1G8SA

Methanococcus jannaschii fibrillarin pre-rrna processing protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
230
structure length
230
Chain Sequence
MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikshii Fibrillarin
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN
total genus 69
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1g8sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g8sA02
4IWQA 4LUEA 2WD1A 3Q2MA 3VSEA 1SZMA 4QTDA 3V01A 3PE2A 3C0GA 3FPEA 3NWWA 4KBAA 2JDOA 4FKQA 4KUJA 2I40A 3QQGA 4RFZA 5B2LA 3VUHA 2RG6A 3DXQA 4KKEA 4P90A 5DIAA 2W1FA 3NPCA 4FIEA 3KKVA 1ZYCA 2B9HA 2C6OA 2J9MA 2OIDA 2W1ZA 1F0QA 3GU6A 5EG3A 4ZSGA 3REPA 2PZIA 4M7IA 2JITA 3U54A 4IKPA 4NM3A 1FINA 1PXKA 2PVYA 3D5UA 4BIEA 1ZMVA 2RKUA 3TM0A 5CF4A 5CEQA 5DLYA 2ZAZA 3EZVA 3F5UA 3FQEA 1ZKDA 4PWNA 1UWJA 3QWKA 2J0KA 3N51A 4AF3A 5M53A 3COMA 4XCUA 2ONZA 5IUHA 4E30A 5HNGA 2OW3A 4WD5A 3KU1A 3HCBA 4Z9LA 2RGPA 1HOWA 4KSQA 3ZO2A 1L9KA 2YAAA 4P7GA 5KS2A 3BGZA 2ZV2A 2BTSA 2DYLA 2GSFA 2H34A 4WSYA 1A06A 5D10A 5DA3A 1INLA 1LPUA 2DS1A 3KF4A 1XJ5A 4DA4A 2IBSA 5K0FA 2IVVA 4ZY5A 2G2IA 2XNNA 1ZY4A 3EZRA 2REIA 1YB2A 3DQWA 3LCKA 4W4WA 2EX4A 3UMXA 2JKOA 1CKJA 2ADMA 5EZSA 4QP1A 2JBOA 2XK7A 4WA9A 3ROCA 3LJ2A 4BDHA 2W5HA 4YTCA 1NW5A 2B78A 2HAKA 4OW8A 4BCMA 1FOTA 4CTKA 4CMUA 1YDTE 4RTRA 5HIBA 4MQ1A 4BP3A 5AP1A 5ACBC 5HX8A 3PSCA 3F88A 4FR4A 3TKIA 5LQRA 3I4BA 4EH6A 5LSAA 1NE2A 4HVDA 4G1WA 4BZDA 3FMLA 4YNOA 4TPTA 3NUPA 2BH2A 1GJOA 4FT3A 3DXPA 3ORZA 4HCVA 1BL6A 3MFUA 4LRMA 3WIGA 2ZW9A 5AAFA 5F1ZA 5EI6A 2NYUA 3BV3A 4E20A 5EDQA 5BYZA 3DFAA 3OCSA 4UB7A 2WNTA 4A4OA 1UVRA 5B7VA 5E1DA 3F3ZA 2F8LA 3HRFA 1BUHA 5IQBA 5IMXA 4JRNA 4PDSA 3HUBA 4DTAA 3BI6A 4OTQA 3O50A 2GAFA 4IAYA 1YZHA 4JIKA 4C03A 4X3FA 2B25A 3KPJA 5CYIA 5DTQA 2QQ7A 3SSNA 1Q61A 3UJBA 4QMLA 1H1SA 3QUEA 3ZC5A 1GY3A 2UZOA 2E9UA 3LFCA 3D7TA 3NCGA 4YZBA 5E8YA 4B6LA 3Q5IA 2FH9A 5M57A 3G2FA 3DUWA 4FKVA 4XRLA 2ETMA 4RFYA 5C9CA 3UP7A 2XYRA 3E8CA 2QKWB 4RIOA 5EPEA 4G9CA 1XDZA 2Y4IB 3DP7A 5K0NA 4JG8A 3O7WA 3EQDA 3S4QA 2YISA 3SVVA 1NW8A 3FYDA 2R6ZA 5CUQA 5A14A 3ORHA 4AUKA 4LOOA 2WMAA 2EVAA 2BDWA 4D4SA 3VF9A 3B8QA 4E31A 3UOLA 5EYMA 3GGDA 3BEAA 1CSNA 5DEYA 5JRSA 5A54A 3UPZA 4GUEA 1KR5A 1ZMUA 2PXXA 3P9KA 5BXYA 4HVSA 3B3JA 1VBFA 1H25A 3BGIA 3WYXA 4E4LA 2F57A 4CZTA 5EMMA 1WFCA 4OTHA 5AP0A 3ZM4A 2WMSA 2IJMA 2GH1A 4JRVA 2R3QA 4KWPA 4FYOA 4NIFB 2VWZA 4TYHB 3R7UA 5AUTA 2YIRA 3HVHA 4ER0A 2AC3A 3LXKA 1Q8TA 5AFVA 5CTPA 1KPGA 4NM7A 4EUTA 4IJ9A 2VDVE 5AV4A 3DBFA 3GRVA 5E1OA 4C04A 2B9IA 4I6BA 1OL1A 3W2RA 1EAMA 4UEUA 1TPYA 4O84A 4PF4A 2C3JA 4H3QA 5BVDA 5E8RA 5JFWA 4FS8A 4JQ7A 4A07A 5JH6A 4DH3A 4F70A 3W10A 4WIHA 3P9IA 3T3VA 4RZVA 3W2OA 4ERKA 4KIGA 5K09A 2XZSA 2BZGA 1NY3A 3OWLA 5EMKA 4AZVA 4CFUA 2R0UA 3B2WA 4ZK5A 3ORPA 3WZJA 1WBWA 4AOIA 3EOCA 4RJ3A 3OXIA 5D1NA 3LFDA 3KGAA 2ITTA 3VO3A 1P1BA 1OUYA 3HCFA 1A9UA 4YC8A 3C4FA 3R7VA 4MTLA 5EKUA 4C33A 1QPCA 4YMJA 4RQVA 3TG1A 3KQQA 3DAKA 1IEPA 4X6RA 1YXTA 4IE9A 1IY9A 1ORHA 3DV3A 3EJ1A 3WOWA 4DFNA 2NXCA 3C6KA 1WBOA 2Y4PA 2R3LA 2AN4A 4ACMA 4E8AA 2ZWAA 4C7TA 3MAGA 2EFJA 4XRJA 1TQPA 1JQ3A 2Y9QA 3MGGA 3NWEA 4ID7A 5M44A 1FVRA 3GQIA 3QZHA 2UZBA 4EYJA 3UA4A 5DN3A 3Q53A 2XUUA 3EN7A 2WEIA 4KKHA 4XMOA 2OXXA 4ZTLA 2J0LA 3WBLA 4B9DA 3G88A 3M4XA 5DTRA 3I5NA 4ASZA 4Q5HA 4EK8A 3E7OA 4YUZA 4I21A 4KW7A 2Z60A 4GS6A 4MVFA 5CI7A 4M13A 3VUMA 4GFMA 4FL1A 4MKCA 3WF9A 2G2FA 3ENMA 4W4VA 4YNEA 4IWNA 5CCBA 2PJDA 2O64A 4JDKA 5KZ0A 4GUAA 2YM4A 4RLLA 1SUSA 2JGZA 3RPVA 5KMIA 1J1CA 3CJGA 1OPLA 5CAOA 3MTLA 3QWJA 4JR7A 4ACGA 1SQGA 5ETIA 1ZXEA 4LL5A 5J95A 2OZVA 2ONLC 2JAVA 2XKDA 4FA2A 2PX4A 4ATNA 1R39A 4C38A 2V22A 4PYIA 2J5EA 4D5KA 4I5HA 2ZIEA 2AN3A 2ORED 5FDXA 4AACA 1J3HA 5L2WA 4FT7A 1XVAA 4O7SA 3SXRA 3TT0A 3B7PA 5BQ0A 2Y8OA 4DGNA 3QGWA 2QG5A 5AJQA 3K5UA 4H1MA 4CT2A 3P7BA 4WVLA 5ICCA 4QVGA 2C7QA 3KXZA 4I3ZA 1J91A 5F2KA 3Q4UA 2V55A 3AT2A 1YXUA 4JBVA 2A19B 3HA7A 4IX5A 4L7SA 4OTFA 2YIQA 1KE7A 5A4TA 4BICA 4E73A 2BZJA 1WAKA 3UVQA 3MGYA 5CANA 4RWLA 3LFBA 1U5QA 4KIPA 1F3LA 2J6MA 3NJRA 4KIQA 3PXZA 3GC0A 5BMMA 3RP9A 4XG7A 5DR6A 4ZSJA 4CGAA 5DFPA 4R6VA 4E5AX 3CS9A 5CEIA 3WF5A 4CKCA 1ZWSA 1O6LA 1EIZA 4C4FA 4TL0A 5HZNA 5EYCA 2XRWA 4C58A 3PIXA 5L8KA 2Z02A 5IH5A 2ZJWA 1R6AA 3SMQA 4O0YA 2ITVA 1DM2A 3OF0A 4RC2A 4A06A 1RI3A 4OUCA 5BVFA 5HEKA 3W2QA 4BDCA 3DB6A 4MTAA 3F3UA 4YURA 5F9EA 1RJDA 3CGFA 3UIXA 1PHKA 4HGLA 4C06A 3CD3A 4I92A 4UBAA 1J1BA 3UIUA 1NW6A 3QOWA 2ZM4A 4EKGA 3IKAA 3FSFA 2HZIA 3ETAA 3LHJA 1UU7A 4O38A 1PRYA 4O6EA 5KX8A 1H00A 4RG0A 2ETKA 4RQKA 4JAJA 3LCDA 2JDTA 4WHZA 3D5XA 1P5EA 3NCZA 2VO6A 5JMSA 2ZZKA 1IXKA 4MWHA 4L46A 1NKVA 2VAGA 2OH0E 5I4NA 1KP9A 5FQOA 4PNEA 5LQNA 4ITHA 1Q0SA 3WI6A 1H1QA 3OE4A 4AFEA 1YOLA 4EH3A 2CKEA 2G2HA 4QP4A 4EHGA 4ZSLA 4HSGA 5KYGA 1LEWA 2F2UA 4FZFB 4OTWA 4WUNA 5CU6A 5DWRA 3IW4A 5M55A 4XG9A 4DC2A 3T0IA 2XJ0A 3CKWA 3IOKA 4AAAA 4NU1A 4WNMA 4CFNA 3CY3A 5M4UA 4FEWA 3FYCA 5BP7A 4KSPA 4BIDA 2GQGA 2WU6A 3I79A 3H9OA 3PXFA 3HLLA 4HCUA 4IEBA 3U55A 1ZHFA 3VYWA 4OR5A 3S3IA 2FYTA 3BYOA 2J0JA 3FDNA 4EC9A 4BI1A 