1G8SA

Methanococcus jannaschii fibrillarin pre-rrna processing protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
230
structure length
230
Chain Sequence
MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikshii Fibrillarin
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN
total genus 69
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1g8sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g8sA02
3AC4A 3LMGA 4DYMA 2XUUA 3THRA 3OCTA 4QMMA 5JUWA 4KB8A 4E5WA 3OP5A 4F7JA 3U8WA 2J0IA 4I5HA 4PX6A 2GNHA 1DCTA 3Q2JA 3QCYA 2W99B 3QKLA 3GU5A 4L7SA 2YX1A 3EFJA 3OWLA 2XEYA 3EQGA 2H34A 3GC0A 3W2QA 4BR3A 4O0VA 4CKJA 4XH6A 1BHJA 3OROA 3PDTA 3WF7A 4FSDA 1NW7A 4RVDA 5K5XA 4EOOA 3WF5A 2UZVA 2BHEA 2ZJWA 4RQVA 2F7ZE 3MGGA 5K01A 4ANLA 2XF0A 3UIXA 3CD3A 5DRDA 2VS1A 2YAAA 2VTAA 3C50A 4FK3A 4H3QA 1RI4A 5D10A 3VBXA 3SA0A 2XKDA 3QLFA 3MB5A 4U3ZA 2ZMDA 5E8SA 4NFNA 3ROCA 4E6QA 5IU2A 3EVDA 4OA8A 5DPMA 3UA4A 1KPIA 3BV3A 3JVSA 3OBJA 2QOFA 3Q3BA 4D9UA 4CGAA 3L8XA 5HTBA 3HL7A 4YMHA 4Z55A 2JJQA 3DFAA 2FVDA 2ZIFA 5DRTA 2R9SA 4UY9A 2YERA 3NCGA 5HBEA 3RPOA 3DQXA 3F5XA 3W2OA 2HMYB 1XJDA 5HHWA 3QOXA 2WOUA 2IH2A 3RCJA 2YIYA 4HH4A 3S3IA 3DXYA 3NWEA 5EIFA 3T3VA 2VZ9A 3UG2A 1XBAA 4ITIA 5EI6A 4CTCA 4Q9ZA 3BT7A 4JDJA 2YCQA 4XCUA 2XK3A 5FTOA 4CMOA 1FMKA 4CVAA 4LOQA 4RJ5A 2ZWVA 1FVTA 3N4UA 1L3RE 3D14A 2R3FA 3SQQA 1Z3CA 5IDNA 1I44A 5EYKA 5CU4A 4IZ7A 2WMRA 4FSUA 4RVMA 4EYMA 5AAFA 2NNWB 4DC2A 1U2ZA 4HRAA 3ZLSA 2OW3A 5JQ8A 3SOCA 1O9UA 5DN3A 5C01A 1E1VA 3FPGA 3C0IA 4H39A 2QVSE 5L2SA 3HP7A 3ZUTA 5E9QA 2JIVA 5P8WA 4DINA 3R3HA 4OTFA 4QNYA 2X0GA 3IG7A 1FPUA 3DXQA 4JAJA 2JFMA 2QOKA 4PONA 3PVCA 1KE5A 4D9TA 4X0MA 3W16A 2Y8OA 5F9EA 5K0CA 3ETAA 5CAQA 2C0IA 4FSTA 4FTUA 3OMVA 4GT4A 4N70A 2J0LA 5CZHA 4O7VA 1H1RA 5KMKA 3BGDA 3P9CA 5DOSA 4KUJA 2XNPA 4RLKA 4U80A 4CLIA 2ZYBA 3RJCA 3NGAA 4HW7A 4IX6A 1R18A 3A7EA 3E7OA 1YVJA 2PVHA 5AADA 2C6OA 2C30A 3HA8A 4BBFA 4A9SA 5B2LA 3GXOA 3MY5A 5BYZA 4BIBA 5EMLA 4OR5A 3EL7A 3G5DA 4H36A 3CGOA 3C4ZA 3CTQA 3EFWA 1H27A 2O8YA 3Q04A 5CVGA 5HIDA 3RZBA 3OOGA 3OW3A 4CLJA 4FKSA 5FULA 3D4QA 4JG7A 5CENA 3WI6A 2OFUA 3FUUA 2IVUA 4LFIA 4AW5A 2CMWA 2VWBA 4FZ6A 2I9KA 5DE2A 3GQLA 2RL5A 4HNIA 4DTBA 3QQHA 2X8IA 4N6YA 3SX9A 3TT0A 3TKAA 1PXOA 4NU1A 1V0BA 3F3TA 4FT0A 4NTTA 3SXFA 2O0UA 4DA5A 1MJFA 3I60A 1R6AA 3U55A 2OB2A 1BMKA 3BU6A 3JYAA 4QTEA 3HVIA 3E3BX 2ZDTA 5GOZA 3P23A 3NDIA 3R2YA 1PRYA 3NYNA 3F66A 4XG8A 4XRJA 4EHZA 1M6EX 4X1OA 2XEZA 4U45A 4KWPA 3DZQA 3ORHA 3THBA 4D58A 3NUXA 4ID7A 3UTOA 1G8SA 3EHAA 3V5WA 2P3LA 4L42A 4ZAUA 2PVLA 3I6UA 3ORMA 4X3FB 3WZKA 2WIHA 4EH6A 1HCLA 3N51A 5CVJA 3KR2A 2WU7A 4RX1A 4LRMA 4RX9A 3TJDA 1SM2A 3TZMA 4PQNA 3CY2A 4M37A 5T64A 5K0EA 3OFMA 3KQ7A 4ZEGA 1H28A 2E9NA 1UWJA 3QKKA 5K4JA 4RPVA 5D1JA 1PW2A 3DLCA 2YDJA 2XNOA 4X2JA 3PX2A 3IDPA 1GIJA 4EHGA 2PV0A 2IW6A 4K11A 2G01A 5T6KA 4FA2A 4KAOA 1GOLA 5AM7A 4DFBA 4DN5A 1WVXA 2I0HA 4MYGA 2UZ4A 4E7WA 1YOLA 2WAJA 1JPAA 1HOWA 3PJ8A 5EZQA 3PWDA 5A4LA 4O38A 5L6PA 5BUJA 2DUVA 3LCCA 3OE5A 3V8WA 2AN3A 1OPJA 3BGZA 2OBFA 3P9KA 3SVZA 3EJ1A 2B7AA 3HX4A 3IPHA 4GMYA 4Y30A 3VW8A 3MSSA 4FICA 1X19A 5M4UA 3DP7A 3DMFA 2V7EA 3AXTA 3MTIA 5JZNA 5ICPA 2CKOA 3BV2A 1RW8A 4E6AA 5B2MA 2BIYA 4RTSA 5A3XA 1QAOA 5A4EA 5DRYA 5EI8A 4C37A 5BVNA 4LV8A 3PIZA 3GU3A 2QG7A 3D5VA 4R7BA 2GA9A 4PWYA 3FTFA 1GY3A 2IP2A 3LGAA 2QOBA 1OUKA 4CRSA 4II5A 4EONA 3TI1A 2AOTA 2R3LA 4YSMA 3FHIA 3RHXA 4GEKA 5LVPA 3GU7A 4ZMEA 3BX5A 4KSPA 3UO4A 3FUVA 3KQYA 2XJ0A 3OCBA 2PK9A 1JKTA 1NXKA 3PY1A 1CSNA 3QCQA 2XIZA 4BZOA 4GFMA 5HE2A 2WELA 1YI3A 5E1EA 4EH7A 3DY7A 4N0SA 5DBXA 3TV6A 3R9DA 2XNNA 5J5SA 2XM8A 3PSBA 5TR6A 3FMKA 4B9DA 4YR8A 4CKRA 4UX9A 1ZOGA 5KNJA 1FP2A 3FUXA 5FA8A 5IH5A 2WK1A 2VWVA 5EYCA 1ZZLA 4C4HA 4QMVA 2OFVA 5J9LA 2GH1A 4ENYA 5CSXA 1Q8UA 1SYKA 2ONLC 3MDYA 4YV0A 5LVMA 2FCAA 2PULA 4HGSA 5BMSA 5HTCA 5KE0A 4EJ7A 2F8LA 3O50A 4F6WA 2BFYA 4QMZA 3LQ8A 2W1ZA 3ET7A 4NJDA 4YC3A 2BZKB 2NRUA 2YIWA 3PRIA 4RZVA 2O05A 3A26A 4L7VA 4UYAA 2W4OA 4XG9A 5JGAA 1H4LA 3I1AA 3OT3A 1JSUA 2FB8A 5EOBA 5FWAA 4R6WA 1UNLA 5DI1A 1REJA 1YOMA 2J4ZA 2PSQA 2QR7A 3BKBA 4FKUA 4GKHA 4HZRA 2ZV8A 4K9YA 4QP1A 4D0WA 3TG1A 5IH4A 3HCDA 4CKIA 3P79A 2UZOA 4X2FA 5HVKA 3UG1A 2BRHA 4BDBA 4NK9A 5IA3A 3FI3A 3HVJA 4S34A 3UYSA 2YA9A 1Q99A 3PUPA 4W8EA 3FXZA 5C9CA 2QLQA 2WMWA 3MW1A 4HCTA 2IJMA 2YZLA 1XBBA 3ELDA 5AUZA 3Q5ZA 3QTSA 4I3ZA 4L67A 1OKZA 3MV5A 3QU0A 3MY0A 4GFOA 2FUMA 2VTNA 2YAKA 1XVAA 5ETCA 3W32A 3A7JA 3SRVA 2B54A 3NYOA 2Y1WA 3CCNA 3GENA 4B4LA 3FRHA 4IMYA 3EN4A 5LWNA 2GLUA 3IW7A 3LCUA 1IR3A 2C7OA 1PHKA 1U5QA 3V5JA 3ORXA 3FYDA 4YO4A 4GF5A 2JDSA 1BI8A 1I09A 2JIIA 2V0DA 3MH0A 4Q9SA 2C1BA 3VBYA 3W8QA 4BZNA 4U97A 4DEAA 3NLBA 4BDEA 3R1QA 5IA4A 2HWKA 4MNFA 3E8NA 4TWPA 2IH5A 2YTZA 2B9FA 5HZMA 3ERCA 5DRBA 4WA9A 4RX7A 1EJ0A 3P2EA 2YVLA 2AUHA 4E73A 1X1DA 3LKDA 1ZGJA 2WNTA 2A2AA 4L68A 1B39A 3DXXA 2O64A 3BHTA 5GJFA 1OL2A 4TTHB 2WTWA 1XO2B 3W2SA 4BCJA 3M33A 4DZRA 2Y6MA 3V6SA 3BYMA 4DH5A 2HV9A 3JWHA 5AA8A 3PY3A 3NNXA 3TV7A 1APME 4FV1A 4ZJJA 2FSTX 3A27A 4I21A 5I0BA 3SX0A 4FEUA 4F7SA 1NT2A 