1G8SA

Methanococcus jannaschii fibrillarin pre-rrna processing protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
230
structure length
230
Chain Sequence
b'MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN
publication title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikshii Fibrillarin
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 69
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1g8sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g8sA02
1FP2A 1QMZA 1U2ZA 3QTSA 4M97A 3A26A 4YZBA 5GJDA 5CM2Z 1XWSA 4U8ZA 4B0GA 3UIUA 3KXNA 1QAOA 4MXOA 3EWHA 3FSFA 3VJNA 3BHHA 4DINA 1PXLA 1G8SA 4BN1A 2PT6A 3KGAA 1KYZA 2G1TA 2GHMA 3ODYX 4QP7A 3P9KA 3TIYA 4ZP5A 1UWJA 4R7HA 3G90X 4RQVA 4APCA 5CCBA 5A4LA 3NCGA 4OT5A 3HNGA 4D1ZA 2O63A 2JDTA 1JSUA 3G6GA 3RAIA 5K0EA 2AOTA 4KS7A 2C7OA 2IH4A 4DBNA 3FXXA 1ZRZA 2BROA 1PMEA 4QYYA 4ASXA 2X0GA 4KA3A 3GIWA 4BDHA 2IDKA 4IVAA 4E4MA 5HIKA 4PMPA 4WHZA 1E1XA 2WXVA 2Y6OA 3CTHA 4PP7A 4OTRA 5E91A 3VUMA 5AA9A 2Q0BA 2W5AA 5C01A 4ZSLA 2NXEA 4YURA 3HMMA 5E8RA 3FI8A 5I9UA 4OTGA 4H3BA 4XS2A 2P3LA 4ACMA 3FYJX 3LBFA 2IP2A 5EM5A 3ZONA 4GV1A 3KFAA 4PWNA 3ERCA 3TZ8A 3M4XA 3LM5A 4KW7A 3DOUA 1YWVA 3FI2A 3C5UA 2WQOA 2JDRA 4FE2A 4DH8A 2VDUE 4IZYA 4QMZA 5I9YA 3EZRA 2BALA 1M2QA 4XG6A 2CDZA 1MQ4A 4GOMD 3TXOA 5EQEA 3TV4A 2WTIA 4IWPA 4F9CA 1YI3A 4FKGA 2QYOA 4PMSA 2VWVA 4TWOA 4J96A 3LOKA 1ZZ2A 4FGBA 4IAKA 3MH0A 4AG8A 4G3DA 1P4FA 5CSHA 5TOZA 3G2MA 4E2ZA 5CSWA 3ALNA 4OTQA 1ORHA 4RGJA 3A61A 1ORIA 5JFWA 4HYSA 1KR5A 1ZYDA 4IEBA 3HDNA 1NW5A 3QGYA 4EH9A 2H34A 4BHNA 1FPQA 1VP3A 3GQLA 4EBWA 2VS1A 3C0GA 3FLSA 4LI5A 5HEZA 4E4NA 5C27A 2VO3A 2EVAA 4KB8A 3RP9A 4JL9A 3M1SA 2C3LA 4D1XA 2X6DA 3WARA 3LPMA 3O2MA 1D2CA 3JPVA 4FSWA 2QR7A 2ZYBA 3S68A 4O7TA 1XDUA 4PDYA 3HVHA 5BVNA 4BCGA 2GH1A 4D4VA 4DH5A 4PNKA 2C5OA 4BYIA 4HCTA 3NPCA 3D2KA 3KQSA 4ASDA 3EEYA 3BWJA 4Y8DA 3BHUA 2PX4A 2OXXA 3GRVA 4E4XA 4BTFA 5LVNA 5D10A 5K0FA 5M4UA 3EKKA 3OTVA 3RCJA 2FPOA 3CQWA 5E1EA 4L53A 1WBPA 4YTFA 4NZWB 2ITXA 4X2FA 3P1AA 1IEPA 4ZLOA 3P7BA 2F7EE 3D5VA 4GK3A 5ACBC 4FA2A 3EHAA 4EC8A 4GKIA 3VQHA 2PVYA 4H1JA 5FA5A 4IWQA 4AFJA 1PXMA 1VP9A 4I1ZA 3CJQA 4LOPA 3C50A 5FQDC 3A7JA 4FL3A 4FSTA 1UU3A 3DGKA 3QOWA 4FL1A 3PY1A 1Q8TA 2WU6A 3QCXA 2AOTB 3NIEA 2PZ5A 2BFYA 3PIZA 4RC2A 4B6LA 4EOSA 1BUHA 4ER0A 2JIUA 1SVEA 4O81A 3PRFA 4JVGA 1WXWA 4GVAA 3FMNA 3ZLWA 3OXIA 4HGTA 2Y4IC 3OZRA 3N4UA 2CJMA 3IOKA 4XUCA 3GNIB 3Q9WA 3TACA 2W9FB 4KIGA 4NWMA 4LRJA 3UO4A 4FKWA 4L6QA 5L8JA 2AOXA 3RALA 4U5JA 4B9DA 3GENA 5H3QA 3EFLA 3P9CA 2QOBA 2ITWA 3R8VA 1ATPE 4FKRA 3KB7A 2UZWE 5JRSA 3LJ2A 2FCAA 4FTMA 3DLCA 3B8RA 4J8NA 2XP2A 3ATSA 5K01A 2PZYA 3NUUA 2EJTA 3COMA 3R83A 5KNJA 1HMYA 3PXFA 2ACXA 4F4PA 5L2WA 3PSDA 3ORTA 4I6BA 4PYKA 4FK3A 3ZM9A 4BCIA 1GNGA 3WF6A 3FLZA 4U3ZA 4II5A 1BMKA 4DG2E 2OIDA 4EZ5A 2JHAA 1BL7A 4KIQA 3DV3A 4M15A 2WMAA 2CL5A 3FPJA 4EZ7A 3SX0A 4DAWA 4CFFA 4QQNA 5IQCA 3PG3A 3ZH8A 4O2PA 4IIRA 4NKSA 4JR7A 1Y6BA 3ZCLA 2QOLA 4RWIA 4HGLA 3ZMMA 1OUYA 4FEWA 4YSMA 3VC1A 2AVDA 3HX4A 5DWQA 5EHLA 3ZDUA 4MIKA 2ZW9A 4MNEA 1FGKA 4ZK5A 3Q6UA 3AMYA 1OBGA 4O7SA 1YOLA 3I7BA 5I9ZA 3MVLA 5DGZA 4P7GA 3UZTA 3W55A 4UWCA 4G3FA 5DFPA 2PVNA 5CCXA 4EK9A 1Y6AA 1H0VA 3EN9A 2FRXA 3EFJA 1IG1A 3OXZA 3C4EA 2XNEA 5AJQA 5HNIX 3HP2A 5HLPA 3C0KA 4FSUA 2C5YA 4FI1A 3Q04A 5HIEA 4WG5A 4RX1A 5EGSA 5ACKA 3Q9YA 4G56A 4YP8A 3OG7A 2PMLX 2XZSA 2W1GA 4C34A 3OZSA 3QRUA 1NE2A 3EFWA 2YDJA 1LUFA 1ERKA 5IMEA 3HV4A 3NNUA 4D9UA 4FKLA 3GP0A 2O2UA 3UG1A 3Q2MA 1XJDA 4IVCA 2Z6QA 4O7VA 3UNKA 4DCAA 5A4EA 2OK1A 3HV6A 5K0LA 5EQYA 3CIKA 5ICPA 2VO7A 3QQKA 1TW2A 2YM3A 4LUEA 5B2MA 3MFTA 4P5QA 1JTFA 1L3RE 5HI2A 2UYCA 2FGIA 1J3HA 3C13A 2XNMA 4L46A 1OM1A 5I4NA 2UVYA 3UPXA 4HC4A 2JHPA 5JGDA 4Z55A 3P4KA 5AV3A 3VBQA 3BQCA 4R5YA 4GK2A 3E5AA 2UW3A 3BLRA 3V8WA 2WQMA 3ANRA 2CGVA 5GP1A 2EFJA 2BRNA 4D5HA 3LKMA 4RTKA 1FGIA 4CLJA 3NUPA 4XRJA 3ACKA 3HRCA 2PU8A 2R3HA 2XIRA 2J90A 5IUIA 3R3HA 4L3PA 4DF3A 3BWFA 2P0CA 1D2GA 4FICA 5HHWA 4PYQA 2ONYA 3SHEA 4PTGA 4C08A 2VTOA 2I6LA 4BKJA 2PBFA 5CEOA 3HL7A 3OCJA 5HKMA 3ANQA 3AC2A 4GFOA 4EK4A 4ACDA 1SYKA 2AS0A 1MRVA 4OTIA 1AD5A 3T3UA 4D28A 2UZVA 4ASZA 5CU0A 3KXXA 4C58A 1YDRE 3UVRA 4KSPA 5CF4A 5LVOA 4P5ZA 4WOVA 1SUSA 5DM2A 1R00A 2OZAA 3G2OA 2PVMA 4TNDA 3E3BX 4L9IA 2QG5A 4IWNA 1CKIA 4G3EA 4KD1A 4UEUA 4FTQA 5BMMA 4F1TA 4AUAA 1Y8GA 4O0UA 2K4MA 2PX8A 1P14A 4FR4A 4WSYA 4IBMA 5EVJA 5A9UA 5L2SA 3QQLA 3KXZA 1NVSA 2FYTA 1YXSA 4YO4A 4F7SA 5DHJA 4XLVA 2W1EA 1FPUA 2GNFA 4FV0A 4RQKA 4GT3A 2PK9A 3KPVA 4B8MA 4PIMA 3QKLA 1J7LA 2GCDA 4MNEB 2FSTX 3DMFA 1O9HA 2XKEA 4YTIA 5G1XA 3ER8A 2YAKA 3DJ7A 5LVMA 5DR9A 4AE6A 3CTQA 1GY3A 5J1VA 5E8UA 4CFVA 4JAJA 4O96A 2F4JA 4BICA 4JOAA 3NLBA 3BGPA 4AA4A 3ZFMA 5HZNA 4FZVA 1NBHA 3AT4A 2ZBRA 5EEHA 2HXLA 3WZEA 3EVDA 2IN6A 3M6VA 3EN5A 2IZRA 1JVPP 3LZBA 3OROA 2AN3A 4FKIA 3R6XA 3F61A 4XV3A 3MH1A 2CKDA 1P1BA 3FTDA 4IAFA 4X2JA 5CF8A 1NW7A 1PXOA 3OP5A 3LAUA 2GSFA 4BCFA 3HECA 3FTFA 3EJ1A 3I5ZA 1KPGA 3AGLA 4FL2A 2PY6A 4BRXA 1U5QA 4PMMA 2I40A 4F9AA 4XG4A 4XLIA 3C1XA 4J71A 3DQXA 2BRMA 4FKVA 2WAJA 3OW3A 