4F6UA 3F5PA 3GO4A 3UJ8A 2W96B 2R3GA 4FSTA 4IDVA 5E1EA 1UV5A 3RK9A 2ACXA 4BBFA 5L8LA 1R0PA 3OD6X 3ACJA 3QD2B 2G9XA 2R64A 4FT9A 4IDTA 4BCNA 3QBNA 3ORKA 5GIPE 1F38A 2VDWA 4FKSA 2UZLA 2Y7JA 3JR1A 4PTEA 3W2PA 2QE6A 2C6IA 3HP2A 1YFJA 3VBVA 1UWHA 5GINE 3DOUA 2E9OA 4KIOA 1OIYA 1DI9A 4IMYA 5IQGA 2QD9A 2B7AA 2I0YA 2OF2A 3DZOA 3FMMA 4BZNA 3FRHA 4UX9A 5DM2A 3SXJA 3PY0A 4XYFA 3LMGA 2O65A 5IA2A 2XBMA 2OLCA 2IZSA 3OCBA 4ER5A 4JOAA 3K54A 4I0TA 4C4GA 3FZ1A 4XV9A 3AMYA 3OP5A 5H8BA 1M6YA 4EQUA 3B3FA 4FTLA 1ZOEA 4FTRA 4NM0A 3G90X 2I6GA 4Y73A 3SAYA 1YI3A 2OGVA 4WG3A 2PE0A 4EOLA 5I9WA 3G2MA 3C4ZA 3FAAA 4PYNA 4XLIA 1JKTA 3FTCA 3ELDA 5HE1A 4E70A 3HV4A 3VBYA 4PNKA 3NUNA 3OZRA 4D1XA 3MH1A 4F0FA 1Y8CA 3E3PA 4HYHA 3HV7A 2AOTA 4QVKA 2IH2A 3FEGA 5AAGA 1OI9A 5M4IA 3R71A 1WBSA 2BZHB 4IANA 3SSMA 1PMNA 3O7LD 5FGKA 3EWHA 2GNGA 1SG9A 3G5LA 3TMAA 5K4IA 4QP2A 4YSMA 4EZ3A 4AT5A 2N47A 3LDFA 5DM1A 3QX2A 2OXDA 4IJPA 2WMWA 2FSMX 4QYFA 3EFLA 5DT0A 4BTKA 2IW6A 1BLXA 3F5XA 3QQUA 4MNEA 4PL3A 3QCSA 4ZY4A 2P33A 3A4TA 2XH5A 2X81A 4Q9ZA 3C6MA 4GL9A 4CKIA 3R8UA 3ZHPC 4F4PA 4DEAA 5ANDA 4ASDA 3WZKA 3TV6A 3FV8A 1B6CB 4FZVA 3PX3A 3CCNA 3PP1A 2EU9A 4F9AA 5DG5A 4AGUA 1OKWA 3U9NA 2Z6QA 5AV2A 5CVGA 2O0LA 4BTFA 3R8PA 4DMGA 4GIHA 4HYUA 4QPSA 3ZLXA 4AUAA 1A48A 4KIFA 3LFSA 3S68A 3BGVA 3G5TA 4XCXA 1OIQA 2PMNX 4GVAA 3EN5A 2VWWA 4AN3A 4YUVA 4Z16A 4DKJA 3A2CA 2WZJA 4XUDA 2JIUA 4TWNA 2H96A 2Z7RA 4R78A 1BHJA 2ZVJA 3PTAA 3PJ3A 2O63A 3VBWA 1FBNA 1ZYDA 3GCVA 2CKPA 3FXXA 5JEBA 1RJBA 2WMRA 3PTGA 5J9LA 2BROA 3T7TA 4F7SA 2Z7SA 1BX6A 1YOMA 3QA0A 1UNLA 3SQQA 4TYJA 4NWMA 5C8NA 4F99A 4QTBA 4ZTHA 1P14A 3MVMA 4I6FA 4PRJA 3UODA 1DAWA 1Q8ZA 2HK5A 1MUOA 3UOHA 1VR2A 4L3LA 3N9XA 2C5VA 2FK8A 4YJQA 3GCZA 3Q9WA 4ZAUA 2UW0A 3QU0A 3MESA 5IQHA 3QCQA 5AM7A 2P3QA 3NW9A 2PWLA 3WZUA 4DM3A 4Y30A 5K0JA 5BUJA 2I0VA 3VW6A 5I5ZA 3ZS5A 3AGLA 3VS0A 1Q62A 3TI1A 4X3FC 5EGSA 2W1EA 4X21A 3O7LB 5AAEA 3FMDA 4CRSA 4AFJA 3LQ5A 4MWIA 2R3HA 2YFXA 4NCTC 2YM6A 2P40A 3DQXA 4GIIA 5HIIA 3F9NA 2UVZA 5HICA 2UW7A 1KV1A 1GIJA 3HKOA 5H02A 4BDGA 1RJGA 3EPPA 2ZULA 4BYJA 4EZ7A 3ZOSA 4JAIA 2VTSA 4ZTRA 3VQUA 2HTEA 9MHTA 4RYLA 4IZ5A 3LSTA 1WBPA 4X2GA 2HXLA 3N4UA 2BPMA 2VTIA 4YJUA 1M7QA 4RJ4A 3HEGA 4RJ7A 3I53A 3FUWA 4FK6A 1BC5A 2QOLA 1MP8A 3NUAA 2R3IA 5ANEA 5IG1A 4CMTA 1VP3A 5M5BA 3P9JA 1XH6A 3AC2A 2YM8A 4GK2A 4LUDA 4QT1A 2V5QA 5HE2A 5H2UA 3F2NA 4EUUA 5L2TA 3NR9A 1YWRA 3BCEA 1CKIA 5BYLA 2GS2A 4UZDA 3LBYA 4PP7A 4EK9A 3R7OA 1DUSA 2OBFA 3VS2A 1X1BA 3ELJA 3EQHA 1ND4A 2ZYBA 4PDYA 4S34A 4PDOA 4U79A 4FZ6A 3DNEA 2QC6A 2YXDA 5EM7A 1GNGA 3C9WA 1FVTA 1P4FA 3CP9A 4GK4A 5DRTA 5HILA 3SM3A 5HG8A 5K0GA 4R6XA 5I9YA 2AN5A 3BWCA 4JDIA 1ZZ2A 2Z7LA 4C3PA 2P3GX 2VZ6A 3DJ6A 3Q4TA 3UJ6A 2YN8A 5J5SA 4A6EA 2Z6UA 3V5WA 1PXMA 3PZEA 3EQFA 5FD2A 5B0XA 3GUBA 3T8OA 5HCZA 5LMBA 5GIOE 3BHYA 1XQZA 2C5NA 2EWAA 3BHHA 3DXNA 4FEQA 2VWVA 3QTSA 4IIRA 4QP6A 3PG3A 1RDQE 1ZOHA 4YJPA 3ZLYA 2B0QA 1OVEA 5I9ZA 2B2CA 4ZZOA 1TQIA 5AMNA 1K2PA 4FTMA 3RPSA 5IISA 5M06A 3TM4A 1GZKA 4W4XA 3NRMA 4G34A 3V5TA 4F9WA 1X1CA 3LPMA 4USEA 4P7FA 1U59A 4WG5A 4V0GB 1FGIA 4XG6A 3EN9A 5L6WL 4R7IA 4B0GA 3HYHA 4XG4A 4ZZNA 4PQNA 4C4EA 2P1DA 5JGAA 2HENA 5CENA 2YDJA 2RFDA 4AW0A 1Z3CA 3R9RA 2PL0A 4FNXA 4IWOA 2JLDA 4N6YA 4YZDA 1X1AA 3FRIA 2VWIA 1MRVA 2BRHA 5G6VA 5E9JA 2GHMA 1U5RA 4J53A 3POOA 2GPYA 3C0HA 3I5UA 2V74B 3R04A 4O27B 1JSXA 1V0BA 5IUIA 2WOTA 3UWPA 4RVGA 3PVGA 3QALE 2V7AA 4AP7A 5AV3A 4F1TA 3FPFA 4OLIA 4P5QA 4E2XA 3QRKA 5JT2A 2BM8A 3DMFA 5EQEA 2W1IA 3IW6A 3ZYAA 2IFTA 4HGEA 2X0GA 4UYNA 3BBWA 2PUIA 3QKMA 3G0EA 4KBKA 4XV2A 3OZ6A 4W4YA 4EQMA 2R3JA 4MBIA 2WOUA 3EVCA 2CKQA 3MTIA 4QPPA 3VS3A 2UYOA 1R78A 1WXXA 5JKGA 4KDCA 4IV0A 5J9YA 4FNZA 3K0BA 1JG4A 3RAKA 3Q87B 3LQ3A 4FI1A 2BIKB 1IRKA 4S30A 2YDKA 4X2JA 4Z3VA 3ZCLA 4CG9A 3MQ2A 5CVJA 3EGVA 2OSCA 2KULA 3F2RA 3SGCA 3UQCA 1Q5KA 2VU3A 1APME 2BALA 4CFXA 3LFAA 3LCSA 4CCBA 3QRTA 2PE1A 3KMMA 2C68A 5DRDA 2JIVA 4HYSA 4ZLOA 4FTJA 1P91A 3GWZA 2OKRA 1FMKA 3FBVA 5IEYA 4V01A 2I7QA 3OZTA 5JR3A 4L3PA 1EJ6A 4K9YA 3IOPA 4DH5A 3CJQA 4LECA 5I9VA 3PA4A 4FSRA 4OTGA 4YLKA 4D9UA 4RTSA 5LCKA 3TPZA 3SX0A 1V39A 3DZQA 3ZEWA 5CAUA 3H9FA 3KR0A 3KCFA 4ISCA 3FY2A 3UYTA 4FL3A 3A7HA 3Q4CA 5IA3A 3ZU7A 4J98A 3NNXA 1GZ8A 3JWHA 4PNIA 2PV0A 2EG5A 3FHRA 3VS7A 4AZFA 3M6VA 4RVLA 4W8DA 4RIWB 3SXFA 3WF7A 4LGHA 1IA9A 3CY2A 1IM8A 5IQAA 3MERA 4NZWB 1ZGJA 2VGOA 4I6HA 2J5FA 3VS4A 2BRNA 2BRGA 3R22A 4J95A 3BGDA 2WAJA 1LUFA 3FUXA 2I0HA 4V0RA 3SRVB 3HNGA 3ROYA 1W7HA 4EOJA 3COIA 3TRKA 2GNHA 3R9OA 4GJ2A 1FMOE 2CMHA 4BLWA 2WPAA 2C6LA 1PXPA 3CIKA 3KULA 3EB0A 3U87A 3LGAA 3EQPA 4CRLA 4GOLD 4JNWA 3R7IA 4DFUA 3P7AA 4G17A 2ZMDA 5EIFA 1KOBA 3QZIA 3VBQA 2WKMA 4GK3A 3SA0A 4MAOA 5CCXA 3LIJA 2O5KA 3GU8A 2WIPA 4CCUA 5BW5A 4O7TA 2YDIA 5A4EA 3KQ7A 4C07A 1H07A 3W8QA 2YTZA 2ESMA 4E32A 3I6WA 1IA8A 3DLZA 4FV9A 4M12A 2BM9A 4JXJA 2IBTA 1H1RA 3MA3A 3QTUA 1REJA 4QMUA 4FTIA 5HKMA 3ULZA 3C3YA 5F20A 4XG8A 4BCKA 4O0VA 2Q83A 4D0XA 4G2FA 2X6EA 2C0IA 1NW1A 4JBPA 3EN6A 2YXEA 4O0TA 3HP7A 4NFNA 4GQBA 5EW8A 3PVUA 5M4CA 3VC2A 5CAVA 3DNDA 4ASXA 5ICFA 5E8UA 5HBEA 