3DDQA 4EOIA 3DR5A 2FGIA 3UVRA 4P90A 2ZTHA 2YM4A 4CZUA 1DL5A 4TYGA 5LR6A 5H2UA 4X2GA 2UW3A 2O57A 3AT2A 4F1TA 5E1MA 2EXMA 2ITVA 3REOA 5HO8A 4IJ9A 3RTPA 3ZO1A 4UZDA 3CBGA 3OPNA 3UFBA 5ITAA 2YJRA 1MRYA 3LOKA 2WMXA 5DYJA 1Z57A 4DGOA 2OXTA 3I53A 4GK2A 5K0GA 3R9XB 5IQHA 3TUDA 4BCKA 5K9IA 2CLQA 3FMDA 2B0QA 4C2VA 1MHTA 2GQRA 4AT5A 3GRZA 5A46A 2OJFE 3K0BA 3GOPA 4ZY5A 3R73A 4TYHB 3VIDA 3AC1A 5M4IA 4ZSEA 4DEGA 5D41A 3FRIA 4J99A 3ZHPC 5CU0A 3TKUA 4FT7A 3HKOA 3LJ0A 3AD5A 3JPVA 3QGWA 4AA0A 3QD2B 4YHFA 4CNHA 1JSVA 2CN5A 2ITZA 5ANKA 2X7FA 2ITPA 4PGHA 3DTCA 3FY2A 2WMUA 5GJGA 4AAAA 1AQ1A 5ICGA 4HGEA 2OLCA 3U54A 4C4GA 4U41A 3FPEA 5DT3A 5HE0A 3OCGA 4QMXA 4X41A 3H0YA 3P9NA 2FRXA 3UBTA 2C47A 3FJQE 3CQWA 5DR6A 5CSHA 5IG1A 1BUHA 4YJSA 5E7RA 3G0EA 2WQBA 3L9LA 5CLPA 4NKSA 4APCA 3F5PA 4NIFB 2AN4A 3P9JA 4RMZA 2PWYA 1A06A 3TDWA 4R8SA 3QGYA 4GFGA 1CTPE 3LDUA 5CD1A 2G1PA 2EJTA 3PP1A 4EUTA 1YWNA 3E8CA 3K54A 4G6LA 3CGGA 5J87A 3FZGA 5F95A 3KQTA 3NPCA 3ZXTA 3ZXZA 3BZ3A 2H8HA 2XJ1A 5EW9A 3GWZA 4A4OA 5L8KA 4AW1A 3L1SA 1BLXA 4H3PA 5C8MA 1ZGAA 1J1CA 3JUHA 4GVAA 2PGXA 2XBJA 3LE6A 4O0TA 4A9YA 4DH3A 3GB2A 4I6FA 5A4QA 1T46A 2FK7A 4LOOA 4AOTA 4FSRA 2VTOA 2Y6OA 4XBRA 5AM6A 4BGGA 4X21A 2CMGA 4AACA 3C4WA 4IAIA 4GT5A 1Q0TA 4EBWA 1MRUA 3NTVA 1JSTA 3RMFA 4YZNA 3BE2A 4YJNA 3BHHA 2ETKA 3LCOA 1IAJA 4X3JA 3MJ2A 3ELUA 4USDA 3NAXA 2F9GA 3QXPA 3E88A 4HPTE 3HLLA 4A4LA 5H3QA 5GM2A 3KMUA 4RIWA 1KUTA 1ZYSA 5DA3A 4CXAA 3EEYA 4JI9A 2J0KA 4QYHA 2A14A 5HE1A 2YR0A 4DMGA 5E8ZA 1J91A 5D7AA 2P3QA 5AJQA 2BKZA 3BYUA 3TNIA 2FPOA 3G0FA 4ZMFA 3KCFA 4V01A 4DGMA 3HNGA 3I81A 1OECA 1BKXA 5L2WA 1JKSA 3AC2A 1PJZA 1ZOHA 3I9FA 3ANXA 4EQZA 2JBOA 1NKVA 5CSWA 2WEVA 5L8JA 2YHVA 3NSZA 4E6CA 2BILB 4O6LA 4R6XA 5JFXA 2G1TA 3CEKA 2CKQA 4BDDA 5CF6A 4IB0A 4MCVA 2JKOA 3BHUA 4FEVA 2ZM4A 3ORLA 3QF9A 4O7SA 1JSXA 4IH8A 1F3LA 5EKXA 2QG5A 3D15A 2ZIGA 5LMAA 4E4XA 4CWAA 3MIAA 1KE9A 4DG3E 5EDPA 3LXPA 2VP3A 3DJ6A 3RK5A 3WYYA 4OBQA 4EZ5A 3R01A 3QXOA 4L8MA 3PWYA 3T9TA 1H1QA 2BDJA 2WZJA 2W1EA 2UZWE 4EK9A 2PVRA 5HKMA 3ZRLA 4TPTA 4QRCA 4DF3A 5M57A 4EHVA 5DTMA 2BRNA 3LCVB 3C0HA 5HVJA 2OB1A 2VX1A 3KMMA 4PDSA 5CEPA 5JT2A 3L8DA 4FSXA 1OL1A 1H24A 3UA3A 3FQEA 2X4ZA 4O21A 3UNJA 4A4XA 1YRPA 2YIQA 5FBNC 1OI9A 1HCKA 4ZTMA 4ACDA 2UW8A 1XDSA 3QYZA 4G56A 2JFLA 3DQWA 1UU9A 5IZFA 5DX1A 5KS2A 3BYVA 3E63A 5ETAA 4AA5A 5DTRA 3SXJA 1IM8A 5AP2A 3KQQA 4HGZA 3E5AA 5AP4A 3NS9A 3POOA 3FLQA 2X9EA 2VTJA 2YCSA 3ITZA 3DOGA 4K0YA 2P7IA 4WUNA 4GUEA 4HYHA 5K0FA 5TKDA 4V04A 1PMEA 4I1ZA 4M15A 2UVXA 4FSWA 4B7TA 3C3PA 3KXZA 5EHGA 4UZHA 5AP3A 5HG8A 5E9JA 4PMSA 2YWVA 3F3VA 3FSKA 1V0OA 4GVJA 3WF8A 1H25A 3BLQA 5HIEA 5AP0A 3E8EA 3OS3A 5EQYA 3WOWA 3DXZA 2OIDA 4I0SA 3B3JA 3HMIA 4NSTA 5EZSA 3ZCLA 3G2PA 1M14A 4FEWA 3ID6C 3VBWA 4P7GA 3SGLA 4QQCA 3F88A 2X8DA 1WBSA 1M52A 1R00A 5CU6A 3PZEA 5E8TA 4NZWB 4WNMA 5DWRA 3W2RA 5I9VA 1QAMA 4QYYA 2P41A 3AXSA 1MRVA 4M7RA 5GM1A 3TKYA 2QU6A 5A6NA 4ALVA 1WBPA 1EH4A 2A4LA 3CR0A 1O6KA 3VBTA 4MHAA 5CUQA 2AC5A 5E9EA 4ZTSA 3FTDA 4M0ZA 3AY0A 5LQJA 4X61A 4FIJA 4ASDA 4FX3A 2J2IB 1XQZA 5FA5A 4XNEA 3BYOA 3ELWA 3FPJA 4DM3A 3ZM4A 3N9XA 3LLAA 2EWAA 4EC9A 3MS9A 1ZRZA 2ZV2A 4IAAA 3MH2A 2VD5A 2ZM3A 3BU3A 1XH7A 2PU8A 4XYFA 3VS3A 4AZVA 4YTCA 4XUDA 4CKCA 4E2YA 5BW5A 2XKCA 1JOWB 2WMQA 2QI8A 4KBCA 2IFTA 3UZTA 4B6LA 3GC8A 1NVQA 3D5WA 5F4NA 4HNFA 3VVHA 5HCYA 5EPEA 5C4KA 2JDRA 4MWHA 4RWIA 5HG5A 3OOMA 3NW7A 4CMUA 3GIWA 5CQUA 1L9KA 5LQKA 3HV7A 4FIFA 2W17A 3CTJA 3NNWA 1G8AA 4FKGA 3UZPA 2W1IA 4KRCA 5DEWA 2UYHA 2VN9A 3KN5A 5CU2A 2ZCJA 4J1RA 3DK3A 3G89A 1NVSA 4LWOA 4KSQA 3GU8A 2BAKA 3GI3A 3DBDA 4ALUA 3FPHA 2CGXA 2ITOA 3B5IA 4U40A 2R7BA 3E87A 4HCUA 3GQIA 2BR4A 4DKJA 4DGLC 3CTHA 5CT7A 3HA3A 4EZ7A 2I6LA 3ORZA 3GO4A 1XBCA 2QURA 3LX6A 4O7WA 2ZVJA 4ERWA 5KCVA 3CVOA 4KIFA 4YJPA 2BR5A 4F9CA 3LZBA 3OXZA 4PF4A 1AV6A 4YJRA 2HCKA 4PYJA 4ANMA 4UN0C 3QQFA 5C9ZA 2G8NA 3THSA 3HP5A 5H8GA 5BVFA 4HPUE 4XEYA 5E91A 2UW6A 4FTKA 5AEPA 2IDKA 3KKVA 2VUWA 3FI4A 4J7BA 4QOXA 2UZBA 4JDKA 5D12A 3TQSA 2HY0A 5L2IA 2YCFA 2P7HA 3LPBA 2IW8A 2NXEA 2G72A 4FKJA 3PSDA 2OZOA 3BUSA 2QOLA 2VRXA 4W8DA 3UIUA 2K4MA 4IWNA 4DLIA 3RGFA 2YEXA 4QDJA 4OT6A 5EC8A 1G5SA 2YIRA 5JN2A 5CVEA 4L3LA 4PCLA 4FNZA 2BAQA 5BUIA 3LLTA 4FOBA 1RJDA 1S9JA 1Q8WA 3TZ8A 3C13A 2ZULA 3VO3A 4O7TA 4A7CA 2EU9A 3QQUA 4FSYA 2H11A 3FMLA 3MH3A 2QYOA 1XH8A 1M17A 3A25A 4UV0A 3CQUA 3ZYAA 4ER6A 3R1NA 3QQLA 4U79A 3RPRA 4DE4A 1R1WA 2F49A 1SQFA 4ZSAA 3OY3A 2IPXA 2CGVA 4IWPA 1K2PA 2YXEA 5DLSA 4RC4A 2GQSA 3COMA 5BVWA 2J50A 1OIUA 4MNEB 5EHLA 2E9PA 3OG7A 3CIKA 3MVLA 3R8LA 1RI2A 5AWMA 2AOUB 3F3ZA 3MJ1A 4KDRA 4O2ZA 3GC7A 1P1CA 4APPA 5FHQA 1UU3A 4XG6A 2VWXA 3OCSA 5IA2A 4A6DA 5LCJA 3FKOA 2WOTA 5HE3A 2B9IA 2VU3A 3LFEA 4R5SA 3DLIA 5KZ0A 4PNIA 5LJJA 4RIXA 4NM3A 4M67A 3SR4A 1WAKA 1LPUA 4HVDA 3U4WA 3R2BA 5J1WA 2NXNA 2BTSA 3OBGA 3ZC5A 3AQVA 3CSVA 4NKAA 4V0GB 1AGWA 2DWBA 3IW4A 5GNKA 1JQEA 3NYXA 3QWJA 3MVMA 2WTKC 2OBJA 3ZDUA 5JKGA 3CD8A 1AD5A 3OY1A 4ZSJA 5HEZA 4LM5A 4BCGA 4QQKA 5HLNA 3FZSA 1SUSA 4C59A 2H6DA 3MFSA 4BYIA 3UIMA 2JH8A 2UYOA 5IMXA 4UWYA 1RI1A 3EQFA 3TWJA 