIA 2IIPA 2JHCA 4JXFA 3SW4A 4QQKA 3DOUA 5D7VA 4DGNA 3WYYA 1R39A 4V0GB 4JQEA 2AYPA 3BHYA 3LXKA 3ELUA 3RHXA 3E7OA 4F0FA 5C01A 4DFYA 4EH7A 2X9FA 3QQUA 1XTPA 5DR2A 3UC3A 2QURA 4AT3A 4MXAA 3RODA 5KMMA 3OCTA 2WU6A 1FMKA 4IX5A 4MQ1A 4USEA 3JWIA 2AOUB 2XIXA 4U80A 2Y8OA 5HORA 4O7SA 2PUPA 3ELYA 4NUSA 3R9XB 1DAWA 4FTQA 2R3HA 1XQZA 3NW6A 3EFJA 3H2BA 1IEPA 3KY2A 2HW7A 3DMFA 4EJ7A 3MHTA 4A9YA 4G5PA 3PIYA 2NXEA 3FE3A 5CU4A 2JDOA 4MBJA 4U3YA 3OZTA 2IBTA 3CD3A 2I62A 4OBWA 1X1DA 1M2RA 4YC8A 2FPOA 3UMXA 4TYEA 4E4MA 4KABA 1WBPA 3LLTA 4G17A 1KWPA 4P5QA 5HNGA 1FPUA 3FZ1A 5CT7A 5DGZA 2VNWA 3D7TA 4RVDA 5HIMA 1PXNA 4GFOA 3VHKA 3C0IA 1GZ8A 3ZC6A 3BKXA 4RWKA 2PVCA 3FSKA 4O7TA 4QMNA 1PKDA 5HZMA 3EVZA 2X9EA 4KIQA 1BYGA 4QMWA 3G0EA 1OIRA 3QUPA 4MD7E 5IQHA 4O7LA 4C4EA 4KS7A 5IMEA 3U81A 1O9HA 5EH0A 3OU2A 3T7RA 3ZSIA 2AN3A 3QC4A 2BM9A 5I5ZA 2QD9A 4G3GA 4FL3A 1YHWA 4OTHA 5DA3A 5HESA 4YHJA 4BI2A 3DXPA 3KR1A 2BMCA 2UW6A 5EIWA 3W2SA 1YQJA 2VDWA 1EQAA 4D55A 4Q5HA 2ZB0A 5JGDA 4OT6A 5AP4A 5M09A 4U0IA 4XLIA 2RG6A 1UWHA 2P2IA 2BTSA 5C9ZA 3WI6A 5AV1A 4PNEA 4ZP5A 2X8IA 2VAGA 1PMVA 1FP2A 4EOJA 2B25A 2X6EA 5EQJB 3RINA 1X19A 2RFEA 3HA7A 4IVBA 4ER3A 3EH9A 3EPPA 2DULA 5GIOE 4DTBA 2UZLA 4LOPA 3QZIA 2ITNA 3POOA 3QCQA 3HV7A 4AGUA 5EVJA 4FC0A 2JG3A 2AN4A 4PCAA 5DYJA 3IW5A 5CVGA 2OJ9A 5G02A 4BICA 4AE9A 4LG1A 2ONZA 2W1DA 5KZIA 4GQBA 4HGYA 2SRCA 3B89A 2ZAZA 2OJIA 5IU2A 4NTSA 2X81A 2PX8A 5E8JA 3GRYA 4KSQA 4RIWB 4WRSA 5BYZA 3OUKA 3N4VA 4RVMA 2BZKB 4WNMA 3ZFYA 3LFFA 3I9FA 2XK3A 1XXLA 2HOGA 5LWNA 2OO3A 4IVCA 1TVOA 3FUWA 2BCJA 2X7GA 4PMSA 2VO6A 2FSLX 1YB2A 4DG2E 4QNAA 3F4KA 3MYGA 4RMZA 5DFPA 4WG4A 2X7FA 1B6CB 3IO7A 3KMWA 5C8NA 3F3WA 4UV0A 4YSJA 2QVSE 4ZZMA 4WXHA 3SG9A 4ACDA 3E93A 4F65A 3NUAA 3R24A 