2WMXA 4HVIA 2VDWA 4WD5A 5DT0A 2QY6A 4YLJA 4YUVA 4A4OA 5BYYA 5HESA 4E30A 3PXZA 4C2VA 4JXJA 3NJRA 3OEFX 4QMXA 3HRBA 4ER5A 2GFSA 2OI4X 4KRDA 2X1NA 1XQZA 3LMGA 1BLXA 3DTNA 3I58A 1J1BA 4KBKA 2WNTA 4HTFB 2WTVA 4DEHA 1YI4A 3MIYA 4UALA 3JWIA 4AZEA 5CVFA 3ZOSA 2HZ0A 4IADA 3DJ5A 3LLAA 3WILA 1KIAA 4ENXA 2JDSA 2PVFA 3EN6A 3FYCA 3QX2A 3DNEA 4DBXA 3NDIA 5AA8A 2QOHA 3LCDA 3LQ3A 4M0ZA 4TYJA 3MB7A 3TM0A 3D83A 5BVFA 5IEVA 3GC8A 3P78A 3TZMA 1YHSA 2XEZA 2R0UA 3PUPA 3LHDA 1XO2B 1OL2A 5E92A 4W4YA 5DR6A 1H01A 3WZJA 5D1HA 2XF0A 3LDUA 1Q8WA 3BV2A 2ZB1A 2F9GA 3FZGA 4GUAA 3U6IA 4E20A 5AP3A 3HMOA 5KMKA 2OICA 5DPMA 4BDAA 2PKWA 1XBCA 4JBQA 1H0WA 3KQYA 4RMZA 3RK9A 3EGVA 4LMUA 2QOFA 5AP6A 5DSTA 1SKMA 3E8NA 3UBDA 3LJ0A 2RFDA 2J2IB 3CEKA 2PE1A 1GAGA 4PTEA 3WE4A 3E7PA 3MWUA 4K8AA 4C37A 3E92A 3F66A 4ONAA 3VHKA 5FTWA 4RLKA 2OZAB 5ETCA 5I5ZA 3QQGA 4Y30A 2UW5A 2ONLA 4M13A 2DS1A 3VS2A 3QCYA 2WMBA 2PX5A 1EG2A 4O21A 3FKLA 2IGTA 4DLIA 2QM3A 4ERKA 4AT3A 3LIJA 5J8IA 5IH6A 4DEAA 3EQGA 3H30A 3MPTA 3V3VA 3A2CA 2YQZA 3OWPA 3IPHA 4FYNA 4CTJA 4W8EA 5L2TA 2HIWA 4CVAA 1Q4LA 1QPEA 1YZ3A 4RPVA 4AWIA 3G5DA 3R0QA 2YJSA 4XG2A 4I6FA 3TJCA 3AT3A 4E2YA 5HTCA 1S9IA 3VC4A 4LUDA 3DAJA 3DMHA 3HP5A 4YJRA 2GPHA 1IA9A 5CEKA 4NT4A 3R6TA 1UU7A 1ZOGA 4GRBA 2QONA 3F5GA 4RWKA 4WVLA 1DCTA 4E33A 1SZMA 1M0EA 3SOCA 5EW8A 1IR3A 2AOVA 3MSSA 1UU9A 4U45A 3QQUA 4V01A 1EH4A 4IM3A 3ZEPA 3FKNA 3UOHA 4E5AX 4XG7A 3R63A 4FSXA 3QWKA 3K0BA 1WG8A 4LRMA 3DKOA 4HW7A 1KE7A 3W1FA 2VTTA 4JQ7A 3FQSA 4CMOA 3NX8A 3IW8A 5KKRC 4FKTA 4IDTA 3GCPA 3ZDIA 3FMEA 2G72A 3O7LB 3DOGA 3PE1A 4AOIA 3JVSA 4MQ2A 3QTZA 4I41A 3DULA 1XCJA 4Q5HA 3CY3A 1Q99A 1UIRA 4NCTA 1L8TA 3FLYA 3VO3A 2BR1A 4I4FA 4CGAA 4ALVA 1YRPA 4Y73A 5KMNA 2C1AA 4NW5A 4NUSA 4FUXA 5K03A 4IJPA 4IB3A 3ORXA 4F70A 3FAAA 4M37A 4IVDA 3OE5A 2QI8A 3ORMA 3BHYA 4RVMA 3GRUA 3G8AA 3PVBA 5CAPA 3Q52A 2CCIA 3PFHA 2C7QA 4D5KA 1I09A 4YJTA 2Q83A 3AY0A 3DK6A 3WE8A 3QD0A 3T9IA 3GB2A 3TEIA 2AR0A 2NYUA 2BFXA 2P8JA 4NECA 3T7RA 2YTZA 3KXGA 4KIPA 5D7VA 3NWWA 3NDJA 4LGGA 4AZTA 4JRNA 4P7JA 2B52A 3DCVA 2VDVE 3V5JA 3UC4A 2ZSUA 1J7UA 3V8SA 4QMYA 3ZZEA 1KXZA 5K05A 4Z7HA 2WO6A 1APME 4JXFA 2XEYA 2IIPA 4DEBA 2O5KA 5KQSA 3KPUA 4J53A 3BXOA 2BZJA 2B78A 3RAHA 5JFSA 5AADA 5JQ5A 4BP3A 1YQJA 1OI9A 3VRZA 3KU1A 1Y8YA 4QYGA 1OR8A 4FP9A 5HEKA 1Q5KA 3KPJA 5E8YA 3ULZA 4AN3A 3Q32A 2BHHA 2FO0A 4RZWA 1RJFA 5K0NA 2DULA 4PYJA 4S32A 3EVCA 1M7NA 4PL3A 3PE2A 5AP4A 5DT3A 4EH4A 3HA8A 4IB5A 3SGLA 1H24A 4GIIA 2YITA 4MEDA 3P7CA 3QZIA 4WNPA 3D4QA 3D7ZA 1BL6A 2W7XA 3QQFA 3GRYA 2V74B 1NBIA 1J1CA 4TYEA 2VU3A 1ZY4A 3PPJA 2BZGA 5LWNA 3M70A 3W33A 2UW6A 4C61A 3B2TA 5CAOA 3W18A 1V1KA 4YZ9A 1F5QA 3FBVA 2VX0A 5IQIA 4KVZA 2RFNA 4IZ5A 3HKOA 3ZSIA 3DKFA 4OQDA 2AC5A 3MA3A 4C4FA 3BE2A 3SG8A 3NRMA 1RI3A 4W4VA 5DM1A 4DH1A 4FKUA 5T6KA 1P91A 3OW4A 1H1WA 1QYRA 3IYLW 3O50A 3OC1A 4J7BA 3ZUTA 3PS9A 3VAPA 1FMOE 5DA3A 3DK7A 2JD5A 2GNGA 4ZTRA 2YCSA 4JNWA 3OWKA 2IO6A 3X0DA 3QF9A 2Z7RA 1FMKA 1EIZA 2RIOA 4NM7A 3MPAA 4XX9A 5IPJA 3HV5A 3GRZA 3WI6A 2JBPA 2PY3A 4Y5QA 3VW8A 4MXCA 5EI8A 5AUVA 3QWJA 2IW9A 4P58A 1NVQA 5HCZA 4ZTHA 4DA4A 3FPFA 4X41A 5LARA 4EWHA 4DH7A 3T3VA 3MTEA 3OOMA 2X8EA 3HAMA 2R3IA 2B9IA 3QQJA 1W98A 1WMKA 3D7TA 4U79A 3HA7A 1KOAA 2FA2A 4FVRA 4BIDA 3SX9A 3P23A 3I9FA 4F9WA 2XK9A 1BHJA 5ANEA 5EYDA 1PYEA 3KRWA 5HBJA 4RT7A 5GNKA 3R2YA 4YUQA 4O2ZA 2ZV9A 4K6ZA 3FPQA 3DXNA 3M2WA 4FGZA 2VX3A 5BVWA 4CFWA 4GMYA 2G71A 4ERWA 2J5FA 2GA9A 2OZOA 1WBSA 1PMVA 4FUYA 5DTMA 2J0IA 1SUIA 4TL0A 5BP7A 4C35A 1VR2A 1JSXA 5HG9A 3Q4CA 4FSDA 2WMQA 4DG0E 3EQRA 2WA1A 4X6RA 4I0SA 3EQDA 2UW9A 4F7JA 1QPDA 3GC9A 4CTCA 3FYDA 5E1DA 3KKVA 3QTRA 1JR4A 1OIYA 2GQRA 4FZDB 2NP7A 2YM4A 3I6WA 4WRGA 3W8LA 4YMHA 1SNUA 4USDA 1VYZA 5EHGA 3PXKA 4M7IA 1GIJA 2XYQA 4JLCA 2QG7A 5ERGB 4EOIA 5FTGA 2NO3A 2RG6A 3HTXA 1KHHA 5EG5A 4GKHA 3MTIA 4FOCA 3GRRA 5A4TA 4EH2A 4L00A 3OOGA 3O0GA 5HE2A 1QANA 4NFNA 4CCUA 2F7XE 5ETIA 2P2IA 3JWHA 4EOJA 2R3SA 4H39A 3BZ3A 1YDTE 1NXKA 2P55A 2QO7A 4FIGA 3G8BA 3ELDA 4O7ZA 2OH0E 2ZWAA 2BH2A 4UWBA 3OUKA 4FVQA 3EB0A 1YXUA 4IX6A 2OXTA 2H8HA 5KMIA 2CGXA 3KREA 5E8ZA 3UQCA 1VYWA 1UWVA 4YC8A 3VS6A 2WMUA 2GHLA 5KZIA 5GOZA 4BCOA 5H8EA 1XJ5A 2Y4IB 5L6OA 5EW3A 4KINA 1R8YA 4CKRA 3NAXA 3CCFA 5C1IA 4ARKA 3BBTB 3PY3A 4WUNA 4HOKA 2ZMDA 5H9BA 3HAVA 5DX1A 3R7EA 5A54A 3ORIA 2PSQA 4PUZA 3RPYA 4AE9A 4BTMA 2UW0A 4ZTSA 4F6SA 3OU7A 3FKOA 4V0QA 3AC4A 2WIHA 4WG4A 2CMWA 3REOA 5CVUA 3V01A 1P39A 2OKRA 1YVJA 3L9PA 4F1MA 3TTJA 4DCMA 3RK5A 4U7TB 2B54A 4DFXE 3DDPA 3UOLA 3BGDA 3EZVA 2JLDA 5T3QA 3MYGA 3QRKA 4X60A 1H07A 2BMCA 2XM8A 3KN6A 3D7TB 3A99A 4BB4A 3PX3A 1D2HA 5CS6A 1JQHA 3QUDA 1DUSA 4L43A 3TFWA 3HCEA 3CLYA 1IM8A 3G5TA 2OO8X 3F3WA 1BYGA 4OTHA 4ZY4A 4JRVA 2YISA 2JGZA 2YCRA 4N57A 4RFYA 1PMNA 3R7UA 2IPXA 5KQRA 5FA8A 3ER9A 5K09A 4IFGA 2HELA 3QU0A 3KRLA 5AUYA 4C06A 5IA1A 1Z57A 2W4OA 3W2PA 4HVDA 3R71A 3S00A 1ZHFA 1MRYA 4YC6A 3DZQA 4HPTE 3MAGA 2YIRA 4B7TA 5LVPA 1SVGA 2IZUA 4RC3A 1OIUA 3WSTA 4BDBA 5KMLA 3SDJA 3V5LA 3NVKI 4YR8A 3UPZA 4X7QA 3FMDA 3RHKA 4XH6A 3OE4A 4F6UA 4RJ5A 1R18A 3LFSA 4DG3E 4J1RA 3DFAA 3COIA 4RFZA 