1FMOE 4Y5QA 4YZCA 3R22A 3H0ZA 3FMJA 4F7NA 3DTNA 3CKXA 4ACCA 4FZAB 3EOCA 4GS6A 2GS6A 5FXSA 3TRKA 5LQNA 2WA1A 4IZ5A 1GZ8A 2PBFA 5KMIA 2X8EA 2XK9A 1WBVA 4KW7A 3KREA 4MF1A 4OTRA 4QPPA 4F84A 4CFWA 2P3GX 4ACMA 2WMSA 4JRVA 2XS0A 4MD9E 5IQGA 3QZHA 1ZOEA 2R3GA 3LFQA 4GW8A 4U8ZA 3Q2MA 4I5CA 3V04A 4FV8A 4C2WA 1BX6A 2XNBA 3V5QA 1YXTA 5DT4A 4QMSA 4HVSA 5F2NA 2E9UA 3V51A 3Q4TA 2P2HA 3F9NA 1WS6A 4EKIA 1OITA 3HTXA 3DT1A 5DX0A 4AWIA 1BKYA 1YHVA 4JXJA 3VUGA 3NUYA 2E2BA 3OZ6A 3UJCA 4MIKA 4FIHA 3ZH8A 4ALWA 1H1SA 1EJ6A 4DH1A 3RP9A 4O0RA 5LOHA 2QHNA 3Q52A 5L6WL 3R8MA 3BU5A 3VJNA 2OJGA 3VS0A 4YUQA 3LCSA 3VC2A 4LMUA 3VULA 1H01A 3OVVA 3G6GA 5DVRA 4TN6A 3FKNA 3DK6A 4PWNA 4RJ7A 3DAEA 4RVHA 2ZV9A 1KSWA 3REPA 3E64A 3VQUA 4RVFA 4YMGA 4K6ZA 4F7LA 4YV2A 3EEOA 2Y9QA 3LXKA 3VUHA 1LR4A 1FPQA 3KQPA 1GIHA 5FG8A 4MQ4A 2PVKA 2C68A 4WNKA 2IDJA 3C4FA 4ANBA 3LL7A 4G5JA 3Q60A 1QL6A 4NUSA 4QTDA 4JDIA 4YU2A 4J71A 5KHWA 4FVPA 1JG4A 3ER8A 3CJRA 4BI1A 3UPXA 3EVEA 3DB6A 3R0TA 2I0VA 3H2BA 1VQ1A 2EUFB 2XK6A 3OUKA 5K4IA 3IO7A 3PLAE 1Y6AA 3FLYA 2HENA 4JVGA 4KIOA 5FLFA 3TDVA 3TJCA 4ZZNA 3TPZA 3JVRA 5EKNA 2BAJA 4O2PA 2Y1XA 4DA4A 1UFKA 3B8RA 4I6BA 4KRDA 2X2MA 3Q87B 4FIIA 3RM7A 1JVPP 2OXDA 1YXXA 5M4FA 2PZ5A 2YM8A 3C5IA 3GCPA 3NUAA 4GT3A 4XRLA 3SKCA 2B9JA 3JXWA 5F2KA 5HILA 3ENMA 4JDHA 4Y46A 3GOKA 4O7ZA 4IV0A 3FUWA 5MHTA 5EGSA 4OTGA 2CL5A 2CSNA 4NH1A 5TO8A 2X6DA 3GUBA 3TACA 2HXQA 1G60A 3BPRA 4DBNA 4K1BA 4OW8A 5DEYA 5E1SA 2VNWA 5CEKA 5G02A 3QD3A 4J52A 1YOJA 3JY0A 3UBDA 3G2MA 1E1XA 4FODA 2C7RA 5A9UA 1B42A 4YBJA 1WBNA 3KK8A 2WD1A 5DR9A 4E33A 4CSVA 3RK9A 3QUEA 4LRKA 1DAYA 4ARKA 1FINA 1VPTA 2RIOA 3QRKA 1TQIA 2ADMA 3GNLA 3N4VA 4H58A 5LVOA 4HTFA 1ZY4A 3I0QA 1KYZA 4QT1A 3AWIA 3ACJA 3Q9XA 1F38A 2C6TA 4YUWA 3CJTA 4FZFB 5E8XA 1XDZA 3DOUA 2QM3A 3UZUA 3QYWA 3QD4A 4NW5A 3H10A 4NM7A 1OPLA 3UGCA 3VBQA 2ZB1A 3P7AA 2ITNA 2XB7A 4GV1A 4JRNA 4DITA 2E5WA 4FG7A 3EMDA 1J7UA 4QNAA 5CEOA 4MD8E 4LWPA 2HZ0A 5AV1A 4RWZA 4E93A 4R1YA 1KE8A 4RWJA 1D2HA 1BL6A 3ER9A 3EVGA 3HRFA 3OUNB 4F9YA 3R30A 3A8WA 3O8PA 5BXYA 3C7QA 2JBPA 2YM6A 1Z9XA 4Z3VA 1F0QA 2UUEA 4AW0A 1M2QA 2UVYA 3OC1A 3S00A 3U6IA 3UJ7A 1ZWSA 3R71A 5EG3A 2LGCA 4U42A 4XLIA 5GIOE 2IO6A 2YDIA 3ORTA 3R7VA 3E7PA 4KS7A 1H00A 3IECA 4JR7A 2YQZA 5DM0A 3GGFA 3VBVA 4NJ3A 2JAMA 2PVCA 2JC6A 4HG2A 5T67A 4L53A 4Q5EA 4JQEA 4F1OA 2VTSA 2J51A 4OGRA 2G2HA 4E2WA 4U7TB 2PE0A 1N7IA 2JLDA 5FWDA 5HX8A 5HNBA 2W1CA 1F5QA 2BR1A 4JG6A 5EW8A 3EWHA 1NY3A 3ULZA 3Q4UA 1JBPE 2HXLA 3G2QA 3UDBA 4BRXA 4O82A 2B55A 5E8JA 2R2PA 2XIKA 2VNYA 2XCHA 5K3YA 1G55A 1PMVA 2BZIB 2CKEA 4YC8A 2HR1A 2O2UA 3BCEA 3K5UA 3KXGA 5LSAA 3KXHA 3Q32A 5EKOA 3QTWA 4MD7E 4M68A 4Q2AA 3QTZA 4GIIA 5AUYA 3U9CA 4F9WA 3KK9A 5D1NA 3WIGA 4YV1A 1VP3A 2PY6A 4QYFA 4CTKA 4P7KA 2CNUA 3PSCA 1YWRA 3FPMA 2AOWA 4AS0A 2Q0NA 4EK5A 3KFAA 5FD2A 3HZTA 4PINA 3AMYA 1H0VA 3QCSA 4IHPA 2OSCA 5FUTA 5IQAA 3PPKA 5CEMA 3D94A 5EKUA 3FMHA 2ITUA 4Y2HA 1OZ1A 1FVVA 2WGJA 4O0UA 5M06A 3C4XA 1ZZ2A 3FL5A 4JR3A 3G33A 4LUEA 4FKTA 5J9ZA 3FXWA 3KF7A 5AUXA 3W18A 4JIKA 4U7PB 3QX4A 5IA1A 1RJFA 3OTUA 1H08A 3JWJA 3QA8A 3KCKA 2W9FB 3G9NA 2BZJA 2UZTA 2GNFA 4FV2A 4YLKA 3V8SA 1SVEA 3U6JA 3ATTA 2VV9A 3EQHA 1KXZA 7MHTA 3KQSA 2IZRA 2ZLBA 3PVGA 2QRVA 4DCMA 5FM2A 3FBVA 2GCDA 2PE2A 5HQ0A 1YDSE 1N2XA 4PYOA 4OX9Y 2PXCA 3VF9A 3LMHA 4I5MA 1R78A 4WBBB 5AFVA 4OTQA 3MERA 4MWZA 3KB7A 3KVWA 3H9FA 3GRUA 4PYQA 4BLWA 4QDKA 5AP7A 4H1JA 4DFLA 3SC1A 3G8BA 2DS1A 2JKQA 4FT3A 1MP8A 4RIOA 3B89A 1MQ4A 3QHWA 2AOXA 1UIRA 2FH9A 4MXYA 4FG9A 3Q6WA 4NL0A 1GJOA 3PY0A 4H1MA 2PZIA 3R9HA 3D5UA 3VRZA 3ZONA 4A06A 4IB3A 5IEXA 2XYRA 4AUKA 4X2NA 3ANRA 4XJ0A 2J9MA 1ZKDA 4YUVA 4MEDA 2JH9A 1DI9A 2XA4A 1JKLA 3R6XA 2PMOX 4G31A 5AX3A 3O17A 3NMUF 4IVDA 4B8LA 3EVZA 4L01A 4G1WA 3MN3A 3OWKA 1OKVA 5AX9A 1W83A 4CFUA 3BGVA 4M97A 2JGZA 4FSQA 2IZUA 4ZTLA 4JBPA 4A9UA 4IFCA 4Z9LA 5FBOA 2XBAA 3OEFX 4RFMA 4BVUA 1BOOA 3IDBA 3V8VA 2QOCA 3TTIA 5HFJA 2C6MA 3QWKA 4HJOA 3IHTA 4H05A 2NP8A 3MHTA 2PZRA 5CASA 4WIHA 5B1SA 2X4FA 3M6UA 4GYIA 3ERKA 4RG0A 2KULA 3PXQA 2BM8A 4LECA 3BQCA 4EMSA 1PXNA 1SVHA 4GJ2A 5JRSA 4JL9A 4C4JA 3D7TB 3S2PA 2WXVA 4IE9A 1ZMWA 4O0WA 4AZTA 5FTWA 4YC6A 3U9NA 4BB4A 3UO5A 4L9IA 4O0SA 3DV3A 4C3RA 3CPBA 3OWPA 3ANQA 4YZ9A 3VJOA 2O0LA 3FI8A 1Z5MA 2XKFA 2C69A 3DFCB 2VWUA 1TW3A 2ONYA 5CM2Z 2PX4A 2V7AA 4W4XA 4PTCA 4J8NA 4E2ZA 2XYUA 5KBRA 5DH3A 5KKRB 3IV6A 3WZEA 3KULB 2NPQA 4FV3A 4RC3A 3ZLYA 3NW5A 3R9NA 3I7BA 4BTJA 5EMKA 4R5YA 4ISCA 2PSSA 3BWMA 1ORHA 3OZRA 1J7LA 2QOQA 3UQFA 3E62A 2NRYA 3KR0A 4FS8A 3TOSA 4BC6A 3GGDA 1EQAA 4RVTA 2GFSA 4AF3A 5HLWA 4AGDA 3UQGA 4PL3A 2ERCA 3PX3A 3NZ0A 4QVGA 5EQJB 4ZY6A 4KNBA 3AC5A 3BEGA 3BHVA 3PFGA 1SZMA 1UA2A 4FK6A 2YDKA 4FV9A 2UW0A 2UZUE 4YNOA 3VC1A 1B6CB 4IWDA 1OMWA 3HDMA 5EQPA 1NW5A 1KYWA 3I79A 2VTQA 4R3CA 4WRGA 4XS2A 4YSJA 4OA5A 2BTRA 4PDPA 5CY3A 2R64A 3DKGA 5C8KA 4OUCA 1GNGA 4FTJA 4O0XA 4M7IA 3GU6A 3HVCA 2Z7LA 4GU6A 3UE4A 1KWPA 2XKEA 3QHRA 2P0CA 4RJ8A 4U0IA 3MPAA 5IUHA 3BWFA 1SNUA 2P3OA 2UYQA 5M08A 3UOLA 4CMTA 4XMOA 4XOZA 1R74A 2NXCA 1V0PA 4JT3A 2PJDA 1MQBA 4GH2A 4PMTA 4AG8A 5IISA 4RZWA 