2FH9A 3BWFA 2Y7JA 3ZXZA 3AC3A 4PQNA 3QTIA 4LI5A 4A4OA 2GFSA 4TKSA 5BVKA 1HCKA 1JTEA 5IA4A 4IAZA 5BMSA 3PLSA 5ETAA 3THSA 3LSTA 4WG5A 4C3FA 4GFMA 5C27A 2VDUE 4GVJA 4OR5A 1K9AA 5CF6A 3UMWA 3PFGA 2PE0A 4F9AA 3R30A 5EMJA 2Z2WA 1HMYA 3GNLA 3RJCA 1G5SA 3PVGA 4I5HA 1YWNA 2JKQA 3FLNC 3QALE 4F84A 4LYNA 3CBGA 4YLLA 3G2MA 3CTQA 4NCTA 5M51A 2W1GA 3ZUUA 4RWZA 2CKPA 3MB5A 3UIUA 2PZYA 2YCFA 1VJYA 1SVUA 1M2PA 4O7YA 2YAKA 3UVPA 3F2NA 2GCDA 1U2ZA 5EYCA 3DKOA 5EOLA 3X0DA 3KHKA 3QUEA 5KMNA 1PXPA 4JDHA 2C1AA 10MHA 2YIWA 5M4CA 4I0SA 2G1PA 3FUXA 4J53A 4RSRA 2R64A 3U87A 3KF7A 5EMLA 2E9PA 1YVJA 3QX2A 3WZUA 2YHVA 1H08A 3FJQE 2O63A 2OFUA 3SSNA 2QOOA 3DKFA 3GOKA 5E1BA 3O2MA 1NA7A 5EQEA 1PYEA 3DXYA 4AAAA 4YTHA 4TYHB 4AWIA 4YJOA 5L2TA 3H9RA 4BCHA 2YXEA 3PRIA 1RJDA 2HK5A 4O0TA 3BWJA 2VTOA 4NW6A 3CKKA 3FLQA 4U6RA 4L00A 3A8XA 3D0EA 3EVCA 5ICPA 2IVVA 1S9JA 3EQFA 1J7IA 5KX8A 3UOJA 4HYIA 4HZSA 3LHJA 4I41A 4MWIA 3QOWA 3UG1A 3NNVA 5FG8A 3EL7A 4ANLA 3OFJA 4O7VA 4YHFA 5H3QA 3TL8A 2BM8A 2EB3A 4G1WA 5KUPA 3UQFA 3ORZA 3E62A 2I7CA 4BGGA 2B55A 2WD1A 3TKUA 2OIQA 1GJOA 3AT3A 3U54A 2OZAA 3IDBA 1PJKA 2QE6A 3BLHA 3LZBA 3FTFA 1X1AA 2YM8A 4M3QA 2OO8X 3NAYA 4YJQA 4H1MA 4M7IA 1YI3A 3DDQA 4ANMA 2Y1WA 1OITA 5CQWA 2XS0A 2C6MA 2GMXA 2VTNA 2UW5A 4BCGA 3EEYA 2HNKA 4FTNA 2XVDA 3NNUA 5CD1A 4XG9A 4ZSAA 2PWPA 4IMYA 4FL2A 2GNIA 2BZJA 2LAVA 5L3AA 4Y85A 5CU2A 4CQEA 3FPFA 3G89A 4XMOA 4EC9A 3CP9A 3EMBA 3MVMA 5T6BA 3TI1A 4FICA 5LQUA
chains in the Genus database with same CATH superfamily