3FMHA 2E9VA 2YM6A 2UZOA 5DRTA 3LCVB 3ZO1A 2BRBA 4MHAA 4DYMA 3WYYA 3W8QA 3AXWA 5HU3A 3NW6A 3OPNA 3R21A 3WF9A 4A9UA 2WIPA 2A4LA 3OFKA 2J4ZA 4U43A 3W10A 3ZRLA 3QD3A 3LPBA 2J50A 2ADMA 3C4XA 3OCTA 5HILA 4NM0A 4PP9A 2YDIA 3G0FA 3FTEA 5M07A 3GT8A 3E8DA 5ICCA 1JNKA 4EH6A 1UKIA 4E73A 4QO9A 3LQ8A 3SW4A 2UW8A 1RI5A 3THBA 1OL6A 3FMLA 3RVGA 3IW5A 5HCYA 4J97A 2BTSA 1QL6A 3RGFA 1OUKA 4FGRA 4XV2A 4QPPA 4YMGA 2ZMCA 3C9WA 3RINA 2P40A 5F20A 4MVFA 5ANDA 1JSTA 3OUNB 4DCGA 4G6OA 3BT7A 4GC5A 3NW9A 3ET7A 3GOPA 1X1AA 3MJ1A 3PY0A 4HCUA 3TKYA 2CN8A 3HZTA 2V7AA 4ITHA 3PVUA 4HVGA 4DGOA 4C62A 5CZHA 3QZFA 5E1SA 2V62A 2J5EA 3BU3A 2OJFE 4XEYA 3IK3A 2IBTA 1EQAA 2IW6A 3GU3A 5FXRA 2EXCX 4E5BA 2JKOA 2LD4A 3FLQA 5E90A 5EHIA 4A6DA 5EPEA 1P5EA 3AXSA 2ITVA 4DCEA 5TR6A 3E05A 3C0IA 5A4QA 1B6CB 2XCHA 4E6DA 2GDOA 3EL8A 2R4BA 4FKJA 1WVWA 3OY3A 3NYNA 5E9EA 1JG3A 5DE2A 2QNJA 4R1VA 2H1RA 3ZUVA 2XIZA 4RSSA 4X3FA 4FOBA 1KWPA 3SRVA 4DZRA 2P33A 2EB3A 5L6WL 3ROCA 5H8BA 3KXHA 2W17A 2WK1A 3GNLA 2C68A 2WQBA 1UKHA 1RI2A 5M5BA 4GJ2A 3KVWA 4AUKA 3LM0A 1PY5A 5EI6A 2VRXA 4M68A 2REIA 4GOOD 1Q97A 2PWLA 4J98A 3MS9A 2XJ0A 3GCQA 3KA0A 2VTNA 2WTJA 2RGPA 3PTAA 5ANKA 4CD0A 5HVYA 5A6NA 5CSXA 4N70A 5M57A 2QOIA 3CE3A 5CT0A 1XH9A 4C7TA 4YJNA 4JX7A 5JK3A 4C33A 2HZIA 4LL5A 3QZGA 1RJBA 4EMSA 4QRCA 4RYLA 2HY0A 1WVXA 1R0EA 3RZBA 4BCPA 4GEOA 3R22A 3FMMA 4MX9A 3BZBA 5AX9A 2UYOA 4Y95A 4C3FA 3KMUA 5EW9A 5KMJA 5P8WA 1YXTA 4BGQA 1M6EX 2JKMA 2CKPA 1K9AA 4HRAA 3P2KA 2UZEA 4RTRA 1FQ1B 3MVJA 4R6XA 4U9AA 4EQZA 3PB3A 4L52A 3Q3BA 3ORPA 4ISCA 5M08A 4CZTA 5KE0A 1UFKA 2WZJA 3ZBFA 1U5RA 3GCUA 1SM2A 2XNPA 4F85A 4ZIMA 1OKYA 2JJQA 2RFEA 3ZM4A 4BLWA 4FV9A 4RX9A 2YM8A 4P7FA 2EG5A 1G3NA 3E62A 4JIKA 1JKKA 4O0XA 4TZRA 3BWBA 4BCNA 3OU6A 2W1DA 5AP5A 5DBXA 1U46A 1TQPA 3AC1A 4PF4A 4V04A 2OXDA 4AACA 4RG0A 2E2BA 4PNEA 4ACHA 4AZWA 5K0JA 4HGEA 4FIJA 3O17A 3OD6X 4XBRA 2WTKC 3QC9A 5D9HA 3LFCA 3MY1A 5GINE 4CQEA 4GSBA 5FTQA 1AQIA 3FZTA 3A7FA 5DPVA 2J6MA 3LCKA 4C3RA 3PWDA 3A60A 4HVHA 3ITZA 2IH2A 3IW7A 3U55A 3QTQA 4LL0A 3R9RA 5CD1A 4OR5A 3KR9A 3EEOA 3PWYA 3U6JA 3VBVA 2GNJA 4H1MA 3JS2A 2ZBPA 1GJOA 2Z60A 1NW6A 4BR3A 5DOSA 3IV6A 5IG1A 3KU2A 4QYHA 4FT4A 5CENA 5EM7A 3GDHA 3SW7A 4EUTA 5AV2A 2I9KA 4IDVA 2C3JA 5HNGA 3A7DA 2OJGA 2DYLA 2OLCA 4U81A 3F6XA 3FLNC 3PT9A 1X8BA 3PZEA 3BKBA 1IA8A 2V0DA 2WD1A 2AN4A 5T67A 3UFBA 3F4KA 3IQ7A 5AUWA 4AP7A 3VQUA 2C1BA 4F7NA 2YABA 4EHZA 3TNQB 4A9TA 4NM5A 5FBNC 2R3GA 4O91A 4X3FB 4XYFA 2X7GA 5E1BA 2H6DA 2HCKA 1NKVA 4R1YA 4Q5EA 2A0CX 3SRVB 3A4PA 5FDXA 2I0EA 4FIHA 2O0LA 3UJCA 4IMYA 4AN9A 3N51A 2ZWVA 3F88A 4YJSA 2XNOA 4YBKA 2R3QA 3H2BA 2XK4A 2QLUA 3MCZA 5F2KA 5BNJA 3QKMA 4OW8A 2BUJA 4CT1A 5ITAA 3SOAA 2AYPA 3AOXA 4IHPA 4UXLA 5IA0A 4ZMEA 4A7CA 2XCKA 3R7IA 3V8VA 4X1OA 5DRBA 4GYIA 3KQQA 1S9JA 3ELUA 3AQVA 2J0MB 3TNPC 5IEXA 4NFMA 1PKDA 1O54A 3AXTA 4RIWA 2XBAA 3UIMA 5ANJA 4C3PA 4EOPA 5EMKA 3QD4A 1N7IA 3NCZA 2I0VA 3CCNA 2VTRA 3C4FA 4RTMA 5CZIA 5EMMA 2YUIA 3IKAA 4RZVA 4R3PA 1CKPA 4RTSA 4TRLA 2GS6A 1ND4A 1U59A 1Q8ZA 2R3LA 1ZGAA 4CKBA 3P8ZA 4FKPA 4EOOA 4DTBA 1DI9A 2XNBA 4N6ZA 3UC3A 3UIXA 5D7AA 4XCUA 3GCVA 5AP0A 2B9EA 4LQMA 4CZUA 1F3LA 4ZTLA 3R2BA 5M09A 3LCTA 4YGAA 3OCSA 4B17A 3FL4A 5M4IA 2BKKA 4U97A 4EK8A 4EVIA 5CY3A 5E1MA 2OU7A 3U81A 2ZM4A 2BCJA 1EJ0A 5KHWA 3EGEA 1ZLTA 3CSVA 5HOQA 1QZZA 2P3GX 2QVSE 2ITZA 4IAIA 4BI2A 3ZC6A 1RDQE 4AS0A 3EMBA 2W05A 4FSNA 5JR3A 4QQ5A 5LMKA 1W82A 3NYOA 5B2KA 4FK6A 3WF5A 4ZTNA 4QDJA 4C07A 4M0YA 4HGZA 3GFEA 1XHAA 2NP8A 3FPGA 4IQ6A 2AZTA 3HCBA 2WQNA 1KPHA 3TOSA 2GAFA 3ZSHA 2BDFA 4EUUA 4N6YA 4CLIA 5DXJA 1PJKA 3BEGA 3BWCA 3DB8A 1CMKE 3EPPA 2HWPA 3CS9A 3UA3A 2ITQA 4RFMA 2W06A 3R1NA 2WPAA 1OPKA 4HVSA 4V0RA 2HWOA 2JITA 3MB6A 3VS3A 4LGHA 4ASEA 4BTKA 5F2OA 3EQIA 1XR1A 4FTTA 3VC2A 2C6LA 2JFMA 5IH3A 1W8CA 3VUIA 3EMDA 3O31A 2R7BA 4DMGA 4L01A 2BTRA 5BVKA 2J0JA 4C05A 3R7OA 3BKWA 4J95A 3SVZA 4OQEA 2JFLA 3UZPA 4MBJA 2B9HA 3HYHA 4BBMA 3ALOA 4IAYA 2HR1A 4ORKA 2I6GA 2I0YA 4AGUA 4R6WA 3GUBA 2C47A 4D0WA 1B38A 1PXJA 4LOOA 4OT6A 4FIIA 2W4JA 3LW0A 3LXKA 3QFVA 2VTAA 5HLWA 1W84A 4QVKA 2WA2A 3T7SA 2YN8A 4KDRA 5FHRA 1XH7A 4W4WA 3HVJA 3RPRA 5FP6A 3OMVA 4DLJA 5IQFA 3R02A 3TUCA 4MWZA 5T6BA 1WBNA 3FZRA 4BLVA 3KXMA 4EH3A 5HNBA 4ANMA 2OBJA 4MHTA 2ESRA 2CGUA 4R05A 4O82A 3OBGA 5BMSA 4YV2A 2W0JA 1CTPE 3DTWA 4PYOA 2CHLA 4J8MA 2PXCA 2XRUA 5D41A 3BU5A 2VO6A 3C0HA 4BDFA 1JG2A 4QP8A 3QALE 1RW8A 5AAGA 2Y0AA 1MQBA 4Z9LA 4RIWB 4IB0A 3MW1A 4AF3A 4QMNA 4FZAB 2XYUA 2LGCA 1W83A 1AGWA 5ANOA 4PIPA 2ETMA 4FZFB 2CMGA 4FSQA 4L45A 3HMIA 3T9TA 3DZOA 3UMWA 4L7FA 3EQPA 1VBFA 3FWQA 3CBGA 5EIWA 2VWWA 4QPSA 3ZEWA 4QP3A 5IEYA 4CSVA 3FPHA 3COKA 3HEMA 4PINA 1OL7A 5FG8A 1H1RA 1ZMVA 5LWMA 4QPAA 4QQCA 2YWVA 4IW0A 1PXNA 4FR0A 4L7SA 3NNWA 3SXFA 4ZSAA 3DH0A 2CKOA 1REJA 5J95A 4AW1A 2OW3A 4QMTA 4K77A 4S31A 3NW7A 5KX8A 4H3PA 4WBBB 1X1CA 3FUUA 1LPUA 4GFGA 2YZAA 3QZHA 4QTDA 4QMLA 5IQGA 1URWA 4MXYA 4BC6A 4EH7A 3NAYA 1OMWA 4WRSA 1T45A 4Y2HA 3GFWA 2CWWA 5DTQA 2OIQA 5IISA 3CXWA 5DRYA 4C4EA 5FGKA 5HX6A 3ZHPC 3G5LA 4ZTBA 1JWHA 5CU2A 4A9YA 3FY2A 2O65A 3EVZA 3FC2A 2Z7SA 3KULA 5IQEA 