4MTAA 1VBFA 5M55A 3P97A 3IONA 4TWCA 3FMMA 4WRSA 2RKUA 2YZAA 2XK8A 4YPDA 5DGZA 4EKLA 4RJ3A 1QYRA 4CT2A 5LMKA 3A7HA 3DKCA 3EQPA 4MBJA 4RX8A 4PP9A 3TNPC 3EYHA 3QA0A 5ANGA 2BHHA 4S32A 4UYNA 3QRIA 4FTRA 4BBEA 4EC8A 1U46A 4NW6A 4RVKA 4YTHA 4C08A 3HP2A 5GP1A 8MHTA 5EW3A 5AIKA 2KW5A 4DFZE 1L3BA 1QAQA 5HO7A 4V05A 3O7LB 2OWBA 4B0GA 3TTJA 3NR9A 4FC0A 4WD5A 3DDPA 1VR2A 3LJ1A 5F20A 2W5BA 1RI3A 3LFFA 3RNIA 2BZGA 5TT7A 2FSMX 4UEUA 4AN3A 4F0IA 2ZSUA 1U4DA 4DH8A 4FTLA 4I41A 4I22A 5E9WA 3OFKA 3DXPA 3QZFA 1XH5A 2IWIA 5ANOA 1YZ3A 5HEKA 5J95A 1EG2A 3R7OA 1W8CA 1JAMA 2OO8X 5BMMA 4WXHA 2QLUA 2RFDA 4FIEA 3T7RA 1J3HA 2X2KA 5HIMA 2OYRA 3MPMA 1IRKA 5HG7A 2B4SB 3GP0A 3ZS5A 4O96A 3AGMA 1FOTA 3HAVA 5HX6A 2ESMA 3HVKA 4DQ0A 2Z7QA 3UNKA 2VZ6A 1XJ5A 3TN8A 4I20A 4FNYA 5FQOA 3O0GA 4O81A 2BIKB 1KV1A 2CGWA 3ODZX 1O6YA 2QO7A 3FUPA 4FEQA 4QPSA 4BICA 3TUBA 2WMAA 3O4FA 4PIMA 1ZAOA 2R3JA 1FP1D 5EMMA 2XIRA 4CD0A 5H8EA 4EI4A 2YACA 4ZJVA 1Q62A 3KN6A 1SG9A 3KXMA 2PWLA 4I6QA 5HGIA 2JHAA 4GUAA 2CCHA 3W10A 1JR4A 2H96A 3R9RA 2C1AA 1R0EA 4BIEA 1YXVA 2OXYA 3PVWA 3Q9YA 2B25A 4POOA 1AF7A 4IQ6A 4K2RA 2G70A 2O65A 2UZNA 1JWHA 3PIYA 5BVDA 4OQDA 3COKA 3TFWA 5FGKA 3TV4A 4L3PA 3QRUA 3ZRKA 2F4JA 4C02A 4PDYA 3R8ZA 3UJGA 5FCDA 5ANDA 3CY3A 2GTMA 3L9PA 2E9VA 4EK6A 3UJ8A 3F6XA 4E5BA 2B9EA 3BE9A 5BYYA 5KYGA 4HGLA 2ORED 5M5BA 4UXQA 2WFYA 1SVUA 3KQOA 2LAVA 3HV5A 4GG7A 3ZSIA 2JDOA 2P33A 4K18A 4AOJA 2GS2A 4U5JA 2WQNA 3ME5A 3DTWA 1UKIA 4PTGA 2QQ7A 3LDFA 4PYMA 3L9MA 5HBHA 3B7PA 1CKIA 3MI9A 3I5NA 4TYHA 4G3EA 1RI5A 3C0KA 3FI2A 3LIJA 3ZRMA 3P1AA 1Y8YA 1OB3A 3A99A 4LQMA 1RE8A 1WBTA 3JS2A 3KXNA 4MAOA 4P58A 2Y4IC 4CG8A 3SSMA 5DG5A 3GU4A 4RWLA 4BP1A 1F3MC 2ZZKA 1LEZA 3Q53A 2XVMA 3CGFA 4F63A 1FJXA 2XIXA 4ER5A 5JEBA 2GDOA 3CJGA 2BDWA 5CVDA 5CCXA 1KOAA 1CDKA 3WSTA 1BYGA 4E70A 5LQAA 3QQKA 4TWOA 3TLJA 2ETMA 3RALA 5AUVA 5I9WA 3FPFA 3LFBA 4WG4A 5DFPA 5EG5A 4C07A 4G3DA 2YITA 2W06A 4BDFA 3VNTA 3K5VA 3L9NA 1ND4A 2OO3A 5K03A 3OW4A 3LQ5A 2C6IA 3UC4A 3PJ2A 3DJ7A 2B78A 1T45A 2JIUA 3EIDA 1P39A 2R3NA 3B3FA 1REKA 3VHEA 3FDNA 3ZOSA 3VS2A 5M56A 4CKBA 4IX5A 1GAGA 3KQMA 2WKMA 5I5ZA 2IN6A 4M84A 4RIWB 4GCJA 4PGGA 4S2ZA 5EYMA 1AQJA 3QKMA 2W5HA 2PL0A 4RX5A 5IDPA 4XG7A 3CKKA 3P7BA 4JNWA 4I5PA 4ACHA 3GCSA 1WBOA 3SXRA 2VDVE 3LM0A 2A0CX 4XBUA 2UW4A 3R21A 3PXKA 4CCBA 1W98A 4R3RA 5FP5A 4BCOA 5CNNA 2ACXA 2VWZA 3HCAA 3KPVA 5HI2A 3I5UA 5F94A 5A14A 2I40A 1IA9A 4LOPA 4PRJA 2YXDA 3KF4A 2Y4IB 4WSYA 2OZVA 3HA7A 3Q9ZA 4QMWA 3QQGA 2NP7A 4KINA 4HSGA 3EYGA 2R6ZA 2OICA 4DAWA 3DNDA 3M2WA 3KRXA 5LVLA 2VTLA 4IWQA 4MWIA 4F0GA 3U6HA 5LQRA 5JFVA 4RTLA 3MFTA 4GC5A 1UWHA 4OBPA 4UXLA 4KKGA 5JFSA 2OKCA 3R8UA 4E20A 2IH4A 3G51A 4IBMA 3H3CA 3ALNA 1IEPA 4EKKA 4BDAA 4AZFA 2JITA 2VTRA 5DSTA 2C7QA 3PPZA 1TKIA 4TYJA 5C27A 4C38A 1VLMA 1X1BA 1XDUA 3Q7EA 2ZOQA 5IEYA 1YFLA 2HYYA 3PA5A 3ZFYA 4IC8A 4E4NA 5FUBA 4ZOGA 5HU9A 2XM9A 5CTPA 1SNXA 5L3AA 3DAKA 3K6RA 4IVBA 4O91A 3SDJA 2DULA 1RJBA 4GJ3A 2OY0A 1JNKA 4TYEA 5AP5A 4M69B 4XV2A 3HMOA 4IVCA 2R5TA 5BVKA 2Z6QA 3RI1A 5CVFA 3QTIA 3P78A 2HY81 3CQEA 3O71A 2OI4X 2PY3A 3OT8A 4CRLA 3AC8A 4CZTA 2ZAZA 3FMNA 3DJ5A 4OT5A 3A7DA 2PMNX 3GDHA 3OZSA 5E8RA 4A07A 2OIBA 4FBXA 4QMOA 5CZIA 4AZWA 5CANA 5IF1A 5LVNA 5GINE 4RJ6A 2AVNA 2QONA 4HOKA 3LHDA 4U81A 5EM8A 2O3PA 4O6EA 4IW0A 5JSMA 1YB2A 4FZ7A 2XYVA 4ERKA 3H4JA 4CT1A 1ZXEA 2UW5A 2O07A 5K0LA 2FYSA 5E8UA 3FZPA 5HIKA 3EQDA 3NW6A 4EORA 2WQOA 4F64A 3VC4A 3KPWA 5DT0A 3ZO2A 3S68A 3PXFA 3LHJA 1A48A 1W82A 4C4AA 5IH6A 3C0GA 4Z2YA 3FZOA 3LXLA 4G3FA 4X6QC 2HW7A 4WNOA 3AMAA 3GC9A 4TNBA 1O54A 1JTFA 3GFWA 5M44A 4C4IA 1SQGA 1JSZA 3I64A 4EOSA 4HGYA 1PXJA 3FAAA 2B1PA 1HNNA 4DEHA 4FSZA 1OIRA 3Q5IA 2PUNA 2PMLX 4FSNA 2Z7SA 3M1SA 4CEGA 3FMEA 2G71A 2IZTA 2N47A 5I9XA 2GNJA 1JLUE 5ETIA 3I0OA 4ZTQA 2C5OA 3AD4A 3PE1A 4DG2E 3UPZA 4AXAA 2XRUA 3UJDA 4QTTB 3A8XA 3EVFA 2YM3A 3F5UA 5IQEA 1L3CA 3F3UA 4K77A 1PXLA 4BLUA 3HEGA 4ZS0A 3NWWA 5AUTA 4IB5A 4PL5A 1EIZA 3HV6A 4BY9E 1YDRE 3FV8A 4ZTRA 1R0PA 4WKQA 1H07A 4BDCA 3BLHA 4I4FA 4E8AA 3MFUA 1XWSA 4BDGA 1QPJA 4D2RA 4FV6A 2P1DA 5DXAA 2QHMA 3WARA 4C35A 1VP9A 4ITHA 3CE3A 4BDKA 5C8NA 1YI4A 3DBFA 4M38A 4I93A 5FHRA 2QO2A 3FL4A 4Y5HA 3DUWA 2PVYA 5A6OA 1Y6BA 3MY1A 5D9HA 5E92A 3QCXA 4MTLA 4TYIA 4PNKA 4FNXA 3HV4A 5H8BA 3BGIA 4ASXA 3PA3A 3WF6A 3G6HA 2ITQA 3QQJA 2IVVA 2QCSA 2F2UA 4PUZA 5GJDA 4U3YA 1OGUA 3Q4CA 4D28A 2VTIA 3R7IA 5J9YA 2W96B 3LAUA 1ZQ9A 3QX2A 5ICEA 3EQRA 2JG3A 1GZOA 2Q41A 3EVAA 1JQHA 4M0YA 4RC2A 5IEVA 1JTEA 1OBGA 3EN5A 2XRWA 4O29A 4FR0A 2KTYA 3RM6A 4EOKA 2WU6A 4RTOA 4EZ3A 2X39A 4R1VA 5DM1A 5DM4A 5K8VA 2RG6A 5EHIA 3QZGA 1M6YA 3C9WA 3LKZA 4X60A 3EFKA 2BALA 3AGLA 3IGGA 4KIQA 4GQBA 3UOHA 3VS1A 5HNIX 3B2WA 3R83A 2I0YA 5DIAA 1M2PA 3R1YA 4DLJA 3CJFA 3O8TA 2C6DA 4C33A 2HZIA 4PYNA 2PYWA 1W7HA 3QALE 3WIKA 4D4RA 4K6MA 2FO0A 3I7CA 4BTMA 3C51A 1VZOA 4FV4A 4HC4A 1JG1A 1NW3A 2IVSA 2VO0A 4F09A 3QD0A 3PP0A 3FLNC 2BROA 2GU8A 3ZC6A 5LWMA 4CFNA 4IKPA 4IJPA 1YXSA 4EOLA 4ER3A 3DBEA 2R0IA 1WFCA 2R3HA 4ER0A 3IW5A 4U7ZA 1UWVA 3NDMA 4YJUA 4UBAA 3EVCA 3R9OA 5M07A 5HVYA 3W1FA 2XNMA 4S31A 3OTVA 