3GP0A 4QMTA 2OB1A 5LMKA 3ZRKA 3V5QA 2YZAA 2VO0A 4G3FA 3CLYA 5KBQA 1YWNA 4O91A 2F7EE 4YMHA 3CGGA 3AC1A 1IG1A 4RTLA 2H8HA 4TTHB 3JYAA 3L9MA 3FC2A 5ACKA 1PJZA 3ENHA 4FTOA 4M37A 4EMSA 1R8XA 5HG5A 1EJ0A 4ENXA 3G6GA 4PL4A 2A27A 2BHEA 3LE6A 4IVCA 3V3VA 4D2RA 3TZ8A 2EJUA 4R6WA 2C6MA 5HIKA 4QQTA 5KVAA 3TCPA 5T64A 5F95A 4PCAA 4L7FA 2ERKA 4UXQA 2XYQA 1T46A 5HD7A 4II5A 3DLCA 4J97A 3Q4ZA 1KPIA 1FJXA 1NV8A 1KUTA 2PWPA 2W06A 1VEBA 4XOYA 3GRYA 3MFRA 3FPQA 4G3DA 3JWGA 1ZMWA 2IO6A 4ONAA 2F9GA 3OXZA 5IEVA 2W05A 3OY1A 4QYYA 4RWJA 3LAUA 5DM4A 4C05A 4C08A 4C59A 2J90A 1JKSA 4WUAA 3FI8A 2IGTA 3SVZA 2PX8A 2HW7A 1SQFA 4RIYB 4GYIA 3R8VA 3ZSGA 3G7UA 4QP7A 3ME5A 2XRUA 5CVDA 5FADA 3ZBFA 3BLRA 2HNKA 3DULA 5FXRA 1G8AA 3O23A 4EOIA 3MVLA 3VJNA 2BKZA 3HGKA 1XWSA 3AT3A 5T67A 3LLAA 3BYMA 5LCJA 1YI4A 5LWNA 5BVKA 1UNHA 4YTIA 2R3MA 4CKRA 5LJJA 4PTCA 4TWPA 3R0TA 1P1CA 4HC4A 4WKQA 5LQCA 4D28A 1OL5A 2V7EA 2NPQA 4RVFA 3TFWA 3AC4A 5J9ZA 4OX9Y 2PVCA 5KO1A 4BLVA 3K3JA 3A62A 5FTOA 5C01A 5C9ZA 5IF1A 2E9PA 5CX9A 3IDBA 4EHEA 3BZBA 4E26A 2WQMA 5F2OA 4NTTA 2VTPA 2X7OA 3H3CA 4OGRA 2ITZA 4X1OA 1PKGA 5EIWA 4WRGA 5ETAA 3FPHA 2QKRA 2QONA 3MJ1A 4IX6A 1H24A 4O0XA 4WT6A 2XNEA 3SG8A 5CEOA 3A99A 3M42A 3OROA 4EHVA 1WS6A 2VX3A 1L3IA 3R24A 5DSTA 3UJCA 4V0QA 4TKSA 2P3LA 2UZ4A 3B89A 3UP2A 4MNEB 4UOEA 5CXZA 3ZUUA 4RSRA 2GTNA 5FM3A 5CSWA 1N7IA 3SW4A 4IB3A 4QP8A 2VZ9A 2C69A 5FTQA 2CGXA 3Q3BA 2AVDA 4PYQA 3TR6A 2CNUA 4U7PB 3C5IA 1VYZA 2CGUA 4QO9A 1PKDA 4L01A 3R7YA 4A9TA 2WMTA 5AP7A 4BCJA 4K11A 4BB4A 4Y2HA 4I93A 5CWZA 5E9EA 3HA5A 5EMJA 3NUSA 5L6PA 2OZAB 4CNHA 2BKKA 4IACA 2W1HA 3IV6A 2I0EA 4CWAA 2WA2A 3LHDA 2ESRA 3R3HA 1R3CA 1ZYJA 5ANIA 4WXHA 3PY3A 5DSXA 2GQSA 3MY0A 5CLPA 4ZY6A 4BBMA 5AWMA 2F2CB 3E62A 4ITIA 1H27A 2UW6A 3I81A 4ZZMA 3C4WA 4BI2A 4APCA 2BCJA 2QNJA 2HZ0A 3PWYA 5CM2Z 4LRKA 2C7PA 4EBWA 1PXNA 3OU2A 1L8TA 3NSZA 3HA8A 3LLTA 3MBLA 4ZP5A 1OL6A 3U8WA 5HIMA 4DFBA 4IAZA 5ICGA 3UIBA 3NX8A 4BLUA 3NW6A 3GRUA 4FSZA 2C6KA 5E8SA 3HCCA 2F49A 1VLMA 1UNGA 1SNXA 3ZTXA 2FRXA 3JWIA 1PYEA 2X7FA 1YXSA 2X8DA 2YA9A 5AIKA 4DN5A 1KSWA 2C1AA 3OU7A 5DXAA 4HTFB 4XHKB 1WBTA 3HX4A 4RC3A 3KQSA 1NW3A 2CKDA 3MIYA 5HIJA 2RL5A 3PXKA 4IVAA 4TYGA 3O2MA 2WK1A 4FZAB 4GOMD 2X4ZA 5E2BA 1KE8A 1WVXA 3AOXA 4KRCA 3VHKA 5A4QA 4C37A 3SXSA 3D0EA 4U7ZA 4Y5QA 2GPHA 5FULA 2E9VA 3V5LA 5CAPA 4P5ZA 5HG7A 3FMHA 3PRIA 4RIXB 4EK4A 4K6ZA 4CKEA 3MB7A 3LCUA 4X0MA 5E1SA 1YOJA 5HLNA 2R3OA 2PPQA 4ACHA 3BKXA 4IV8A 3TLJA 2XNBA 2YHVA 3DAEA 3O51A 4ANMA 4CLJA 3CEKA 3HVIA 2ZZMA 4YUWA 3P9CA 4MBJA 2P0CA 3BHVA 1JG3A 4G3EA 1OGUA 2QOOA 4AX8A 3QHRA 4OBOA 4ALVA 1P39A 2VN9A 3I0QA 5D7VA 4DLIA 5FWDA 5IDNA 4U0IA 2J51A 1OBDA 1XJDA 4O2ZA 4GC5A 3VUIA 4J99A 1RI5A 3W32A 4DG3E 4R3RA 3GU4A 3LOKA 4XH6A 5DOSA 2X6DA 5AUXA 3ZLWA 5CSPA 1FQ1B 4XLVA 4K6MA 4E2WA 4DAWA 5FCDA 3NDJA 3HDNA 4J52A 5JQ8A 5E91A 3AQVA 4GT5A 4NYEA 3R8LA 2C30A 3MY5A 4BR3A 1FP2A 4NKAA 4PONA 3DAJA 1OKVA 4DEGA 5CVVA 3BZ3A 1JQHA 5DGZA 3OW3A 5EW3A 4RTOA 5K0EA 4GV1A 3G2QA 4C62A 1R8YA 4PIPA 3BGQA 4DEDA 3FKOA 4WBOA 2GS6A 3W2SA 3LM5A 3W55A 5HU3A 4QQCA 5TO8A 3E63A 1OBGA 2WQNA 4IZYA 2XM9A 2W4JA 4AT4A 4C0TA 3NNWA 4FTTA 3HUCA 5LQJA 3FKNA 5ANJA 5J7HA 4U8ZA 3HNRA 4M7RA 3KMUA 3KN5A 2XJ1A 2Q0NA 4RIYA 4BGGA 1Z5MA 5E7RA 4FYNA 3LMIA 3OS3A 4NCTA 5HU9A 5DNRA 5BUIA 3ORIA 3COKA 5C27A 4XX9A 3ER8A 5KNJA 4Q5EA 4FKTA 4QDJA 2X2LA 3M2WA 4NK9A 5C1IA 2QVSE 2VWYA 3ZLSA 2O06A 3X0DA 2BAQA 3EQGA 2O3PA 3DK7A 3VS5A 4RA4A 3LW0A 5IQIA 4EH2A 2QU5A 4F9YA 3KRRA 3SV0A 1D2GA 5AM6A 2B52A 4BDKA 5IU2A 2VGPA 2Y4IC 3MHTA 5HOQA 4ZTNA 4YJRA 2J2IB 2QO9A 4QMSA 3HVCA 1IR3A 3RMFA 3UBDA 1R00A 2GNJA 4FKIA 4ZJIA 1DL5A 2OFVA 3E92A 3OTVA 3PX2A 4HTFA 4OQDA 5CAQA 3P23A 3OPNA 3OUKA 5K03A 4FIFA 4PMPA 3A8WA 1SUIA 3P2KA 3AD4A 3QTRA 4RT7A 5CI6A 4FODA 3A27A 2GFCA 3EEOA 4RVMA 2PVHA 4U42A 5GHVA 3IW5A 4RLKA 3AG9A 4GF5A 4E2YA 4BCHA 2OIBA 2ZMCA 4IQ6A 1JWHA 2X39A 3RCJA 4BCFA 4I41A 2GLUA 4DEIA 3TZ7A 4M67A 4EL9A 4JXFA 4JI9A 3CR0A 4DLJA 4GUBA 3TV7A 4ZLZA 4O29A 3R6TA 2CMGA 8MHTA 1VE3A 5K01A 2FSOX 4DGMA 3KN6A 2VTRA 3GFWA 3OWJA 2VD5A 3P78A 3PZHA 4IW0A 3EQCA 4MYGA 4DFLA 5KMNA 5K3YA 3V8TA 3EVAA 5FHRA 4FTCA 3CVOA 3KC3A 4RX7A 2WIHA 3TXOA 3R30A 2QLUA 3G9LX 3OHTA 3PIYA 3HA3A 3P8ZA 4ZXTA 5HHWA 3P86A 3E8DA 3VUGA 3R0QA 1RW8A 4EH7A 5LVMA 5GWXA 1BI8A 3FPMA 5L6OA 3NIEA 4Z2YA 2A1AB 4FBXA 3DT1A 5CSHA 1ZAOA 4R1VA 2OH4A 3IEIA 3QTIA 5E8ZA 5EM5A 5AUWA 1AF7A 5K0CA 4XG3A 3Q5ZA 3KQWA 4AW2A 4QRCA 4F6WA 1OM1A 4XG2A 5EOVA 3GNLA 1KPHA 4KRGA 2IIPA 3HZTA 4ZOGA 2VTHA 5GM2A 2PZ5A 3D4QA 2NP6A 3JVSA 3Q9ZA 3ANQA 4F0IA 5A4LA 1YXXA 3SOAA 5HBHA 2OKCA 3V51A 4GT3A 4E93A 5BVEA 3IHTA 3C51A 2ZCJA 3ZSHA 3OT8A 3T9IA 3W33A 3IW8A 3BHTA 4H39A 4FG9A 4PX6A 3KK9A 3BWFA 3TNIA 4EORA 3KR1A 3ID6C 5K4JA 4QMPA 3PE1A 3PPKA 2XYUA 4FKOA 2XK8A 2WXVA 3EQRA 3I1AA 3EH9A 3EYGA 3PRFA 4IB0A 3VRZA 5TT7A 4OT5A 3NVKI 4FGZA 3BLHA 4BDAA 2F7ZE 5E4HA 4GBED 4O7LA 4H3PA 3GGFA 3OC1A 4QYGA 3HAMA 3QQJA 3UG2A 3TUDA 2CL5A 3M33A 4YV1A 3AXTA 3QZFA 4F7LA 5AA9A 1CM8A 4M68A 1U2ZA 2XA4A 2BDJA 2B55A 3KPUA 1FPUA 5MHTA 4L9IA 1Q3DA 4L67A 5DRBA 3PA3A 4AE9A 2YWPA 4ANSA 