4O7NA 4AZVA 3QAME 5K3YA 4EHEA 2VTQA 2FSMX 3QA0A 4F63A 1WXXA 3ORLA 3UGCA 5A14A 4P2KA 2BHEA 5E8SA 3DNDA 4RLLA 4NKAA 4DGGA 4C03A 5FM3A 1KE9A 3UMXA 5GIPE 3ZRMA 2YFXA 2G2IA 1PKGA 3V5WA 1VJYA 3QOXA 3PLAE 3JWGA 2WMTA 5TKDA 5ANGA 4X0MA 4FT5A 4YHTA 3ZO2A 2ZFUA 4QP9A 2PV0A 4YLKA 2VTIA 4AN2A 2GPYA 2PUNA 4FTKA 1KE8A 4G16A 3VS1A 3VUGA 3IECA 3FUVA 2BILB 3KCKA 3S1HA 2BAQA 3LMIA 1JG4A 3JWJA 3TG1A 2H96A 3BGZA 3SLSA 5C1QB 4QT1A 4OBXA 4WO5A 2ERKA 1O9UA 3PYYA 3FRIA 5LQNA 5HZMA 2R0IA 4F9BA 4L67A 4CFNA 3AC5A 1M17A 5KUPA 3Q60A 5JZJA 4YTHA 3F2NA 4FEVA 5LSAA 3NUAA 5HO8A 3U87A 3F3TA 3BYVA 3BI6A 2UYHA 2EX4A 2WU7A 4BLUA 2B1PA 3NIZA 1WCCA 4DGLC 3AMAA 1SQFA 3TNHA 4ZOGA 1EAMA 3ETAA 1VPTA 4UY9A 2F8LA 4EKKA 2CMHA 1KE5A 4EH5A 1UNHA 1JAMA 5HG5A 4HYHA 4IE9A 4BZOA 2OJIA 2VTMA 4RVLA 3ME5A 4BCJA 3EOCA 2FSLX 1ZOHA 5LVLA 4GBED 1KOBA 1WY7A 3SC1A 4Q2AA 4KBCA 3MV5A 4GUBA 1MP8A 5AWMA 2HYYA 3AT2A 4JS8A 4Y72A 1RJEA 1YB2A 2NRYA 3PJ8A 2VTJA 1WFCA 3UE4A 3A8WA 3U8WA 3PZHA 4G17A 4CV9A 5EYKA 1PHKA 2ZVAA 4QNYA 3LGAA 5T68A 5CANA 4FIFA 4IC7A 5CI6A 2ETKA 5HO7A 4HSGA 1KE6A 4XG3A 5F4NA 5AP1A 2C3KA 1ZMWA 2BIYA 3R9HA 4C0TA 3I60A 3QV2A 2F7ZE 1WS6A 5TT7A 4V05A 5KMOA 3KC3A 1G55A 5BX0A 4XJ0A 2UZDA 2QKWB 4N4SA 4ER7A 1PMUA 4IM0A 5IH4A 1VE3A 3GQIA 5D1JA 4L8MA 4FT2A 3FI3A 2PT9A 3WYXA 4DEIA 3G2PA 2PVLA 4DTAA 4PTCA 1JQ3A 4JR3A 3GO4A 4S34A 1YFLA 4A06A 5IKMA 4FV3A 3IOPA 3G33A 3CGOA 5JH6A 3BGIA 5M55A 4I5MA 2GNLA 3BWYA 3DKGA 4FEQA 3HVCA 4BDEA 2F57A 3KQWA 1GZOA 3VWAA 5JZNA 3MTLA 4K1BA 3UBTA 5FUBA 1P2AA 3KULB 1MUOA 5K0GA 3UWPA 1GOLA 4D2RA 5LQKA 4RTNA 3FPEA 3DXZA 2J51A 2ZB0A 4FMQA 2WTWA 4PNIA 4P7KA 4H36A 2QO2A 3A7IA 4M36A 4AU8A 3E8EA 4G9RA 3NWEA 1X1BA 3R1QA 4O86A 1NY3A 2XIYA 4QOXA 3L9MA 2C6EA 2R3FA 1PYXA 2OJ9A 4IV8A 4G6LA 3PSBA 3I0OA 3RWPA 3UQFA 1QPJA 3CY2A 3Q87B 1OL1A 3F69A 2OJJA 3L8DA 2UZ4A 4HGSA 3IDPA 3G9NA 4H3QA 4I93A 1TPYA 5LQAA 3SGCA 2XIKA 4F9YA 1XXLA 3R1SA 4QMVA 3VUKA 4E5WA 5A46A 5C26A 5JT2A 3JY9A 4I3ZA 3W2OA 4OLIA 4ZSEA 4F86A 3UO6A 5JMSA 1T43A 1FP1D 5EDRA 3LCUA 2BM8A 4MTAA 3FLWA 3T8OA 4EYJA 4D4YA 3BPRA 5K5XA 3GU5A 1H25A 1ZXEA 3VJOA 4M12A 2ZDUA 1XH6A 3UOJA 3CGFA 3BYSA 3NDMA 4P90A 4P4CA 4GS6A 4PYIA 4YZMA 3RAWA 4BZDA 4ZJJA 2I1MA 4XV1A 3MH3A 4FV2A 3AG9A 5EQPA 4R77A 2GNIA 3A7HA 4RTQA 4IWDA 4XV9A 3ORHA 4O0TA 1HCLA 3R8LA 3KPWA 3UG2A 4HTFA 3K2LA 3DLIA 4ALUA 2C69A 4K0YA 4X21A 1HOWA 4FC0A 4TW9A 5C03A 5M44A 4QMMA 4ITIA 5LJJA 3PTGA 2C0IA 3REPA 4I0TA 1RE8A 5C9ZA 5AUXA 2G70A 3ZSGA 4EKGA 4AOTA 3DQWA 2BM9A 4TNBA 2JG3A 2AVNA 4ZLYA 3QXPA 2O07A 2OF2A 3GWZA 1I1NA 4I94A 2PVJA 5FBOA 3V5TA 4JQ8A 5K4JA 2WFYA 4FTNA 3DAKA 3P5KA 4MWIA 5FD2A 5HBEA 3GC7A 4R7IA 4ZSGA 3Q9XA 3QTIA 2E9OA 3EN4A 3CC6A 3NUXA 3V6SA 3C3YA 3SG9A 4FTLA 4JIAA 4IV0A 2PZPA 2RKUA 4RA5A 2YIXA 3OCBA 3OXTA 3ZLXA 1O6KA 4AT4A 3EVAA 2GTMA 3ULIA 5CAUA 1KUTA 3NUYA 2CN5A 5J9YA 4CTKA 3VNTA 3Q53A 3P0MA 1XTPA 3BX5A 4YU2A 5JFVA 4PONA 3GJYA 5IQAA 5AM6A 5GHVA 1XH8A 4K9YA 3FV8A 3UYTA 1G8AA 3VF9A 2P2HA 3AGMA 3F5UA 5K5NA 4FT0A 5FCDA 4PY1A 5EHYA 4F0IA 2XJ2A 5A6OA 3LDFA 2I62A 5EYMA 1JQEA 3IONA 4D55A 4D1SA 5KYGA 3HGKA 4OX9Y 3PVGA 3CD3A 4RX8A 4RVFA 4HZRA 2P35A 2ZVJA 1I4WA 1PXKA 3D5UA 2F2CB 3WF7A 3JR1A 1OBDA 2VWXA 3I6UA 4ANQA 3FPMA 2ITOA 3CJTA 4RX7A 3AWIA 4FNYA 2P7HA 4S30A 3TZ9A 1R39A 4G3GA 2QOCA 3EVGA 3QTUA 3V5QA 5CTPA 4LM5A 4FV1A 4A4XA 5H8GA 3D0EA 1M6YA 4FODA 5BYZA 4GYGA 4QNAA 5FM2A 2IBSA 4E6QA 4DGNA 5DYJA 3PJ1A 4UWYA 4AOJA 4DT9A 2FK7A 3HP7A 2BRHA 2KW5A 4GW8A 5B1SA 4IAZA 3QKKA 3RCDA 5E8JA 5J1WA 2NNWB 1WBOA 3FE3A 4QTEA 2OWBA 5EOVA 2VNYA 2GTNA 3DLZA 4I4EA 3TNIA 3GVUA 4YHJA 3GU7A 3R01A 2ZV8A 1JPAA 2OBFA 3UJ6A 2X8DA 2W5HA 3RMFA 1YOMA 1XH4A 3G2QA 5C4KA 2G1PA 3HA5A 3TUBA 4CKCA 2GQSA 3D94A 3TM4A 4PV0A 4FTUA 5LMBA 3LJ1A 4I21A 2ZOQA 2GS9A 2C7RA 3UJDA 2A1AB 3SM3A 2QHMA 3VULA 2GQGA 4S33A 4AGCA 5HTBA 3RODA 4TWNA 3TT0A 2XS0A 3RPVA 3F7WA 3ORKA 1ZAOA 3H3CA 1HNNA 2R6ZA 4IWOA 2ZJWA 4QTUB 3TKIA 3VVHA 3WIKA 2JKQA 4BDGA 3RNIA 5HE0A 5K9IA 4RVDA 3FJQE 1K2PA 4WKQA 1YUBA 4MBIA 2QOKA 1WBVA 3HMPA 4O7WA 2EXMA 1DS5A 4U44A 3WZDA 3GI3A 3DS6A 3M42A 3BLHA 3NWBA 3L8VA 3V04A 3HM2A 2X2KA 3OS3A 5CEQA 4OGRA 3PJ2A 1AQJA 4ZTQA 5U4XA 3BBWA 4WIHA 1IAJA 1AV6A 2JAMA 2BPMA 5L8LA 3I1AA 3SSNA 2ZTHA 5JGBA 4UZHA 3LCOA 3PP1A 4I5HA 4NJDA 2Q0NA 3LKDA 2W1CA 4R7BA 2WTDA 3A4TA 1ZARA 2Q41A 4CXAA 4UX9A 2PUUA 4OTFA 2Z7QA 5JEBA 4C04A 4LECA 1WBTA 3B3FA 4KKGA 1W0XC 3PX2A 4X2NA 2NP6A 1R0PA 2XKFA 1UU8A 5AUUA 3PDTA 3R24A 4E1ZA 3OWJA 3RK7A 2PJDA 2GS7A 2R3MA 5IQBA 5D1NA 3MJ2A 2OZVA 3PFGA 2WTCA 3DK3A 5EDPA 3O4FA 2X2LA 1TKIA 2ZV2A 4YZNA 4V0GA 5HBHA 3G7UA 1O6LA 5CAVA 2QO9A 2ONLC 5HE1A 2P41A 3A4OX 5C8KA 5AX3A 1M2PA 5I9WA 2XVMA 2BDWA 5CUQA 1GZKA 3QX4A 2A14A 1ZWSA 2XKCA 4KUJA 3GBZA 4MD9E 5CU3A 3CKKA 4O0YA 4YUXA 4C59A 2QRVB 4FV6A 5BW5A 3G0EA 4HNFA 4WUAA 2O57A 3F3VA 4YMJA 4Z7GA 4PDPA 3NNXA 3MERA 4PGHA 1M2RA 2CGWA 4G5JA 3LDGA 4OBQA 3KK9A 3PLSA 2FH9A 1OECA 2J0LA 2XNNA 4BCKA 3FHIA 4LMNA 3QLFA 5IH5A 3P2EA 3AD6A 4L3LA 3TTIA 5EZQA 3HLLA 3ZLSA 3ODZX 5EG3A 8MHTA 5CEPA 2OFVA 5CVVA 5HIDA 2X4FA 3DXQA 2CLQA 4CG8A 2HTEA 1P4OA 4B4LA 1BC5A 4HGYA 2P3QA 3UODA 