5AIRA 3TIYA 3PTAA 3R7UA 4O7NA 1VL5A 2ZVAA 1P2AA 3FWQA 4FKVA 4NFMA 5BPYA 2ZBQA 3DH0A 4DFNA 3ALOA 2WHBA 2UZDA 1VJYA 2F57A 2CJMA 3NRMA 3TCPA 3JWGA 1M0EA 1XKKA 3QTQA 2GHMA 2GHLA 1IAHA 2GNGA 4HYSA 4CCUA 1G6Q1 2GB4A 2XYNA 4FTTA 4ZTNA 5EIWA 3IK3A 3SXSA 2GMXA 4R8RA 4XX9A 3A62A 5BQ0A 3K3IA 5CWZA 3ELYA 2F7EE 3JR1A 3NUNA 3ZM9A 1QANA 2ITXA 1R39A 2R3KA 2W1GA 3E3PA 2Y7JA 1CMKE 1YWVA 3DBCA 5IQDA 1TW2A 3P08A 3F69A 3L8VA 4FEXA 4KBKA 1RJGA 4B99A 2FK8A 1DS5A 4AN2A 5E1DA 5LCKA 3QL8A 1NV8A 4FKPA 4RFZA 1H1PA 2WIPA 2I1MA 3E92A 1NA7A 3DK7A 2VDUE 5K0JA 4XV1A 1U54B 2C6LA 4PNEA 5AA9A 3D5XA 4U9AA 4TL0A 3LFAA 2HZ4A 2YJSA 3I6WA 3QRTA 4NTSA 4W4WA 3PA4A 3QUPA 4KBAA 3T3UA 4FVQA 4G2FA 3KPJA 3OE4A 2PZPA 5EQEA 1TQPA 3G7UA 4QMNA 5HCXA 3OU6A 1CKPA 1Q3WA 4MBIA 2YCRA 2PMIA 3C4CA 5EDRA 2JHCA 3EMBA 2PPQA 2C5NA 3BEAA 1U54A 4BCNA 4E32A 1Q5KA 4NCTC 4OLIA 3LXNA 3ZLWA 4NWMA 3DZOA 4X63A 2PX2A 3F7WA 4GUBA 3VRYA 3QC4A 3GVUA 4EL9A 3HM2A 3UJ9A 3R0QA 2Z8CA 4OTHA 3TM4A 5DSXA 5ANEA 2G9XA 4QQNA 2DYLA 5DHJA 2GTNA 4FTOA 3OU2A 1U59A 4BCQA 5L8LA 3EKKA 4X3FA 2HWPA 2J7TA 2B9HA 2IW9A 5AMNA 4J97A 3TZ9A 4IANA 4C0TA 2ONZA 3A4OX 5HG9A 4LYNA 4GRBA 3MB6A 2HW6A 2OZAA 4DGNA 3G2FA 4TXCA 2PT9A 4RVGA 4A6EA 3EZRA 3GXLA 4I6HA 1WZNA 4C04A 1XHAA 5G6VA 5CALA 5AUUA 3F7ZA 1IASA 5JR3A 3HMNA 4EOQA 4GC9A 1XTPA 4QP6A 3E23A 4QP7A 4BGHA 4AW2A 2IIPA 4XUEA 3HCBA 2H1RA 3OZTA 2F7XE 2AN5A 4MX9A 4O7YA 3TKHA 4FV7A 2JD5A 5CSVA 1P1BA 3O8UA 2UV2A 3GNIB 2Y4PA 5DPVA 4YZBA 2PUIA 5FEEA 3WZUA 4GOND 3ZU7A 3C1XA 4XUFA 3KMWA 5JRQA 4JX7A 2BDFA 1GZNA 4GL9A 5IUGA 5BVEA 3X0DA 3CBLA 1PKDA 3F2NA 4FTMA 1VIDA 3MTFA 2GNLA 5F1ZA 3EGEA 4Y85A 3WILA 3KULA 4N6ZA 1DI8A 3BLRA 3V8TA 4NYEA 5DNRA 3LDGA 4DEEA 2ITWA 3DLZA 2W1HA 2QU5A 4V0RA 1WY7A 4F6SA 2WQMA 5I9ZA 4Y72A 3AXWA 4BIDA 4HTFB 3R1SA 4Z16A 1NW8A 3O7LD 4C3FA 3R04A 1XH9A 3ZMMA 4IAYA 4JG8A 4YHTA 4FGBA 3ZUVA 4RIXB 3LPMA 4FL3A 3COIA 4JJRA 4RTKA 3DKFA 1QZZA 4AQCA 4K33A 4U6RA 4EK3A 2REIA 3ZFXA 3FZ1A 3JWIA 4G6OA 3UP2A 3IEIA 3R8VA 4USFA 4QPAA 2GS7A 1QMZA 4O0YA 4BP3A 4ZK5A 1JG2A 4XLVA 3V5LA 4I24A 5B2KA 1NE2A 5CF8A 1UVRA 1DM2A 2ZDUA 4MH7A 2C5VA 3DKOA 3NAYA 4QO9A 2AYPA 3EZVA 4ZY4A 3HRBA 3ZZWA 5KUPA 2YUIA 4E31A 4EEVA 1XXLA 2QE6A 3LCDA 1KPGA 3RHKA 4MBLA 1Q3DA 2OF4A 3ODYX 2WA2A 3AD6A 4EKGA 5FTGA 5BUEA 3OXIA 4BDIA 1WVYA 5EM7A 3IOPA 5K0BA 4QQ5A 2VWWA 4ACGA 1WCCA 4BDJA 3ZO3A 3HECA 2VWYA 4Z7GA 4E1ZA 3D0EA 1I1NA 2AVDA 5KQRA 3QOWA 2P55A 1OR8A 3KHKA 4YJVA 3UP7A 5C26A 3U51A 4ZIMA 3NEWA 3KU1A 4Y83A 4ZP5A 3AT4A 4YJQA 5CVHA 2WO6A 4FL2A 4TNDA 2RG5A 4W4YA 1FVRA 2GNIA 3VF8A 5CIYA 2C3KA 4EH4A 4FT4A 1OL5A 1YW2A 4RGJA 3CJQA 3FZTA 3C6KA 3LSTA 1VE3A 2XIYA 4PV0A 1PXIA 4C62A 2UYCA 2BH2A 3OF0A 3G8AA 5CNOA 3M6VA 2QRVB 4YNEA 4B8MA 3F4KA 5CXHA 3P9IA 4FT2A 4I92A 2XJ2A 3PIXA 2OH0E 4IM2A 3NNUA 4RWKA 2YABA 5TOZA 5M51A 4ONAA 3S95A 5CVVA 2VTMA 1KR5A 2ZW9A 4YTFA 5BYLA 3SG9A 2PHKA 4AFJA 3PG1A 4GSBA 4BGQA 4G9RA 3LCKA 2JEDA 2WTVA 3Q6UA 3QAME 4QYEA 3UJAA 4G6NA 2VTTA 1R3CA 4XV9A 4QP4A 5CI6A 5FDPA 3EN6A 3OU7A 3BI6A 3IOKA 2GPYA 4FNWA 3Q96A 1BI7A 3HA6A 2HIWA 3OEZA 4YTIA 1H1WA 3W33A 3ZFMA 4NM5A 3KRJA 3G5TA 3MCZA 4IB1A 4D4VA 3EN9A 4IADA 3UC3A 1Y91A 4YPSA 5CYIA 3UMXA 4IAKA 3W55A 5M4CA 4FOCA 2B2CA 4FSMA 3R6TA 4PIPA 2R4BA 1KV2A 5BVOA 3FE3A 3EGIA 5DX8A 4CFFA 1QPCA 3POZA 1VYWA 5E1OA 1BL7A 3RVGA 3HMPA 3MB7A 3NW9A 4YUZA 4ZZOA 4ZLZA 5HESA 4X3FC 2AOTB 2IVTA 3BGQA 3HCCA 4EYJA 2ZB0A 3PXRA 5CF5A 1UU8A 2Z60A 3LM5A 2PXAA 2VX0A 4MQ2A 3NYVA 4YZDA 5EEGA 3PFHA 2VTPA 3KU2A 4WVLA 2Y0AA 1K3AA 4LI5A 5IQBA 3CS9A 3VW6A 5FEQA 5C1QB 3MQ2A 5D1HA 1OKYA 1OUYA 1XR1A 2HWOA 3MA6A 3OHTA 4S30A 5HORA 1TPYA 3H9RA 3SSOA 2X6EA 4GU9A 3VUIA 1FGIA 1M7QA 4AT4A 5CU3A 4S33A 2QO9A 4QTAA 2AS0A 3ATSA 3M6WA 4RIYB 3RODA 3RAKA 2HELA 2BCJA 2PE1A 2Q0BA 4CFXA 4ZS4A 2JAVA 2J0JA 3PRFA 3P7CA 4A9RA 4CG9A 3D2LA 3MBLA 4Y8DA 3V01A 4D55A 3NIZA 3KR9A 1CM8A 5KMNA 5HOQA 5IUIA 4FG8A 3LFSA 1YZHA 1PYEA 3KRWA 3ACKA 3AT3A 1ZMUA 3GEQA 4PMMA 5FP6A 4HVHA 2AZTA 2P40A 4RTJA 3BQRA 3LFNA 4IM0A 3UMWA 2R7IA 4QTBA 2YM5A 4X2KA 2W05A 2XCKA 2CKDA 5K0NA 2A1AB 2CLXA 4ZLYA 5IKMA 3AC3A 2C4GA 2OGVA 3V97A 4GIHA 3QRJA 3ELJA 4GEOA 2C6EA 3V3VA 1G38A 2FYTA 5KQSA 5B0XA 2ERKA 5EHYA 4F1MA 2B3TA 4QVKA 4P5QA 4TZRA 2JKKA 4JXFA 4I4EA 3UYTA 4R77A 1UKHA 4ENXA 2C3LA 4FTCA 2EB3A 5CI7A 4PYIA 5DM2A 2XBMA 3KVXA 1NV9A 5DT2A 4LMNA 4DTKA 4LL5A 1M2RA 2PVJA 2WTCA 4F9BA 2WTKB 2CDZA 2OIQA 2CPKE 4FGZA 4GOLD 5CF4A 1KOBA 3RWPA 4DFUA 3SAYA 1ZHFA 3W8LA 2DPMA 4PL4A 4EJNA 2QKRA 2WMTA 3PJ3A 3N4TA 3SLSA 4BBMA 2WEIA 3VS4A 2GQGA 1WXWA 5KMLA 2A27A 3F5GA 1YHWA 3G9LX 3GCUA 5GIPE 3VSEA 1Q24A 2Z2WA 4FR4A 3A7FA 2BRMA 1D2CA 4FT5A 2G2IA 4IZYA 4F99A 2J0MB 5C4LA 1Q8TA 4L46A 4PCAA 4YP8A 1I9GA 3ZBFA 2OZAB 3WE8A 1JG3A 2F2CB 3H9OA 4FV5A 3B8QA 5ACBC 4DTAA 4WO5A 4KDCA 3R28A 4EWHA 3CPCA 3FSFA 3ORKA 3B2TA 4C34A 1ZYCA 2OK1A 3BIZA 5M09A 1ZY5A 5CAPA 5CAUA 3S1HA 3P2IA 2HNKA 3E8SA 4XV3A 4BHNA 3BKXA 4YUYA 3A2CA 3IYLW 4C61A 3LFCA 4FTQA 4RT7A 3WF9A 5IQFA 5HZNA 5FADA 1G3NA 2PTKA 3FUTA 3CLYA 4QMYA 2QNJA 3SG8A 4YURA 3FYKX 5JZJA 5KX8A 1L1EA 2PKWA 2O06A 3F3WA 2PUUA 4EVIA 2QC6A 5KHXA 2HK5A 