1L3BA 3KQVA 3KPYA 1WY7A 3LCCA 2PVKA 3LJ1A 4YLJA 4PGHA 4S33A 3S00A 1H1DA 2C47A 5FEDA 5C4KA 4M36A 3UNKA 2G70A 4C34A 1Y6BA 4L43A 5EYKA 2Z6AA 4YJOA 1EH4A 4DCMA 3TJDA 1QPDA 2R3PA 3LJ0A 4CXAA 1U4DA 3JY0A 1G8SA 4BCIA 4QQJA 4PCLA 3NLBA 1GAGA 3DJ5A 3IECA 4Y85A 5FHQA 3NDMA 5FQNA 3ZM9A 4LG1A 3QF9A 2CWWA 3UZTA 2PYWA 3IO7A 5FEEA 3CC6A 1Z57A 4BDJA 2R7IA 5DI1A 5JFXA 3P97A 2ZFUA 4KDRA 5LQAA 3R2BA 3LCTA 4FV4A 5EK7A 2H1RA 1NW7A 5DT2A 4UYAA 2EXCX 3DGKA 3FUTA 4LV8A 2OK1A 3U6HA 2CGWA 3KL8A 5HTBA 4YO4A 2V7OA 4EWQA 5IQCA 5IMEA 4NT4A 3PLAE 5DR2A 4ZTSA 3GVUA 3UJGA 4AT3A 3KXHA 2HY0A 4XV3A 5KHXA 2WTJA 5FDPA 1SYKA 2VX0A 5DVRA 2IVTA 3DOGA 5I9XA 1H0WA 3E05A 1XH5A 4IC8A 4YZCA 2FVDA 5IQDA 1JQDA 5K5XA 4ZMEA 4FT0A 1Q0TA 4JVGA 4N0SA 2JDRA 3R02A 3RHXA 2I7CA 4RBLA 2UYQA 1JG2A 2XCKA 4GG7A 2ZOQA 3KRLA 3TKHA 4FGRA 2PVRA 2XIXA 2YITA 3G6HA 5H8EA 3RCDA 4DFYA 5IDPA 5L2IA 3CD8A 2ZIGA 4FG7A 4FV8A 2SRCA 4FEUA 4FIGA 1H4LA 3UPXA 5T6KA 3KMWA 2ZB0A 2FUMA 4NJDA 2UW9A 1UKHA 1U46A 3JS2A 2XBJA 4U7TB 5D7AA 3TNWA 4EYMA 2XMYA 4ORKA 3ZH8A 2GS7A 4FUYA 4BCGA 1LEZA 5BVOA 2IDKA 1KHHA 5FBOA 2LD4A 5EM8A 3MIAA 3LQ8A 2BAJA 2DUVA 3V5PA 2QHNA 3QQHA 1QCFA 4WRSA 5CQUA 5CVFA 4O81A 5D11A 3B3GA 4RX8A 2P55A 3UZRA 4DGGA 2ITUA 4HGYA 4YV0A 1YFLA 4YUQA 3GCPA 4FK3A 3W1FA 3QLFA 3WSTA 2XB7A 4YV2A 3RINA 5K05A 3R9DA 2UZNA 4YP8A 2WQBA 2ERZE 3MVHA 1O6YA 4FEXA 4I22A 3ERCA 2AZTA 5HO8A 2VTQA 2C5YA 4JBQA 3KKZA 4UZHA 4MK0A 4KAOA 2OG8A 3PJ1A 2XK6A 3WYYA 3TACA 1PMUA 4DG2E 1V1KA 3GXLA 4AXAA 4WG4A 4ER6A 4UXLA 1K9AA 3ET7A 3LVPA 5EHYA 4LYNA 4QTUB 4C36A 2YM3A 4GOOD 3D5VA 4AZTA 3H30A 1TVOA 4U3YA 4C4IA 3NS9A 5A4CA 2ZSUA 1JG1A 1PMEA 1M2RA 2EB2A 4FKJA 4EZ5A 5CU0A 4WNOA 2X1NA 4X3JA 5IA0A 2WMQA 4QOXA 3BX5A 2XJ2A 4DFXE 5FWAA 3PP0A 5JUWA 3IW7A 4YGAA 2FSTX 2IZTA 3A8XA 4MF1A 3BLQA 4N4SA 1FGKA 2B1PA 3QYZA 2HZ4A 4OT6A 2W1DA 4E7WA 3OT3A 4TYHA 3VRYA 1NVSA 4IB1A 1WMKA 4F9BA 1XDSA 5J8IA 3HMOA 4OTRA 4D5HA 2V62A 4FIHA 4F64A 4X60A 3CE3A 2PVFA 5ERGB 4AU8A 1WG8A 2OPBA 2WTKB 2ZTHA 5EOLA 3I7CA 2ZBRA 4M8TA 4K2RA 4FT2A 4H36A 1JTEA 3CKXA 3I64A 4CTJA 4ALWA 3F66A 3SG9A 3GCQA 3DH0A 3TM5A 4FGBA 3R8MA 3ACKA 3BQRA 4K8AA 5CT7A 3V8WA 2R3RA 1ZYSA 4CSVA 5KBRA 3FLNC 2PK9A 2RFSA 3LDGA 3LL7A 3PB3A 2PX2A 2X2MA 2RFNA 3UGCA 1HCKA 4EKIA 3GQLA 3I6UA 2AS0A 3LCVB 2WFYA 4DHFA 4PIMA 1YKRA 4DH8A 3DR5A 4ANQA 4M14A 4IFCA 3QL8A 1KYWA 2YXLA 4OA8A 2CNQA 4J71A 3AXSA 1M2PA 4F6SA 5E8JA 2BRMA 4I6QA 5HG9A 3UC3A 1HNNA 4EWHA 3K3IA 4BIBA 3E3BX 5C8KA 3DMGA 4KA3A 4PTGA 5BVNA 1M6EX 1V0OA 5K0BA 2JHAA 3FZTA 3KB7A 3UE4A 2JH8A 2PGXA 4IFGA 3DU8A 5HLPA 4U41A 1NA7A 3LKZA 4AN9A 2JHPA 4EOSA 5D1JA 3F4KA 4C4AA 1BKXA 5A46A 4YZNA 3G5DA 4J8MA 4QNYA 3HCDA 5I0BA 4X2NA 2HR1A 2O07A 1JBPE 3ZSIA 3II5A 3RTPA 3KQPA 5HCYA 3ZDIA 2UYHA 5KKRB 4PMTA 4BYIA 5HIEA 1SVUA 4NUSA 3D2LA 4IC7A 1DS5A 4ZEGA 5B2KA 1QPJA 4DFZE 3F5GA 3AY0A 3L9LA 2JEDA 2PE2A 2XIZA 3NWBA 4QDKA 2VTMA 4BP1A 4OTIA 3ORXA 5CVUA 2JKQA 5CZHA 3E8SA 3PUPA 5FM2A 5L8JA 2VP3A 2QOIA 4TZRA 3PXQA 5AA8A 3ZONA 3HVKA 4GFOA 5GM1A 3SD0A 2CN8A 1XBAA 3ZUTA 4ZJVA 3TNPC 3PVCA 3A4OX 4YJVA 3ELWA 5BW4A 2RFEA 3OWPA 5CZIA 4UWYA 2PVNA 2PZYA 1H0VA 3DFCB 4HOKA 2JKKA 5EW9A 4OQEA 2BVAA 2WQEA 4LMNA 2CSNA 3JWJA 1Q24A 4DT9A 3IGOA 2A4LA 5IPJA 4DH1A 2ZM3A 3L9NA 5KMKA 3EMGA 3L8PA 3FPGA 4ZTBA 4FIIA 3SX9A 4DITA 5AEPA 4BCPA 3HRBA 4DTKA 1XCJA 2XYNA 4DE4A 2X9FA 3K5VA 5EG5A 2Y1WA 3V6RA 3P79A 5EC8A 3P1AA 2G1TA 3FUPA 1M52A 3N4VA 4FVQA 5GJDA 3HCAA 2HZNA 2W1GA 1XHAA 4KBCA 3C4EA 2BILB 1OPKA 4AOTA 1YQJA 3RODA 3R21A 1XH4A 4C2VA 3UMWA 1MQ4A 5BUEA 3QFVA 2QR7A 2P2IA 3F2AA 4XJ0A 1QAMA 1OECA 4IHPA 2O57A 4CFFA 4PWYA 10MHA 4EH9A 3MH2A 1RI1A 3K6RA 3UO4A 2WMUA 3CPBA 2ZVAA 3TTJA 5D41A 2GTMA 2IG7A 3CPCA 4GEKA 3PJCA 3EVZA 3M70A 2B4SB 4EVIA 3OEZA 5AUYA 2QYOA 2C6DA 5CT0A 3AC5A 2PVJA 2NP8A 2O8YA 3P08A 4FSWA 3RGFA 3ZUVA 2Z8CA 5LWMA 2NXEA 3K2LA 2CCIA 4E6CA 4QPNA 3OY3A 4ER3A 3L1SA 4O7NA 3DCVA 4KS7A 2G01A 2H11A 5FG8A 3BKWA 1W83A 4E2ZA 4RA5A 1QL6A 1LR4A 3ELYA 3IDCA 4A7CA 1H8FA 3VHEA 5L2SA 5G02A 3PWDA 4O2PA 1T45A 5IA1A 4R7BA 3G8AA 4QMVA 2NP7A 5IH3A 1OB3A 4QP9A 4FKLA 1FP1D 1FPQA 3KU2A 3BWMA 3AC3A 3ZXZA 4ENYA 1DI8A 5TKDA 4PYOA 4YJTA 4RRVA 3PIZA 4GFGA 5IH4A 4G31A 4JX7A 2W5BA 3BWBA 5HFJA 3OFJA 5C26A 1ZG3A 4FOCA 4FP9A 3KQTA 3GB2A 3H0ZA 4P7EA 2AC5A 3CBGA 3HDMA 2UZEA 4O0WA 4RSSA 4Y95A 4F09A 4OTDA 3SHEA 4D55A 3FLZA 5C8MA 4FIJA 2VTOA 4B99A 2OI4X 4FTAA 5JZNA 2QO2A 4IX3A 3EQBA 3ZC6A 2JKMA 5ITAA 2VDUE 3EHAA 5E8WA 1KE6A 2JDSA 2XYVA 5M08A 1NBIA 3O0GA 3JVRA 2C1BA 3LBFA 3IGGA 3OOGA 3EQIA 1PW2A 1PXIA 4DG0E 4HPUE 5M4FA 2P3OA 2PU8A 2H6DA 2X8EA 1R1WA 3IG7A 3ER9A 1CDKA 2HOGA 3CQEA 3OE5A 2XK9A 2PVMA 4YJSA 2G72A 4YJNA 2PKWA 1X8BA 3VS6A 5H3QA 4AN2A 4I5CA 4A6DA 5BMSA 4RTNA 3ERKA 3DMHA 4L00A 4FE2A 2C5OA 4XP3A 4F1MA 1P2AA 3D94A 5HLWA 3FWQA 1BL7A 3FE3A 4NH1A 3MFSA 2P2HA 3VVHA 1OIUA 4E6AA 2PUUA 1OKYA 2R2PA 3F7ZA 4HJOA 2HXQA 4M69B 2HCKA 3THBA 3U51A 4EK6A 5EQPA 4RVKA 4HVIA 2XVMA 1I09A 2YCQA 5U4XA 1XTPA 2EXMA 3GRZA 1VYWA 4ACCA 5HEZA 3DDPA 4X2FA 5LMKC 5ANOA 3DKCA 3RHKA 1JKLA 3NGAA 3SKCA 3TL8A 2BR1A 4QP3A 4QMYA 4XUFA 5EHLA 2OWBA 2QU6A 