1NT2A

Crystal structure of fibrillarin/nop5p complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
KELMRNVYLLDDTLVTKSKYGSHYGEKVFDGYREWVPWRSKLAAMILKGHRLKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDSTAEPEEVFKSVLKEMEGDFKIVKHGSLMPYHRDHIFIHAYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of archaeal box C/D sRNP core proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
molecule keywords Fibrillarin-like pre-rRNA processing protein
total genus 60
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1nt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nt2A02
4FKUA 2PUNA 3O0GA 3R9DA 3FXWA 3LDFA 2PVYA 2ONZA 4FVRA 3BWCA 4EMSA 2VX3A 3UJ6A 1E9HA 2IZTA 3PWYA 4MEDA 3AY0A 1YKRA 3PWDA 4EONA 3KQWA 4GU6A 4OA5A 3BKBA 3ORKA 1G8SA 4O0SA 1JG4A 4QDJA 5KQSA 4PCAA 1GIIA 2C7OA 2WB8A 4M13A 4PDSA 5K4IA 3QHWA 5DR6A 4KNBA 2EJTA 5HE2A 3EOCA 2WIPA 1Y6AA 2ITNA 2QI8A 3MY1A 3BYMA 4XP2A 4BDHA 5IEXA 1WY7A 1P4FA 2YAKA 3PX2A 2B3TA 2XM8A 4R7IA 3U6JA 2H6DA 2Z7LA 2VS1A 2WTJA 3PVCA 3S2PA 2UZLA 2XK6A 4CT1A 4R05A 5I9WA 5K0LA 1YI3A 4GIIA 4LFIA 5HBHA 4DEEA 4PCLA 3A4OX 3F69A 1BLXA 2LAVA 4AGDA 1YFLA 1XH4A 4FKVA 4O0RA 2ZMDA 3COHA 4GCJA 4CQEA 4S31A 4EBVA 2ERCA 3M33A 4DINA 4QMNA 2VGOA 3CXWA 4M36A 1FPQA 4F6WA 4JX7A 4GC9A 2WHBA 2R4BA 4QMUA 3FUVA 5DRTA 3H9FA 2GPYA 1P5EA 5HIIA 3TR6A 2EG5A 4XUCA 2BHHA 1PXPA 2VO0A 3E63A 2OLCA 3PFGA 4FZFB 3JYAA 2W5AA 4HYSA 1GOLA 1R78A 4I22A 4RTRA 5D10A 3PJ3A 5BVDA 1A06A 3DBEA 4RWLA 3P1AA 4NECA 3BEGA 3BRBA 3IW8A 5FRIA 3S0OA 3GENA 3TDWA 4DFZE 5HORA 2FYTA 4N4SA 1QL6A 2GNFA 1IY9A 4YHJA 2XKEA 1PYXA 4G9RA 4V05A 4AZFA 3S1HA 5HX8A 1N7JA 2O0LA 3BGQA 4LUEA 3Q6WA 4LQMA 3SXFA 4BGQA 1UU3A 3C7QA 1JQEA 3AG9A 3F3WA 3FPMA 4DCEA 1YZHA 3E92A 3BGIA 2VO7A 3PA3A 4YC6A 3GRRA 1R3CA 4U41A 2BTRA 3OS3A 3UC4A 4EUTA 5HG9A 2OF2A 2ITOA 2VTIA 3VS3A 2FPOA 3R9RA 4ER0A 4FG8A 5L6OA 3VHEA 3ME5A 5EG5A 4QP4A 4RJ4A 4C36A 5DG5A 3TNQB 2B4SB 2R5TA 2IG7A 3CR0A 5HTCA 5IG1A 3DBDA 4LI5A 5CVDA 4OBWA 2UZEA 2X81A 4F1MA 1KHHA 4KIFA 5ICEA 3Q9WA 2CLQA 3OROA 4I6BA 4RVMA 4LGHA 4O96A 4PL5A 5DBXA 3GWZA 4E31A 2IVSA 4ANQA 5EW8A 5HG8A 3UO6A 4JDHA 1IEPA 2AOUA 4PNIA 4U44A 3F82A 3VS4A 5CF4A 3C0KA 3HA5A 3KQ7A 3EFKA 3UBDA 2NP8A 3AMBA 3OWKA 2AC3A 3VJNA 5I9XA 1RI4A 2P3QA 2UYQA 4A9TA 2BDJA 4WG3A 3QV2A 5LSAA 2UZBA 2W1CA 3OXTA 4ZSEA 3BKWA 2YIRA 3FMNA 2AVDA 4GK2A 5KS2A 4BGHA 4C03A 3A4TA 3S68A 4JG6A 4HYUA 1I44A 3NPCA 5JH6A 1OZ1A 3BV2A 1M17A 2OJFE 1R0EA 5LVMA 2Z6UA 4CLJA 4M3QA 1Q41A 3HMIA 3GFEA 1SNUA 2BRBA 5FP5A 2C3LA 4QMZA 5BVKA 2HTEA 4ISCA 5FG8A 3HDNA 3I7CA 1CM8A 4GOLD 3ZO2A 4O2PA 5CU6A 4F08A 4FIHA 1OKWA 2F7ZE 4ZTSA 2ETRA 3L9MA 3TZMA 2HV9A 4QT1A 3UMXA 4EYJA 3EVGA 1J7UA 3CC6A 4I4FA 3CJRA 3IDBA 4NM7A 2I0VA 1FINA 5EOBA 5CTPA 2JKQA 3MFSA 4YGAA 2I40A 5A54A 2H1RA 2YR0A 5TF9A 2ZZNA 5K0GA 3BLRA 1PMUA 3GEQA 4ZAUA 3OE5A 3UJ9A 3CQUA 3ZMMA 3FPQA 2YIWA 1DAWA 5HESA 5E1OA 3RI1A 4PIPA 3PJ2A 5CF6A 5CVGA 2XK9A 3I6WA 3ERCA 3Q87B 3ENHA 4POOA 3U81A 4FV4A 4O7YA 3E8SA 2IW8A 4Q2AA 3MVMA 3S00A 5LQNA 3FL4A 2WK1A 3I53A 4FTMA 2PL0A 5J1WA 3R9OA 3Q5IA 3E3PA 3V01A 4USFA 4LV5A 5FA8A 3ID6C 2VTNA 3OUKA 4BCFA 4DFYA 1WCCA 1OIQA 2J50A 3UVQA 1UWHA 4AG8A 3EVDA 4HJOA 2OH4A 3NLBA 2VV9A 4ACCA 2YABA 3DFCB 3BWBA 4RIYB 4YUWA 2Z7SA 4S32A 3M6UA 1G8AA 3UIBA 2WTIA 3BU5A 3A25A 4L00A 2NXEA 1BL7A 4IX4A 3OCBA 3R21A 2PT6A 4MWZA 3P7BA 3QUPA 3WZEA 3FXXA 3ZOSA 3Q60A 3Q9XA 5LVOA 3QX2A 5E1MA 2FSOX 2IZSA 3RINA 3WF9A 4U80A 5IEYA 1PYEA 3FYDA 3PT9A 2VNWA 1NW1A 4KKHA 4O29A 2OBJA 2OIBA 3HV6A 3IV6A 2PVFA 1AGWA 4AS0A 4B99A 2VZ9A 5I5ZA 4ENYA 2PY3A 2FUMA 2BM9A 3ANXA 3WOWA 5JGDA 2J9MA 2B7AA 2G1TA 4AOTA 2ZVJA 3JWHA 5E91A 4BLWA 3QKLA 3UOLA 5KZ0A 2ERZE 3CTQA 4XRLA 5FULA 5E8XA 3TDVA 4RLLA 3MHTA 3HNGA 3LM5A 2PUIA 3LJ2A 3K2LA 3MSSA 2F9GA 2I6GA 2NRYA 4LRMA 4PGGA 4BN1A 3SKCA 3D15A 1R8YA 4RX1A 1KUTA 4TL0A 3OY3A 4NWMA 4NJ3A 3V5JA 2P8JA 3WBLA 4UN0C 1MP8A 4FT9A 2REIA 3H9RA 3HGKA 4FSZA 4K11A 4RFZA 3VUHA 3WF7A 2VWIA 4A9UA 3R8ZA 3LL7A 2W1EA 5K3YA 4E4NA 3MIAA 4FTTA 3Q9YA 4H3BA 2JBOA 2Z6AA 5LOHA 3PA4A 3M6WA 3FUPA 2VU3A 5FQDC 1IA8A 4AZSA 4BLVA 4NKSA 3R28A 4OR5A 2C6IA 1SYKA 3MGYA 4IJ9A 1OB3A 3AT2A 3EZRA 2PVHA 2R3FA 1UU9A 3FI4A 4H58A 5C4LA 1OUKA 2EVAA 4ZSGA 1NT2A 1ZQ9A 3RPRA 4DEBA 3R9NA 2ZULA 4P58A 2YISA 1SZMA 2VTLA 4IAAA 4IX3A 4NT4A 4WNKA 4WUNA 3P97A 4GH2A 2YVLA 2X4FA 5AV4A 3D5VA 1AD5A 3L9NA 3ZEWA 5E1SA 1RI2A 5FUTA 1VJYA 3O51A 1Q62A 4RWIA 4BCOA 3I5NA 5DLSA 5L8KA 1KYWA 2AR0A 4F85A 3H0YA 1J1CA 3F2NA 4C62A 5CIYA 4M68A 3EEOA 4XHKB 5D41A 4GW8A 4XBUA 1QYRA 1KXZA 4I5HA 3GC7A 4MQ1A 5HG7A 5HICA 3TTJA 3FMLA 4XCXA 2F57A 1DS5A 2QE6A 3QF9A 4G1WA 4EK4A 2I9KA 4ZS4A 1OM1A 1IXKA 4O0UA 3QTIA 1DI8A 4BKJA 4B6LA 3TOSA 3GU8A 2Z7RA 4AGCA 4YURA 3HCFA 5LVLA 3AC5A 3LCUA 3HKOA 4FI1A 1Q0SA 2BIKB 2W9ZB 4RVTA 3F3ZA 5EG3A 4E73A 3HV3A 4FZ7A 1DUSA 5AA9A 2OO8X 4GG5A 3UA4A 5DRBA 4HVGA 3IHTA 4JDKA 3SOAA 2UYOA 1WBTA 3PSBA 3OWLA 4FKTA 4DE4A 1ZGAA 3TKHA 2O57A 2CCIA 3RWQA 5T6KA 4AE9A 2BIYA 4EOOA 4ATNA 1XQZA 1Y8YA 4MD8E 4X2JA 2OG8A 4CFMA 3WYXA 3HVIA 5C8MA 5E8VA 2W1HA 2UW8A 4RWKA 3CE3A 3SXSA 4A7CA 3V8VA 3PJ1A 3FLNC 5IQGA 4AA0A 