3D9VA 1YXUA 2O5KA 4KD1A 2WTIA 4QTCA 5FTQA 3OD6X 5HLPA 4D1ZA 3SD0A 2J5EA 2NXJA 4IV8A 1Q0SA 3PG3A 4OQEA 2YFXA 4NT4A 4R3PA 3HAMA 3PXYA 3SOAA 3VQHA 3U4UA 4USEA 5CAOA 1M7NA 4NCTA 2XYQA 4G5PA 4KIGA 3PE2A 10MHA 2R0UA 4LGHA 5J7HA 3UODA 4YUXA 2J90A 4LV5A 2CN8A 4G17A 4EOMA 4H3BA 5B7VA 5AV3A 2V55A 4QMUA 1OL7A 4EHEA 2PT6A 3MAGA 4XCXA 4E30A 4DHFA 2C0OA 3LMIA 4P7EA 4KKEA 4TY1A 3UOKA 1XCLA 2HTEA 5K5NA 3FXXA 3LW0A 1JQ3A 2ZFUA 1A9UA 4HGTA 4YHJA 3O2MA 4BYJA 1NBIA 4L00A 2CMHA 1UNHA 4FV0A 5EDQA 3K3JA 5G1XA 2HOGA 4EH5A 1QPDA 1STCE 4D2SA 1FQ1B 3NX8A 4K8AA 4D1XA 4DH7A 4HVIA 4AGWA 1R8XA 3PPJA 4KA3A 4TRLA 4IIRA 1P4OA 4IVAA 2GS9A 5AP1A 3G5LA 5L6OA 3KQWA 1N7JA 4MHTA 4BTKA 5T3QA 4F86A 4AFEA 2PX8A 5JFWA 3SHEA 2RFNA 3SW7A 4ZSLA 5FXRA 3C4EA 3VAPA 3HCFA 3O7WA 5IA0A 3TR6A 2PWPA 3UJBA 4FKLA 4JBVA 3HVHA 5DLYA 4PDOA 2XNGA 4AGCA 1H26A 1UV5A 1ZARA 3PTGA 4IEBA 4EH2A 5JGBA 4PY1A 3U81A 2X7GA 4FE2A 3E8DA 3W2PA 3E05A 2V5QA 4AE9A 4OTWA 5ICFA 2Z02A 2RFEA 3FKLA 4IX4A 3TNHA 3ZZEA 4A9TA 3EKNA 1PKGA 1KE7A 2GFCA 2GHGA 3VYWA 4KIPA 3DMHA 3IS5A 4WBOA 1B38A 3GCVA 4I0RA 4JX3A 5A54A 3L8PA 3M42A 3FQSA 1AQIA 2AC3A 4IWOA 2BKKA 4G9CA 4HYUA 1HMYA 3C3YA 3QFVA 3NVKI 5BX0A 4EQCA 2XP2A 1PYXA 3ZSGA 3LCTA 4PYLA 2PXXA 1W84A 5L2TA 2I7QA 4O27B 4FKOA 4UWCA 5U4XA 2CNVA 2E9OA 4Y95A 3VUKA 5LMKC 3M11A 4ZXTA 1IY9A 3BHYA 4BCPA 4MXAA 1V39A 2NO3A 1X1AA 2YXLA 1WVWA 3C5UA 4GG5A 3KQVA 2BVAA 3ZBXA 3MGYA 5EOLA 4DCEA 2CNQA 4DEDA 2R3MA 5AUWA 4DGGA 4MNEA 4C7TA 2AOUA 2W1FA 3R24A 4YJOA 4R05A 4Y73A 1KHHA 1BC5A 5EVJA 4C3PA 4FUXA 3RPVA 4M12A 1Y57A 3QC9A 3FLSA 4QMTA 4MKCA 3LJ2A 5CS6A 5CT0A 4GYGA 3FTEA 3D7ZA 5EFQA 2X9FA 2ITYA 3PJCA 4IFGA 4L52A 2PZYA 4NM0A 2AOVA 1OIYA 3H30A 3LVPA 3HUCA 4KS8A 2P35A 4BI0A 3WBLA 5T6BA 4DT9A 2V62A 3FY0A 5HD7A 5KMJA 3DU8A 3BXOA 2ZZNA 2W4JA 3EH9A 4GK3A 2BM9A 3FLWA 3QBNA 4FTAA 4C06A 3NIEA 2XNEA 5BW4A 5A4TA 5HIBA 5D7VA 4D0XA 3P5KA 5LQUA 4EQUA 4LRJA 2C3IB 5I9UA 5KO1A 4L45A 1YUBA 5AP6A 4E2XA 1I4WA 2LD4A 3ZSHA 3GFEA 2ZMCA 3PJ1A 4OBWA 3HNRA 5ANJA 4YZMA 2WMBA 1Q8YA 1Q8ZA 2HAKA 5AV0A 4WG5A 2ZBRA 2VGOA 2YIXA 1ZYDA 4BCMA 2VO3A 4R78A 4YBKA 5EK7A 4F9AA 4R7IA 1W0XC 2EG5A 2G2FA 2ITTA 2OPBA 3P8ZA 3MFRA 3FTCA 2EX4A 5T68A 5HIIA 4DFYA 5E8WA 1U5RA 2IZSA 3SRVB 1URWA 5EM6A 2ERZE 4D5HA 4QP3A 3C6MA 2BRGA 3BWYA 3VHKA 5ACKA 2BFXA 3TM5A 4QMLA 4AGUA 2QOOA 3QZIA 4IC7A 4G34A 3DB8A 5K09A 2ZIEA 3TUCA 3PVBA 2I0EA 1LP4A 2UVZA 3DA6A 3DNEA 1PJKA 5CXZA 3EQBA 4BZDA 2QR8A 2VO6A 4QMQA 4ANSA 3LBYA 2RF9A 3NUUA 3GCQA 4UWBA 2W4KA 3O31A 3BRBA 4E26A 3T9IA 3D2KA 5DXJA 4RTMA 2Q83A 3DPKA 2QODA 3V5TA 9MHTA 2CCIA 3AMBA 3IKAA 3ORNA 4AP7A 3TMAA 4ATNA 4D4SA 3LQ3A 5HCZA 3ULIA 2ONLA 2EB2A 1QCFA 2OG8A 1TQMA 1H1DA 1P4FA 1VEBA 2XMYA 3SV0A 2WB8A 3P0MA 3DXNA 4CV8A 4BI2A 4N4SA 4ZZMA 4FGRA 4MK0A 4RFYA 4QP9A 3MCTA 4HCVA 4RLLA 3RAWA 4JQ7A 4DEBA 4AE6A 2XK7A 4RTRA 1WMKA 2FSLX 1R8YA 3EPPA 3KRRA 4KRGA 4ASZA 1ZMVA 4YLJA 3NDJA 4KVZA 3GJYA 2H9VA 3GCZA 4P7JA 3FPQA 3VUMA 4AZEA 4WG3A 3RAIA 3EQIA 5I4NA 3QTUA 5HICA 4BTFA 3KGAA 3P86A 3Q4ZA 4CQEA 3IQ7A 2QY6A 4PTEA 3RW9A 3EN7A 4DFXE 3V5PA 3MESA 3CXWA 3HDNA 3LFDA 3V6RA 4KWCA 3PFQA 5AAGA 1OM1A 1Q97A 5GHVA 4OTIA 2JDTA 4RBLA 3M6XA 3NJRA 3PYYA 3SVVA 3RWQA 4MXOA 5ICCA 4G3GA 1PXMA 4WHZA 4FKIA 2ZBPA 2QOIA 2VX3A 3KR1A 2WMVA 4JQ8A 5IPJA 4RTQA 2PVMA 5ANIA 4XG2A 3W2CA 4F0FA 1SKMA 1YKRA 4G3CA 1ORIA 1UU7A 5C1IA 4UALA 1YF3A 1S9IA 4YLLA 4PP7A 4BDHA 3BZBA 3TKIA 2CKPA 3NUPA 5AV2A 4BCFA 2I6GA 3HYHA 5JQ5A 3UJ6A 3HMMA 4F65A 3WZDA 3PS9A 1K9AA 3KA0A 4JBQA 3NCZA 4LUDA 4P7FA 4UOEA 4RQKA 1O9HA 2Z7RA 4EH9A 3P4KA 4L7FA 1P5EA 4M8TA 1SMHA 5CAVA 2C6KA 3FZRA 1QPEA 1J1BA 3ROYA 5E2AA 3MPTA 2P4IA 3CCFA 3CKWA 1RQQA 3FC2A 3Q9WA 4MQ1A 3KC3A 4L44A 4OBXA 1ZYJA 4ITJA 5F2OA 2OJ9A 3DLSA 3KXXA 4JS8A 4CXMA 4J95A 2JHPA 3KPYA 2HZNA 3CP9A 2R3RA 3QUDA 5J8IA 3TNWA 3PB3A 5H02A 2J6MA 3L8SA 1EAMA 3T7SA 4C03A 2X81A 4F08A 4JOAA 5FXQA 3KRLA 3VS6A 2W7XA 1V1KA 5KKRC 3RINA 4V0QA 4BF2A 3VS5A 4C4FA 1WBWA 2WTDA 5LMBA 5DWQA 5ERGB 4EBVA 3ZDIA 4EWQA 3R7EA 4AA4A 5IMEA 1WG8A 4M36A 1KP9A 3P71T 3TIZA 3FQHA 2C5YA 2BRBA 2R3IA 3O23A 5EHOA 1PMUA 4FTIA 4R6VA 2XK4A 5CQWA 1DUSA 1INLA 3T0IA 5CCBA 1LEWA 3F82A 3ORIA 5IQIA 2VAGA 1KIAA 5J1VA 1T43A 3SSNA 2NP6A 3DS6A 4Q5HA 5EOVA 4DCAA 2FHPA 5E1BA 5EMJA 4O22A 3PZHA 4L43A 2VTHA 5BNJA 3RKBA 4NECA 4HYIA 2PLWA 4XUCA 5FM3A 3U87A 1FGKA 2OJIA 4WNPA 2IG7A 3CC8A 5FEDA 1IA8A 3A4PA 2BZHB 1GIIA 2UZLA 3BWJA 1PY5A 3EMGA 4JIAA 4ZTBA 4E4MA 3FEGA 3EGVA 4XOYA 4ASEA 3HA5A 4QQTA 3BGPA 4XP0A 2IGTA 3MA3A 1P91A 4MVFA 3FC1X 3LKMA 1OIQA 2R3OA 4QQJA 3TL8A 4EH8A 2V74B 3M70A 3F61A 4I23A 5CEQA 5KMOA 3VUDA 2Z6UA 3BBWA 3OXTA 3WYXA 3HEMA 4H0NA 4D5KA 4RTNA 4RSRA 1PXKA 3EQCA 3BKWA 3RK7A 3B3GA 1O6LA 5E8VA 3I4BA 3MVJA 5LARA 3ZUUA 3G2OA 5TF9A 2CHLA 5JGDA 2IBSA 2PVNA 4PMPA 2YN8A 3UZRA 3BYSA 3QLGA 4CTBA 4DBXA 5C0OE 3MWUA 2EVAA 2QOHA 4ORKA 3TEIA 2BMCA 2UW9A 2QKWB 3RCDA 4C4EA 4EUUA 1SUIA 4P2KA 3DMGA 4IAZA 3NWBA 1P14A 3RPYA 2PVFA 1XCJA 4DG0E 3D7TA 1DAWA 3G15A 1WXXA 2CWWA 4BN1A 4IZAA 4FZVA 3HGKA 4B17A 3OFJA 1OL6A 2JDVA 1ZG3A 4TW9A 4QTUB 3SMQA 3EFLA 2C0TA 4FL1A 4RIYA 3EVBA 1NW1A 4JAIA 