3D83A 4L68A 1VPTA 4R05A 4EOQA 1OPJA 3D9VA 3PG1A 4TY1A 1YXVA 3KRWA 3KHKA 2K4MA 2YABA 4O7ZA 4NW5A 3ZFMA 4N6ZA 3RM6A 4CFWA 1D2HA 2IW9A 2PMIA 3NUXA 2PZRA 1WZNA 3HRCA 4XUEA 5DRYA 5E1MA 5ICEA 1XKKA 3BQCA 3LXLA 2PHKA 4F86A 1MRUA 2QY6A 1YF3A 2BFXA 4JDJA 4GKIA 4RX9A 4AS0A 3A4PA 4AZWA 1WCCA 4A9RA 1B42A 3LX6A 3HVJA 2W0JA 5JRQA 4YC6A 1ERKA 1YI6A 1YHWA 3C4CA 1MRYA 3EIDA 3MSSA 4HPTE 2R5TA 4MXAA 5C03A 2HMYB 2GQRA 2QOHA 2ZB1A 4JG7A 3MB6A 3HM2A 3O8TA 3VUKA 5CEPA 4O83A 3QD3A 5E2AA 2OY0A 5TR6A 3KR2A 5CF6A 2FCAA 4HG2A 3O8PA 3I7BA 2GNLA 2WTVA 3LM0A 3D2KA 2WGJA 4FSUA 2I1MA 4DGLC 2AOVA 5K9IA 3BIZA 3PDTA 3R83A 1LP4A 3C5UA 4ARKA 2QOCA 2C0OA 4IVDA 3O4FA 2OO3A 3T7SA 2W17A 1YVJA 2XF0A 4MH7A 4O7VA 3LKDA 2ZV8A 4BHNA 3H4JA 4UN0C 2XEZA 4MD9E 3G33A 2PY6A 3QTZA 1T43A 2WTDA 3FZOA 3PXRA 4R3PA 4CKJA 1PMVA 4FVPA 5LVNA 2VNYA 5B1SA 1PXJA 3FC1X 1JSVA 4NFMA 3UJ7A 2GS9A 2X9EA 3DKFA 4JIAA 5DBXA 3JPVA 3COHA 4EBVA 4NTSA 4F7NA 3RWQA 4MQ2A 2JG3A 2A14A 5AIRA 4M15A 4MHTA 2ITPA 3GOPA 4B17A 4RWIA 2UYCA 3ITZA 3FI2A 2R3FA 2UZWE 5CF8A 1EQAA 3CTJA 2JBPA 1G5SA 2QOBA 3L8XA 3LDUA 3OU6A 4YHJA 4R1YA 2IZUA 1G3NA 3TDVA 4TWCA 2ETRA 1JNKA 3BHUA 3NAXA 3WF6A 3BPRA 4F08A 2ZV9A 5D12A 4E4XA 4M0ZA 5JGDA 2BFYA 2HY81 2XIKA 4G5JA 3NAYA 2W9ZB 1W84A 3GC8A 3FYKX 1JVPP 3WZDA 2AOWA 4I4EA 2UVYA 4FV7A 4FSYA 3DB8A 3A7EA 4EQZA 2YX1A 2UZUE 2UW4A 3OOMA 1OUKA 2GNFA 1U54A 4IM0A 3KRXA 1YDRE 1ZY5A 2NO3A 2YCSA 2YM7A 3H10A 3L9PA 4QQ5A 4CFVA 4DA5A 3MWUA 2AVNA 4OBXA 4AW5A 2ITXA 4EH8A 4F65A 1QAOA 1REKA 4FNWA 2XNPA 5CSVA 4TNDA 4GJ3A 4TNBA 5JFSA 1BMKA 4BCQA 4QTEA 5A6NA 2VV9A 4IX4A 3QX4A 1OL7A 3RAHA 3KXXA 3UZPA 2XKEA 2BUJA 5ANGA 3D2IA 3UJAA 2PUNA 4L8MA 5EYDA 4CV9A 2EB3A 3OCTA 3QCYA 4EONA 4OA5A 3UJDA 2QOQA 2XIYA 3LMHA 4YHTA 2JFMA 2JAMA 2ZBQA 3GU3A 2JC6A 3P5KA 3UC4A 3UJ9A 2B9JA 5KMJA 3V97A 4QPAA 4W8EA 4RX5A 4RVTA 5HD4A 4BHZA 3HMPA 1RI2A 1OR8A 2ZIFA 3VWAA 5CNOA 3RK7A 3VF8A 4O0RA 2NNWB 2DQ7X 4U97A 3VAPA 3A7DA 3CJTA 3VN9A 3TKUA 1H26A 3NW5A 3B8RA 4C3FA 2XP2A 3FTEA 1SVEA 1Q41A 2AUHA 3IS5A 4S31A 4YMGA 2ZDUA 2Y6OA 3ZEPA 3HECA 4G5PA 4KRDA 3VBTA 5T6BA 4GYGA 4B4LA 2C7RA 3GC7A 3NNVA 5CXHA 3UIMA 3PPZA 1XH7A 2Z2WA 2UW8A 3Q9YA 3QD0A 2PY3A 4E5WA 4QQKA 4Q9SA 3FYJX 3R63A 3WE8A 5CEMA 1QYRA 5I9UA 2W7XA 3EKNA 1XBCA 4M97A 2WU7A 4O7YA 3ANXA 3FY0A 3IQ7A 2HWKA 2QRVA 5EKXA 4L7VA 4JS8A 3TKYA 4DEEA 4BCOA 2JIIA 3OCGA 3RZBA 3TZMA 2WTIA 1UWVA 4PMSA 4MIKA 3QTXA 2IW8A 3F82A 3F3WA 5B2MA 5DT4A 4O6LA 1Q8YA 2A0CX 2IDJA 3MDYA 1Q3WA 3UZUA 1W8CA 2PWYA 2JDVA 4CMOA 3BU3A 4FUXA 5A6OA 1G60A 2PSSA 4LWPA 3NIZA 3OVVA 4FNYA 1JSTA 4P4CA 3NYXA 4EJNA 4GG5A 4NSTA 1DAYA 2CKOA 2Y6MA 2PXCA 4U81A 4QTTB 3RWPA 3ZBXA 3EKKA 5GOZA 3FZGA 3FLYA 3MTFA 1N2XA 1SKMA 4HW7A 1ZLTA 3FPJA 2W4OA 5EI2A 3OW4A 1XH8A 1ZOGA 4J1RA 5FEQA 4PGGA 4J8NA 3FSKA 3GI3A 3OZSA 3PXYA 5CALA 2ITOA 3RK5A 2W99B 3HTXA 4CTBA 5F94A 3MH0A 4TWOA 3UYSA 4HZSA 3W16A 5DEWA 3LECA 5DPMA 3MPTA 4UWBA 3REOA 3FMEA 4A4XA 3SOCA 1F3MC 2WTCA 3R1SA 3OG7A 3R9XB 3UA3A 3WZEA 2I9KA 4BTJA 3GC9A 1S9JA 4I23A 4CZUA 4EH4A 2QLQA 2NXNA 5E8TA 4BDFA 5BYYA 2AOTB 3O17A 4X41A 3F69A 3PYYA 3GU7A 5D9HA 3RNIA 4BDDA 3MFTA 4GW8A 5CY3A 3VBXA 4EOKA 1RJFA 3FTFA 4AZSA 4GT4A 2PTKA 3VW8A 4IAFA 3MV5A 4CT1A 3MPMA 3MW1A 3CC8A 2BAKA 5KCVA 1ATPE 4HYIA 5JZJA 5M09A 4HCTA 5CVEA 3R9HA 2QRVB 1NXKA 3UBTA 2CLXA 3OXTA 2FA2A 2UW5A 5KMLA 5H8GA 5CIYA 3KVWA 3NUYA 3CCFA 3RAWA 1E1VA 1SMHA 1YHSA 2C5XA 5FLFA 4F0GA 4HNFA 4H3BA 2FPOA 4POOA 2IWIA 3ATTA 2ZM1A 2OU7A 3P2EA 4AQCA 5FXSA 5DT3A 7MHTA 2VX1A 3E88A 3KQOA 4H58A 3UQFA 5EKNA 4NJ3A 3ORMA 1JSZA 3MCTA 4LMUA 3ZO1A 3E23A 3LPBA 3R7EA 4USFA 1O9GA 2BRBA 4FKGA 2R7BA 3CGOA 4RTPA 3FHIA 3NYNA 3U4WA 3UOKA 5JK3A 3KVXA 3TWJA 1WVYA 4U43A 3UTOA 3PVBA 3PVWA 4V04A 3S2PA 3QKKA 5IZFA 1UKIA 3OEFX 4CVAA 4RWKA 2YEXA 3ZRLA 3ZXTA 5IH6A 5EI8A 5KMOA 2HWOA 4BGQA 1KOAA 3E93A 2X8IA 4WNPA 4B8LA 2YUIA 5FA5A 3PJ8A 4U3ZA 4AA5A 2UW3A 4FVRA 1W82A 3FI3A 2CCHA 5EOBA 5HE0A 5KUPA 1B39A 1J7IA 1U54B 2VRXA 3F7WA 3LCOA 5T68A 3TUCA 3FUUA 2P35A 1KE9A 2XS0A 1Q8WA 1XH9A 4IADA 3R1YA 5IA5A 3Q9XA 2QODA 3DK6A 3ODYX 4XOZA 3BBTB 2PZPA 3BKBA 1Y8GA 3R6XA 3A25A 3OMVA 2HELA 2YM5A 2XKCA 3HA6A 4FV5A 2ITNA 4K1BA 4PY1A 1XR1A 2GU8A 5ICPA 5HQ0A 3I5ZA 1IAJA 2YCRA 5D1HA 4MCVA 5CVHA 3BXOA 3ZFXA 4YHFA 2ITQA 1H1WA 4G56A 3AGMA 4PDPA 3UDBA 3ULIA 4Q2AA 2BR3A 5DXJA 4OBPA 4D2SA 1I9GA 3QRJA 4A9UA 1M17A 3WIKA 1UU3A 2OJ9A 3VS1A 2OYRA 3ZFYA 3KREA 1NT2A 2NRUA 3MPAA 4ZSAA 3RIEA 2QHMA 2YACA 2WELA 1KIAA 5H9BA 4PUZA 3CJFA 2WMXA 4HNIA 4RIXA 4A9SA 4N57A 4EOPA 4H1JA 5E9QA 4JBOA 2P7HA 4OBQA 5KKRC 3MB5A 3PFHA 4MXYA 2I62A 1AQJA 4GRBA 3BYVA 1Q8UA 2X4FA 1AD5A 3S0OA 4KWCA 5DTMA 3DK3A 3I0OA 2VTLA 4RV9A 4AGDA 4I0RA 2QOKA 3H9RA 4JQ8A 4XS2A 3FKLA 4U40A 1M2QA 4EK5A 3M6XA 4KVZA 5EZQA 4S2ZA 3O71A 5IQFA 2KTYA 3KRJA 4LRJA 4IH8A 3GU5A 5K5NA 3Q2JA 5DWQA 1QMZA 1Q99A 2QURA 4X7QA 1OKZA 4PYMA 4QMQA 4YBKA 2PMLX 4YTHA 3FMNA 4FL2A 5IA4A 5LQUA 3IPHA 4R8SA 3M6UA 4DTBA 4MQ4A 3G9NA 1NBHA 2OICA 4XV1A 4R5SA 4ZTMA 5IQEA 5HNIX 3GCSA 3RPRA 3P71T 2NRYA 3THRA 1RE8A 5TOZA 4O7WA 2Y1XA 4QYHA 3DPKA 3R1NA 3CJRA 4F85A 5TF9A 3Q04A 3M6WA 4PMMA 3OFKA 