5EEHA 5IH3A 3V97A 4RIYA 2JIUA 3AXWA 4IAFA 1SKMA 2W7XA 4LYNA 4HCUA 1FMOE 4PTEA 1YHSA 3HP7A 3R71A 2QKRA 3QUDA 2PX4A 1SUIA 4ALVA 5EKOA 2WMVA 5CYIA 4EOKA 2YM8A 3FSFA 3Q6UA 4PY1A 2XYVA 2XBJA 4ZMFA 3T9TA 4U79A 4JL9A 5LCJA 1ZY5A 2J0MB 2ZB1A 3A7FA 4CGAA 3O7WA 4X21A 4U5JA 4FTCA 4BZDA 5AA8A 2ZZMA 3UE4A 3LFCA 3PB3A 2VWXA 5K5NA 3ORIA 4L46A 4IB3A 1Q5KA 2ZV7A 4XV9A 3W8LA 2WQOA 4CZUA 2YQZA 5HVJA 4Z7HA 4AT5A 2HMYB 4MQ4A 2PUPA 3UJ8A 3K3JA 4XH6A 3W8QA 4XUFA 5GIPE 4X63A 2C6OA 3Q2MA 4O22A 3EGEA 3G2MA 3SSNA 3NWBA 2BZJA 4KBCA 3BZ3A 5AUYA 3A4PA 4BDAA 5CF8A 3ORHA 3SVZA 2UW5A 3EEYA 3EVCA 4RPVA 5JFXA 1ZMUA 1NBHA 4HGEA 4AOIA 1L3IA 3Q32A 4O2ZA 4RX9A 4X3FB 3ZRMA 2GLUA 5AP5A 5BVNA 2AN3A 2NXJA 2GNHA 3C6KA 3UNJA 1CTPE 3KCKA 1H1DA 4IWDA 1ZWSA 2IP2A 3PJCA 3OW3A 3MW1A 4U6RA 1H1QA 4APPA 1VP9A 3JY9A 4YUXA 4RVKA 2PSSA 3FRHA 1LEWA 4IWOA 5G1XA 2J51A 5KKRB 3A60A 3WZUA 5CU0A 1EQAA 3D7TB 1WXXA 2XBMA 2BDFA 3KXHA 4AAAA 3Q4TA 4G3FA 2R2PA 3IKAA 4MTAA 5C8KA 3PVGA 3TUBA 4BDGA 4MNFA 4FT3A 3VVHA 2DYLA 2EFJA 4FC0A 1H07A 3H3CA 4YNOA 3S95A 2FSLX 4FIIA 3UVRA 3W33A 3A99A 4GEOA 4CFUA 4Q9ZA 5CASA 3MV5A 4FV8A 4NUSA 4JQ8A 3MJ1A 5BYZA 2ZIGA 2ZYBA 4AN9A 5JT2A 1IAJA 1OL5A 3D7ZA 3DOGA 4ZOGA 3RCDA 4JG8A 4JI9A 3OT8A 3D4QA 5B2KA 1YOLA 4FG7A 3ZYAA 4IADA 2K4MA 4QQNA 1WBOA 2PE0A 4A6DA 4EOIA 4QP1A 3R8UA 1UWJA 3E62A 5M53A 3F2RA 2FH9A 3HMOA 4II5A 3FI2A 2XJ1A 3FLSA 3QKMA 1KE5A 2PPQA 5C4KA 3UFBA 5CEMA 4QTDA 1L3BA 3DMGA 2UZDA 5HHWA 5AAEA 5K9IA 4XYFA 3PIZA 3QZFA 3BE2A 4EYMA 3AMAA 5M08A 5KUPA 3PY3A 4RSRA 4E2ZA 3VO3A 2B9IA 3FZGA 4GC5A 2Q0NA 3NYVA 2YEXA 2Y4PA 4GRBA 5FD2A 5CEPA 4I0RA 4N6YA 3NS9A 3F66A 3MH0A 4JQEA 2BMCA 4DGOA 4GT5A 1PXKA 1ZOHA 3C4CA 4FKGA 4J8MA 4QP8A 5DT4A 3KF4A 3VS1A 4F63A 5IQHA 1Q0TA 4PWYA 4MWIA 1OL1A 3NX8A 3HVHA 3NGAA 3Q4UA 2VWBA 3S4QA 4IDTA 3C9WA 3VF8A 3P8ZA 5DWQA 3RODA 3UO5A 5K0CA 4CFWA 4KRCA 4O84A 4I94A 4FTAA 4AWIA 4PYMA 4YMHA 1XCLA 4CTKA 4YMGA 3QA0A 5D1NA 4IJPA 5EC8A 5DVRA 2PX8A 5J9LA 1OPJA 2C1AA 5C26A 4L43A 4QVKA 2WMBA 3BYUA 3LM0A 3UO4A 2XP2A 2QOQA 2OKRA 4QP9A 5HE1A 3DXPA 2KULA 3H0ZA 4U8ZA 5CVJA 4W8DA 1B42A 3KPYA 4IAKA 5LQKA 4O7SA 4O38A 4PL3A 5E8TA 4DA4A 5T64A 3RM7A 3O50A 3UNZA 3DR5A 5HIEA 4L7SA 4AN2A 4EOSA 3ELDA 2JEDA 2PMIA 2XNOA 2ZDTA 3EIDA 4M37A 4R8RA 5CCBA 5A4CA 3HVCA 5AUZA 4C38A 3DCVA 4F0FA 3VW6A 5GJDA 3HM2A 3DV3A 4KB8A 2Y6MA 2PVLA 3WF6A 3VC2A 3WSTA 1H00A 5ANOA 4OQDA 5E2BA 1H27A 2AYPA 2W1DA 4BHNA 5EQJB 1IASA 3UBTA 1TW3A 2R3JA 4FSNA 1FP1D 5LR6A 1GNGA 3GNIB 4OTRA 3MPMA 3U4UA 5JFVA 3TM4A 3C4XA 4FSQA 5DR9A 2R6ZA 1WBNA 4FV2A 2B54A 3T7RA 2QURA 5E1EA 3LW0A 3W2QA 5E1BA 1ZZLA 5K5XA 1L8TA 5DR2A 4NK9A 4KIOA 3HMMA 3VSEA 2XNMA 2Z6QA 5E9JA 2C0OA 2XEZA 3UWPA 3LIJA 4IC8A 5L6PA 4IM0A 2VX0A 1NW8A 4YJSA 3FMJA 2XA4A 3FYCA 2EX4A 4UOEA 4XOZA 4BIDA 2XZSA 1H0WA 2CKQA 2IZUA 3E88A 3DJ5A 3M70A 4KAOA 4ZY5A 1F0QA 4ZJJA 3E8EA 4EKKA 3QTQA 4F7SA 2QRVB 2I0EA 5D1JA 4C33A 4B17A 3JVSA 4FKQA 3PFHA 1PXMA 2EB3A 2WOTA 3FZTA 4OBXA 5IUHA 2JKOA 5JRQA 4NZWB 3UJBA 4DCMA 3PG1A 3NUUA 2BALA 3SC1A 1OBDA 2QU6A 4LMUA 4Y5QA 3SD0A 3LXKA 3OU7A 2VD5A 3KVXA 3R63A 5EHOA 1UVRA 2VWYA 2XKCA 3ZCLA 3DLZA 4ZTRA 1S9JA 2VTRA 5ANEA 4AACA 4FUXA 4EOQA 3G2PA 2PXCA 3ZC5A 4C3RA 3GU3A 5FXQA 2V55A 3JY0A 4A07A 3UJ7A 2WKMA 5IKMA 4MBLA 2ZAZA 4EHVA 3NAXA 4FV1A 4N57A 3DNEA 1XKKA 4I6FA 1VP3A 3FI3A 5DSTA 2C6KA 2CNUA 4KRDA 3Q96A 3FMDA 4FYOA 3O96A 4AZVA 4L52A 3PJ8A 2CGVA 4C3PA 1PXNA 5IA5A 3FHRA 4JBQA 2ZWVA 1H4LA 4PMTA 4MD9E 3FKLA 4XNEA 5EM7A 2X4ZA 1STCE 3UQCA 2JDSA 2E9OA 1YQJA 2VTTA 3LCSA 4M67A 5CZIA 3ZO3A 5GP1A 4L67A 3R7IA 4GMYA 2C5YA 4V01A 1PKDA 4RMZA 1H24A 3QCQA 5A14A 3COKA 2ITPA 3KQTA 1EH4A 2ZMCA 3COMA 3GCUA 4EL9A 2FHPA 8MHTA 2BZKB 4C3FA 2ONLA 3OU2A 2HELA 1GJOA 3DBFA 4JXJA 4D55A 4O0VA 1QPJA 1GZKA 4OTWA 5AAFA 2E9NA 4DH7A 3NW5A 2HY81 5CAOA 5GWXA 3EVBA 1RW8A 3HX4A 3UYTA 1G55A 4PYOA 5JGBA 1NVQA 4NL0A 4RJ6A 5KMOA 3EN7A 4FNZA 4G16A 3PPZA 4O7WA 4O0TA 5GNKA 5BYLA 2ITWA 2YJSA 3F5UA 4F7NA 1RJDA 4NFNA 1XDZA 2GMXA 2SRCA 2C0IA 2B2CA 4GOMD 4EHZA 3OOGA 5ICCA 2Q0BA 4MF1A 1LR4A 3SG9A 4BZOA 4FEQA 4UV0A 5IQAA 4WA9A 1OMWA 4PWNA 2BRHA 4BDIA 2JKMA 2R3GA 4E33A 4JNWA 3A7GA 3MI9A 1KPGA 3PVUA 1YXSA 1JKLA 2F2UA 4DQ0A 4MX9A 1VIDA 2P41A 2GTMA 5ANJA 2J90A 2ZJWA 3PPKA 4RJ5A 4JBOA 2VTOA 4YJOA 1FGKA 2PTKA 4ER3A 4LM5A 3RKBA 4E4LA 3U87A 4U3ZA 2Z60A 5L8LA 4CKCA 2QOLA 3K54A 4FEUA 3KN5A 4HPTE 4DFUA 3DXQA 3LFBA 5HFJA 4TN6A 3GRYA 2QU5A 4DF3A 5EYMA 3R7VA 2V62A 2QODA 4M38A 1XBCA 2QO7A 2JD5A 4B9DA 1VEBA 4BI0A 4L42A 1PMEA 2JDRA 3TI1A 3TJDA 3LBFA 3FLYA 3TG1A 2YM6A 2B78A 4RGJA 3R8MA 3W2PA 4FE2A 4GIHA 2W05A 4IW0A 4QP2A 2I0YA 3G0EA 4RA4A 3W55A 4ACGA 3QQKA 4USEA 5H8GA 4WRGA 4QQTA 4FKJA 4DG3E 4RTLA 4QYHA 2JAMA 4AZWA 4HOKA 5KHWA 4F0GA 3RAKA 4QPPA 3CY3A 4FZAB 3TNIA 5KX8A 5EEGA 4DH1A 5IA0A 1GZNA 2XNEA 2IJMA 3VIDA 4X41A 5I9UA 1XDUA 2PX5A 4FV7A 3FTFA 2ONLC 4C58A 2JGZA 4PYLA 2IVVA 2WEIA 3DBQA 4ACMA 2QD9A 2VTHA 3VW8A 5BX0A 4YC8A 3NUAA 3B8RA 2QOKA 2G2IA 3BHYA 3DPKA 4ZJIA 2CKOA 1ZAOA 3NWEA 4RC4A 5F4NA 1HNNA 4RVHA 3EVZA 3RIEA 3W16A 3GXOA 5FCDA 4AU8A 4C35A 4RIOA 1JG3A 3GGFA 3B8QA 4G2FA 1JAMA 5JGAA 3BUSA 1JSXA 3SOCA 5LQUA 