1J7IA 2XH5A 3A7IA 4E5AX 5KZIA 3SW4A 4GOMD 1FBNA 1VYZA 2FSOX 1ZLTA 2RFSA 3ENHA 3R02A 4J53A 4N57A 4EOPA 3DULA 4BHZA 3TZ7A 2DQ7X 1RDQE 4P5ZA 5CX9A 2BR3A 4XP3A 1Q41A 3GT8A 3PXZA 3UVQA 4AT3A 2W0JA 4AU8A 4R7HA 5D11A 4IX3A 5E8YA 4KABA 1X8BA 1YI6A 2OF2A 5M53A 4AZSA 4GBED 2BPMA 4TT7A 4QP2A 3WE4A 5E2BA 4RSSA 5H9BA 5ETFA 5DR2A 2GPHA 4KKHA 2OKRA 4O83A 1NVRA 4UB7A 2OH4A 3FHRA 3NVMB 3UOJA 1CKJA 2V7OA 4MXXA 2B53A 2GSFA 1PF8A 4I0TA 1E9HA 4J96A 3SM3A 1L8TA 2YISA 1YQJA 5IA5A 4XP2A 3TNQB 4FUYA 5K05A 4W4VA 3II5A 3ZO4A 4YGAA 3UNZA 4PYKA 4J98A 5LQCA 2C3JA 3F2RA 4QP8A 4F6UA 3S0OA 1GZKA 3FYCA 3DAJA 5JK3A 1SVGA 4O7RA 3MTEA 2Z6AA 2RGPA 4G16A 3PT9A 5FQNA 3QTXA 3MTLA 4D1SA 2G15A 3R7YA 4FT9A 3LBFA 2BUJA 4BKJA 3M4XA 1YHSA 3QV2A 2YWPA 2VO7A 4IDTA 3UIBA 5GWXA 3KPUA 5HIJA 3F2AA 4OTDA 4RA4A 5E4HA 5KBQA 2W1DA 3CC6A 3COHA 4XHKB 5AV4A 1NBHA 4RV9A 3UWPA 4FI1A 5EEHA 4HZSA 5C03A 3IW6A 1IG1A 4F70A 3E7VA 2ETRA 3R00A 3KY2A 3RPSA 2XVDA 4ZJIA 4AN9A 4CFVA 3MIYA 4IM3A 2R3QA 4CV9A 4LL0A 4DT8A 1LUFA 2VGPA 2X7OA 1XH6A 1PMNA 3GBZA 4AUAA 2VDWA 2J5FA 2OU7A 2IBTA 4RA5A 4GOOD 5LXMA 4FIGA 2QD9A 5EI2A 3GRRA 4X7QA 3SGCA 2ZWAA 1KPHA 4EK8A 3KEXA 4CFMA 4O84A 1O9GA 1OPKA 3EB0A 3G88A 4ZTHA 3HCEA 5HNGA 4GK4A 1KE6A 1TVOA 2O63A 2CGUA 2ZM1A 4MXCA 3AG9A 4YO6A 2ESRA 2I62A 2R3SA 1Q4LA 3FLZA 3BWBA 3MVHA 4M13A 1XH4A 4DCGA 4I94A 2A19B 4YJTA 2EFJA 4RYLA 3MYGA 2NYUA 3BBTB 4FKWA 4CTJA 5EYDA 4QMPA 2GAFA 2V22A 4O86A 4WT6A 4JBOA 4BCIA 3KL8A 2C7PA 4M14A 4C58A 2ZZMA 3VWAA 4L3JA 2WTJA 4TWNA 4Z7HA 3PVUA 2WQEA 2ZV7A 4FP9A 4RRVA 2I7CA 1URCA 2C5XA 4ANQA 3R8PA 4F4PA 2AR0A 4YMJA 4RTPA 3A61A 2VWIA 4V0GA 4XG3A 4L6QA 4HVGA 1WZYA 3EL8A 5JMSA 5KMMA 3T7TA 1ERKA 2UW7A 2W5AA 3OWJA 5JH6A 3UQCA 3UVPA 1H8FA 4EOJA 5AAEA 2B52A 1OKWA 4U44A 4JLCA 3ZEWA 4BCHA 4GKIA 4QYGA 4QPNA 3GRYA 1H0WA 3HUBA 3AJDA 4J8MA 5EM5A 3DGKA 4OBOA 3P2KA 4LG1A 5BP7A 2P8JA 4U43A 4FZDB 4LG4A 1ATPE 3TM0A 3VS7A 4P4CA 4EK4A 2EJUA 1YFJA 1OVEA 4ZLOA 3WZJA 3R63A 3G90X 3AOXA 2WPAA 3I58A 1RJEA 3OCJA 1L3IA 1OBDA 2XZSA 1IXKA 1X1CA 4F85A 1Y8CA 3DCVA 4FMQA 4ZSGA 3ZEPA 3D2IA 3HV3A 3MH1A 4M3QA 3VN9A 3K2LA 5CVUA 4MXZA 3ZTXA 5I9YA 3TXOA 3IGOA 5FDXA 2P2IA 2UZEA 4C05A 2SRCA 3PLSA 4FTNA 1Y8GA 2X2LA 2PUPA 3I5ZA 4FKQA 5CEIA 3ZLXA 4EQMA 4FKRA 3A60A 3BWCA 3LECA 1JKKA 3UO6A 2EXCX 4AOIA 5HD4A 2R3PA 3E93A 5DTQA 4XG4A 5KVAA 4FVRA 3A7GA 4LGGA 1JQDA 1YDTE 3S4QA 3HRCA 1Q61A 3GRVA 5E90A 2OJJA 3NNVA 4FYNA 4D4YA 5EH0A 2OXXA 2JKMA 5A4CA 4FYOA 4AX8A 5HU3A 3T8OA 3IDCA 5LQFA 5IH3A 3O96A 1D2GA 4RVLA 3A4TA 3KKZA 4E4LA 4BLVA 3QTRA 2XVAA 4EH3A 4CKEA 2PX5A 4O7LA 2X1NA 1PXPA 4WUAA 5FQDC 4TKSA 5IQCA 3RAHA 3FYJX 1MUOA 3O51A 5CSPA 4WOVA 3DBQA 3BELA 4DEIA 1NW6A 4IDVA 3ORPA 5FRIA 1UNGA 3NUSA 4E6DA 4X6RA 4IAFA 4RJ4A 2H00A 3D83A 3RIEA 4ER7A 3IW8A 2FA2A 2W9ZB 4IACA 5HBJA 2YM7A 3JY9A 4C36A
chains in the Genus database with same CATH superfamily
3UICA 4EW2A 5JUWA 2W99B 4L7SA 4EY4A 4DG9A 1V95A 4JBIA 4U2BA 1A7JA 1Q3KA 4MYCA 4UHCA 1OI3A 4UVDA 3GZNB 3OEEA 5IUKC 4BZXA 5J47A 3GQVA 2XWQA 4NDZA 6Q21A 1HNXB 4Y2UA 1FS4A 1Z3CA 4W1PA 2C7OA 2WMRA 4MHOA 5AAFA 4L9RA 5FNZA 4H39A 3U4QA 4LOKA 4DINA 3N8KA 2X0GA 3OQIB 4PX2A 5CPFA 1FDOA 5BQFA 2PH1A 3QVGB 4U80A 3RIXA 2DM6A 4HW7A 5JSZA 3N86A 5AADA 1VGVA 4LAFA 1IVNA 1VGQA 3VPHA 2DFVA 4KFUA 4YRSA 5JCXA 2YJZA 3R74A 3SC3A 2VDJA 2RGUA 4HNIA 4WZBB 5DW0A 1UCFA 3CH7A 1WXDA 3NGLA 5AFSA 1MB9A 5GOZA 4N6GA 4NFHA 1KY2A 1MGPA 1GGNA 3KQUA 2DH5A 2UXBB 4L9SA 2WIHA 1WSWA 1HCLA 5DO9A 2MTBA 4J9UE 3KQ7A 1A9YA 2VJYA 1GIJA 4UUMA 2AWOA 4WIAA 3SIWA 1AHIA 4CF5A 1B3RA 4A8PA 1HPLA 3MS7A 4E6AA 1ZMTA 4ZZ0A 2H1IA 4L76A 2ISCA 3HGQA 3HXTA 5G0TA 5LMNB 4DV5B 4MULA 2VWQA 2DUMA 2Q3FA 3AP2A 2Q6IA 2WELA 4W7IA 3L46A 5J5SA 2UVDA 4CT4B 1GPNA 2WK1A 4C4HA 3IQIX 5D00A 1YZGA 2O05A 1EK0A 2P9CA 1E6UA 2XPCA 5EOBA 4IDEA 4I2VA 4R6WA 1JDTA 5ALSA 3NWEA 4HZRA 1PR4A 4BX3A 2BFBB 4CKIA 3IDSA 2W2TA 4BU0A 4YCSA 2NV6A 5KQMA 4X2FA 4BDBA 2JJ2A 5GGXA 5E6RB 1MMFB 2IZOA 2IJMA 2LDXA 3FMFA 4I3ZA 3RAFC 3SRVA 3MTQA 3GENA 3LQKA 3UAYA 4X97A 4DQXA 1PHKA 2EKBA 3VBYA 5CDSA 5K0SA 4BRZA 4J43A 3VBEA 2Q5EA 5J4KA 1GAQA 2X19A 5DULA 2V8BA 1XKLA 3P2EA 5LZ9A 3U4HA 5GJFA 1OL2A 3M33A 1BVRA 2AMYA 1T9KA 4F9GA 3DDQA 3ZHTA 3DR5A 1ZWLA 4H3KB 4MRMB 3PNVA 2D1YA 4UZDA 4DGOA 1Z57A 1M34B 3HB7A 2B0QA 2GQRA 3VZRA 4DEGA 3EAQA 4YJGA 1A5ZA 4YJ3F 3TFQA 1SKYE 1PTJC 4AAAA 2B20A 1AQ1A 5ICGA 3V4PB 1IVSA 4QMXA 1QBGA 5E7RA 1ONBA 4QYIA 3L9LA 1Q0ZA 1Z6GA 3ZZUA 1NLYA 3GA7A 2QTFA 3IOEA 2ID9A 3DA8A 4OXXA 4MUFA 1L5RA 2EJCA 3GFFA 3NBAA 3M6LA 4JLJA 3C4WA 3D5QA 4EBWA 1GNRA 2JLUA 3MJ2A 3S81A 2D0PB 1XZIA 2J0KA 1NSTA 4ESVA 5FWXA 2BKZA 1LQ2A 1LTKA 4RF5A 2OBBA 4C0BA 3VYRB 1QHHA 2AF4C 5B2ZA 2VTVA 3DJ6A 4TXMA 1G1AA 2UZWE 4JT9A 5HVJA 4LJYA 4O21A 1HDEA 1G291 4F72A 1H1LB 2O8DA 5KOYA 2AFIA 4XE5A 3BYVA 4AA5A 3KQQA 1FRVA 4WUNA 1V45E 4B6GA 4WFIA 4DIDA 2P90A 4PMSA 1PNVA 1PGOA 3VVBA 2B2NA 5I5EA 1NRIA 3VC3A 2O8FB 5DHQA 1M14A 2VVTA 4P7GA 5DBEX 2C92A 3TL2A 2P41A 4II7A 4TMTA 5GM1A 2PJZA 1U8CB 3NEJA 2C9BA 2C59A 1LPSA 3NC4A 1JXOA 2CB0A 2EWAA 4DQLA 1A2KC 1SQ5A 4KBCA 2O2CA 5IAJA 4HNFA 4HLNA 1P9NA 5EPEA 