1XBBA 4EEVA 3CQUA 3OBGA 4CD0A 4PL5A 4RWZA 3MJ2A 3KPWA 3PFQA 5CQWA 3PT9A 3LXNA 5E9WA 5FA8A 4YUXA 2O05A 2W5AA 4Z7HA 2GCDA 5ETFA 5M56A 3THSA 1OZ1A 4K33A 2YZLA 4KABA 2CLQA 5FUBA 2PX5A 3Q32A 2EUFB 4R3CA 2XCHA 2P4IA 4FV2A 5E8VA 3HEMA 1H01A 3OUNB 4NECA 2W9FB 3NEWA 2Y0AA 1R74A 2LAVA 2HW6A 3R00A 4BDIA 3EVBA 4KB8A 3WARA 2F7XE 5CS6A 3KFAA 4IAAA 4DZRA 5EH0A 4DBXA 3BUSA 3FL5A 2BIYA 1SNUA 3WILA 3EYHA 4MEDA 4BDBA 3BU6A 4HGSA 2DWBA 4FZDB 4D58A 3UVRA 4AW1A 3EFJA 4KNBA 5K0LA 3BE9A 1STCE 1BKYA 1X1DA 4FG8A 4ASEA 4ERWA 3B5IA 4LWOA 3HAVA 3W18A 2XVAA 4DCGA 2XNMA 4CEGA 5P8WA 3MYGA 2UVXA 5AUVA 4FSQA 1PY5A 3Q6WA 1IAHA 2BR4A 4FX3A 3TNQB 2BDFA 4FTNA 2ZV7A 3KQYA 4X63A 4MXZA 3P7CA 4I94A 4GOND 3PSDA 1URWA 3I9FA 2CJMA 4FKPA 5AP2A 2VWXA 2VWBA 5ANKA 3EGIA 3AD6A 4C02A 2IH5A 2CHLA 4N70A 4FKRA 3HCEA 2LGCA 4HGTA 5AV1A 5AUUA 4DT8A 4DCAA 2C3IB 4ER7A 3VJOA 5HO7A 3QUPA 3G51A 2QI8A 4YPSA 3OWKA 2GFSA 4OBWA 4WO5A 4QMNA 1X19A 2WHBA 3OBJA 5EMLA 1I44A 4LM5A 4QMXA 3LKMA 5HX6A 1O9UA 4RJ6A 4YLLA 4KKGA 3IK3A 4J7BA 5AP4A 3RJCA 2R3SA 2VTTA 3Q6UA 3MS9A 2QOFA 4O82A 2P7IA 2G1PA 2FB8A 2QO7A 3T9TA 4FSMA 1AQIA 3QC4A 3NVMB 3U9CA 3R1QA 4G16A 2PXAA 3ELUA 1H08A 3EMBA 4M0YA 5JSMA 2VTNA 4U5JA 3EN4A 3DTWA 2OO8X 3A7GA 4K0YA 2F4JA 4CKBA 5CEKA 4RMZA 2G15A 5GJFA 2OJJA 4QMMA 3VC4A 2IVUA 3M11A 4I5MA 4WBBB 3TIZA 1TKIA 4G6NA 1BOOA 3F3VA 3GENA 5EEHA 3E7PA 4O0UA 3DXXA 3NNUA 2WTWA 4ZJJA 1JPAA 3QRUA 3GEQA 4LV5A 3DDQA 4R7HA 4E5BA 3BEGA 4QTAA 2IH4A 3H0YA 4TXCA 2QR8A 4WNKA 3FUVA 3KF7A 3AMBA 1XDUA 4QMOA 4L44A 4MHAA 5LXMA 3BU5A 2YR0A 3BWYA 5BPYA 2GDOA 3I58A 3T7RA 1JLUE 2YWVA 3A7JA 2YJRA 2G71A 3UO5A 3LFQA 2JHCA 3UOJA 4ITJA 3QOXA 3PA5A 4L53A 2OBJA 2UV2A 5BNJA 4RVHA 3CQWA 4I4FA 1MQBA 2Q41A 2HV9A 3BELA 3DKOA 2O2UA 3GT8A 1UA2A 1OIRA 3F3TA 3SLSA 1QAQA 3EVEA 1WVWA 4HRAA 3U4UA 4GCJA 3O8UA 4JQEA 4ACDA 3G89A 1XCLA 5KMMA 5KQRA 1NV9A 4QNAA 2AR0A 3R2YA 5DE2A 4O0SA 3TKAA 3P2IA 4DYMA 3CSVA 3QUDA 1UIRA 3R01A 1AGWA 1GIHA 3RKBA 2B53A 4YBJA 4C2WA 1Q97A 4FT4A 4I24A 3E7VA 4JDHA 2CDZA 2OF4A 2B9FA 2C3KA 3KXMA 1GIIA 2C4GA 2ZDTA 3MVJA 3QTQA 2PT6A 4P7KA 3U81A 4RTMA 2E9NA 3BV2A 4XP2A 5CU4A 3QQFA 1R0EA 1Y8YA 2R3KA 4BN1A 3NYVA 3NYOA 4EKKA 3KXNA 1QANA 2OZOA 1ZARA 4D1SA 4IZ7A 3GBZA 3B2TA 2GNIA 4L3JA 2YJSA 3C0KA 4ZLYA 4QTCA 1O54A 3FJQE 5GP1A 1G55A 2E5WA 1OL2A 2X2KA 3NW7A 4FC0A 2WEVA 4L45A 3V5JA 4TRLA 3TZ9A 1QZZA 1EG2A 2VS1A 3QQLA 3Q96A 4YU2A 5F4NA 2WA1A 1VIDA 2VTJA 1FVVA 2PVLA 5C4LA 1HMYA 1E9HA 4E6QA 3ZZEA 5AADA 4E4NA 5DX0A 3DLSA 3L8VA 4FZ7A 1IASA 4TT7A 4IWPA 5LVOA 4BY9E 4I5PA 5J1WA 4CV8A 4DGOA 5LQFA 4E33A 5CD1A 2PLWA 2FO0A 5DHJA 3PSBA 4CG8A 4ANBA 4HH4A 4LI5A 3FI4A 1I1NA 4M3QA 3HMIA 4C3RA 5DH3A 4AA4A 4YO6A 1ORIA 3KY2A 4P58A 2R4BA 3MH3A 2GA9A 5HBJA 1GZNA 2C6TA 4E4MA 4X6QC 2ITWA 4DCEA 1ZQ9A 3AJDA 1E1XA 4KS8A 2JH9A 3KCKA 3TUBA 4FV3A 3ORLA 2UZDA 2X7GA 4ZMFA 5HTCA 3LFEA 4ANLA 4JX3A 3GJYA 4FR0A 4LFIA 4NW6A 4FT5A 4LQMA 4EC8A 2E2BA 3G15A 5JN2A 3LZBA 3R28A 2DPMA 4O96A 3A7IA 1M14A 1RQQA 4MX9A 4O22A 4O7RA 1N7JA 1NVQA 3GRRA 2GHGA 4FKUA 4K18A 2XVDA 2J50A 3EEYA 3EGEA 2Q0BA 3KK8A 2CGVA 4EHZA 5LVPA 3ALNA 2H00A 3HV3A 3QGYA 2AOXA 4ALUA 3AXWA 5FP6A 4ZIMA 5GNKA 4BC6A 2ZZNA 3KULB 4EH5A 3OCJA 2WMVA 1Q4LA 2YCFA 5HE3A 3UVPA 4GEOA 1CMKE 4USDA 5A3XA 1L3CA 4JJRA 2B3TA 3WF8A 1SVHA 1OMWA 3TEIA 3D15A 5CF5A 2YVLA 5C0OE 5KQSA 2YERA 1PYXA 4RJ8A 2J0MB 3SW7A 1NVRA 1XXLA 4EOOA 5DR9A 5IKMA 2R0IA 1V0PA 4MXOA 3QLGA 1VL5A 3AT4A 4IAKA 3ZRMA 2C3LA 3LFFA 4GSBA 4QQNA 3JY9A 3JUHA 4D4YA 3QQKA 1WZYA 4C4HA 3RAIA 4AGCA 3A7FA 5FTWA 2OFUA 1BYGA 4F9CA 4G3GA 3DLIA 1Y57A 2C6EA 2I6LA 5HCXA 5HNBA 3E64A 5J87A 4BF2A 1F5QA 4TYEA 3EVDA 5AX3A 1JR4A 4IZAA 4GC9A 3CTHA 4MBLA 2UZVA 4DEHA 2ERCA 4TN6A 4I0SA 3V6SA 1VZOA 3DXZA 4IAIA 4QMZA 3UQGA 4YUYA 4FMQA 1SVGA 4EK3A 4D9TA 1G6Q1 3FLSA 2B9EA 4RX1A 4MNFA 3HV6A 5DYJA 5LVLA 3Q7EA 1MJFA 4U45A 5EHIA 3C4XA 4RGJA 2PUPA 3R73A 3AD5A 3ZZWA 5BVWA 5JGBA 3C7QA 4IWDA 3FZPA 1DCTA 2WTKC 3POZA 4JLCA 3D7ZA 1JOWB 3FQSA 2ONLA 3RPYA 3E87A 4B8MA 2WB8A 4XP0A 5IUGA 3MTEA 3QCXA 1G38A 1Y6AA 5GJGA 4BRXA 5FUTA 1WBVA 5HGIA 2C0TA 4BDEA 4CTCA 3UFBA 4AE6A 4F84A 1TQMA 3WE4A 5M51A 4GMYA 3BGPA 3C13A 3QKLA 4RC4A 3PLSA 4WOVA 3ZO3A 3E8NA 4FV6A 2AOUA 5LQKA 2IVSA 2JFLA 2B54A 4TYIA 4DQ0A 3KQMA 1URCA 5IEXA 3SSOA 4Y8DA 4A9YA 1SM2A 2VNWA 3F6XA 4XEYA 4AGWA 1JTFA 1J7LA 4FOBA 3I60A 2OIQA 4IVBA 5CASA 4L6QA 5F2NA 3DA6A 1HCLA 3S1HA 3P9NA 4YTFA 2RG5A 3KR9A 2CMWA 3VQHA 3EL8A 3HP5A 3QC9A 5KZIA 5CU3A 3PFGA 1JQEA 4XUCA 5EM6A 4L52A 5FBNC 3VC1A 1QPEA 2HIWA 4F7JA 4A4LA 3U6JA 4FTUA 2OJFE 1W0XC 3Q52A 4DINA 4BI0A 3BYUA 3BRBA 4Z7GA 3QXOA 2PMOX 3VULA 3MA6A 4XBUA 3NDIA 3MY1A 3C1XA 4GH2A 4I1ZA 4EOMA 4C61A 5AV0A 4H05A 1GZOA 3SRVA 2G8NA 2AYPA 5EDRA 4ZS0A 3UG1A 3DXYA 3RPOA 1PXLA 3MI9A 5JFVA 5HVJA 3PY1A 2VO3A 4V05A 5HVKA 1K3AA 3SDJA 3W2CA 4G9RA 4EQCA 3H2BA 3RM7A 4D1ZA 3FZRA 3VNTA 4LL0A 2V0DA 4MXCA 4AA0A 3SR4A 2C7OA 2YIWA 4FICA 3TN8A 4YPDA 4EJ7A 4Z55A 4RJ5A 4V0GA 5DPVA 3TV4A 4IM2A 5HI2A 4RFMA 3GOKA 3EFKA 1S9IA 2BZIB 2XIRA 5KHWA 2W4KA 1O9HA 3G8BA 4G6LA 3TOSA 4RTKA 3ODZX 4C4JA 4RTJA 5G1XA 4JR3A 4MD7E 4AG8A 3L8SA 1VJYA 