3ZO3A 5CNNA 2UZTA 1H28A 3P86A 2ITUA 1ZQ9A 3PFQA 1H26A 3SXJA 4DGMA 3TN8A 3BE9A 2XJ1A 1LP4A 3CBLA 5C4LA 2EU9A 2O8YA 3FUPA 3BUSA 1KV2A 5HIBA 3RWQA 3W2SA 3G9LX 3QQHA 3I53A 3SSMA 1Q41A 2HENA 4KWPA 4BDDA 3NMUF 4O84A 2ZULA 1NW8A 3EQBA 3QYZA 1NV9A 3H0ZA 3RPSA 3HCFA 4OA5A 2E5WA 4YJQA 1JKLA 4NCTC 4MF1A 4BGHA 4QMQA 3F3ZA 5EC8A 3NVMB 5EZSA 4PDOA 2BRGA 2PPQA 4FG8A 2R3RA 1IASA 4BVUA 2SRCA 3R73A 4B99A 3UOKA 4QDKA 4JG6A 2JDOA 3UZRA 1R8XA 4EQCA 3GU8A 1QAQA 5FWDA 3O8TA 5HU9A 4NTTA 4IB1A 3Q9ZA 2ERCA 4ZXTA 4QPNA 3BYOA 4D4RA 4OUCA 4FV5A 1ZOEA 3SVVA 3TDVA 3VYWA 4QMPA 3UIBA 5DM0A 3LVPA 1STCE 2V7EA 4O0VA 2VN9A 4GQBA 3TV7A 3OTUA 3B3JA 2XB7A 3KMWA 3NUNA 4IZAA 4NW6A 4AAAA 3LFQA 4MBLA 2OXYA 5CSPA 7MHTA 3AC3A 3OFMA 2X7OA 3MCTA 5FXQA 3T7TA 4FV7A 3LFDA 2C6TA 4FG7A 5E7RA 3HV3A 2C6DA 1Q8UA 5FEQA 3ZFXA 3MESA 5CNOA 5AUTA 2Z6AA 5EM8A 2H11A 3Q2JA 2Y6MA 5EDQA 4GL9A 3ZO4A 3EL7A 2B4SB 5M56A 3ZFYA 2PX2A 3DY7A 4O7RA 3NYXA 3F5PA 3B2WA 5IUGA 2VTHA 3PXRA 3QRJA 2G8NA 2Y9QA 1J91A 3H10A 4EI4A 3EIDA 5DM4A 3W32A 9MHTA 2PGXA 4MXAA 3B8QA 2YWPA 3E63A 3LXNA 2ERZE 5C8MA 4V0GB 4EQUA 2EB2A 4BDKA 3TJDA 3SA0A 5IUHA 4ANSA 2B0QA 2ZIEA 3H9OA 4ANBA 4YTCA 4CG9A 5GIOE 4RVHA 1A06A 3EH9A 4K18A 2HOGA 2YDKA 3L8SA 2G9XA 5BUJA 4EHVA 5IDNA 4KWCA 1Q3WA 3UVPA 5C8NA 4IFCA 5ICGA 4RTJA 3H9FA 1TVOA 1KYWA 5FQNA 4AW5A 5L3AA 5BVEA 3E3PA 2YIYA 5JSMA 1XDZA 1OVEA 4O83A 3Q4TA 2JDVA 4YJVA 3OT3A 3FHRA 4X3JA 3LL7A 3MVMA 3DXXA 4YO6A 4ZSJA 4N0SA 2G2FA 4JBOA 4DFUA 5L2IA 4JDJA 2PVRA 3KK8A 4FTAA 3WBLA 4UOEA 5KCVA 1ZKDA 5E8XA 3N9XA 3KKZA 1YOJA 5KVAA 1JQDA 2C0TA 5KZ0A 2W96B 5E9WA 2GU8A 3S3IA 4ZZNA 4EH8A 4MD8E 5HFJA 4KKEA 5CU6A 3BIZA 2Z6UA 3PA3A 3PA5A 3O71A 2A2AA 4E70A 2YXLA 4FTJA 1JBPE 4KIFA 3DLSA 1XBAA 2O3PA 3U4UA 3CC8A 5JRQA 5F95A 3FQHA 5ICFA 1G6Q1 3F2RA 2IWIA 3C5IA 4CCBA 3D5XA 5F1ZA 4EJ7A 4BDJA 1A48A 2CNUA 5E4HA 5AEPA 5J7HA 1JKTA 2VWZA 4O0WA 3MPMA 5IMXA 4R8RA 5DLYA 4GFMA 5E9QA 2HY81 4TKSA 3RHXA 4OA8A 1H1DA 4ACCA 5EQJB 4NIFB 4YPSA 4JX3A 2QKRA 5ETFA 3NTVA 3FTCA 1YFJA 2AC3A 5CVDA 3V8TA 2PMIA 5IQDA 4RIOA 3HV7A 4EK3A 1XKKA 3GOKA 1O9GA 3MH2A 1SMHA 2JAVA 4U41A 4CKEA 3R1YA 2GS2A 3NGAA 1OITA 4FKSA 5AFVA 4GK4A 3EFKA 1V0OA 4I0RA 2VGOA 4C4IA 4YSJA 3BRBA 3AMBA 4CRLA 2FB8A 1OIRA 4CNHA 3PXQA 4ZS4A 2Z02A 3QHWA 4ER3A 5AP2A 3HNRA 1Z5MA 1TW3A 4X61A 3BGQA 4E31A 2B9FA 4ID7A 3C4WA 4MCVA 5DWRA 4JBVA 4B8LA 2J7TA 4P7EA 5CF5A 3SR4A 4IX5A 1INLA 1I44A 4GC9A 2XM9A 4QP6A 2PUPA 5LOHA 3TR6A 2NRUA 4APPA 4G9CA 5K0BA 1CM8A 3SMQA 4HYUA 4TT7A 2IDJA 4ZTMA 5F2NA 3UJ9A 4C4AA 2C6OA 2VWIA 4YJOA 1WAKA 2IVUA 4FBXA 4OTWA 4F64A 5E2BA 5HG8A 3M6XA 1JKSA 2IVVA 5AAFA 2ETRA 2YJRA 4I23A 2GB4A 3BELA 1H8FA 2ORED 4Y83A 1F3MC 3BHTA 3OY1A 2CSNA 4PYMA 5K8VA 5AP7A 4YUZA 1YXXA 4IX4A 5JGAA 4OBOA 3ROYA 3Q4ZA 4TN6A 2HW6A 5CWZA 1MJFA 2QLQA 4EOKA 5LQRA 3LKZA 1WZNA 4JDIA 3FUTA 3IO7A 4AW2A 5L8KA 2B53A 2PE0A 4WT6A 4CKIA 4DFBA 3DUWA 3O23A 1QAMA 3WZKA 3BWMA 4O29A 3MDYA 2XK3A 2XKDA 5FXSA 1NT2A 4XP0A 2W1ZA 4EKIA 5DIAA 3R9OA 2C5VA 3GEQA 4E4LA 3KY2A 2W99B 2AUHA 3E7VA 3KQMA 1TQMA 4BCQA 2R2PA 4IACA 1I9GA 2GHGA 5FQOA 4PMTA 1WVYA 4IH8A 2W1IA 3MQ2A 3EKNA 5JQ8A 2J0KA 3TUDA 1H27A 2QE6A 3TKUA 2UV2A 3U6HA 4UN0C 3M6UA 5JFXA 1DI8A 2PZRA 4YV0A 3UJAA 4POOA 3QTXA 4GUEA 5H02A 3VN9A 3R8MA 1Q24A 3UJBA 3LXPA 4BZNA 1AF7A 4XNEA 2R5TA 1FVRA 2OGVA 3KRJA 4RWZA 5BXYA 1F38A 3HUCA 2WGJA 4EWQA 4I22A 3NS9A 4BCHA 1CKJA 5IU2A 5JUWA 5AUZA 3I64A 3OBJA 2O05A 4RJ8A 3ZXTA 4E93A 4MQ4A 2BZKB 3CD8A 3P79A 3PSCA 1G38A 1V0PA 2P4IA 2YZLA 4A4LA 5AIRA 5M4CA 3UDBA 4AZFA 4I6HA 3KQTA 3C4ZA 3KQVA 4OTDA 5CXZA 3P2IA 4AGDA 4BIBA 5CEMA 2O0UA 5ANIA 3G2FA 3OZTA 4BI0A 5HGIA 3DBDA 2IVSA 3P9IA 1Q61A 2DUVA 2X9FA 4RVKA 3Q5ZA 4KKHA 3QC4A 1G5SA 2F2UA 2N47A 1OB3A 4RVTA 3KMMA 4BI1A 4ZS0A 4CKJA 2ZZKA 1OGUA 3QRIA 2G2HA 4ACGA 4QTTB 4J52A 4LWPA 4IZ7A 3V51A 4GEKA 3FI4A 2YA9A 1IAHA 2X2MA 5CSVA 3JYAA 4EZ3A 3OVVA 3R28A 4U7PB 2HZNA 2WHBA 4D4SA 1MRUA 4JI9A 4GJ3A 2ZV7A 2R7IA 1FOTA 3FMKA 4C4GA 3CJFA 5KMMA 1SQGA 2YXEA 3DR5A 4O7LA 1JLUE 3CPCA 3I5UA 3PA4A 3V97A 3UA4A 2VX1A 2B7AA 2UZUE 4YPDA 4KS8A 4QP2A 2H00A 1L9KA 3KR1A 1EJ6A 2UW4A 2HWKA 3DB6A 3LLTA 3S0OA 3P08A 2BR4A 3L8XA 3CTJA 4RIXA 3R9NA 2PXXA 4K33A 1E1VA 3F82A 4M14A 2BR5A 2PMOX 2JIVA 2B2CA 2X8IA 5K0CA 4QMOA 3C51A 5FADA 3DT1A 4GF5A 3RW9A 3KHKA 4UBAA 4A07A 3MTFA 4C2WA 3F9NA 2YM7A 3DDQA 3CQEA 2BAJA 4NU1A 3FUXA 3UJ8A 4CEGA 5EMJA 5GJGA 1Q3DA 5IQHA 4F99A 3TWJA 5CQUA 4U3YA 1E9HA 3UJ7A 2Z7LA 4TTHB 2AOUA 2NXNA 5DX8A 4L7VA 5J9LA 5AMNA 3TDWA 4EYMA 2WEVA 5BYLA 3MVHA 3CR0A 4F6WA 3Q6WA 3E93A 3E23A 4I5CA 3TM5A 5I0BA 2BAKA 1F0QA 3NNVA 3PRIA 1XBBA 3N4TA 4MD7E 2IG7A 4EL9A 4KRCA 4PRJA 2OSCA 4X3FC 2UZBA 5EOBA 2X9EA 4OBWA 1CDKA 2GLUA 4XOZA 2HMYB 5FULA 5C9CA 3LCSA 3QUPA 5DI1A 2XIXA 4CT2A 4NSTA 4WA9A 3POZA 2BKZA 4C4JA 3W2RA 2OFUA 1KP9A 2YHVA 4ENYA 4X2KA 4TYHA 4U42A 1O6YA 2C0OA 4GIHA 4K2RA 4UZDA 4EK6A 4BIEA 4JAIA 4F84A 4DC2A 2I0HA 3TCPA 3CQUA 4BP1A 4L68A 4E26A 3RM6A 2ZM3A 3V6RA 4PL4A 4X2GA 3TLJA 1YF3A 4ZZMA 4Q9ZA 1RQQA 4FTCA 2R3PA 5CVHA 3OWLA 4G1WA 4FTIA 4CFMA 4XCXA 3RAKA 2O06A 4ZZOA 4IAAA 5HCXA 4PQNA 2X39A 5HIJA 4YUYA 3WZUA 4TXCA 