2QG4A 1QJCA 4AMVA 1NVXQ 2VATA 1ZNYA 1VPTA 2G01A 3MYRA 3VMMA 4X7BA 4DAWA 1Q15A 5GINE 2WWTA 2BMFA 2JCYA 3N59A 1XXHA 3KULA 2FPPA 3BXZA 4MYCA 4ZARA 4H7KA 1ZEJA 3E8EA 1QNLA 4IZIA 2OFWA 2HY0A 4TTRA 3C4EA 2VNAA 2YW2A 2WTIA 3MTAA 4EFKA 1B8PA 1MFPA 4INOA 2VO7A 1WZ2A 4MVJP 3Q04A 4POAA 3O51A 4ZTMA 1DX6A 3P9SA 4P81A 1RAFA 3LVPA 2W6MA 1LEZA 1Z7WA 1R3CA 2H0QA 1UPXA 2VJMB 3VJKA 3ZNQA 2JKMA 1ZNZA 3DPSA 5BNJA 4I9NA 2BVAA 1TOAA 3H4TA 4HDKB 3IHWA 3NRCA 4B5LA 3CA8A 4MWSA 5BSHA 2GQGA 1J23A 4BB0A 3L49A 4WECA 2XAMA 1DP4A 2WSLA 3FYKX 3NHRA 2BFCB 4RMHA 3WBKA 3MPUA 2P9YA 3AR7A 5TQJA 5EFZA 2HFJA 3V6SA 3CVXA 3JYAA 5DHJA 4DWJA 2WB2A 3KEQA 2YMQA 3N6VA 4DA7A 3EQZA 1LV8A 2XKDA 4L6CA 4XM2A 2QWXA 4YP6A 3FOAA 2PSJA 4UHFA 2IH4A 5FV4A 4YRPA 1KVRA 3VNSA 4ZO7A 2K2QB 3B7PA 1ZYDA 4IVRA 3FZRA 2CC2A 3WL5A 2PIDA 4RZVA 1Z57A 1QPEA 3GMTA 2VRCA 2BR4A 4MUIA 1UAAA 1H0WA 2CUTA 4PX6A 3ZONA 3V80A 3C1AA 2PVMA 3DJ5A 3EF0A 2RFNA 4NCNA 4PPYA 3EXG1 1YQ9A 3CTJA 1L5FA 1CDEA 1CB7A 4CEJB 1F2UB 1WG8A 1WUTA 1WZYA 2B9HA 2VZEA 3RYCB 3ZD6A 4FEEA 4LOOA 5BVHB 1D3AA 3ZM4A 4J95A 5AW1A 3SAYA 3OVMA 4RGYA 2EJTA 4YUAA 2IZSA 4UQLA 4JJ6A 5KNBA 4ZJZA 2CFRA 1V5IA 4A8JC 1I13A 5CVTA 1M6WA 4ZC8A 5F3RA 3AHDA 2I4NA 3N8GA 3FSGA 5KZ0A 1JAHA 3HMQA 1VIMA 4ZREA 4CEHA 3QX8A 2IXTA 1TUBA 2QVZX 3H2GA 1N0WA 4FTWA 1NPDA 3IEKA 5AFVA 2J32A 2D1TA 721PA 3L4JA 5CT0A 4Z9YA 3QAME 3EA0A 3ICWA 4CL3A 4ND7A 4YUZA 5IKEA 5D9HA 2RGPA 2B4TO 1T6NA 1XTTA 3P0FA 5CFOA 1XMSA 2XOEA 4OUKX 2P1DA 1JDVA 1R5BA 1JQDA 1IUKA 5KTPA 1XPRA 4E5WA 4YTCA 4FD2A 4WUTA 3K4PA 1NFQA 3TS1A 1IVYA 1H8HD 4C4FA 3RIMA 5LKAA 2H2HA 1A96A 3AGLA 3MTIA 4FMDF 1MPTA 3V1NA 4TQAA 5T41A 3GLGE 1P3JA 2EU8A 1QH0A 5JFTA 4XJVA 1SUAA 2BIYA 1XPJA 4KXMA 1DTWB 2UYOA 3CKLA 3RS2A 3A10A 5K0GA 3ZY5A 4LG4A 3WKBA 1XROA 2Q5IA 1T9AA 4XE5A 1ZYLA 2VBCA 2XDYA 1VE5A 3IMKA 3PUXA 3RFTA 3H3FA 1Y8ZA 5AWMA 3PJCA 3SPXA 4YRGA 4V05A 2RAFA 1SRRA 2C0TA 1SVSA 4QNNA 4EKYA 5DF1A 2PSSA 3VJMA 2ZAGA 5AX3A 1CDDA 3JXEA 3O83A 3UMCA 3ZK8A 