1M0EA 3QBNA 2H96A 4BP3A 4FTIA 1R8XA 2IVTA 2J0IA 3EL8A 5JEBA 2IO6A 1JNKA 3MFRA 4MXAA 4UY9A 2VTJA 5BVWA 3ZM4A 4HC4A 4EI4A 2IDJA 3G5LA 4GU9A 3LLTA 3R1YA 5M57A 3JXWA 3MH2A 3CTHA 2J0LA 4JG7A 3CKWA 2G71A 2HENA 5AP7A 3VQHA 3GU4A 3QOWA 3W1FA 5EHIA 4P90A 3FPJA 3CPBA 3ZXTA 4WXHA 1PHKA 2RF9A 4JX3A 3R7EA 2HZNA 2OIDA 3HDMA 4X6QC 4PDOA 5TO8A 3NVMB 3ETAA 4QOXA 1GAGA 3I4BA 5DEWA 5FP6A 1NBIA 2NPQA 4D5KA 4D4VA 4EH7A 1JG1A 3BGVA 3SX9A 3BKXA 4E32A 2CNQA 3IW4A 3RALA 4YZMA 4CD0A 4CSVA 4DYMA 1R74A 3DXZA 4KBAA 2C3KA 4JDIA 2ZV2A 4IZ5A 2VRXA 2WTVA 2P3LA 4RFMA 4BI2A 2C69A 4YU2A 5EMMA 3CPCA 4PGHA 5HNIX 4YV1A 4U43A 5AUVA 2JC6A 4AGUA 1ZG3A 3LCVB 1KE8A 3AC4A 2O63A 2W5HA 4J1RA 4GF5A 3GBZA 3G8BA 3HA6A 2R3QA 3PS9A 2NYUA 4JIKA 4BDBA 4PV0A 2ITXA 3TM0A 1X1DA 4IM2A 3NUPA 5IPJA 1X1AA 1Z9XA 3TNPC 3P71T 4FG9A 3UQGA 5A9UA 2R3HA 3O7LB 3KQQA 1I9GA 2AN4A 3Q3BA 2W4KA 2PBFA 1OUYA 2J7TA 4E2WA 2WU6A 4TWOA 2O07A 1H1PA 3NNVA 5CNOA 1OL6A 2OWBA 1Q4LA 2Z7QA 5HD4A 3CQEA 1H25A 3AXSA 4QQKA 3QRUA 1UNHA 4CXAA 3GNLA 1FBNA 1ZXEA 5C1QB 4ONAA 5D9HA 4B0GA 5BVFA 4BTJA 4I5CA 1UNGA 2VTAA 4S2ZA 2H8HA 2C5NA 4U0IA 5CU2A 4CTJA 3TXOA 4A9SA 3LOKA 4PUZA 3HRFA 4MAOA 2DULA 3OCTA 4RVGA 3PG3A 4LMNA 5KQRA 5L3AA 2XYQA 3HP5A 3SSOA 3FAAA 5H3QA 4E6CA 4QMWA 4NM5A 4Y72A 5ACKA 3D2KA 4FICA 2F4JA 3NRMA 4FOCA 4YHFA 1KOAA 5CAVA 3OEFX 4EOJA 2PK9A 3QC4A 5HD7A 1ZY4A 3NDJA 2WD1A 4G3CA 4FT2A 2GNJA 4PRJA 4C07A 2G9XA 4XG7A 1M2PA 4YPDA 4LOQA 3VUMA 2O0UA 3ALNA 1REKA 2HXLA 2WTDA 4PIMA 4OBPA 1SQGA 1JKKA 4JJRA 2GQSA 4ZTBA 1AQ1A 4ASEA 4C4FA 2BR5A 1KE9A 2IIPA 1XWSA 1QMZA 4CZTA 3QD0A 4GL9A 3SM3A 3MS9A 3ORLA 5IQCA 4V0GB 4JAJA 2UVZA 3BLQA 2W06A 4P7EA 5FTGA 2YXEA 3HLLA 5M55A 2BFYA 3P4KA 3P9JA 4AF3A 3VC4A 4AW5A 4X3FC 3V5QA 4EH2A 5HVKA 4ZTMA 2WXVA 4MXXA 4M12A 2C5XA 3AC3A 2EUFB 4JRVA 5M4FA 1JWHA 4PF4A 4JR7A 2J5EA 2YCRA 4TKSA 2YFXA 3E5AA 4RLKA 5AV1A 1BI7A 3R22A 1XJ5A 3QL8A 5FXSA 2YCFA 4EK5A 3KR9A 3E3BX 4GOND 2G01A 4BIEA 4AQCA 4CKBA 2VWUA 3TCPA 3A2CA 3OOMA 4DEIA 1Q8UA 2QOFA 2ETKA 4IZ7A 2G2FA 5ETFA 4KW7A 4FSTA 2WIHA 4N70A 4TRLA 3B7PA 4FR0A 3QRJA 4IFCA 3ZBXA 3UZUA 4DG2E 2PSQA 1W83A 1YDRE 1I4WA 5BMSA 3R8VA 1TQPA 3PXYA 2Y1XA 4BICA 4DHFA 1P1BA 1QZZA 1G60A 3GCSA 4JRNA 4MYGA 5EW9A 4FKRA 3KREA 3KQSA 3A62A 4IM3A 1W7HA 2FK7A 2PVNA 5EIWA 5EZQA 5K03A 3DFAA 3MYGA 2IH2A 2BR4A 2XM9A 2R3PA 4TW9A 5ETCA 3DNDA 3LMIA 2CNVA 4L3LA 4AGWA 2IN6A 1EJ0A 3CGGA 4H3QA 4EVIA 5E8SA 3BCEA 3MA6A 3CLYA 4E30A 1OKZA 3R2YA 2OICA 4FT0A 3PLAE 2VNYA 1WBSA 2F7XE 3EPPA 2ERKA 3PP1A 5ITAA 1RJEA 4KDCA 4HGLA 4EH9A 4ER5A 5KMLA 2ESMA 4HGZA 3BYSA 4QYFA 5M4CA 3P79A 5DTQA 3DKFA 5TOZA 5EFQA 1LPUA 4EK3A 5EIFA 3ANQA 5J1VA 3VUIA 5FDPA 3NNXA 4FKSA 4KIQA 5CQUA 4A06A 3KQYA 5IQIA 4QMXA 1EG2A 2EXMA 3QZHA 1GZ8A 4RQKA 4RX7A 3KXGA 5CSPA 4UB7A 2YWPA 3NNUA 4CFVA 3GOPA 3NIZA 3EHAA 2A14A 2XK7A 3ZDIA 3UPZA 3JS2A 4U3YA 5F2OA 3X0DA 5DSXA 5K0JA 1ND4A 3QYZA 4IWPA 3TWJA 4CRSA 3NMUF 5K0BA 2WMTA 4W8EA 2OK1A 2F2CB 1ZARA 2RG6A 2WMQA 2J2IB 4FIEA 5B2MA 4HG2A 2A19B 2RFSA 1XH6A 4FTOA 4MCVA 4TPTA 4BC6A 3CIKA 5EI8A 4CKIA 4EBWA 5HO7A 5HZMA 1RE8A 3OY1A 2CPKE 1NVRA 4QO9A 5CT7A 3EN9A 3PLSA 4M97A 4C02A 1IG1A 3P9NA 3TL8A 3KXXA 3ORPA 5E8WA 4KS7A 5JRSA 2ZIFA 3OT3A 4MHAA 4QQ5A 2AVNA 3G2OA 1XHAA 2W99B 4ZZNA 1Q8YA 3HRBA 4MKCA 3KRLA 1YZ3A 4F64A 3R7OA 1WMKA 4FEVA 2XNNA 4F0IA 2ZBPA 4R6WA 3P86A 3POZA 4DGGA 5BUJA 3OHTA 4GOOD 5KVAA 3Q4ZA 4BDDA 3C4EA 5LVPA 3TPZA 1M7QA 3UOHA 2RG5A 3QHRA 5DI1A 2PGXA 2RIOA 3EZVA 5EI2A 4ZSLA 4C4JA 4G56A 2DS1A 4S33A 4TWPA 1D2GA 5I9ZA 1IR3A 1J3HA 4XS2A 5CENA 3V8WA 5EMJA 3PY0A 3L8PA 3D0EA 3CJTA 2VGPA 3EQDA 3QKKA 5A3XA 3LMGA 3FZ1A 4JR3A 4ZTNA 1W82A 4G3DA 5CEKA 5DIAA 4FZVA 4GK4A 3R0TA 3P9KA 4L01A 3E7PA 3LZBA 3HCBA 3G15A 5J7HA 4RA5A 4XV1A 2C6EA 4FV5A 2OKCA 4AX8A 5K0EA 3R2BA 3L8VA 3GJYA 3MJ2A 3N4UA 3WE8A 5DT0A 4IE9A 1RI5A 2OO3A 1IAHA 4FTQA 2R7BA 4HZRA 3K3IA 4XG8A 2ZW9A 3CCFA 2QHMA 2WTKB 4Q5HA 5AFVA 5LCKA 3B3GA 1X8BA 3DBCA 3LHJA 2WZJA 3CEKA 3CGFA 2WQEA 2AC5A 2HCKA 4IC7A 4ITHA 5LXMA 1VE3A 2BTSA 2JJQA 3C3YA 5FQOA 3A61A 3P5KA 4TYGA 2QRVA 5F2NA 5EMKA 1UFKA 4MIKA 3VC1A 2XK4A 7MHTA 1BL6A 4FVQA 4RJ7A 3N51A 4EWQA 4G34A 3AD5A 2OB1A 2Y1WA 3KKZA 3FQHA 4ASDA 2BR3A 2BZGA 4I3ZA 5TKDA 1O54A 3I5ZA 3FHIA 4R78A 4NKAA 4Y85A 1O6KA 4FSUA 1ZGJA 2JH9A 4AT3A 1NE2A 1XO2B 3LBYA 3MCTA 1U5QA 4I93A 3DH0A 3EKNA 2YM3A 2YCQA 4FTKA 5EDQA 3MY0A 5GINE 3LAUA 4O81A 3BGDA 4YV2A 4YR8A 4QMSA 5C03A 3CJFA 4FYNA 3WZDA 5CAUA 2UW3A 4XLIA 3TKYA 1H8FA 2XJ0A 5EYDA 2XIRA 4FSYA 5CU3A 2UZUE 3D9VA 3WZKA 3DK7A 5BPYA 2HZ4A 1YWVA 4D5HA 3EL7A 3NTVA 1VYZA 4FIGA 3R24A 2GS2A 2XIXA 5ANDA 4M69B 3R04A 4ZTQA 1YXTA 4YJNA 4DM3A 2ZM3A 2IZRA 1VL5A 2BH2A 1D2HA 4O6EA 2OGVA 3TQSA 4AW0A 4D0XA 5G02A 4CCUA 4LUDA 4O7ZA 3LKZA 3WZJA 3CD8A 2IVUA 1LP4A 2ITZA 4K9YA 3HEMA 3TKIA 4A6EA 5FBOA 4JIAA 5HE3A 3DQXA 4CMUA 4QTTB 5CX9A 2AS0A 3DXNA 1LUFA 2J5FA 2OBFA 2P1DA 5T6BA 1V0OA 5T67A 3MGGA 3FLWA 3MB7A 4GS6A 4R1YA 2QLQA 1Z3CA 2QR8A 4GT3A 2RKUA 2R7IA 3PP0A 4BDJA 2W1IA 5L2WA 2I7CA 2IH4A 4FS8A 2QCSA 1KV1A 3ORXA 3KRWA 4FNXA 4YJRA 4Z16A 2VDUE 3JWIA 5ERGB 3HZTA 3G9NA 4F9AA 3UJDA 3HNRA 1REJA 4DEHA 5ACBC 2G8NA 2VWVA 