2VZ9A 4F08A 2XA4A 3BYMA 3TL8A 3LCCA 2UVXA 1WZYA 4ZAUA 1UNLA 1DM2A 3AD4A 1H1QA 4X6QC 4BTJA 4I5PA 5FTOA 3HCCA 1OIQA 1Z9XA 5CU4A 3H4JA 4RTOA 2OH4A 3R8UA 3FXZA 3K3JA 4ITJA 2C30A 4RTLA 4EJNA 4YZDA 5G6VA 4C4HA 3D2IA 4JDHA 1DAWA 4R3RA 3PP0A 1JTEA 5DH3A 4MTLA 3ZRKA 4TYGA 3B3GA 4XP3A 5A3XA 5DVRA 3EQCA 1YZHA 5CF6A 3R8PA 4Y5HA 2W9ZB 5LQFA 2GNHA 2PUIA 3BEAA 2FYSA 4DM3A 4DA5A 4FIEA 4QTCA 3OFJA 5EI2A 5HD4A 1B42A 3CPBA 3MIAA 1RJDA 3KQOA 3GGDA 4NTSA 2JIIA 2ZCJA 4O38A 1DL5A 5CXHA 3FRHA 4RIXB 3ORZA 3I4BA 3A7GA 4F0GA 4FSRA 3LBYA 4OBPA 4QYEA 5EYCA 3PVWA 2UVZA 4D0XA 3DBCA 2A27A 3VBWA 4TWPA 3K54A 4GU9A 4RJ3A 1H4LA 1L1EA 4TY1A 4USEA 1KSWA 3D2LA 3W2CA 3JUHA 2R3NA 1OKWA 3KF4A 5E1OA 2XYNA 3ZBXA 2JKKA 3EQHA 3MFUA 4EC9A 1GIHA 2Y1WA 2IJMA 4DFLA 3HA3A 3AJDA 4FNXA 4F0FA 3GCSA 3L9LA 2F49A 2E9NA 4O27B 4M8TA 3H9RA 1R3CA 2Z8CA 2AOUB 2H9VA 2ITNA 4DEDA 4WG3A 4LFIA 4W8DA 5A4CA 4S2ZA 5MHTA 4BDIA 5CI7A 4W4XA 5KBRA 3VBTA 2VWYA 4EBVA 4AGWA 2ZAZA 4LOQA 4ZMFA 3ORNA 4LRKA 5IF1A 2ONZA 2XUUA 4BDCA 4ZEGA 3B89A 3RI1A 3E88A 4FKOA 5HIIA 2BZIB 4J99A 3I81A 1KPIA 1ZZLA 2X6EA 2YEXA 4EQMA 2PE2A 4AW0A 4MXZA 1OZ1A 2P3OA 4EKLA 3F3UA 2P1DA 2PSSA 4EONA 4E6AA 1XCLA 1RI1A 3ZYAA 1OPJA 5KKRB 4TYHB 4XBUA 5CALA 4JG8A 2XBMA 2CCHA 3Q7EA 4R3CA 4U40A 3II5A 3MGGA 3U51A 5GWXA 4FTRA 3SAYA 3W2QA 1MHTA 3PXYA 5IDPA 2CPKE 1CSNA 4GU6A 2VWUA 4YBJA 1PJZA 2PVCA 3DJ6A 2WMWA 5CVEA 5FP5A 5JN2A 3HDMA 3HRFA 3NUSA 3MFRA 3RKBA 4O6EA 2EWAA 3E7OA 2X81A 2QD9A 1VZOA 5DRDA 2XK7A 4A9SA 2WOTA 3FYKX 4EEVA 3EYGA 4DEEA 4FNZA 1OPLA 5CIYA 5J5SA 4QVGA 2GFCA 3DFCB 2ITPA 3I79A 1HCKA 2PWPA 3PPZA 2C6IA 4DH3A 2HNKA 4FKQA 3D5WA 5FEEA 5HD7A 4FEXA 4YNEA 2X7FA 2RF9A 5BQ0A 2C6MA 4UYNA 4IVBA 4Q9SA 2VGPA 3MA6A 3KR2A 5AV4A 3TPZA 3SXRA 4YHFA 1K3AA 2ZLBA 3EVFA 4F65A 3K5VA 3R04A 4YLLA 3EVEA 3DBFA 2WKMA 3RJCA 4RJ6A 3CJRA 3MGYA 4A9RA 2VZ6A 3TQSA 3THRA 2YERA 1Y57A 4WNOA 5LR6A 3TI1A 4FSYA 2AOWA 3G6HA 5LMKC 3P9NA 4YZCA 5AV0A 2P7IA 2FVDA 4QQKA 5CX9A 1GZ8A 4ZLZA 4ER6A 4G6NA 4R5SA 1YI6A 4K11A 3UP7A 1G60A 3FEGA 2YR0A 4R78A 4UV0A 2ZBQA 1V0BA 3LFFA 4HJOA 5B2LA 2B9JA 3M6WA 5DT2A 4IKPA 5DG5A 5DLSA 1NA7A 2C7PA 4EOLA 4UYAA 4O6LA 2UUEA 2VP3A 3TNWA 5L6PA 3VS5A 3K5UA 4PDSA 1XVAA 3MHTA 4E6CA 4E32A 5G02A 4FT3A 4L44A 1PW2A 2HZ4A 2ZM1A 4RVGA 4NH1A 2JC6A 3GXOA 4LV5A 3T0IA 5M06A 2W4KA 5CQWA 4CFXA 5EEGA 4ALWA 3PPKA 3O7LD 2AN5A 4M67A 3IG7A 5KHXA 3DKCA 4AT5A 3LSTA 5IA4A 3D14A 4MWHA 2WMRA 3DXYA 5EOLA 4AFEA 1N2XA 1BKYA 4U80A 4M3QA 3BGVA 4PYNA 2NXCA 4FV8A 3WIGA 2PYWA 4G5PA 5M53A 1VQ1A 2W5BA 4CV8A 3OZ6A 1UV5A 1R74A 2WQEA 1WBWA 2BVAA 3QGWA 4FSMA 5B7VA 3IHTA 5FHQA 1UA2A 2OG8A 2VTSA 4C38A 3EGIA 5AAEA 3R8ZA 3LMHA 3SKCA 2XMYA 2BZHB 4Y85A 1FBNA 5FLFA 2PVKA 2CLXA 5BW4A 3PIXA 4NK9A 2UZLA 4NM3A 3DBEA 2YCFA 3TZ7A 2DWBA 4RIYA 4F1OA 3ZU7A 1YWNA 1JSZA 3KCFA 4GT4A 3P71T 5CYIA 2NPQA 2B3TA 3GGFA 3K3IA 5GM2A 1OKVA 3OU2A 3LE6A 4MH7A 3ZLYA 2YCQA 4RX5A 2RFSA 2KTYA 3TIZA 3VUDA 4ANLA 5LQCA 3ZC5A 5DTRA 2IZTA 2QQ7A 4O0RA 5CAQA 4K6MA 3LFAA 3QHRA 4TPTA 1Q8YA 2PZIA 4BY9E 5EKXA 4JQEA 4E2WA 5DX0A 4KSQA 3BV3A 3SXSA 4M84A 1IRKA 1YHWA 3CVOA 1R1WA 4UB7A 5EM6A 10MHA 3ELWA 5CT7A 4E2XA 3O8PA 3E8SA 1RJGA 1AQ1A 2JEDA 3R7VA 2A19B 4G31A 2PMNX 3LFNA 4DEGA 1M7QA 4AXAA 2YACA 3AC8A 5GM1A 2R3OA 3E64A 3MB5A 3HMNA 3DAEA 3C7QA 4QYFA 2XRWA 2W1FA 1R6AA 5FWAA 4ZJIA 5DN3A 1YXVA 5KO1A 3NSZA 3QTWA 4MYGA 3QA8A 2E9UA 3NW5A 4PYLA 4F7LA 3RM7A 4QMWA 3VBYA 1ZMUA 3UQGA 4UXQA 3NZ0A 4DHFA 5DNRA 3EYHA 1SVHA 3LFEA 4KAOA 1NW3A 1N7JA 5HLNA 4RSRA 3TV6A 1X1DA 1PRYA 4LYNA 4XUEA 2R3JA 4QQJA 2FK8A 2EUFB 2JH9A 2O64A 2PTKA 5BVDA 1PF8A 4PL5A 3NR9A 2DPMA 5CVGA 5EKOA 4PX6A 1T46A 3B7PA 4PWYA 1L3CA 3LQ5A 2VWBA 2HXQA 2QHNA 1BI7A 4DFYA 3LECA 4AZSA 3M33A 1H08A 4QMUA 3WF8A 1VL5A 3RTPA 4DFNA 3PVCA 5BPYA 4D58A 4FSZA 5ICEA 1ZYJA 2BR3A 2QCSA 4IJ9A 2G15A 2XVAA 2PXAA 1Q0TA 2OB2A 5DSXA 3ELYA 2C5NA 3HVKA 2OY0A 4NYEA 4C02A 3BQRA 5FDPA 3IDCA 3IGOA 3FXWA 3MN3A 4HZSA 2QU5A 4G3CA 4CRSA 5EH0A 3ID6C 3B5IA 1H1SA 4L42A 1U4DA 2YAAA 2V22A 2WEIA 2ITYA 4Z3VA 5J87A 4U7ZA 5J9ZA 3IS5A 2NXJA 3SSOA 2VTLA 4AA5A 5E8TA 3QLGA 3VIDA 1YW2A 4BBEA 1IXKA 4CWAA 3D9VA 4PCLA 2ZZMA 4QP4A 2ESMA 3JVRA 2PL0A 3VS4A 2WELA 3JXWA 2YXDA 4QP1A 1XDSA 2PHKA 4HG2A 4XG8A 1ZYSA 4WBOA 2OKCA 3C6MA 5IZFA 2WB8A 4RJ7A 2B55A 4CTBA 4GOND 3A8XA 2YX1A 3V5PA 4F09A 4HNIA 4RIYB 2OYRA 3DU8A 3UZUA 5LXMA 3F7ZA 2YM5A 3POOA 1H00A 5DXAA 5EHOA 1X19A 2KULA 4LG4A 4RV9A 3R9XB 3QBNA 3CJGA 1YDSE 2VNWA 4TWCA 1VIDA 4YJPA 2UZNA 3C3PA 3GXLA 3FY0A 2PLWA 4GT5A 4GOLD 5ETAA 3A62A 1PXIA 4QTBA 4BGGA 2I7QA 3VUHA 5TF9A 2QU6A 3DBQA 2JHCA 2IVTA 5CLPA 1REKA 4JG7A 3QCQA 5HIMA 5LCKA 3VSEA 2WMSA 3O8UA 4CFUA 1XH5A 2CNVA 4XUDA 1Y91A 3D15A 5GJFA 5I9VA 3FZPA 4M7RA 3L8PA 1FVVA 1LEZA 2XNGA 3QXOA 1NVRA 4D2SA 2PVHA 4MNFA 4O0SA 3KN5A 1VLMA 3UYSA 4G34A 3W16A 1OL5A 2OIBA 2PULA 2I7CA 1PXPA 3RIEA 4FG9A 2V7OA 3G51A 3UNJA 4O7YA 2ZIFA 4NL0A 2G01A 3PG1A 4EK5A 3S95A 3OT8A 3Q5IA 3FUWA 4KBAA 5HICA 4WXHA 4GCJA 2XK8A 3ENHA 1RI4A 3OCGA 3UJGA 4GG5A 2ZDTA 4MQ1A 4USFA 4U0IA 3KR0A 3PIYA 1V39A 2QODA 5TO8A 2FUMA 1QCFA 2C6KA 5IA3A 1URCA 3BCEA 3MY0A 2UW7A 5F94A 4IM2A 4H0NA 