4R77A 3IONA 3KPVA 2OXTA 2R3NA 4YC3A 3DBEA 3FXWA 4M84A 2VUWA 2YIYA 3QRIA 1TW3A 1W98A 4LG4A 5E90A 3FTDA 2BR5A 2FGIA 2XNGA 1JSUA 1MHTA 5T3QA 3FMJA 2FHPA 2OB2A 5L3AA 4M38A 4FSDA 4JG6A 1H1PA 3DBDA 3DBQA 3P0MA 1R18A 4J96A 1RI4A 4GKHA 2IP2A 1YWVA 4LOPA 3VIDA 3GCUA 5AX9A 5EVJA 1YHVA 4FEVA 3BYSA 3KXGA 2OJIA 5DM0A 3Q60A 3GXOA 5FP5A 1YRPA 1B38A 1M0EA 4CFMA 3GIWA 4Y72A 3FMKA 5A9UA 3G0FA 3RW9A 4FSXA 2BHHA 1RJEA 1JAMA 2OJGA 5DLSA 2OXYA 4EI4A 1CKPA 4HVGA 3IYLW 4Y5HA 4PYLA 3DS6A 5EQYA 4K77A 3CXWA 3M1SA 3FLWA 2R9SA 4IBMA 4ZSEA 4BZOA 3E5AA 5AUZA 3O96A 5HORA 5CU2A 2AOUB 3KEXA 3HMMA 2A2AA 5AP3A 4RVDA 2XK3A 2P8JA 5EHGA 2H9VA 3DJ7A 1KV2A 3SC1A 1P4OA 3UNZA 2ZBPA 4X61A 3FL4A 4DF3A 4TW9A 5EQJB 4R5YA 3NZ0A 2CN5A 4MD8E 2NXJA 4IM3A 4QMWA 3BT7A 2HYYA 3C50A 1UFKA 3TDWA 5DX1A 5EEGA 3NTVA 3EVGA 3PJ2A 5CSXA 1ZZLA 5FTGA 2XNOA 4F1OA 2PSQA 2PULA 2XKFA 3FQHA 4C35A 5HVYA 3QV2A 1KE5A 3TQSA 1Y91A 2P41A 3QA8A 3UO6A 4CQEA 5AP5A 3CBLA 4D4VA 2CPKE 2EJTA 2VWUA 2JJQA 3W8LA 5E92A 3PS9A 4BVUA 5AP6A 5EFQA 4NKSA 1L1EA 2JD5A 3NUUA 4S32A 4RIWA 4AZEA 4MWZA 4MXXA 1VP9A 3E8EA 3HL7A 4P2KA 3TNHA 3GNIB 3DTCA 3QD4A 4KD1A 2CNVA 2VTAA 4FSNA 4GVJA 5LOHA 1OITA 4BGHA 3V04A 4AWIA 3GDHA 4FTKA 2XK4A 4D0WA 1H28A 2YAKA 3ZO4A 2GHLA 3AWIA 2PBFA 5M07A 1UU8A 4U80A 3N4TA 2FK7A 2BMCA 5LARA 4Y46A 2WO6A 3OTUA 4JT3A 2IZRA 5FXQA 3FXZA 3VUDA 3SGLA 5CNNA 4L42A 3EMDA 4AOJA 3T3UA 1D2CA 1UU9A 4I20A 3EFWA 3A60A 2UUEA 3O31A 4YZMA 1BI7A 2IPXA 2O0UA 3AC8A 3C0IA 4HZRA 4E6DA 5LMAA 2PT9A 4FV1A 3IDPA 5FQDC 4JL9A 3V8SA 4DEBA 3PPJA 4KINA 4PV0A 5FRIA 2GB4A 2HWPA 2FYSA 3DKGA 5HZMA 3QYWA 3DY7A 3D14A 1KXZA 1TW2A 3AMAA 3CTQA 3RVGA 1PF8A 3ZMMA 4RTQA 2DULA 3DTNA 3QZGA 1PJKA 1GOLA 1PXOA 2FSLX 2J4ZA 2RF9A 3A61A 3P4KA 4GU6A 4FKWA 5EHOA 2J0IA 5E8XA 3ZDUA 5J1VA 1AV6A 2UZTA 3QHWA 3R8ZA 3QTWA 3TTIA 3TIYA 4BTMA 5DX8A 5EDPA 2W1CA 5KE0A 4BBEA 1J7UA 4CLIA 2BTRA 1WXWA 2KW5A 4PYKA 2YIXA 3LFNA 4LOQA 4P7JA 4FTQA 3A26A 5LR6A 3HV5A 1YDSE 4U9AA 1YUBA 4UY9A 2VO7A 2OZAA 4HGZA 4UALA 3QAME 3R9NA 3V8VA 4RPVA 4YR8A 1KWPA 4Y83A 4NL0A 4BKJA 3ALOA 3ORTA 3L8DA 2ZLBA 2XEYA 3BWJA 2XM8A 4ZTQA 1XO2B 4NM5A 5BX0A 3DBCA 2XBAA 1JKKA 2RIOA 3G2OA 4HVHA 4ZS4A 5HIDA 3HMNA 2ITYA 4YZ9A 3FZSA 3RALA 3EVFA 4XBRA 3D5WA 4QYEA 5HESA 4APPA 5ETCA 5K8VA 3U6IA 3S95A 1O6KA 1M7NA 2BZKB 4DBNA 1AQ1A 3NMUF 4GU9A 4G6OA 4O86A 4DH7A 4F63A 4FV0A 4X2KA 3TJCA 3GFEA 1WBNA 4B7TA 2ONYA 3C3PA 3LXPA 3QXPA 2QG7A 4UV0A 3EL7A 1YZ3A 2QCSA 4XNEA 3BE2A 2ZWVA 4G3CA 3FLQA 4LGGA 4YSJA 1I4WA 3G2PA 5C1QB 1YW2A 3OFMA 3UNJA 3ANRA 5E1BA 4X3FB 1Z9XA 3JXWA 4RZWA 3KA0A 4IB5A 1L3RE 4D4RA 4EKLA 4O21A 4UWCA 4U6RA 4CXMA 3RI1A 3D7TB 2QM3A 4PP9A 3MCZA 3ATSA 4U44A 2IN6A 3MN3A 1ZGAA 4H0NA 3F61A 1KYZA 2WMBA 2GMXA 5EKOA 1ZRZA 2J7TA 3ORNA 4E1ZA 5JQ5A 4R8RA 4PYJA 1VQ1A 2Z7QA 4PINA 2YQZA 1CTPE 2WQOA 3CKKA
chains in the Genus database with same CATH superfamily
1ZD4A 3HB5X 4NYMQ 1P0CA 3LT1A 4QTDA 3V01A 3PE2A 2DFTA 3RRJA 3QQGA 4S1WA 2J9MA 4TUYF 1RWPA 4WADA 5CF4A 3E0XA 2I2WA 3N8IA 1OC2A 3UHAA 4XCUA 1L8AA 5IDXA 4Z9LA 1J24A 1KZ4A 3EDCA 4RSHA 4WSYA 4C0XA 3NYWA 2DS1A 5EZYA 3IOEA 2ZT7A 2BEWB 2ADMA 1W87A 2WT4A 4BCMA 4W82A 5ACBC 4BE7B 2JRCA 1Z0FA 1W47A 1WDTA 1THZA 2LGJA 4YP7A 3DT6A 1HYGA 4J2HA 3NH6A 3HRFA 3N75A 4BECA 3ZOZA 1OE0A 8ABPA 3MFQA 2DR0A 4RELA 4RFYA 4ZJZA 5HF6A 2YQ5A 1BQEA 3RC7A 4BRSA 5DWVA 3TLYA 5B3AA 2XUPA 5FUQA 5JRSA 2BEWA 3P9KA 3L49A 4ZOBA 4DCVA 4A3SA 3SOPA 3BL5A 3VX3A 4RLHA 2C5LA 1YRWA 4JQ7A 2RKWA 5GVSA 2VDWB 2MINA 4CCSA 4CFUA 4LDQA 2WJWA 3R7VA 1T8SA 3M9LA 3C6KA 1P7CA 4XR9A 3IAEA 1B23P 3GGCA 4ZT6A 5H7XA 5DN3A 4WASA 3P2KA 2GM4A 1XNGA 3KYJB 3B1FA 4MW6A 2J3LA 1EVJA 5CAOA 4BO7A 5ULLA 5I48A 4LL5A 1QRSA 2AZXA 2JAVA 5DXFA 4G1MB 4BKUA 2I4TA 3IPRA 3L8FA 2IYOA 4JQSA 3K5UA 1U2DA 5F2KA 5DGTA 3HA7A 2W4MA 3EXG2 4U2GA 2EIHA 1ZNQO 2PLRA 1F3LA 3KBOA 1CZLA 3Q12A 4IPTA 3LP8A 4OU5A 3P9XA 1EIZA 2LIVA 4NDNE 3PIXA 2J32A 3E7FA 3BWVA 5HJEA 5IEJA 2C2BA 5JMSA 2ZZKA 3I8XA 1IBKB 4ZZ1A 4I4IA 3FF4A 5DGHA 1NURA 4EH3A 2CKEA 5DWRA 2DE0X 3LRXA 2PKQP 4EMBA 1OF1A 1KJZA 3NCHA 1WB4A 5K6AC 2OL4A 4UM9B 4RDXA 4UC0A 2WINI 4FKSA 4EGAA 5GINE 1F8UA 2RHLA 2B7BA 1KTVA 3PUVA 3FZ1A 4N48A 3CXUA 2AYXA 4HAVA 1ZOEA 1YI3A 1FC0A 1GYQA 4UZFA 4YJGA 4U2DA 3EWHA 3E15A 3ML1A 1TRKA 5DT0A 2P6NA 2WKSA 2HGSA 3PX3A 2BL4A 1H65A 1Z0IA 3ZI0A 2VWWA 1D4AA 4JU8A 2JFPA 3GMIA 4CKBB 2Z7RA 4B0OA 1FBNA 3GCVA 1Z5PA 2EGGA 3IH5A 1KO8A 3OF3A 2WKPA 2PJZA 1E2QA 5C8NA 5AKLA 5A4AA 4PRJA 4XR4A 3D3KA 5IDVA 3UOHA 1Q1BA 2C5VA 1S9DA 4LF6B 3A3OA 5AM7A 3RBZA 2Y3IA 4XD7D 2FUCA 1H9BA 2H07A 3AUSA 2X0RA 5IBQA 421PA 2G0TA 2P40A 1LVGA 2YJ6A 2HTEA 3REQB 4NBLA 4PLYA 1E20A 4FMCB 4ND3A 3DZIA 3HEGA 3G5MA 1JBEA 3P9JA 2WPDD 3TI7A 2YM8A 5L2TA 1H93A 4S24A 2PUWA 3E2PA 3ENVA 2OBFA 4NHOA 4MA4A 5DYGA 1XD2A 3A05A 4JDIA 1XD2B 5J5SA 5I45A 4KR9A 1P17A 2HHJA 5JAQA 4R31A 1OVEA 2JVKA 5M06A 1TQIA 5AMNA 4C7MA 1PJSA 1GZKA 2ZYGA 4WGGA 2JGKA 5I8ZA 5JE8A 1QCYA 4B0GA 1W8IA 2ZSAA 1EGHA 3X2EA 3UK7A 4JGGA 4NDAA 1ZITA 4UOEA 1X1AA 5ES4B 4A0GA 3LUCA 4NH0A 3QALE 4QBHA 3H6GA 1Z28A 3AKZA 5JT2A 1JDJA 2IFTA 1TO6A 4ECAA 3MTIA 1FYEA 3BPSA 