2X2KA 1Q3WA 4U9AA 3HRCA 3OFKA 3IK3A 2G2HA 3V3VA 4E1ZA 1ZOEA 1HCKA 5DRYA 3L9PA 4FGRA 4CKEA 4QNAA 3EMDA 4KDRA 3SXRA 3F6XA 1QPDA 3PSDA 4F9CA 3FZOA 2WQMA 4F1OA 4XP3A 4Y2HA 1YI4A 4C37A 1T46A 2QOIA 4QYGA 3RHXA 3BWMA 3EMBA 5JQ5A 4H0NA 3TNWA 4FUYA 4YJQA 1HMYA 5EMLA 2ADMA 1VYWA 2CN8A 3G2FA 3C0GA 2PZRA 4GKIA 4YMJA 4ZLZA 1YXXA 4CNHA 3GDHA 3KKVA 4ACDA 4DTKA 3DK6A 4ANLA 4A9RA 2PVCA 1OL7A 4CFXA 4J71A 3GB2A 4C4AA 2UZTA 4RX5A 3GOKA 3WARA 1VR2A 1H28A 4FMQA 4Q5EA 2YM4A 4QRCA 5DT3A 2YA9A 4A4XA 4X2FA 3D5UA 3ELJA 4IWQA 2CCHA 4L8MA 3V5PA 3OCGA 4YZCA 5DFPA 5IQDA 5EM5A 4JVGA 4E26A 5GIOE 1PXOA 2CHLA 4GFOA 4BTFA 4QVGA 2V5QA 2YM7A 3QD3A 2JH8A 3VYWA 1MJFA 4U42A 4DEAA 4YO4A 4Z55A 5H8EA 2XVAA 3A8XA 3HAVA 2JFLA 4LV8A 3VS2A 4ASXA 3TZ8A 5J5SA 4DEDA 2WGJA 2X8EA 5BP7A 4EC8A 3ANRA 2GNIA 2X2MA 3V8SA 4AOJA 3LMHA 5A4TA 2C7QA 2XK8A 3WI6A 1MUOA 4EHGA 5LWNA 3D7TA 2UVYA 3QXOA 5KCVA 5CVVA 3PXRA 1UKHA 1RJGA 5HEZA 2NNWB 2GS6A 3BI6A 1XDSA 3EMGA 1CMKE 3BXOA 4CRLA 2C3IB 2R3MA 4JS8A 2WQNA 3U4WA 3MH1A 2PXAA 4TNBA 3VWAA 4MXOA 5A4EA 1W84A 3LJ0A 3OG7A 3Q4CA 4BTMA 3HVJA 3VRYA 5ANIA 2OZAA 3E8NA 4L6QA 2X8DA 3UOKA 1ORIA 3EVEA 3BGZA 5IQFA 3EQIA 3DB6A 4MD7E 4RIWB 3TIYA 1R6AA 2IW6A 4GYIA 3OZ6A 3ZLXA 3R1NA 4XUEA 2CL5A 2PWPA 3G0FA 1Y91A 4P5QA 3IW5A 4HRAA 2OU7A 3ZONA 2X6EA 2CMHA 3G5TA 3Q53A 1XH9A 3IW6A 4WNOA 3LCKA 2EJUA 3EN4A 5ICGA 3ZS5A 5DLYA 2BKZA 4M84A 3OTUA 3ZC6A 4ENXA 1DL5A 3OZTA 2FA2A 4Z2YA 3BHVA 4CMOA 5DNRA 3QA8A 4YJTA 3ZTXA 4K8AA 2LD4A 3KQPA 2ZSUA 3GGDA 5A46A 4C2WA 5JFWA 2WAJA 3R9HA 2VTMA 4WT6A 1JTFA 3U54A 5JR3A 3WF5A 3JR1A 5LQRA 2NO3A 3ZO4A 3SLSA 3LXPA 3KR0A 4KKEA 3FYKX 2YZAA 3RVGA 1FVVA 4YO6A 3MB6A 3G2QA 2ITTA 5H02A 1OPLA 4XV3A 5D12A 5DTRA 3UZTA 3JVRA 2G15A 1WBWA 4L9IA 5BMMA 4BVUA 4F09A 3LFDA 5IH4A 1X19A 1FVRA 3TT0A 3KGAA 4W4WA 4EOLA 4RTPA 1OITA 4EQCA 3IQ7A 2R3IA 2B9FA 4WRSA 5EM6A 3BWFA 1R00A 5HIKA 1I09A 2WTKC 2O65A 3N9XA 1A48A 3UODA 3GC9A 5E90A 3VULA 4IV0A 3ORNA 3L8DA 2P4IA 3D94A 1ZOGA 3KFAA 3O8UA 4NYEA 4TWNA 3KHKA 4RQVA 4NH1A 5AMNA 4C06A 3KULB 3QQJA 3TACA 3PIYA 3JUHA 3UP2A 1INLA 3F4KA 4TNDA 1O6YA 3T0IA 2LGCA 4DFLA 1TQMA 1HOWA 2WTWA 4YUYA 5A4QA 5K0FA 2XYNA 4UX9A 4BYIA 5HQ0A 2ZIEA 2BVAA 4NSTA 3B3FA 4IAZA 4LECA 2UW7A 4BZNA 4FKIA 3PZEA 3O23A 4YTIA 2GH1A 4YSJA 4IKPA 1Q8WA 1Q8TA 2O5KA 4K77A 3UZRA 3P9IA 5JN2A 4L3JA 1BI8A 4CFNA 2E2BA 3GP0A 3DKOA 3QWJA 4LRJA 3DMHA 1V39A 5GOZA 2JG3A 4USDA 3QD2B 2C5OA 3KQMA 1U2ZA 2ONYA 3QYWA 4FT5A 1Y8GA 4TYIA 1J91A 3OCSA 3QC9A 4XG3A 4DBXA 3PE1A 3DUWA 3NYXA 2V22A 3AC8A 4FL3A 4G31A 2OFVA 4IVBA 4RWZA 3T7TA 3QLGA 2B9EA 4FV0A 1BX6A 3ROCA 3A7HA 4D1XA 4F65A 2UYCA 3QCXA 1YF3A 5EOVA 4RRVA 4IQ6A 4BIBA 4QTEA 3I9FA 3EJ1A 4ZXTA 1NVSA 5AP0A 3KR2A 3OZSA 5C1IA 3B89A 3SW4A 3KK9A 1P39A 2YX1A 5IA2A 3KRJA 4BCIA 2HNKA 2C6TA 4J52A 3O8TA 4YTHA 2C0TA 3EQCA 2B1PA 1X1CA 2IFTA 5CT0A 4KSPA 5IA1A 3T7SA 4F1TA 4DT8A 1SVHA 1W0XC 4U7TB 3DAKA 3NUSA 3R1QA 5LJJA 2XRUA 2PX2A 5K8VA 3POOA 5TT7A 2YIYA 5KMJA 3I6UA 1D2CA 3HA7A 1JQDA 4AFEA 4EORA 4QQJA 1B38A 1SMHA 4V0RA 3ZEPA 1JSTA 4PDYA 3DKGA 2C6DA 2DWBA 4S34A 3P7AA 1NW5A 2PVJA 2VO3A 3F3TA 2YACA 3M11A 5EGSA 3FTEA 3SW7A 3KMUA 3AC1A 3FQEA 2YITA 4FGBA 3RHKA 4ZSAA 2RL5A 3BELA 1WZYA 5GJFA 4EQMA 4RX8A 1IA9A 1VZOA 2XS0A 4M15A 2KTYA 4IIRA 4BGGA 4U45A 4DFNA 3LXNA 3FBVA 3OBGA 4E5AX 4LL5A 4A4OA 2OW3A 3SRVB 3TLJA 3EQHA 2N47A 1WBVA 4UXQA 4R6XA 2ZB0A 4RC2A 5IZFA 2YXDA 3IOKA 5CSXA 5J9YA 1K9AA 2PULA 5FEDA 4HSGA 4KA3A 4AA4A 3EFWA 5DTMA 4I0TA 3VBYA 4F6UA 2VTPA 5JSMA 3AWIA 2VN9A 1P14A 4IX6A 4G6OA 2YXLA 3RAWA 5M07A 3TRKA 2XF0A 3W18A 5CM2Z 3C0IA 3FEGA 4IEBA 2I6LA 4M14A 1JQHA 1KPHA 2UZVA 5FTWA 4AZTA 2B25A 2IH5A 4EOMA 5DOSA 4R5YA 4F9YA 1P1CA 4E5WA 4RTMA 3MTLA 2PY6A 3GU6A 4E93A 4GFGA 2ORED 1FJXA 4IZYA 1XXLA 3CC8A 3ZXZA 1KP9A 4HZSA 2GA9A 2GQRA 2ZM4A 1O9UA 1Q24A 3ITZA 5E8YA 5CVUA 3FMHA 2AOXA 4FP9A 3E8DA 4C59A 3KQOA 4DG0E 3T9IA 1P4OA 2OJJA 4FTJA 5AUXA 4KWPA 5AX9A 3ZFYA 1SVGA 2VX1A 2NRUA 3ACKA 4J97A 4ARKA 5I4NA 4A4LA 1JQ3A 3COIA 2OPBA 1J7IA 4W4VA 2OZVA 1PXJA 5E8ZA 4R77A 5F20A 2CLXA 4C4IA 2ZWAA 3UJAA 3EB0A 3NEWA 2GTNA 2J0JA 2P40A 2YZLA 2P7HA 3LKMA 3BQCA 3BWYA 4V0GA 1M2RA 3MVLA 3DLCA 2HWPA 4FR4A 4BR3A 3TN8A 3OF0A 4DGMA 3TM5A 4FL1A 4HGTA 4PP7A 4ALUA 4NCTC 5CD1A 4DKJA 2RFDA 2GS7A 1YUBA 3R02A 2QO2A 1AV6A 5M09A 3DGKA 3FY0A 4YTFA 4CT2A 3C0HA 3DJ7A 4GT4A 4D58A 1WS6A 4UWCA 4EJNA 4BCPA 4PQNA 2GNGA 1MRUA 3LQ3A 5HIJA 4RG0A 4BDFA 1YDSE 3LCCA 3LDGA 3ACJA 3PPJA 4I92A 4QYYA 2E9PA 2ETMA 4LGGA 5HTBA 4XRJA 2IGTA 1QPEA 3CKKA 5DT2A 1CKIA 2P0CA 2HZIA 3WILA 4MTLA 4PYIA 4FV3A 1PY5A 5LARA 1RQQA 1WVXA 5EHYA 3AJDA 4DTAA 5J8IA 2ZVAA 3Q9ZA 2X7GA 5BUEA 2IPXA 1KPIA 5CWZA 2FB8A 2GNLA 3FI8A 5IQEA 5EYKA 2XNGA 4FV9A 4KINA 3K0BA 4FSDA 4HTFA 2OYRA 3PZHA 4M7IA 3VS6A 3KRRA 3R7YA 2XIYA 1ORHA 1OI9A 3FPEA 2H34A 3GFWA 4NJDA 5AJQA 1JBPE 2XJ2A 2VP3A 4ZS0A 3KPUA 4AXAA 3O4FA 3TIZA 5DM4A 2XVDA 5CU4A 4ERWA 4WG5A 5EHGA 3EGVA 4FK6A 3DQWA 3ZBFA 1XBBA 5DWRA 3EWHA 4IB0A 5CEQA 1Y8CA 4ZLOA 3A26A 3DULA 4DFXE 4PTGA 3BEAA 4QMLA 3LQ5A 1OBGA 3BGPA 3ZHPC 2VDVE 3C51A 4O0XA 3TUCA 2HW6A 4PINA 3AT3A 3PUPA 5KZIA 3TTIA 2XVMA 5K09A 4EK6A 4AT4A 3KQVA 