5HG5A 1CIJA 1AXRA 1K6MA 4QUBA 2W17A 1E1RD 3OD5A 1MQ9A 1T6ZA 3DBDA 3Q0TA 2CGXA 3SXPA 1PR0A 1VI5A 4XDZA 3IAUA 2MR5A 2I6UA 4O7WA 5KCVA 3CVOA 2EKLA 2Q1TA 4Y8VA 3MJHA 4HEQA 3QQFA 4XEYA 2IF2A 3ZEIA 4WERA 2IDKA 1NNUA 3KYCA 4FBLA 4J7BA 4ZVNA 4G89A 2YCFA 4RHFA 4WZBE 1Y4AE 1IONA 4L5IA 4XD7D 1PJBA 4W82A 4GP9A 5JVDA 4R2XA 4PCLA 5BUQA 3LLTA 1S9JA 2QYOA 1VB3A 4ER6A 4OQLA 3OY3A 3H5VA 4IWPA 3P96A 4QO7A 3O2SB 1P81A 4DLWA 5FHQA 1Q16A 1UU3A 4D74A 2VWXA 5IA2A 2IDZA 1JHPA 2FAXA 4C4SA 2PQ0A 1RQ2A 4PG5A 1K8QA 3OBGA 4A36A 1T5SA 2FWAA 1W4ZA 3M4XA 1PE0A 3A9VA 4QQKA 3MFSA 4KH1A 5IMXA 2WMDA 1FMOE 4GS6A 2PBFA 4CM4B 5F9MA 4KW7A 4HRYA 4F84A 2Y1EA 3PVZA 3VC7A 1U8XX 4U8ZA 5E7QA 2YUTA 3EY9A 2VHVA 1YXTA 2HO4A 4CBVA 2QAGB 1OITA 4X6YA 2P2NA 4IJ5A 3H83A 3NAQA 4MO9A 5CGZA 3NUYA 2E2BA 5BV8A 4INPA 2ATXA 4ALWA 3ILHA 4X71A 1EJ6A 4O0RA 1Q12A 2R4UA 5BSGA 4ME6A 5DVRA 3FKNA 4RKFA 3DAEA 1KSWA 4YV2A 2A5YB 3EEOA 4WCVA 3OX1A 4DY4A 1Y3AA 2I1LA 4F5WA 3H2BA 1Z2PX 5IZCA 1KYQA 1DDIA 4KIOA 1SGWA 4FHZA 2G0AA 3F7MA 4EYKA 4DA4A 1AB6A 1NDHA 2PZ5A 3V8TA 5I7UA 1HZZC 5F2KA 1FVXA 4PZ9A 4R3UC 2HXQA 5TMBA 3IEUA 2DHRA 5G02A 3BK2A 1QC5B 4RVSA 5A9UA 3IO3A 4LYFA 3TXAA 4C30A 2GZAA 4CKEB 4PLPA 1A7KA 2P4HX 5C4GB 3T3OA 1XDDA 2FWIA 3P32A 1XDZA 2WTEA 3X2SA 4FYVA 4G0YA 4YBZA 1J7UA 3X1ZA 4R7TA 3VFDA 3ER9A 4IW3B 3VOTA 4ILKA 3C7QA 2JZCA 1SKBA 4OHRA 3M4JA 2UUEA 2QLJA 4CU5A 5F1OA 1J6UA 4YRIA 1MJNA 2JC6A 4L53A 4PRKA 4Q5EA 4OGRA 2EF0A 3WYEA 3Q4UA 3P5JC 1DGQA 3R23A 4NS1A 5K3YA 3LK7A 4GZ3A 3FBWA 3KXHA 2CLEB 4M68A 1KZHA 1RXUA 1G17A 4F6CA 4CTKA 1N3LA 1YWRA 3FPMA 2AI2A 2XSZD 2NW6A 2X0FA 2Q8NA 3LUDA 5FOUA 4YLKA 1SVEA 3KQSA 1T8UA 2PE2A 3T94A 5AFVA 3I6IA 4MWZA 3HKEB 3QY9A 4BRUA 4BLWA 2JKQA 4AS3A 5M7EA 5LMZA 3Q6WA 4NL0A 4H1MA 3D5UA 1ULTA 4MQLA 2PMBA 3V6LA 3OQHA 3EIFA 5AX3A 4UBKA 4CFUA 2FEAA 3IDBA 3L5OA 5BSVA 3NG1A 5KSZA 2DUWA 2R8RA 3M6UA 5CT8A 3EIOA 2NZJA 3MC1A 1SVHA 2V7TA 4WFQA 2VTBA 4KR3A 4RMNA 3RUFA 3W2HA 2O0LA 3FI8A 1Z5MA 2XKFA 2ASVA 3NHWA 2VPWA 3BA1A 3ZU3A 2FW9A 3I7BA 2XZPA 4L95C 1J7LA 2EKQA 3OPVA 3WGGA 4BC6A 1YZVA 3F6RA 1I7LA 3BDIA 1NNSA 2BFEA 2YDKA 1UJNA 4YNOA 4WA8A 4XS2A 2CNOA 3E9MA 3E8XA 3HEAA 3T99A 2BTRA 3H9BA 3MUOA 4WFKA 2P3OA 2ID7A 4YY3B 3IRVA 4ZODA 2NXCA 1D2MA 5JBIA 3GT4A 4NYJQ 5M55A 1DQZA 4HI0E 3QRIA 3H04A 1WDTA 5EW3A 1MW9X 1YS7A 1YQGA 4AN3A 2IX3A 1MO5A 3OFKA 4GKAA 4B5KA 3R7OA 4F2PA 2QLUA 4UHHA 1IEWA 4FFMA 1NBEA 3X3HA 1VKRA 2DT5A 3L06A 2AC7A 2Z95A 4RY0A 4QFDA 3U09A 5H8EA 3NBUA 2BMJA 1YXVA 5JDIC 3PUFC 2CV0A 4L3PA 4ZCPA 3R8ZA 5FCDA 2A9JA 3OJLA 1AGRA 1EU1A 1L1QA 4PTGA 3V7UA 4XRRA 4P2BA 1RHJA 4XIYA 3CW9A 3C39A 3UF0A 5HQJA 5JS2A 1B8UA 3RC8A 1ZMOA 3QQ5A 2ACKA 2XIXA 4RPCA 1KE2A 4QZVA 3GFTA 3KZCA 2W06A 4C7VA 4KLZA 3PJ2A 2RK4A 3OCUA 1JNXX 5LU8A 1DB3A 2QVLA 2D5IA 1XU9A 2QPLA 2JAXA 1N8NA 1PJSA 3GCSA 3LM0A 2X2FA 1TLLA 2IHYA 1PT7A 2OZVA 3H3JA 3Q9ZA 2Q5LA 3WIVA 2NP7A 2R6ZA 1H93A 2HSWA 1QH8A 5JFVA 2YY7A 4UXLA 4KKGA 3LVQE 3R8UA 4J0HA 3G51A 4A2WA 1IEPA 5C27A 5CIYA 1PL0A 8ATCA 3EC2A 5ALUA 4ZOGA 1JNKA 4BNXA 1RW4A 3I52A 3UEOA 2R5TA 4WMLA 5CVFA 3QTIA 1ZVJA 1QPGA 4MUYA 3GB9A 2C3UA 1XTVA 1JX6A 3JASB 4O6EA 5JSMA 2BT4A 1OT5A 3FLAA 2VK2A 4WK6A 5E8UA 1VZ2A 4F64A 5EIAA 1WW2A 4LY0A 1A48A 3BDVA 1B6GA 2A59A 2B98A 4FQ8A 3TLBA 3WMEA 5I9XA 2C5EA 5I48A 3UJDA 4QTTB 2N0SA 2DFNA 4RD6A 4C3VA 1YDRE 3GPIA 3DBFA 4I93A 3ML1A 5F78A 2QO2A 3GLUA 1F7VA 2RGNC 2K7ZA 3KTDA 4UNIA 2BDTA 3HV4A 4BNTA 4QXMA 2IVVA 2VTIA 1DG1G 1TTHA 1ZC4A 1ZDMA 4N7MA 3OX2A 4JC0A 3SYLA 2VUHB 4IDOA 3TKLA 4R1VA 5DM1A 4Y6OA 3AIKA 3QZGA 4X60A 3BMNA 2P2CA 3FNGA 3W7BA 4K6MA 3OTWA 1T4GA 4BRWA 1JG1A 2O5EA 4O4HF 2H4FA 5LWMA 1J8VA 2IIVA 3V7WA 1FTWA 3ZNPA 1RM0A 3VISA 3HR7A 4YJUA 3AR2A 3KKOA 1CJSA 4BQQA 3AHJA 3R7UA 3QPVA 1IK6A 3KOZA 1FYVA 2UZDA 1IAHA 2GB4A 1BGVA 1YQWA 1UQUA 2ZI4A 2R3KA 5ENDA 1NXXA 1W8DA 3P08A 3HVJA 2PVSA 4QELA 3I42A 2WIPA 4I5DA 2A1TR 1XDWA 3WLLA 5HCXA 1SXQA 5ESWA 3QC4A 1GL9B 2DFKB 5D8DA 1PR3A 4X3FA 1UKCA 2CLIB 2OZAA 2EXXA 4LVUA 4LNUB 2I9PA 5LCXA 1WR8A 3AONB 4BGHA 4AW2A 4GG1A 4LE1A 1GNTA 3AHIA 1ST3A 3KYDA 2CHGA 2EBUA 1ZFNA 2E6KA 2QJWA 3O2NA 1KJJA 5H4GA 3VO8A 3U3MA 4FYHA 1CQXA 3USCS 5I9ZA 2WI8A 3JPWA 4ZRNA 4HTFB 2FW6A 3BH0A 2VKTA 4JG8A 4ND1A 3ZUVA 4RZHA 4RIXB 1FP4B 1P0PA 1V4NA 4K33A 1W2HA 2ZUUA 5JROA 1RXIA 3WFIA 1SVSA 4MH7A 1C7JA 4EEVA 1U9IC 1RYEA 5KU1A 5HM8A 5BUEA 4Z7GA 3UAXA 1GV0A 3IB6A 2P55A 3UP7A 1R0RE 1SVKA 3RAEC 3VZQA 4IXNA 3CRQA 5CXHA 3U26A 5CVVA 4ONAA 1XZBA 1GLVA 3SG9A 3FCCA 1B0UA 2GPNA 3QFFA 4Q3KA 3BJEA 2QT0A 4I19A 4JIGA 3DS8A 2L69A 1JKXA 1Q0HA 2PHZA 1RWKA 3IPLA 4ZRMA 5IN4A 5BVHA 1SBIA 3ZFMA 1STOA 3JRWA 5M4CA 1EWQA 4JI3B 3NYWA 2ZYTX 3FNIA 2ZB0A 1JR3A 4H0FA 4PGAA 2EWVA 4L16A 1QGAA 5C1QB 5FEQA 3D0QA 5L4NA 4RGYA 2BDEA 2X6EA 1QO0D 4RIYB 2QVBA 1O5TA 3BB3A 4NOMA 4CG9A 2MSCB 4CLOA 3MBLA 1RVDA 4OHKA 4D9BA 2C3YA 3H5TA 5LD2C 3FSGD 4X2KA 2PFKA 2W0SA 3N76A 4O4JB 4ZLYA 1S3FA 1ZOLA 3V4VB 3VKHA 1YS1X 4E6PA 3TZLA 3N6RA 5FX2A 5EHYA 4BWGA 1UKHA 4DQVA 4LTMA 3G9ZA 5KMGA 1U2TA 4W8HA 1JH8A 5F2EA 2CDZA 2HF9A 5IJZA 5CF4A 3LQ4A 4JY7A 4K87A 3G9LX 1KNQA 5DDIP 2D7DA 5C4LA 2Z9CA 2P5YA