4RWJA 3VBXA 1YWRA 2ZZNA 4Y46A 3KQ7A 4HPUE 4LG1A 3CKWA 4FZ6A 5HE3A 3ACJA 5FRIA 3EQFA 3QUEA 4DQ0A 2OPBA 2PWYA 1U54A 4DTKA 1SG9A 3U54A 4DFZE 4CMUA 4YV1A 1L3IA 2VUWA 1TQIA 1LR4A 3LX6A 3ATTA 3JY0A 2IZSA 3O7WA 4M69B 2OF4A 5AIKA 4H58A 1B39A 2GMXA 3QCSA 4XOYA 1NV8A 5KBQA 5IA2A 4GVJA 2ITTA 2R9SA 3HEGA 1LEWA 2QOQA 2R64A 2YIWA 2XYRA 3GCZA 2VV9A 3Q4UA 2ZIGA 3I7CA 4L3JA 4PCAA 5I9XA 3UVQA 3R00A 1Q62A 3LFBA 1Y8CA 3U4WA 2CNQA 5LQUA 5EIFA 1FINA 5M4FA 2VD5A 2IFTA 5H2UA 4MAOA 5EFQA 1M14A 3HA6A 2QOOA 5F9EA 3FSKA 3A7EA 3FZSA 2XBJA 5DT4A 4AA0A 3OEZA 4WNKA 4Z16A 4ATNA 3VS0A 3UO5A 1GIIA 4DKJA 4HYIA 1P1CA 4QQTA 5LMAA 4BCMA 3FL5A 4XP2A 3G88A 4TYIA 2FSOX 4RC4A 3CGGA 3BHVA 4WNMA 4KNBA 2XH5A 3HUBA 3VRYA 5DEWA 3FDNA 4BHZA 4G2FA 3FQEA 5DEYA 5IA5A 5D12A 3VW6A 5E9JA 1H1PA 3CKXA 3ELJA 2Y4PA 4QMSA 1IY9A 2B25A 4MK0A 1KV1A 3IEIA 2V5QA 3ZUUA 3KRXA 2HAKA 4MKCA 1A9UA 3F2AA 5FUTA 3LHJA 2BDJA 4ZY5A 3ZZWA 3Q96A 4RRVA 3SV0A 2HK5A 4BYJA 4FTOA 2J9MA 4JT3A 4CXMA 3C6KA 1JG1A 2YIQA 3DPKA 3N4VA 1Q0SA 4FX3A 1UVRA 4I20A 3QYWA 3HVIA 1VEBA 4EOQA 4RTPA 5EKUA 4MXXA 4HH4A 3H0YA 4M38A 3G89A 1JSVA 1BI8A 2XYVA 4LWOA 3TRKA 5AV1A 3KEXA 5KS2A 3I0QA 3ZS5A 5HVKA 4FZ7A 2EJUA 3MBLA 4I92A 3O96A 2HV9A 3KRRA 1R78A 3EN7A 3U9NA 2Z2WA 5EMLA 4GH2A 3TKAA 3OHTA 4E8AA 4DT8A 1Z3CA 4H05A 3GU4A 4JBPA 4HCVA 4PGGA 1BX6A 3I5NA 2Y1XA 3DTCA 4X63A 4AQCA 5E8VA 2OB1A 2UYQA 5K4IA 5FEDA 3KVXA 3G15A 2RL5A 5C0OE 3RPOA 5BVOA 1YHVA 2BIKB 3LXLA 3C4CA 5AM7A 3R7YA 2IH5A 4KABA 3ANXA 3PJCA 5M51A 3P97A 4EORA 3ERKA 4AX8A 3KL8A 1UNGA 2WTKB 3COHA 4EHGA 3MY5A 3UTOA 2R3KA 1ZYCA 2DQ7X 1FJXA 3IDBA 5HORA 1J7IA 4YNOA 4ZJVA 5EK7A 5D11A 4C36A 1JOWB 1ZY5A 4O22A 2C5XA 3BLQA 4FYOA 3BU6A 4IANA 5E8WA 3DA6A 3FZOA 2YVLA 1U54B 3R0TA 5EKNA 3VF8A 5DR2A 3VS7A 4D9TA 3KQPA 4I24A 5CASA 2QRVA 5BUEA 2V55A 3BYUA 3GC0A 3SD0A 4LV8A 4RA4A 4QTAA 5HQ0A 4JDKA 3L1SA 3QRTA 4XUFA 2W1HA 4NJ3A 1NW1A 3A25A 2XVDA 2VAGA 2LAVA 5HVJA 2VTPA 2VO0A 1OKZA 3DP7A 2CKQA 3S4QA 4YC3A 4IX3A 5B0XA 3TMAA 3E87A 4DE4A 4U6RA 5BUIA 4XRLA 4R6VA 3FZ1A 1SNXA 4EOMA 3E8CA 1ZG3A 1BKXA 4XHKB 3UP2A 3FC1X 3KF7A 4ZY6A 3DXPA 4Z2YA 3CP9A 4FT7A 3IW4A 4BBFA 3MI9A 4IC8A 3K6RA 4FS8A 2IW8A 2OO3A 4FNWA 1QPCA 5HG7A 3P9JA 4FT9A 1FVTA 2FHPA 2XK6A 4GG7A 4CMTA 2WOUA 3PJ3A 3WOWA 4RBLA 2QC6A 4YJUA 4XG9A 4KIOA 5CVJA 1GZNA 3F5XA 3R30A 1YKRA 2Y7JA 1ZGJA 3MFSA 2HW7A 2JH8A 3R9DA 4FEUA 3OF0A 3O51A 5E2AA 2C3IB 3EMGA 5CEIA 3M11A 1M52A 3L9NA 4R8SA 3FMJA 3ENMA 2X4ZA 3THSA 3HCDA 1L3BA 5HX8A 4RWLA 3AD5A 4FVPA 2C4GA 1SVUA 3S2PA 1BOOA 3KPYA 3BKXA 3QD2B 1DAYA 4KRGA 4JJRA 4YUWA 2RG5A 4A6EA 3P7AA 4E7WA 5JKGA 3ZXZA 2WMVA 3ZTXA 2QR8A 3NYVA 3DMGA 2Y8OA 3GU6A 3TKHA 4DN5A 3QL8A 3EVBA 3SQQA 1UWHA 3NEWA 4XMOA 2CKEA 4RJ4A 3HCAA 5T64A 3IW6A 2E9PA 1W7HA 3UNZA 3VHEA 4DITA 2QURA 5LCJA 3A27A 4KDCA 4FV4A 3IGGA 4BF2A 2JBOA 5LQJA 3U9CA 4I6QA
chains in the Genus database with same CATH superfamily
4JYAB 2F00A 1QQ7A 3QTSA 3KL2A 3CVUA 5CM2Z 1FQWA 2XUPA 2ZYTX 5SYNA 4HGQA 4MR9B 4RF3A 4ITRC 5FLYA 2QDKA 1G8SA 1ZJWA 2PT6A 4EYOA 3KGAA 2G1TA 2R66A 3W0MA 3ESZA 4ZP5A 4R7HA 5CCBA 5A4LA 4JJGA 3LT2A 5MGNA 2IU4A 1DVRA 3CNQS 4D1ZA 5CR9A 3G6GA 4IMIB 5K0EA 2AOTA 2OFFA 2C7OA 2GCPA 3MPOA 1XTBA 3FXXA 3W8EA 1OH8A 1PMEA 3BMQA 4ASXA 1A8UA 5K99A 4HPJB 3Q9NA 2D4AA 5FOWA 2YWCA 5HS6A 2IDKA 1OHHD 5KOJB 2DUUA 4UUAA 1GLNA 3MWFA 5HIKA 2JGRA 4OQNA 2YYYA 2MHCA 2P1ZA 4WHZA 4PP7A 1FOEB 5FJIA 5DNDA 2RBKA 2V55B 4G5FA 3A4NA 2DF8A 2WT8A 1XWFA 3EUAA 3TUZC 4K6FA 2XNCA 4YURA 2Q3FA 5I9UA 4ZO7A 4E5MA 3AEQB 3PJEA 2P3LA 2X0IA 4UE2A 2QRMA 3OZWA 3PPIA 4BYMA 1QGUB 3DBHA 3E7DA 4ZI5A 3W2EA 2YWEA 1M0SA 3ZONA 5B3JA 1DBQA 1JSCA 1AXRA 4Q9DA 3B1YA 1RR6A 3KFAA 1V11A 1YONA 3OX2A 4LA4A 2RSLA 4C76A 1YWVA 1JJAA 4XQEA 2C58A 1QH8B 2H54A 2FMXA 4HMQA 2LR0A 1UT5A 1T5DX 3FROA 4RHEA 1HOTA 4KQXA 3EZRA 2BALA 4XG6A 1XL0A 2CDZA 4OQFA 3RNOA 4BQFA 4KQFA 1KTIA 3TXOA 2PUGA 3CO0S 2PU5A 5EERA 4E3ZA 5EQEA 1A96A 4OTZA 4KKVA 4JYBA 3IRVA 1Y81A 4RMNA 3LOKA 1ZY2A 5F78A 4CW7A 1ZZ2A 3DA8A 3HABA 4IAKA 4AG8A 1UCFA 4G3DA 2ZPTX 4KMMA 4K1XA 3K15A 2HNBA 1P4FA 3MWJA 3G2MA 2OYCA 3HJGA 1MZPA 1CUCA 4MIEA 1U7OA 3K6SB 1CG6A 4EATA 2JHFA 3MD9A 1KC3A 1EUZA 1Y8QA 4CL3A 2WSBA 4U8GA 3PF8A 2FFQA 4O1IA 4LYEA 5A4MS 4MVJH 3HDNA 5M04A 1NW5A 1FPQA 2Q3MA 4K88A 1ZJJA 3GGCA 7REQA 1KORA 1KE1A 1J8DA 2FN7A 1YSCA 3C0GA 1F8XA 4YXFA 3FLSA 1WCWA 4LI5A 6ABPA 3RIGA 2CJWB 3RP9A 3HV0A 4IH4A 2C3LA 1ETUA 3EC1A 3QMPA 2H2HA 3LPMA 1LZKA 3O2MA 3VYVA 3JPVA 2GZRA 2X1LA 2FZWA 4O7TA 3VVCA 3HVHA 3DFFA 3F3MA 3I09A 4D4VA 4IRMA 4ASDA 3KWFA 2Q4BA 2ZT7A 1XEWY 4PGFA 4E4XA 3OLYA 5JATA 3CLVA 2FPOA 2JFNA 4W8GA 1D4OA 4BLTA 5DHFA 5E1EA 2WIKA 4ZAFA 2PN1A 1YJXA 4JB2A 3EN0A 2F7EE 4KK4A 2QJFA 3D5VA 4UEKA 3YASA 2ODAA 5ACBC 3SOPA 2PMKA 4FA2A 1RWOA 4EC8A 4UM8B 3L1HA 5FP0A 4B48A 5FA5A 1KVTA 1KQOA 1PJ4A 1V8FA 4AFJA 1NMQA 1PXMA 4ZA2A 4MUMA 3L2OB 5KSZA 4LOPA 3C50A 4ROTA 3OTWA 3I9V1 3RVRA 2VH5R 1QGZA 3R5TA 4S1PA 1UU3A 4AZ0B 2VUUA 4HNAA 2Q2OA 1JWBB 1Q8TA 4CM9D 3TO5A 4AQYB 3QCXA 4DMKA 1Y9JA 3TOVA 2PZ5A 1JWLA 4RC2A 4EOSA 1BUHA 3SS9X 3K4PA 3A4LA 3TUIC 4CDGA 1SVEA 1HE4A 5DIZA 5A62A 3HGTA 1PR1A 4JVGA 