5AUWA 2OZOA 2UV2A 3RM6A 4D1SA 4C4EA 5CVEA 3H2BA 3EQBA 2C3JA 3I0OA 1ZHFA 3RJCA 1UNLA 3ZUTA 2ESRA 1UWVA 2WMXA 4DGNA 1U46A 5AEPA 4TY1A 4FSXA 5CVHA 3LFNA 3TZ7A 4P7FA 3RW9A 1ZZ2A 4XG9A 3DTWA 2W0JA 4YHTA 3BV3A 4LG1A 2PVKA 3QXPA 3EQGA 3LFEA 3E8CA 4IFGA 4BCHA 1KR5A 4KBKA 3QTUA 5IUIA 3UP7A 4K18A 5DM0A 4Z3VA 3MTEA 4XBRA 3BT7A 5B7VA 2QR7A 5HG5A 2QYOA 4AE6A 3QOXA 3R0QA 3TV7A 9MHTA 4RTJA 3QD4A 3HVKA 4QPSA 4CV8A 4QTCA 3ATSA 2Z8CA 3FMMA 2O64A 2X9EA 3MFTA 3Q5ZA 4JBVA 4ER6A 3CP9A 4J99A 5HCYA 3P2EA 2PUUA 4PX6A 4WUAA 2JDVA 3I7BA 1ZYSA 5EYCA 1RJFA 3F2AA 3QQHA 2PE1A 1PXIA 3SV0A 3B2TA 3GC8A 1KYZA 4QDKA 4QTBA 4O7TA 2XIKA 1TKIA 4BBFA 2HY0A 4WD5A 3SR4A 3EYHA 2XRWA 2YDJA 3PTAA 3KN6A 5L2SA 3R01A 1FP2A 4RTKA 3ATTA 2NXNA 2UZWE 5AP6A 1R18A 5CXHA 5HE0A 5J95A 4BDCA 5BNJA 5HOQA 4TTHB 3AOXA 1ERKA 2Y0AA 4GVJA 5HO8A 5C27A 3ZZEA 5I9VA 3HUBA 3N4TA 5ANKA 3VS5A 5FGKA 4FODA 1QPCA 1OKYA 2QVSE 3OMVA 3PVBA 2HK5A 3DZQA 3TEIA 4EZ7A 4E6DA 4P7KA 5IA4A 2X7FA 3G88A 1XR1A 2W9FB 3BYVA 4PTCA 3ODZX 1VLMA 4OQEA 4QMYA 1PXLA 4G6LA 4DEGA 3UZPA 4S30A 4F70A 3MB5A 3AXTA 5L2IA 3DLSA 3CD3A 5E92A 1EIZA 5EKUA 3I1AA 1FOTA 4E2XA 3LLAA 4FNWA 4P5ZA 5CI6A 5HIDA 4O7NA 3E93A 5HBEA 3E23A 10MHA 4LOPA 2XH5A 5L6WL 5BUIA 5KE0A 3OVVA 2Y7JA 1SNXA 2R64A 4GJ3A 4DH3A 1NXKA 3GRZA 3CCNA 4MBJA 3UNKA 1NKVA 4RTSA 1XJDA 3VUKA 5BVEA 2R0IA 1NA7A 3KXMA 5IDNA 2OZAB 4PDPA 3LQ8A 3C3PA 1W98A 2X9FA 5IA3A 4AW2A 5C01A 3V6RA 3NIEA 2ZBQA 2BHEA 3NYNA 2A2AA 4H1JA 2UW4A 4MBIA 1JPAA 4EH8A 1NY3A 2UW6A 3OEZA 4WNMA 5E7RA 5IMXA 1H08A 3FMKA 3K5UA 4DH5A 1AQIA 1N7IA 4WO5A 4E6AA 4EKLA 4CG8A 3MPAA 3UYSA 4FVPA 3LXLA 4JQ7A 2P33A 3CKXA 2PJDA 5EOLA 1H01A 3ULZA 3R1SA 5HLPA 3MWUA 3CJGA 1KE6A 4D4RA 4KRGA 2OY0A 1EJ6A 3HCDA 3FYJX 5C9ZA 1GIHA 2P2HA 2XCKA 3RPVA 5KBQA 4EJ7A 2R3RA 4C61A 4E6QA 4X2GA 4NW6A 1O6LA 2YDIA 4JOAA 1CKJA 1JOWB 1UV5A 3OE4A 4H05A 3C6MA 3W2OA 1U54B 4YLJA 3LFSA 4FKPA 3OUNB 5T3QA 4RZWA 4F99A 3AGMA 4TYHB 4ZTHA 4ALWA 4I5MA 4BF2A 2OFUA 2W1GA 3E87A 4PP9A 3ENMA 2C5VA 4AUKA 4HYIA 2HXQA 4UWYA 3U9NA 3E7OA 1DI9A 1PJKA 1TVOA 4PMSA 3E05A 4JXFA 2NP7A 3T3VA 5HLNA 1TPYA 3H4JA 2XKFA 4FIJA 5LQFA 3KU1A 3LFFA 4J8NA 5D11A 3KULA 3ZLSA 3ZLYA 5M4UA 1VPTA 4FV6A 2VUWA 2ZCJA 4E7WA 3EGIA 2B52A 4WHZA 5CUQA 3THRA 4E70A 5MHTA 3R3HA 2AOTA 4FNYA 2I62A 4I6HA 3R8PA 4M7RA 4YPSA 3OZRA 5E1DA 3L8SA 3ZH8A 2CGXA 4LWOA 3SVVA 3RMFA 3ZSIA 2C30A 2CGWA 3FSKA 3OD6X 5EDPA 3CBLA 4ANMA 4E8AA 4YJVA 2G70A 5AM7A 2ITUA 3A7JA 4C0TA 1QCFA 4MXYA 3OFMA 3ERKA 4ITIA 3QCYA 4QMMA 4V0QA 2X7OA 2A4LA 3ZZWA 4G9CA 3K5VA 4PYJA 5E9QA 5T68A 4MK0A 3FPGA 1U4DA 5BW5A 3RTPA 3IGOA 4BTKA 4X60A 4OTQA 4I4EA 3G5DA 2Q83A 3ORTA 4OUCA 4Y73A 5AUUA 5DXAA 4GG7A 3U9CA 4D28A 1PF8A 5DPVA 4E5BA 4RBLA 4X6RA 3LPMA 3DY7A 1KOBA 1YHWA 5DYJA 1M6EX 5J87A 4W4YA 5IMEA 5GM1A 4CWAA 2OJIA 4YBKA 4N0SA 2I1MA 4HW7A 3FZSA 4NM0A 4QMQA 3HP2A 4WSYA 3LECA 4I1ZA 3PXZA 5DH3A 4ZIMA 2F49A 3LPBA 3D83A 3PRIA 4D1ZA 3P2IA 4FKOA 1NW6A 1O9HA 3DDQA 1E1VA 5DPMA 2B9HA 2X39A 3L8XA 4HYHA 3G8AA 2IDKA 3KA0A 3P08A 5HX6A 3GVUA 5AX3A 3V8TA 4C4GA 1CSNA 1UU8A 3PA5A 1G5SA 4O0WA 3H10A 4Y30A 4C2VA 4CG9A 2YIQA 3FLQA 2DPMA 3D5WA 3HV5A 4JBPA 1SUSA 4KKGA 2ZLBA 5E8UA 4Z7GA 1DCTA 3O71A 4OTHA 2KW5A 3S3IA 3R7UA 3LGAA 4IX5A 3KPJA 3BHTA 2QY6A 3ORZA 3I81A 3OP5A 4NCTA 3EFLA 3ZRLA 2PMNX 2GB4A 3CSVA 1MQ4A 3NUXA 4I6QA 4IB1A 4O6LA 3BZBA 2XB7A 4MXCA 1YI6A 1QANA 1W8CA 5HVYA 4QTUB 3RK5A 3GXLA 2PT9A 2P3OA 3SGLA 1B39A 3KB7A 3QTXA 2BRMA 2ZDUA 5AADA 1K3AA 1RJBA 4CKRA 3DDPA 3W32A 1M2QA 4AW1A 3BLHA 3TV6A 2WA1A 5EPEA 5DGZA 3G51A 3VBWA 2WMRA 2JBPA 3GCVA 4OTGA 3VNTA 3MAGA 4O27B 4XG6A 2R3SA 2BAKA 2JHPA 4X1OA 3BBTB 4TYJA 3KY2A 2E9VA 5M5BA 4C7TA 3GU7A 3V6SA 4P4CA 1URWA 4FT7A 5GJGA 3HCCA 2C4GA 4H39A 2WEVA 4D2RA 4F84A 4ZZMA 4QPNA 3P0MA 4P7GA 3A27A 4NIFB 5HCXA 2XKDA 1BHJA 3O7LD 2HOGA 4DCGA 3GCQA 3PTGA 1ZMVA 5AV0A 3HTXA 4XUDA 1JSVA 3IG7A 3ZFMA 4UEUA 3B2WA 5CAPA 4HH4A 5HZNA 3AD4A 4E4XA 2QKWB 4FTLA 3U51A 3QZGA 2P2IA 3HMNA 3U6IA 3VJOA 3OBJA 5EKXA 1AQJA 2RFEA 1JKTA 2GCDA 2YERA 2FRXA 3RGFA 5B1SA 2G1PA 2R3OA 3LSTA 4CVAA 5JMSA 3F9NA 2O3PA 3R83A 4I20A 4YLLA 4QP3A 2Y8OA 3V04A 3F3UA 1H1RA 4DTBA 3G33A 1QAMA 2QC6A 4RVLA 5FLFA 5E9WA 2X2LA 3ET7A 2E5WA 3QRIA 3PY1A 4QQCA 5EZSA 4DLIA 4IVDA 3HV4A 1V1KA 2HW7A 2QONA 3MN3A 4UZDA 3C4WA 3A8WA 4FZDB 4UALA 5JKGA 3FC2A 3OU6A 4FKLA 4L7VA 4LWPA 4G5JA 1GZOA 2WNTA 3HV7A 5CVFA 3KU2A 5H9BA 4GFMA 3AC2A 4K0YA 4RZVA 1NW3A 5IH6A 2HIWA 4EZ3A 4GBED 1FVTA 1L3RE 3VHKA 3F5XA 5CY3A 4R3PA 5FM3A 4XV2A 4R1VA 5EQPA 3RK7A 4DN5A 4EK8A 2AOTB 4CEGA 4CTCA 5HGIA 4IBMA 2QOOA 3O17A 2QOBA 2FYSA 4JDJA 2CKEA 3THBA 1JSUA 4WVLA 3LVPA 5CEOA 3EH9A 2JIIA 4K6ZA 4E20A 3L1SA 2G72A 4HVHA 4FSWA 4EZ5A 5KMKA 4F7LA 3TZ9A 4YJUA 2HWKA 5ICFA 3TKUA 4G17A 4HGSA 3DAEA 3FUTA 2OXDA 5FBNC 3KMMA 3A7IA 4M0YA 4FEWA 4G6NA 4I41A 2YUIA 3FRIA 5EDRA 4RT7A 5GHVA 3HCAA 2BZHB 1BOOA 5P8WA 4EQUA 3TNHA 3R6TA 3BQRA 3EQFA 3UTOA 2XNBA 1SQFA 4O0YA 3QZIA 3JWJA 1FPUA 2V7OA 3VF9A 3FTCA 3UC3A 5EVJA 4BI1A 5KHXA 3FXZA 5DEYA 1ATPE 1XTPA 1R39A 5FADA 2FCAA 3R73A 3IONA 4R3RA 4RC3A 4U7ZA 5HNBA 2QM3A 3D2IA 3E7VA 1YB2A 5E8RA 2F8LA 3OTVA 5FEQA 5H8BA 3VS0A 4YC3A 