5K3DA 3KTDA 4P33A 3B52X 4G9BA 4GMHA 1OAOA 3K2EA 5MGBA 5AD1A 1XDZA 4JX7A 4MYRA 2M2IA 4L74A 2NSDA 3UMVA 1KP9A 4PXYA 4F7NA 3KQUA 2VXOA 4NFHA 1NBAA 3E15A 2V9PA 5NLLA 4DT1A 3T3UA 4H7FA 3O21A 3GRVA 2Y66A 2FZ4A 1IY1A 2R8BA 2QTZA 4WE3A 1FVTA 3WBLA 3IE1A 1M2FA 1QFZA 5HVJA 1FQ1B 1LLCA 1SCJA 5KNCA 2GQSA 1GNLA 4FN5A 4FKWA 1GZDA 2E9VA 3FZOA 2O6LA 4KQIA 3JS2A 4MYSA 4N5NA 3M2WA 3I0QA 3V2HA 4N5IX 3GRKA 5CCDA 2J5KA 1SIUA 5ALLA 3LQ2A 3WVNA 5BR4A 3D4IA 1QGUB 2BM0A 2GN8A 3FZSA 4RYDA 3II5A 3AUKA 4PZ9A 5HU3A 1CQIA 1Y7IA 1JKXA 2G67A 2Q99A 1J22A 3PDHA 1KKUA 2PMNX 4IIFA 1HEYA 4CU5A 2MR6A 3E3OA 3NJRA 5DH3A 4F4HA 1OIXA 2JIZA 2BRUC 3L43A 5AW3A 4HGQA 2HCRA 5HE3A 1UU3A 4L3WA 2B1GA 3JQCA 4XIFA 4KSYA 5D1JA 3S2EA 2W8BB 4C3VA 2QONA 1W85A 2FW7A 2PVYA 1P1HA 4ZDIA 2VZ8A 4O83A 3I5XA 3ATSA 2X2KA 2O50A 1A1VA 2OCYC 2AF4C 4EKEA 4KI0A 3HV3A 1Z5MA 2OI4X 3L4BA 4HZUB 1VL0A 3KO8A 3SLKA 3ZS5A 3ROFA 3CY3A 1WXGA 3EBLA 4MRMB 1P6UA 4YEDA 2P2YA 4UMFA 2C2ZA 4CV8A 3QU2A 1WL8A 4GI7A 1MN6A 1A9OA 3KZ1E 2IZRA 5KMGB 5FD2A 4WRGA 4RK0A 4LOQA 1RDFA 5C18A 2BPMA 1NQXA 5BQ0A 1Y3IA 3LCDA 2ZT7A 3AF4A 3GX1A 4HUJA 5BWCA 3OOYA 4UHBA 4ATNA 2QOLA 4H05A 2XKBA 3Q85A 4W4XA 1UAGA 1F6WA 1MJ5A 4FKBA 1NMZA 2V6MA 4B34A 2O5CA 1HYGA 1QQ5A 3MBLA 2X7XA 4TMWA 3NU1A 4H0FA 3L9MA 4ZCQA 4EPXA 5JS7A 1P1JA 3Q4UA 3BDVA 2IKQA 3Q96A 4I36A 5CAQA 2JDID 4BLWA 3MS9A 1OH5A 5LUAA 3NMUF 3FOEC 1V7ZA 4TWZA 1DEOA 4RVCA 4CM9A 5CYPA 3DL7A 3GJTA 3ZLJA 3GEPA 1IZYA 4Z2AA 4ZCRA 4EUSA 3HRCA 1FFCA 3QBTA 4PTLA 1Y98A 1QIKA 4QP2A 4IAIA 1SCIA 2PZPA 2ITZA 4QAQA 2ZYTX 1EVKA 3EVFA 2HF8A 5KQPA 3AILA 2JRCA 5EZSA 4ZAUA 5LJJA 5DI3A 1JKLA 4FVQA 3AHHA 3KB7A 3BU5A 2IUFA 3ZK7A 1YDSE 4MWGA 3UXMA 3RP9A 3EVBA 4AKEA 3FZNA 2I3ZA 2Q1WA 2Q5JA 1DLIA 2H3HA 4YV1A 1SQGA 1RXSA 