4O1HA 2E4VA 1AY0A 4MJXA 2Y4IC 1JEQB 1NPYA 4BE4A 3WICA 2CJMA 2ACVA 4XUCA 3LVFO 3Q9WA 4MWBA 4DSOA 3I2JA 1VXOA 4L28A 4KIGA 3WL6A 4RPLA 4F71A 4NWMA 4LRJA 4FKWA 5L8JA 4Q05A 2AOXA 3RALA 4U5JA 4KQGA 3ESDA 3CZQA 1E92A 2DFPA 3EFLA 1YQDA 2QOBA 5B4UA 4DV2B 2LKDA 3AVTA 4GDMA 4N8DA 2FCAA 4FTMA 4A1FA 3DLCA 5FOXA 2BMEA 3O8CA 3COMA 4MYDA 2VNSA 4F4PA 4LOKA 3PJGA 2DR2A 3OICA 4AY5A 2XCUA 4FK3A 5BVHA 3FLZA 3Q7RA 5LUBA 4I08A 4A0FA 4FQ7A 2W22A 2OLJA 1I13A 4QQNA 2ZBEA 1YZYA 4AECA 1SCUA 3K7EA 3L4SO 2ID8A 3QF4A 4HDAA 4MOWA 4JR7A 4M1YA 2H31A 2V6JA 3HJTA 2OQVA 5BQ3A 3L46A 2OFXA 1PT5A 4YSMA 3FHOA 2IHNA 1XP5A 1WNTA 4BRZA 4ZK5A 3KYIB 3N7AA 4MI3A 4OHUA 5DGZA 1XQ1A 1GCIA 1E3EA 1U2GA 4EX6A 1MPXA 4RDHA 1ZSNA 4GBMA 2OXEA 2ON6A 5DFPA 4EK9A 3EDOA 3IB6A 3SCZA 4HLUA 4E46A 1IG1A 3OXZA 3R3JA 3UWMA 3C4EA 1U04A 5AJQA 1DC6A 3HP2A 2C5YA 4H08A 3EGXB 3KBOA 4L51A 3GLIB 2JFZA 1Y6JA 3QKTA 4EY7A 3Q9YA 4Y0NA 4YP8A 3OG7A 5HCNA 2XZSA 2VDMB 2GN0A 1MABB 3AQ4A 2W1GA 5AJVB 4EWLA 3ELBA 4CQMB 3RU2A 1LUFA 5IMEA 1OXUA 3DBRB 4Y67A 1N3IA 4IQGA 4PSKA 2K7ZA 4D9UA 4FKLA 3SZMA 3GP0A 3KSMA 4AY6A 3QELA 3SJ7A 4CEHB 2PKQO 2OA0A 2HQ1A 1DAGA 2EKDA 3Q2MA 1T5HX 3SNHA 1TK2A 3C6ZA 3RKRA 4LRXA 1TEXA 4FWTA 4UUPA 1W48A 2VO7A 4DR7B 4GSYA 2V59A 5DN6A 3UHJA 4QYWA 2YM3A 4FGJA 4I8XA 2WAAA 3G5AA 2A9KA 3MFTA 1G7TA 4P5QA 5HVNA 4MPJA 4RD0A 1Y8RA 1J3HA 3C13A 2UZ3A 3R5HA 3A11A 2W4QA 4CCSA 4KXNA 3A9UA 5CA0F 1G21A 2HF9A 3G0DA 3OHSX 1WHTB 4MGZR 4HQ6A 4Z55A 1PEKE 3P4KA 3EC2A 3BFPA 3KB1A 4GK2A 1WKBA 4GU5A 4C6HA 2X7XA 4IEIA 3ZTTA 3NV7A 2D00A 2CMDA 3OT5A 4W1QA 5AM5A 3KVYA 3LKMA 3ACKA 5I7UA 1PK8A 5IUIA 4YLGA 2O9JA 2GXUA 5DGHA 4BUZA 4FICA 3O0DA 1BYUA 3L40A 3SHEA 4INJA 2O50A 1ABFA 1T9ZA 4MB2A 3NC1C 2I6LA 3A1WA 2PBFA 3HV2A 1ML3A 3E1GA 3DQPA 3HVUA 1A27A 4CN8A 5JMOA 5CT6A 4GSKA 3AC2A 1KEUA 4RM3A 4PC7A 2RHGB 4E7OA 1SYKA 1A2QA 4TMKA 4DCVA 3GPCA 1Y1QA 3K30A 4JQZA 2UZVA 3L4JA 4ASZA 1J6UA 2CXUA 4AY4A 3DEAA 1RWPA 3H1BA 2ZEJA 4BNFA 3UVRA 2BM0A 5KCMA 1VIVA 5DM2A 1G9TA 4EF6A 3G2OA 3KAQA 3W34A 1NVVR 1XHLA 1WSDA 4L9IA 4FIZA 1AX9A 4G3EA 1KYYA 2WWFA 2C2HA 1P14A 4FR4A 3HWRA 3BM5A 4X44A 1AK2A 2UZAA 3SU8A 5CLHA 2A5YB 4YO4A 3IOCA 3SC2B 4XLVA 2W1EA 1JLLB 4QM6A 1RAHA 2PK9A 3KPVA 1Y6QA 5ALPA 1SCBA 3HYTA 5TVGA 4WLFA 1SEPA 2JGDA 1E4YA 2FSTX 3DMFA 2XKEA 2BISA 1FSGA 2KWIA 1A82A 3QA9A 4IHKA 2YAKA 4URFA 1WL8A 2ID4A 1GPUA 3URKA 5LVMA 3A1FA 4Y2UA 5J1VA 2G1KA 1FNMA 2G67A 2Q50A 4EGFA 4O96A 3BS4A 2CK3D 2I8CA 1K7EB 4BICA 2C98A 3MJHA 2JLAA 3DZJA 5HPYB 2UUOA 1E79A 3T12A 2WFMA 3EXIA 3M6VA 4LRSB 4K9MA 2AXPA 4FKIA 3R6XA 3MH1A 1VL1A 3MCVA 4X2JA 5CF8A 2UZIR 2BFPA 2JIBA 1AQLA 3OIVA 3FNBA 2GSFA 4RJ2A 3R75A 4BCFA 3P9RA 3EJ1A 3TW8A 3C24A 1KPGA 4QWWA 3HPQA 4MRRA 2UZ1B 3ZLJA 3V4RA 3D7MA 2CUKA 3LT1A 4F9AA 5AW6A 4XLIA 4LDAA 2O3RA 4OXYA 1D6NA 1A88A 3ROFA 1Z26A 3H4MA 3AM3A 4FKVA 1OBOA 2VDWA 3BD8A 4YLJA 4POAA 1RYEA 3JQ8B 4A4OA 2HSEA 4E30A 1JJ7A 1WMEA 1B14A 2FPIA 4LZNA 4C2VA 4F8YA 3F8WA 5IULC 4CM4A 1XQZA 3I58A 4KBKA 1ORDA 1GZ4A 4HTFB 4ZOLB 3CUEF 6CHYA 3V6LA 4OVKA 1US8A 1G8MA 4EJMA 1GZ7A 1D04A 1Q83A 3LLAA 4J29A 1PQWA 1W34A 2IHUA 3ETLA 1MB3A 4C4TA 1ZN2A 3NDIA 5AA8A 5E3IA 3B53X 2QUZA 3E82A 4NLLA 3CHYA 3LQ3A 1E9VA 4ZU6X 5KAPA 1JI3A 3TM0A 1CUJA 3D83A 2A84A 2FP4B 2O2IA 3T1NA 3K73O 4FIDA 4ZEWA 3TZMA 2B1IA 1YHSA 1A95A 1WD7A 2R0UA 5E92A 4NC9A 2A5GA 5DR6A 1H01A 4WNYA 3WZJA 4PXYA 3LDUA 3W3ZB 5LPNA 1P1KA 3BV2A 2ZB1A 3NXKA 1IK4A 3JQ9C 4NICA 5G4KA 3U6IA 4E20A 4WSOA 5B57C 4QOIA 3G2HA 5HJ5A 1SBNE 3K1AB 5DPMA 3CZPA 3TW4A 1GKYA 4LMUA 2P0EA 2WMYA 1V96A 4K7JA 5DSTA 2HPVA 1SKMA 1WU7A 3QFSA 3VKGA 3K8YA 2QG4A 5IUNC 3HXPA 1ONOA 4JEMA 4BU1A 3WE4A 4OQXA 1FRZA 3U61B 3M3DA 1ZLXA 3VHKA 5FTWA 4RLKA 3ICWA 3R9IA 2HYDA 1C1XA 1BGXT 1I2MA 3AKLA 2ONLA 1RRPA 3OQ1A 3AY6A 2WMBA 1J2JA 2PX5A 4AKTA 3PG5A 4D3YA 1GO2A 5GJBA 2QM3A 1NNSA 4ESHA 2QM7A 1PP4A 3GUCA 2JS7A 4DEAA 3EQGA 4N3AA 1QPBA 2B82A 1N8SA 3N0TA 1Q4LA 1QPEA 2BONA 1AG9A 3GFPA 1J4AA 3G1WA 1BSVA 4M9XA 1QQ5A 3IAEA 3L4BC 2Q0SA 3VC4A 1YDEA 3OQJA 3WXBA 2QJOA 3BC1A 4YJRA 1QBGA 3T9BA 4NT4A 3R6TA 1UU7A 1FDVA 4JLJA 3C14C 4GRBA 3E48A 4WVLA 5G0WA 2QENA 5I51A 5EW8A 1DELA 4BHTA 3BMXA 3MSSA 1I3CA 1UU9A 1HSOA 3QQUA 4IM3A 1PFUA 1NZFA 3MT0A 3FKNA 4OF4A 4MRVA 5P21A 5LIPA 4GR4A 5EJIA 1O3YA 1QYVA 4HW7A 4X97A 5A6SA 2HNAA 5CLFA 1BMDA 5JAUA 4LCEA 4JQ7A 4DC9A 3O4HA 4P54A 3F8SA 5T57A 4US2R 3FQSA 1X2EA 4C4YA 1U1EA 4FKTA 4IDTA 4ERNA 4UVEA 3MPUA 1OOEA 3WMXA 3O7LB 4RIHA 5BQOA 4AZ3B 4LFCB 3QXCA 3PE1A 4AOIA 5GONB 3JVSA 5DGTA 3PEYA 4NZOA 1KQNA 2C8LA 4RCZA 1DHRA 2VQ6A 4I4FA 4L76A 1TTTA 4CGAA 3KKOA 3ZDRA 1WW2A 2E4ZA 1DAMA 4GD3Q 3NHSA 1KO8A 4QXAA 5EHQA 4ZAZA 4NUSA 2CXQA 3QTBA 4FUXA 3Q0IA 2F9LA 4BKPA 3ZZ0A 3ORXA 3JYOA 4UZFA 3EZGA 5C5DA 4G09A 2WPNA 3VH1A 3HPRA 5EGNA 4M37A 4DY4A 3DHEA 3OE5A 1E98A 3PA8A 3AEZA 2GVDC 2C2OA 3IP9A 3QJ5A 2XNKA 3PFHA 5JCZA 4E5UA 5CK4A 1KY5A 4YJTA 1P4RA 3DHNA 3AY0A 3NHFA 3GJXC 1Q6ZA 3WE8A 3QD0A 5J5AA 3Q8XB 4WVFA 5KNCD 3T9IA 3EA0A 5U9CA 1SUDA 2P9FA 2BFXA 4A73A 4NECA 3KXGA 2VP0A 1VG0B 4LGGA 2BZ0A 3KOOA 1GG2A 5LP6F 2VDVE 2WNSA 3QUAA 2VYND 3V5JA 3UC4A 3KRTA 3TZEA 5CIQA 4EEXA