1BKYA 4IACA 1QAOA 3IDCA 4QMTA 4PYQA 4R8SA 3MFUA 2VTSA 2XUUA 2UW9A 2YJRA 4H3PA 3VS7A 3WF8A 4QP6A 5AUTA 3M6VA 4I23A 4UBAA 4BCJA 4DAWA 3NDMA 3V5LA 2AOVA 4XLVA 5E4HA 3CBGA 2NP6A 2UUEA 5LMAA 3PYYA 3DZOA 5CXZA 3DJ6A 3EYGA 4CKJA 3O8PA 5EQEA 2C47A 5F9EA 1U54A 5FQNA 3GQIA 4XOYA 1Z5MA 2EU9A 1WG8A 2WELA 3FKOA 4AP7A 4CTBA 3MY5A 1A9UA 4XG4A 1F5QA 4PYKA 3M6XA 2Y9QA 3F7ZA 5JZJA 2VWZA 2QOCA 3C4FA 1PW2A 4X2KA 2X0GA 4EWHA 1Q3DA 5CANA 2R0UA 3QFVA 2V74B 5E9EA 2JKKA 1CKPA 2OB2A 1PKGA 3GRVA 1Q97A 3KC3A 5A6NA 4Q9SA 3HECA 1PRYA 1G6Q1 4Y8DA 1T43A 3QALE 5DX8A 4DH8A 4AZEA 3P9CA 4QP7A 2O06A 3G90X 3GIWA 3M2WA 3FY2A 4HTFB 1SVEA 3ZUVA 3IGGA 4FGZA 4C05A 3NDIA 4X2NA 5C8NA 4BCKA 5HNGA 1K2PA 5FUBA 4OBQA 4K1BA 3ER8A 5M06A 4LOOA 1VQ1A 5BW4A 3I0QA 2I0HA 2XIZA 2CSNA 4L45A 4CCBA 5EI6A 2XYUA 4IV8A 3ZSGA 4PYNA 1BUHA 1MQBA 1OVEA 4J95A 1H0VA 2PWYA 1APME 3R00A 4FT4A 4RVFA 2JHAA 4GEKA 2W4OA 1NW7A 1S9IA 5DXJA 3L9LA 4XX9A 4W4XA 4EK9A 3MQ2A 1YOJA 1HCLA 4OBOA 3GCZA 3OPNA 5FWAA 3Q04A 4HNFA 3NCZA 3KVWA 4J96A 5AP3A 2E9UA 3TUDA 4BBMA 5JFSA 4ZSJA 4EQZA 3ELYA 2OJ9A 2PYWA 1OIRA 5HIBA 3HL7A 1WXWA 3DOUA 1M7NA 1PMNA 2JDTA 2YM5A 5CNNA 3LKDA 3QGWA 3BE9A 1BKXA 4RSSA 4F9WA 5I0BA 3PXQA 1TW2A 4DLJA 3RAIA 4EH6A 3VUDA 5BYYA 1JG2A 1YWNA 3SXJA 3DU8A 2FGIA 2XMYA 2YN8A 4YJPA 1LEZA 3EQRA 4Y83A 5CF5A 4RV9A 1ZYDA 4RYLA 1DAYA 4CFFA 5FEEA 4YV0A 5HKMA 3AD6A 4RIXB 4I5PA 4YBJA 3W10A 4BCQA 1UU7A 2QG5A 3QTZA 5HILA 3LFQA 1OL2A 5ANGA 1I1NA 3P23A 5K05A 5CEIA 2BAQA 4WKQA 4K6MA 3EN5A 2YTZA 3SDJA 3UIUA 3ORMA 2PZPA 2XK3A 5DX0A 3C5UA 5AAGA 3FWQA 3THSA 3OC1A 3NVKI 5DX1A 2VTQA 5FHQA 5LQCA 3FUWA 3G89A 3HA3A 3I5UA 4CV9A 5DA3A 5ETAA 3SGCA 3IPHA 2ZTHA 3EVFA 3LCTA 4DZRA 4OT6A 3LCDA 3AGLA 2XEYA 5EK7A 5IUGA 4ZTLA 3FMEA 1X1BA 1XCJA 2OIQA 2QO9A 2WMAA 3GC0A 4RIXA 3R8LA 4OT5A 2UZ4A 2QQ7A 1OIYA 4KIGA 2YAAA 3ELWA 5CS6A 4FEXA 4H1MA 3FPHA 3NZ0A 4XP0A 4KABA 4O82A 3RPSA 4I0SA 3WE4A 3I58A 3ZDUA 4DITA 2PVMA 3JPVA 2WQBA 4IWNA 3D14A 5JUWA 3M4XA 3KPVA 2JDOA 4L7FA 3Q52A 4MH7A 5DM1A 3LJ1A 1V0BA 4BYJA 4DA5A 1Z57A 4P7JA 5IF1A 1Q8ZA 2PKWA 4UYAA 3RP9A 2VDWA 4UXLA 3PFQA 5LWMA 3SX0A 4DMGA 5AWMA 4BDKA 3GUBA 3BHUA 4F4PA 3MERA 4GQBA 5H2UA 1YWRA 5FXRA 1F3MC 3P7CA 4IMYA 3KXNA 4PONA 5GM2A 5L8JA 4LRKA 2Y6OA 3I60A 5BXYA 3BU3A 4BDEA 1OECA 2JHCA 3DTNA 4B8MA 5EH0A 2YHVA 4D9TA 4PMPA 5D7VA 3FE3A 5KNJA 3OXIA 5E8JA 4EKIA 3QLFA 5CI7A 1R1WA 1WBPA 3RCJA 4ZY4A 3LFAA 5K0NA 3U55A 4GUBA 4DBNA 3HCEA 5LQAA 4U97A 3HAMA 2BPMA 2PHKA 1Q61A 3DKCA 2ZM1A 4WNPA 4HVDA 3U6HA 4F86A 4EH4A 5CSHA 4X7QA 4Z9LA 3SAYA 5HBJA 2W5BA 5M51A 2HAKA 3CS9A 1F38A 1WVYA 3E64A 4PL4A 5BQ0A 2W1ZA 4FL2A 3GRUA 2H9VA 4L44A 4LL0A 1OKVA 1UKIA 4YLKA 5AP2A 1JKSA 3UIXA 3VBVA 5K4JA 1NV9A 3G7UA 1V0PA 4FX3A 4ZEGA 4FTRA 3VN9A 2GPHA 3MVHA 2PZ5A 4YUVA 5F2KA 2W17A 3RAHA 5FA5A 3AT4A 2P3GX 3RZBA 1H26A 2V0DA 2C7RA 1YW2A 4ITJA 1T45A 2EXCX 1YHVA 3GQLA 3NUYA 4WBBB 3TV4A 3ZLWA 1U5RA 5DN3A 3UJGA 2CKDA 2PVRA 2BM8A 1SM2A 2CMGA 3QTWA 3TFWA 4WOVA 4FOBA 2RFNA 4QMVA 3I64A 1Y57A 5EQYA 3KPWA 2ITQA 3M42A 2PMOX 4IB5A 4QNYA 2BFXA 2PE2A 3DLIA 3KRXA 4HNIA 5EW3A 5CAQA 1YXVA 1EAMA 2GFCA 3IO7A 3RWPA 4IVCA 3FUXA 2WMUA 4ZY6A 5FHRA 5AP1A 2WTCA 3C50A 4DFBA 2JFMA 4L3PA 3NCGA 4EC9A 4J98A 4EKGA 4NM3A 3WIGA 3ELUA 3T8OA 3QCSA 3LX6A 3PXFA 4G5PA 5FTQA 1L1EA 5B0XA 3SRVA 4U81A 5EHLA 4RTQA 2B9JA 2PWLA 1R0PA 3W2CA 2VWWA 3QWKA 2FSTX 3CQWA 3VUGA 4EEVA 3SQQA 4FSMA 3VQUA 2BAJA 3H9OA 4KD1A 1OIUA 3DP7A 5M56A 2X8IA 3FUUA 3MBLA 1JR4A 2XCHA 4QMPA 3GO4A 4U7PB 4GJ2A 3LE6A 4ID7A 2OI4X 1J1BA 4KWCA 4C04A 5CZHA 4L53A 2JAVA 2BDWA 3FQSA 4L68A 2CMWA 5FTOA 3V5WA 5KBRA 2C7PA 2O8YA 3VBTA 3KXZA 4PMMA 4MHTA 5FM2A 2PU8A 3V51A 2AZTA 1FGIA 3IEIA 1FMKA 4I24A 2R9SA 3BBWA 4YNEA 1PJZA 4Y46A 4G3EA 4GYGA 3RPYA 5U4XA 4R6VA 4BCGA 3PIXA 5A4LA 4ORKA 5AV2A 5LMKA 2YCSA 1WVWA 4OTDA 4P2KA 3D5XA 4MVFA 3FDNA 4AFJA 3UOJA 2O2UA 3C5IA 3F3VA 1KV2A 3DB8A 3G6GA 1Q99A 4FIFA 4UYNA 4QPAA 4IAIA 3DAJA 5LQJA 5CSWA 3ROYA 2WOUA 2YDKA 3F5PA 4XG2A 3QRKA 5C0OE 1G38A 5ICPA 3FZPA 2ITVA 2W96B 4NTTA 3EN6A 3DXYA 2QG7A 3II5A 4OLIA 2AOUB 3MCZA 1WFCA 3KF7A 1MHTA 3MDYA 3BWJA 1M6YA 1MRVA 1KE7A 2A0CX 2QNJA 4F6SA 4BCNA 4RIWA 4IANA 5CQWA 4BCMA 4D9UA 2H11A 2ZZKA 2BR1A 3FV8A 4E2YA 2BUJA 1KIAA 1E1XA 4APCA 4RTOA 1IM8A 4BP1A 3DXXA 4O86A 2DQ7X 3KMWA 4ZMEA 3BYOA 4MQ2A 3IDPA 1GIJA 1YXUA 5J9ZA 2RGPA 3UVPA 4BHZA 2Y4IC 3AQVA 3GT8A 2VO6A 3KR1A 3Q7EA 3LHDA 3IS5A 3GCPA 5LMBA 2GAFA 4C08A 3ZU7A 4J53A 4BB4A 4UWBA 3PRFA 3QAME 2GS9A 3H30A 2PV0A 1YFJA 1URCA 4RJ8A 1L3CA 4OTFA 4RFYA 4FKWA 3LCOA 5FDXA 4IVAA 3TKAA 4PNEA 3KEXA 3R9XB 5AV3A 2WMSA 1JTEA 1UA2A 4FA2A 2X1NA 3MTFA 2IWIA 2CKPA 3KK8A 1KSWA 3NSZA 4AA5A 3ZM9A 4X61A 2PXXA 3LDUA 3HEGA 5E2AA 3T3UA 1TQIA 4TXCA 4X0MA 3UMWA 4CMTA 3F61A 1ZKDA 2ITYA 3R30A 4GSBA 1YDTE 3SHEA 4DCAA 2J6MA 3DA6A 3QQGA 4EUUA 5JK3A 4Y95A 4OX9Y 3DK3A 1J7LA 3MPTA 2AN5A 4HCTA 3JWGA 2IBTA 3C1XA 1M14A 2B53A 3RNIA 3FC1X 3V5TA 2Z02A 3IOPA 2W4JA 3PDTA 3PE2A 3EVAA 5HCZA 2NXCA 5K01A 3IW7A 3O2MA 4I21A 1H1SA 2BCJA 2WPAA 4OGRA 5AP4A 3SA0A 4A9YA 2XYRA 3FLZA 5M4IA 3CY2A 3SG8A 2ZBRA 3CJQA 3NW9A 4KVZA 2QOHA 4GK3A 4IHPA 4HVSA 3QRTA 3QU0A 4RJ3A 