4C0JA 1Y9DA 1DBVO 2ABWA 4UPDA 5AKJA 4OGRA 1GV0A 4HMOA 1NZDA 4FZFB 3LW8A 5IDPA 4NMMA 5JO9A 1AOXA 2VO0A 4WCFA 2H1LA 2WF6A 5M06A 3SDZA 5M07A 3KC2A 4IFGA 2P75A 3TEFA 1EM8A 2C3KA 2LWIA 2YC4C 2FWMX 1NM5A 2VJBA 3OFND 1HQYE 4KNYA 3AJEA 4F70A 1JG6A 2ACKA 4FNYA 3JW8A 1NW6A 2J9RA 3RNYA 1RKBA 3GUCA 4KUHA 2ID4A 1OKKD 2W4IA 1IQUA 3CWQA 2PS0A 1WKCA 3F8SA 3FBVA 3ZV5A 3TQHA 4QELA 4AT4A 3VX4A 2ZXEA 1HNWB 3ABQB 4BXOA 4B46A 2DR3A 2G4LA 3IAHA 2QTTA 3L4BC 2IYAA 4EPYA 1JEEA 3RW9A 4HAXA 4YI5A 5ALNA 4ZOCA 2X19A 1TKIA 4QYXA 2QLMA 3HN2A 3TRFA 3AR8A 4QXOA 4OHPA 3K9LA 3O4FA 9GPBA 4ZZ1A 3SBXA 2VX0A 3FQEA 1OU4A 2GNLA 2GILA 2IHTA 1NF9A 4U7TB 2IDZA 5M7EA 3QVGA 3ZBTA 4GIIA 1L5OA 3VR3A 2CEKA 4DA4A 1SNUA 2PVRA 4IBMA 3TZLA 3MFUA 4R98A 4QUHA 3A36A 3HSSA 3NYWA 2ZWVA 3PQDA 2YHIA 5CFZA 4NXNB 4LXGA 4B6SA 1NTRA 1B93A 1EFDN 4XUGB 3LFTA 1SO8A 1KDOA 2VSQA 1Q99A 3MTGA 3MCZA 3QVTA 4DR5B 1BJRE 2JKYA 1OFGA 4O0RA 2OLEA 3PQEA 4KR3A 5B4UA 1ZA1A 1EUCB 2VXBA 1L3BA 4HC4A 3UENA 2IA5A 2O14A 2OA0A 4PGFA 4L5JA 3OZRA 5IJWA 3EC2A 5DN6A 1ORWA 3QFRA 1P9RA 4QMTA 1EM6A 1PFGA 2W17A 3P0IA 2QR5A 1EGMB 5F2EA 4BAZA 4XLTA 1UJMA 3BMXA 4E1AA 2BKXA 2QTBA 4KG7A 1PKXA 4JL6A 5CM2Z 2WVGA 1E9BA 5LZ4A 1W36B 4IWNA 2XWPA 4YAJA 2PU7A 5HQ3B 4PNKA 1E1QD 1FVRA 4M6WB 3LBIA 3HCRA 5EFOA 3UP2A 3A9RA 4J1QA 1YVRA 1UV5A 2AFVA 1H27A 3IO3A 5CXHA 3LY7A 2CL6X 2ZMDA 2YY6A 2XMCA 4D1SA 3TNWA 3A4NA 4ZY5A 2CNLA 3C3JA 5EC8A 1L7NA 4JB3A 3I9V6 4ILEA 3EQGA 2HXGA 1FJHA 4WCFC 4AS0A 1DKOA 3PKIA 4KLZA 2G0NA 2PMOX 1F0YA 4QXQA 3OWLA 4X6LA 1SBTA 3O8NA 3FBTA 1SD5A 3KWMA 1BX6A 4PRYA 1CE8B 4RMJA 3EVDA 2A9JA 2VXCA 4YJFB 1X15A 3OEFX 4FVPA 4H4EA 2B2CA 5F21A 1O4VA 3UB2A 4YFYA 1ML4A 4X2KA 2VPPA 2OV6A 2QIOA 2CFSA 3IAM6 2ES4A 3C13A 2CMWA 2A5YB 3U4HA 1PHPA 