1YZVA 2QMUA 3IDQA 1OI4A 4RMJA 4FI1A 2BIKB 1UAAA 1MA0A 1Q7BA 3WKEA 1XZQA 3RJZA 5DRDA 2VJAA 2E7ZA 3AZPA 3FBVA 5DHPA 3CY6A 4TYQA 1D9ZA 3J80A 5I9VA 3PA4A 4BFLA 1Z36A 4PBTA 3KR0A 1DC5A 3DKPA 5K6AA 3FHRA 2F4NA 5TLSA 3ZE7A 1BEZA 3THXB 2VGOA 2HV8A 2BRGA 4UAGA 4NJOA 1W7HA 4Y2RA 1PWZA 3JY6A 1A97A 3VTAA 5DO9A 1RRGA 4MDEA 5HE8A 2X9VA 2ZMDA 4XIGS 2YHIB 3QX9A 4O7TA 1GPNA 1SCAA 3QVMA 1U02A 2ZYTX 2CHQA 4FV9A 3DLZA 3OAAA 4M12A 4DSOA 2FKAA 3A70A 4LJ4A 1WB6A 1WLYA 2J9FA 4GQBA 5C37A 1EXWA 3DNDA 3RIGA 1KK1A 4QMTA 1SC4A 3LPAA 5JFGA 3ZRKA 4HH3C 4JB3A 3EYWA 1TT5A 2WJZB 2Q46A 1I1OA 3LE6A 2ZWOA 4UTPA 3ZK7A 3QY9A 4PM4A 4R3UC 5AICA 2QVGA 4II5A 4G0WA 3S1LA 1E69A 4M22A 4IMIB 4WOKA 4G3DA 1ZGGA 3R6LA 4E0BA 2IGTA 5TMPA 3ME5A 2XRUA 3G9QA 3BLRA 4LRYA 3QU5A 3SZOA 5CEEA 1CF2O 1IY0A 4KFSA 5LQCA 4EEZA 1OL5A 5JS7A 4LOAA 2HT6A 3AC4A 4EUEA 3QHPA 2VNKA 3N6XA 4X1OA 1PKGA 2XNHA 1BKDR 5DSTA 1NOKA 3KU4A 2CGXA 4LOHA 3H5NA 1KZ6A 1O8CA 3OMWA 5CWZA 5E9EA 4CN9A 3AR3A 4QX6A 4LF5B 3QBVA 5DIFA 1GG5A 3OEEA 4WNAB 3Q0EA 4EZIA 3HA8A 3M1IA 3MBLA 5JS2A 4JUBA 1C3OB 3O9MA 3VU1A 5CP8A 1PYEA 2VRCD 3NHAA 1ENOA 4Q3DA 4KK3A 1TLLA 2CNOA 1LPPA 5CB4F 4TYGA 3HYCA 2PH1A 1I30A 1KYVA 1WQ1R 4IGIA 1XA3A 4KKXB 3TLJA 1OFUA 1TZJA 3HVIA 1OXUA 3PX2A 1OGUA 4AX8A 3FRJA 4L78A 1JKXA 3RUFA 4OXRA 1DOHA 1T5BA 3A2LA 3H2IA 2AFHA 5E91A 1P9RA 3N58A 1O89A 4RTOA 5CYPA 1SK8A 1GVHA 1OAOC 1P5RA 3BCRA 3C70A 3W2SA 4JCCA 3QX8A 3AVWA 2UYYA 4FHEA 4PTLA 2YVAA 5HU9A 2OAGA 2WEKA 2ZK7A 5KWIA 3SFVA 3GLUA 1VE7A 4ZTNA 2YC4C 1RWQA 3RMFA 4IDOA 2C3YA 4HTFA 3QXSA 3A27A 4RVMA 4GF5A 4BCHA 3EZ2A 3NALA 3V7YA 1G20B 1E1NA 4DEIA 1ZS9A 3GCGA 2VF2A 2OQRA 4ZLZA 3Q6IA 2AW5A 1BRMA 4UHKA 1M9NA 5FHRA 2VA8A 1JHPA 5HHWA 3FPMA 3D54D 3QTIA 1O57A 2VTHA 4C5CA 4O2AF 4JI5B 4GMDA 3IHTA 3OT8A 1LNQA 3UICA 3DL0A 4CMKA 4XX0B 5K4JA 3PE1A 2X3FA 3SAJA 2OP1A 3B53X 5D01A 2A9FA 3T1YB 3QXGA 3KSZO 5FEDA 4BX8A 1Z8DA 4L43A 3JQAD 4U4AA 4GL2A 4Y2PA 4BCIA 3QKSB 2AZDA 2VQDA 3ZXYA 4KK4A 3QLVC 1WMAA 3R2BA 5EK7A 4IMPA 1KEPA 2V7OA 5IQCA 4O2BF 5I9XA 2OC4A 5IQDA 4XWTA 1LPBB 4NJMB 3RHXA 5JROA 4BQEA 2H1OA 1FRNA 4AN4A 3UPXA 3QZUA 4EATA 3ND6A 1U46A 2YASA 5CPFA 3PQ7A 5AVUA 1UF9A 5JPCA 3EGXA 3C7DB 2BAJA 3KPUA 1QCFA 3KK0A 2W2OA 3ROKA 2QD5A 1E94E 3SE0A 2WQBA 3MVHA 3ERCA 3ST7A 2X5OA 5BYAA 2JAUA 2XK6A 3CUKA 4BX0A 4NONA 4UXLA 2P5YA 4JODA 4P7BA 1JKJA 5BRNA 2HA6A 4XUGB 2Y93A 4Y2XA 2ZRNA 3JZFA 3A8XA 4MF1A 3QYZA 1UQUA 1WSDA 3VRYA 2WB2A 4R1TA 4FIHA 1Q0QA 4ZVLA 3RS2A 5ENZA 2ZG6A 1V8OA 4FGBA 1CVLA 1J0CA 4R83A 3GQLA 5IAGA 2WFYA 4GP7A 4OKIA 4QBGB 3DBVO 4J71A 4F6SA 1XP8A 5HG9A 4OATA 2EHDA 5C8KA 4HN2A 3CLTD 2BISA 3DE2X 1CUWA 1JKJB 4DSUA 1FCJA 2GJ9A 1ONSA 4Q00A 4C4AA 2A57A 4D4IA 3VVMA 2UYHA 2E4YA 3KUXA 4NUSA 2XAOA 2EZ4A 3HU3A 5FOSA 1T26A 3M5WA 3HVKA 3U09A 2PD6A 2DXIA 1CEEA 4QXPA 4KEAA 2BVAA 3OFNA 2XQJA 1Q24A 4ZTBA 5KMKA 3SX9A 1O96A 4MR8A 4DMMA 4DE4A 1W581 3FSJX 3RADC 2BFFB 3H1TA 1XLVA 2QR7A 1QAMA 2QSZA 4YPOA 3CPBA 3D8SA 3CPCA 2C6DA 3OPQA 5JNVA 2O8YA 2SHKA 3K2LA 4AK9A 2PA0A 2Q62A 1QDEA 3ED1A 1A9RA 3SIRA 1I6WA 4HMOA 1T45A 2NP7A 5FTLA 2CJXA 2FZLA 3MSCA 3HO1A 3VTKA 2VDNB 1RWWA 4G31A 1HTWA 4IZHA 1ZA1A 4O0WA 4AWAA 4D55A 4FTAA 2R1TB 2Z0MA 3JVRA 4MQFB 2V7BA 4HPUE 1YS2X 1EJ2A 4E7PA 1MEOA 2W93A 2IUYA 2PHZA 2RIRA 3RYFA 3VV2A 1YVPA 4R9NA 2VBCA 4NH1A 4R1MA 2P2HA 1WDMA 4CIBA 1CP2A 3SCZA 4TY1A 3KHKA 3P5BA 2QY6A 2OXIA 4V2UA 1N25A 4HR7A 4WL0A 4A9RA 2P9BA 4G5OA 4Q3BA 3O8TA 2NTJA 2Q9CA 4ZCPA 1VPEA 2GUGA 2X8BA 3VO2A 2CDBA 1E1RA 3V4PB 4JUDX 5CT8A 3PHJA 2OO3A 1E89A 5ESDA 3I9NA 1JZSA 2PX6A 5JEDA 2W7TA 1DQPA 5BURA 4EBVA 1RQ7A 4GZ5A 4KPYA 4M15A 2OKGA 5EYPB 3JTMA 4LBZA 1EQAA 2R3FA 1IMJA 3L8XA 2QOBA 2VP4A 5M04A 4M0ZA 1FSSA 4KO2S 4KO8A 2HY81 4AFNA 3UMMA 2GNFA 2KX7A 4CFVA 4JA0A 2FE4A 3QWFA 4MPDA 2WSSA 1BMFA 4REOA 3W5HA 2PUNA 1G17A 3U44A 3LMHA 1GA6A 4C4XA 3R5XA 1SVLA 3ZIDA 1Z0UA 6REQB 2NNWB 2DQ7X 3B2NA 3FTEA 3UXHA 1XRNA 3ZEPA 4DIOA 1QP8A 3FOBA 2VOEA 4QEZA 5LWQA 3R63A 5ALQA 2WTAA 2HWKA 4BLQA 1K97A 3R3UA 2R7NA 5BV7A 3N8HA 3F3WA 4X8OA 2QQGA 2A0CX 4KI7A 2PWYA 2Q6OA 2Y6MA 3SIPA 2OQ2A 4YCCA 1Y6GA 4UJ5A 2HRQA 2QPAA 3WBBA 4YRPA 5DPMA 3R1SA 4BO4A 3G2NA 2IEBA 3IODA 3RHTA 3ZDZB 4R0VA 4QDZA 4GT4A 2PTKA 4OP2A 1KKLA 1XAHA 5JZJA 1PJRA 5KMLA 5H8GA 5CT5A 3TNFA 5A0VA 1RZ3A 1RXYA 4N3AA 3DOJA 2WMNB 4QODA 3KV3O 4Q9HA 3SLRA 5B5SA 4W1SA 2CJWB 1DGQA 3PVWA 4L7VA 4WKCA 4XLLA 2WTEA 4WNPA 3VO1A 3VR3D 1Y1LA 2CCHA 2CXRA 3TUCA 2ZCVA 1Z68A 2G9QA 1Y8GA 3IBYA 1Y7LA 3HCRA 4OL9A 1G5QA 4NFHA 3ESZA 4MUXA 3HKBB 4OBPA 4XFKA 4WK6A 3HADA 3FYSA 3KE8A 3UAXA 3EN0A 1BVUA 3BXZA 4OBQA 2ASEA 2RK4A 1GT6A 1PVOA 4BJHB 4GRBA 3A1WA 3EODA 5C53B 4MMXB 3T3NA 2ZOSA 3ZLUA 3RSZA 2DUUA 2YMLA 4XQEA 4QSHA 4X7QA 2A30A 4YBKA 1X6VA 2WWXA 3WTCA 2BE9A 1RXEA 3DDHA 4NU5A 1PEAA 3V1NA 3CQUA 3OBGA 4CTMA 4G65A 4TV9A 4QYXA 4OGLA 3TBKA 2A58A 5CS6A 1KF0A 3EFJA 3QLVA 3BE9A 4CJXA 2OMEA 3CONA 3VZSA 2ASVA 2OFXA 3MYGA 2VNJA 3WOHA 3OZDA 5ANKA 4IINA 1RWXA 4TSKA 3R5JA 5AUUA 3OFND 4G0OA 3PHCA 5H70A 1GHTA 3G51A 2GFSA 4OBWA 3AOEC 4GICA 2RGAA 1GU0A 1QKJA 2PRSA 3QC4A 4W9NC 2PXAA 2QRZA 1FTYA 3EN4A 4IGEA 1TKIA 1X3SA