5HU9A 4AN3A 1RI1A 2BILB 3NYOA 5F94A 3NUNA 1ZYCA 4O91A 2J4ZA 4KIPA 2BKKA 2PZIA 1CDKA 2UZNA 3OW4A 4GV1A 1L9KA 3O31A 4CXMA 3PXKA 5IU2A 3UPXA 3MH3A 3IYLW 1JLUE 4M0ZA 2BRGA 3OWPA 1AF7A 3HMPA 3MESA 5IDPA 2J0KA 4YZ9A 4ZK5A 4PNKA 1YVJA 3A7DA 3MA3A 1F3LA 2C6LA 5HI2A 1BMKA 2VZ6A 3FJQE 1QAQA 4JT3A 3N4VA 2ZFUA 3VRZA 3MIYA 5C9CA 2EB2A 5LVNA 3QGYA 4QMOA 3D2LA 5IH5A 4HGYA 2C6MA 3B3JA 4MXZA 3NW6A 4N6ZA 5CSVA 4FK3A 3EFJA 2A27A 3NAYA 2C68A 2GHLA 3KCFA 2R3KA 4V04A 2DUVA 5F95A 3UGCA 4TZRA 4MWHA 2CN5A 3PVWA 2OXYA 4ANBA 2ZV8A 4F7JA 2PLWA 3P2KA 5AIKA 3SSMA 5ETIA 4EH5A 1BYGA 2HZ0A 3I79A 3ZRKA 2ZV9A 3NWWA 4O7LA 4ASZA 4B4LA 3DTCA 5KMNA 2EWAA 2YWVA 5HU3A 3ER9A 4D0WA 1ZLTA 4U40A 3BPRA 5EKNA 3C4ZA 4FTUA 5KO1A 3OXZA 4WIHA 1SG9A 2FO0A 1YRPA 4FZ6A 1ZRZA 1PMVA 4YUQA 3TJCA 2JITA 4GUAA 5CCXA 3F88A 3G6HA 3KL8A 3QTRA 2VAGA 4OTIA 4TWCA 4C4HA 4DC2A 4DT9A 3R6XA 4FBXA 1NV8A 3SMQA 2F7EE 4KS8A 1RI3A 3NW7A 3BHHA 4TT7A 2I7QA 5A6OA 4EH3A 3OWJA 1YOMA 3QQLA 5AIRA 4B8LA 1VBFA 2Z2WA 4R7BA 3OCJA 1KWPA 1ZMWA 4WG4A 2GHGA 1G3NA 1P2AA 1O9GA 4EHEA 2A1AB 2BROA 3NNWA 5DE2A 3P78A 4XMOA 4ZJVA 2H00A 4R3CA 4E4MA 5M44A 2GU8A 2FK8A 5IQBA 4YZNA 4Y5HA 1H1WA 2OH0E 2QHNA 2V7AA 3F5GA 4WBOA 4B7TA 3FPFA 4AUAA 2JIVA 4ANSA 2PMLX 3VAPA 1UIRA 4TYEA 2B55A 2GHMA 2OSCA 4GUEA 4KUJA 2P35A 3UJCA 1WAKA 4JAIA 4K2RA 2Q41A 4X3JA 1XH5A 4O21A 4IZAA 4XCUA 3HYHA 2JLDA 3VBXA 5D1HA 1JSZA 2WU7A 3UG1A 3VBQA 5B2LA 5BVOA 4BY9E 3DT1A 2ZOQA 1DM2A 4NTSA 3Q2JA 3ZSHA 4JLCA 2V7EA 2XBAA 2GDOA 2WFYA 3EQPA 4J7BA 4O7VA 4OW8A 3ZFXA 3RK9A 4M8TA 1JVPP 4LG4A 5IEVA 4K33A 3B5IA 3CVOA 4RTNA 3W2RA 4D2SA 2HR1A 3BX5A 5DRDA 2P7IA 1SVUA 3RPOA 3DMFA 5FWDA 2UVXA 1B6CB 2CDZA 2O05A 3EKKA 3ODYX 4YSMA 4BLUA 1RDQE 4ERKA 4KSQA 5EM8A 1XBAA 3NR9A 1U59A 4HCVA 5DHJA 2WO6A 5HLWA 1ZYJA 2OXXA 4TYHA 3FTDA 2OF4A 4YUZA 3CGOA 4XJ0A 5KKRC 2GFSA 2PZYA 3UG2A 2ACXA 3G9LX 2W1FA 1P91A 4YP8A 3PX3A 3A7EA 3IECA 5G6VA 4GVAA 3WYYA 3ZO1A 1BC5A 1OGUA 4D4SA 3NJRA 4RVDA 2UYHA 1XH7A 3M1SA 3ZUUA 2AUHA 2X6DA 2R3LA 4XEYA 4UZHA 5I9YA 1N2XA 3OFJA 2IW9A 2CGUA 3HUCA 3QQUA 4O83A 4X3FA 5JZNA 3REPA 4HVIA 4MNEB 4IH8A 4NW5A 2UW0A 4O7RA 1IRKA 2OXTA 5HIMA 5F1ZA 5CLPA 4IAYA 3FKNA 3FZRA 4R7HA 5KMMA 1WZNA 4QYEA 3GI3A 4RWJA 4IDVA 4BRXA 3K6RA 3CTJA 3QQFA 4ZZOA 5TR6A 1XH8A 2UZOA 4ER7A 2BRNA 3HA8A 3F7WA 2HYYA 3UIMA 1XVAA 1Y6BA 3ALOA 4CLIA 4EOPA 4F9BA 5DM2A 2HWOA 2B0QA 3BIZA 4FSRA 3AMYA 2FVDA 2WA2A 5HEKA 3QX4A 2R3NA 4HPUE 2AOWA 4OA8A 5KYGA 4ACHA 3U8WA 2OJGA 2GSFA 3MTIA 3WIKA 1OR8A 1MRYA 4YZBA 5KMIA 3MVJA 2Y4IB 3C13A 3GU5A 4BBEA 2BZIB 3BU6A 5JQ8A 4NFMA 4YZDA 3TMAA 2P55A 3DS6A 4ZLYA 3UA3A 2YIXA 3FL5A 3PSCA 1OPKA 2XNPA 5D7AA 2GQGA 3QUEA 5IISA 4R5SA 1FQ1B 5AM6A 1GY3A 4C34A 4D4YA 5CALA 3QTSA 4ZP5A 4QTAA 3UQFA 4G3GA 1M52A 4FTNA 2WMWA 4DGLC 3REOA 5L2TA 2FSMX 4GKHA 4NU1A 4MNEA 3ULIA 2IBSA 2CWWA 3W2SA 2C1BA 4H36A 5LMKC 2CJMA 4YTCA 2QLUA 3UDBA
chains in the Genus database with same CATH superfamily
3O0GA 1QNLA 1MH9A 3FMIA 5BVHA 1QQAA 2I29A 4OA5A 5KQSA 4BNNA 3AEUA 5JSUA 4PDSA 4MV6A 4RENA 4JWKA 2XM8A 3S2PA 5K6AA 5EFOA 4PCLA 3RKUA 3K8ZA 3KKQA 16PKA 3PHCA 2OLCA 5MN4A 1W76A 2IYRA 1XJ0A 3ZHBA 3BEGA 3REGA 4OP3A 4V05A 4KVAA 1YR6A 3BGIA 5H3HA 4EUTA 4PZCA 2O8BA 4RKEA 3VHEA 2Z08A 3CPSA 5DG5A 5HTCA 4TVSA 1XMSA 4KIFA 3WIVA 3PC8A 4B17A 4PC7A 1GNVA 1XD8A 1K6IA 4ZSEA 2KYRA 3ACCA 1I44A 3IX7A 1ILWA 5DWDA 5BVKA 4ONEA 3HDNA 4B73A 4QU0A 1FYXA 5BY2A 1QTQA 3UMXA 1ZI6A 4Q9AA 4P4UA 721PA 4PX2A 4JEUA 5HESA 3OLQA 1GVHA 1VGVA 5JU6A 4POOA 5WRFA 4PY2A 2C2YA 1BD4A 1ZOIA 3L8CA 3GFRA 3DT8A 2OH4A 5ALWA 1V41E 3P94A 4EO4A 1V8FA 3TTVA 3L4BC 2PT6A 2ZJ8A 2VF2A 2RK3A 2IYEA 1DDOA 4O29A 1Y5NA 5JH7B 5JZ9A 3MGAA 4XRLA 4YDHB 2W11A 2PUIA 4PGGA 1H2RS 4ZRDA 2ZDQA 3OKCA 1CKEA 1GGEA 2NZVG 4PX5A 1G5IA 2VWIA 1WE2A 4FTTA 1Z2AA 5IAAA 1JXQA 1SCJA 4Q3BA 3I9KA 4MVCA 4M55A 4M0DA 3BCUA 4Z4EA 3PLNA 1TMGE 5E1SA 3NM5A 2QD2A 5DLSA 3T9CA 2AR0A 1MTOA 5TEWA 2Q6LA 3GC7A 3MTQA 1JLSA 2OZLB 4JSRA 2I9KA 4ZS4A 2HU5A 4O4LF 1Q57A 4D0RA 3V1NA 4F04A 4MGZR 1PGQA 1Q0SA 2G0AA 5EG3A 4E73A 4HVGA 1SHTX 1DZ3A 3I2KA 5AW9A 3LBHA 4RWKA 2PAAA 1YQ9A 5JNTA 2VEOA 1FMOE 4PTEA 3HP7A 3R71A 3ITEA 3CB2A 4JP5A 1OT3A 4XR9A 4BNYA 3T9TA 1BGVA 2ZB1A 4FTCA 4B9AA 1PHRA 5BR7A 3PNMA 5HVJA 1D5CA 3G2MA 4JOSA 1N6NA 4M9ZA 1K7EB 5JFXA 3UHPA 4HGEA 3HXMA 5ED4A 4I5DA 2D5CA 4EG7A 5HZHA 2GNHA 5JXIA 3OW3A 1VP9A 1O9BA 4DC9A 4EHBA 4V0MA 3A99A 2JAUA 3DKIA 4GPD1 1OL5A 2D3WA 4FLMA 1WX1A 3OT8A 1BHO1 3OCWA 1SC3A 1XD9A 3HVRA 5B7NA 2Z1DA 1CF4A 2JGKA 4PANA 3UFBA 1U8CB 3OJFA 2AEFA 3NYVA 2BL4A 4LDQA 5LZ9A 1QVAA 2F3UA 4LW8A 1QLJA 1OL1A 3KVNA 1YIDA 5DWQA 3OY2A 4MWTA 5LKAA 3ZGVA 5LZ2A 2RJ3A 5ER9A 4H18A 4ON9A 4O7SA 1WMEA 2A4MA 1ZD4A 1OU4A 2GCNA 3SZGA 1C7FA 5T4EA 4F0FA 3HM2A 3QUBA 2BMVA 4L9AA 1MN6A 1KDTA 3LPAA 1ZEMA 5I7AA 3I1FA 2OP1A 4FSQA 2RBGA 4FV2A 2QTTA 5DR2A 1YA4A 1FRFS 3ZOKA 4F5WA 1XNHA 4IM0A 3D7SA 3T94A 3FYCA 1H0WA 2IZUA 1K6XA 1FDWA 3E8EA 1E5DA 4K9MA 3QTQA 3GMSA 4BEVA 1PXMA 2EB3A 2WOTA 2FWRA 1O5OA 2BALA 4DQLA 4Y5QA 2VD5A 3C3DA 5TT0A 3OEHD 3ZCLA 5FYDA 2I6XA 5FXQA 2OZPA 2V55A 2P4QA 5IKMA 2B9VA 2BKAA 3ZLBA 2BMAA 2Q27A 3NGLA 2VDMB 5CZIA 1PT8A 