2D74A 4OTZA 4A2CA 2JH8A 4L3VA 4V24A 2OE2A 4RENA 5GZ6A 1JLUE 4DV1B 3ZZUA 2XWBF 3PXYA 3DE3X 5FNZA 5EIXA 3AB7A 1UWVA 2B92A 2CNWA 1YDEA 4G1UC 1JR4A 3FMVA 3FGZA 3G7SA 2ZRDA 1ZWKA 2WELA 2J31A 4DWVA 1VMEA 5ADUS 4BMVA 2FF7A 3DVSX 2WAXA 4MBLA 5LBIA 3W5UA 4J49A 5EP1A 1MD9A 4W9MC 2HWYA 2JJ2A 4M36A 4IO1A 2QZ4A 3Q1KA 4R3NA 1OXXK 3TI7A 2CJWA 4O4JA 2ERZE 3TSZA 3ORIA 2Q27A 1BO6A 4LX8A 1R6XA 4GOMD 4XSGA 4BGIA 3TK1A 2A59A 1Q8TA 4FT0A 1EYZA 4BB5A 2JFZA 1R00A 3BSSA 3A7FA 1LQUA 4AFEA 1Q22A 2X77A 5FM2A 1Y6RA 5F9FA 3CZ5A 4M21A 3L8XA 2WZJA 2PJZA 4PC2A 5CAEB 4LCBA 3FPHA 1W5BA 1T9HA 4HB4A 2PN1A 3KRRA 5LQKA 3TSOA 1VKJA 4IHKA 5FAKA 4ZLYA 1M2WA 4O91A 1UJ2A 3JYQA 3UOAB 3JAWA 4MARA 1Y6QA 2VUHB 2Y1CA 3FSJX 5D51S 3T3HA 3HN7A 3DF9A 4R9UC 4IH9A 2G2HA 2Y4OA 4N6NA 2JZCA 3S95A 5KJCA 2ECFA 3T94A 3RABA 3LUCA 1AN0A 2X6RA 4TVKA 1HT0A 2BAJA 4GPIB 3UNXA 2C3YA 4IEBA 4JP2A 2PRZA 3JWEA 1YCFA 3EOBI 4HN2A 1AS3A 1IOWA 3OLCX 4GBGA 2R6R1 4JBWA 1Y4SA 3JZFA 4HI0E 4K6HA 4U2DA 3LUBA 3WBJA 1EK1A 2OVBA 1YOMA 1GKUB 5KQSA 1G8SA 2R3GA 2OW3A 3BRBA 3DMGA 3VZDA 3VIDA 2DFDA 1H4SA 4EH6A 4DFZE 5C5DA 1TK2A 4FHEA 4Q3OA 5IA0A 1T8TA 1JNKA 5C26A 3FKSA 2OSBA 4YJTA 4RHYA 5TDHA 3SS7X 2CBGA 3DEFA 3U4IA 3NPAA 1UXGA 3NFYA 5J8IA 2A4MA 4EI9A 2IODA 4FKTA 4D4YA 2BYTA 2J9ZB 4P3XA 1VYZA 4ZVMA 2OMEA 1XTIA 3CPBA 1HTTA 2W1EA 3KYJB 1X38A 4G3FA 2W00A 1RHRA 4C7TA 2G6BA 2MSKA 4ZT7A 4CWAA 2X40A 4KIPA 4J1SA 2PO5A 1LX6A 3OJLA 1FPQA 1BFKA 3BGVA 4RIEA 5CVDA 2ZS7A 5ANJA 5AW8A 1IG0A 3E05A 3PLAE 2GHLA 3CLYA 4FJ2A 4KHPB 4ARBA 1GY3A 1OE0A 4PTYA 3ZJ5A 4BJ5A 2XRWA 221PA 3I6ZA 1M2JA 1BFUA 2HQRA 2EATA 3DDPA 4EOOA 3V1UA 3QGMA 4EHHA 1N8TA 4V1CB 3PHCA 4YMJA 1MLDA 2FQ1A 4EBBA 1D6MA 1ESDA 2WKWA 5KTYA 4DT9A 1MQAA 4RVHA 1Z36A 3L7NA 5FUYA 4ZVNA 3U4MA