1EVIA 1OXKB 1YSCA 2C94A 1WRBA 4RJTA 5D8DA 4I6GA 3UYTA 2BF4A 2GBGA 3GFBA 2FW0A 5GNKA 2EBHX 3OJOA 2UUCB 3FDIA 1NYLA 4GIBA 5J4KA 1L1FA 3CEJA 2SCUB 1IN6A 4K6CA 1WUYA 2J3MA 4GIHA 2FH5B 4QQTA 2OO5A 4KCGA 1L7XA 3IB3A 4DWJA 2JFFA 3DBQA 5BO5A 2VTHA 2CW5A 3ADCA 4X7MA 3EGDB 3RC9A 4AU8A 4B6FA 5A03A 3N86A 3MFRA 3OX4A 4MHSA 2IXFA 4BEBA 4OXRA 3G5UA 2QSJA 1UDBA 4U2BA 3GU4A 2NNLD 3ZXTA 5K8UA 1ZWLA 2YCLA 5GJVC 1SRRA 2CE7A 5IXSA 4KL8S 1XF9A 1E96A 5L4LA 2C8LA 2VA8A 1JKXA 2G77B 1C0KA 1RMQA 1YBFA 2ZV2A 4DR7B 1YL5A 1XGKA 3U62A 5HNIX 1KE8A 4J1RA 3GBZA 1H5UA 1U8TA 4EQ6A 2XBLA 1I9GA 1V8DA 4JR1A 1COWD 3CQEA 1R5JA 2IX3A 1IHYA 1GRNA 1U8YA 2VTAA 4MOWA 3NHUA 2G25A 5DCWA 4FICA 1V47A 2O8BB 5J59A 5HD7A 5KDOA 2GNJA 4XG7A 5FFFA 1XLUA 2WTDA 1DIOB 3ZHUA 3FMFA 4V0GB 2A3NA 1J7JA 4MUYA 3AC3A 1ZK3A 5J2UA 2YCRA 2YFXA 4RLKA 4U3JB 1XJ5A 2WG1A 2NPOA 4BIEA 1NBOA 4GO1A 5IT0A 3K1AA 1YA6A 2G2FA 4FR0A 3UZUA 4RDXA 3IR6A 1HG1A 1E7QA 3DFAA 5FBQB 2CNVA 1EJ0A 2HJSA 4B45A 3AVVA 3WJAA 5EE3A 4CTMA 1I3NA 1JMYA 2IUFA 4HMQA 5UKDA 3W90A 4FNOA 5EFQA 5J1VA 2HBRA 5LOVB 3NNXA 1UBSB 3S2SA 4WHMA 1A8IA 2DMRA 2EXMA 3SHVA 3X0DA 1ND4A 4KLRA 4I50B 4D4LA 1TLFA 4HG2A 2X2EA 5EI8A 3OO1A 2F8MA 2WD7B 5CT7A 3OEEA 4KS7A 2ISQA 4MHAA 1LDNA 4MKCA 4JGBA 1YZ3A 5JDCA 1K1EA 1VSQA 3NTQA 1E64A 3P86A 1KVTA 3A1DA 1QHHA 4MRPA 1WHSB 2ZREA 3AKJA 2RG5A 4FOOA 5EI2A 4ZSLA 3GELA 3F46A 3U17A 4TKVB 3WLQA 3GPBA 4XFDA 4XV1A 2CFOA 3OCCA 3MJ2A 4R9SA 3MMPA 1KHHA 4MB6A 2WQEA 5L7YA 3VZCA 2QRVA 3VC1A 4NMHA 4V3CA 4Z86A 4EWQA 3JCZA 2BUCA 5IVPA 4MVYA 1EU1A 1I1HA 1N6HA 3T1YB 2H0QA 2ZWMA 5GINE 1J1IA 4FGKA 4UBKA 1F5SA 4DNXA 4XLIA 3C8HA 3I28A 3IPAA 2XIXA 4UNIA 4HDMA 4AW0A 2C2KA 3Q7PA 4JT9A 3HEMA 3LUAA 3TKIA 4LUCA 4CT0A 1LUFA 1P4RA 3GARA 3EFOA 4KO2S 2G63A 3RYHA 1Q2XA 4AD8A 4Z0NA 3L7BA 3EWSA 3IESA 4FGRA 3UOGA 4KDRA 4LQDA 3F6XA 4MWCA 1DPGA 2FMKA 5CB6A 1V0JA 1JDZA 4FHEA 1BVYF 1J0EA 5BW8A 4UREA 3LI2A 2PZRA 4YMJA 2GX6A 4A9RA 2CLEB 2J3HA 5EJ5A 3GOKA 1CDZA 2YA9A 3D5UA 3ELJA 1O95C 1R6BX 2VPIA 4YZCA 2R2AA 3SYKA 1ZHHA 1PXOA 1RVV1 4AI6A 3K96A 4OGWA 1ZZGA 3HWWA 5LMCA 2C9DA 5E6RB 2MSEB 3TG8A 1KK2A 5LWNA 4EX7A 1UXHA 1GZ7A 4YYEA 1ZJ6A 1OFTA 1CRZA 2C3IB 4L16A 4MDHA 3MH1A 3MF4A 3DAPA 4QDUA 3E0QA 3UOKA 3K70C 2VLBA 3MGCA 5ALIA 3ZLXA 5AM2A 4KWTA 1JH8A 3TR5A 2OENG 2HO4A 5KC9A 1H4VB 4PPFA 3QA8A 4JI6B 4FYMA 3PVZA 1NJFA 4O25A 2NO3A 4NCNA 3TUIC 3MTBA 1NONA 2BBOA 1N2JA 4L9RA 3ZBUA 3ESBA 4AYXA 1ZP6A 4CQMA 5AVQA 2QR2A 2GD6A 1TM7E 3LFDA 2DECA 1VMIA 1IWPB 2YFYA 3C8ZA 3DDUA 3GC9A 1T2AA 1TKCA 1EXDA 2O7RA 5I7SA 2JFYA 3ANTA 4D82A 1XDBA 4KGXA 3T38A 4L8WB 4ZC1A 4BTEA 2QLBA 3B3FA 5HCUA 3A9RA 1BI8A 3QWJA 4LRJA 3NYXA 4NAVA 4D1XA 3IKLA 1DIBA 3G02A 3ZCPA 3O8TA 1SCBA 3AR4A 3DAKA 4MGKR 1PUXA 1JQDA 4RPKA 2L17A 4V0RA 1O4VA 2Y66A 3QY0A 1YUMA 3JQGA 3KJFA 4ZU3A 4RX8A 4BGGA 2XQJA 2VWHA 2JHGA 4E5AX 3FBVA 2O1WA 4TGLA 1S4QA 3TLJA 4EB6A 2R44A 4QRHA 1WMDA 1AV7A 4FMDB 2VTPA 2VN9A 2Q5IA 4DV0B 3KSDO 3QEOA 1G3IA 3WBKA 3A3NA 2QD5A 1XU7A 4LRXA 2IH5A 1FUEA 2IZ5A 2J31A 4PX3A 1KP9A 4XD2A 5KYWB 3T9IA 1VXRA 1SO8A 1GNQA 3EB0A 2J0JA 3BWYA 2HEGA 2B20A 3I5YA 2GZ1A 4NCTC 1E8NA 2QO2A 5L8VA 4UWCA 2E4WA 4RG0A 3O4HA 1K3FA 4XRJA 2X6RA 4PYIA 2XNDA 5HA5A 3IPXA 2XNGA 3KRRA 2OGZA 4UTZA 4NJDA 1FTQA 2F64A 2IYSA 2L82A 3HXPA 4FK6A 4B7AA 2QT1A 1FXWF 4QREA 1XBBA 1POXA 3BGPA 2KLHA 4EFNA 4O0XA 3MJ4A 3UDTA 3KQVA 3RM6A 3GEBA 1LFAA 2X5NA 4LI0A 5C8VA 1HE5A 2ATXA 4D8TA 3QXPA 1JEYA 4DDUA 5B7VA 1KJ9A 5HG5A 5B58C 3A9SA 4MZXA 3E9NA 4INZA 4JBVA 3IHLA 3GGCA 2JDVA 1J0BA 1RJFA 2HY0A 5L3ZA 3SR4A 3QG5A 2GXAA 4RVOA 1ICIA 1N2HA 3BH6A 3RVMA 4H4EA 4G5XA 1SH7A 2GESA 4OQEA 3V9PA 4F70A 2FLVA 4JT4A 4G1VA 5JCJD 1VPDA 1QDEA 2VPPA 1XJDA 1ZOOA 3GLQA 5J5CA 2BGRA 5I8WA 4Q3EA 5DXFA 3R09A 1RR6A 2P33A 1PNQA 2QE7D 5K3FA 1X2EA 3RVLA 4D4RA 3ENNA 2C4UA 1R9NA 2GOYA 2NU7B 1M7GA 4LZWA 3LKVA 4ZWNA 4BXOA 2LKDA 1Y80A 5IK2A 5BQ3A 3OUNB 4RZWA 4BF2A 4BB9A 4RXTA 3BSFA 1W52X 5FOWA 1TVOA 4TYQA 1TPYA 4J94A 5ERXA 1CUUA 3ZLSA 4FV6A 2X0EA 1U31A 4I6HA 1M5UA 1NP3A 4CL2A 3OD6X 4N5IX 4V0QA 1DDGA 4MK0A 2X1MA 5AHOA 4HPJB 5IMEA 1E1KA 4CWAA 3USES 4HW7A 3K94A 3U40A 4D1ZA 4ZIMA 3P2IA 2DCMA 1RT9A 5HX6A 4NMXB 1CJMA 1ZL0A 2VTBB 4QUHA 3CZ5A 3O71A 2KW5A 3HKEA 3EXHB 3EFLA 4OK5A 3QF4B 4AIRA 3BD7A 1PR9A 2VZLA 2HRRA 4Y1GA 1LWNA 3W05A 4YJ3F 3G51A 3BL9A 2MSKA 2RGGA 1V6AA 3HCCA 4YGYA 3C7DB 4MYUA 5HCXA 2XKDA 3UMSA 1Z5OA 1TK9A 3B2WA 5CAPA 3MOIA 2ZJBA 1Z4MA 1Y8ZA 3OBJA 3N3AC 2UZIR 1QS0B 4LNAA 2OKGA 3ODPA 4UASA 4XFJA 4RPHA 2DZDA 1ZESA 2HWWA 3QRIA 4DLIA 3MN3A 2IS4A 4L7VA 2XEDA 3WLNA 5I9LA 1GZOA 3CMMA 3D1JA 4M21A 1FVTA 2V6BA 3O4IA 1T3TA 4AWAA 1FA9A 3AEKA 4LRUA 3NM6B 2NVUA 4ETWA 3FMPB 4HVHA 3SBOA 3FUTA 2IOFA 2QQ0A 1MJGM 4I41A 1N6KA 2EOAA 3NFRA 4RT7A 4L73A 1H22A 1RAAA 4Q9LA 4R84A 1QWSA 2QMYA 5FEQA 1IZ8A 1J70A 3ANYB 5MFPA 4LC0A 1MMFB 2O52A 2NP6A 3TECE 1Z3IX 4XOYA 3MWJA 3H99A 4PYKA 2IXTA 1V2GA 5EP4A 3HWSA 3QFVA 1KYQA 1PRYA 2FPIA 1E3IA 3CPHA 3MTDA 5DX8A 3ODGA 1IWBB 2X0NA 2C4VA 4MS1A 3NDPA 3CEPB 4K9NA 4CHGA 3ZSGA 3WLHA 1PT9A 5DASA 2JHAA 3JZAA 4OBOA 3OPNA 3LT4A 2OR3A 2OJ9A 2DWUA 5L53A 5CNNA 3C70A 3AUSA 3UK7A 5I0BA 4DLJA