1G8SA

Methanococcus jannaschii fibrillarin pre-rrna processing protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
230
structure length
230
Chain Sequence
MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikshii Fibrillarin
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN
total genus 69
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1g8sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g8sA02
5AAFA 4OBWA 4NFNA 4TYEA 4CQEA 2A2AA 2IJMA 3HRFA 4E6CA 5BQ0A 1ZG3A 3FZRA 4ZTHA 3R8UA 4BCIA 1KPGA 2AVNA 4CT2A 4G16A 3RVGA 1PJZA 4O7SA 1R6AA 4KINA 1J1CA 3DFCB 4Y8DA 3ATTA 4RLKA 3WZUA 3BLQA 4IWQA 4EHEA 3OZSA 4FNYA 4NIFB 2XYQA 4GT5A 4H58A 5EM5A 4QTEA 3REOA 5KS2A 5T67A 1WBSA 4GG5A 4PF4A 4QTCA 3WZKA 1M0EA 2C7OA 3TKUA 3FRIA 4AA5A 5KCVA 3PIZA 3EFLA 4NH1A 3PG3A 4XMOA 5FD2A 4AE9A 3DKGA 1BKYA 3G6HA 5F94A 2G01A 4X2GA 5CI7A 4AZTA 2OJFE 3BYVA 4C35A 1JSUA 3EQPA 2O63A 5GHVA 1ATPE 1FGKA 3R04A 5CY3A 3QHWA 3R83A 3LGAA 5D7VA 1Z9XA 3UC3A 3V5WA 3KA0A 1JQ3A 5AAGA 3CC6A 3Q6UA 3MB5A 3ETAA 4S31A 1DS5A 3QWKA 2C47A 4F0GA 4Z55A 5JSMA 2X8EA 4LFIA 4RX8A 5KKRB 1G6Q1 3GU4A 2JH9A 4XCXA 2XK8A 3PXFA 4GCJA 3E8CA 1PYXA 5EIWA 2V0DA 3NYOA 5IEVA 3VULA 1H08A 4X2FA 3C4WA 1OECA 4FVRA 4X60A 2P33A 3DZQA 1XH7A 4G6LA 4QPSA 5HI2A 1UIRA 4X3FA 3MERA 1FJXA 4G6NA 3G7UA 3QC4A 2PUNA 2RFSA 2GPYA 3KMMA 3DJ5A 4RJ5A 4V05A 3FY0A 3KC3A 4C3PA 2CMGA 4YC8A 3F3WA 2UW0A 4R8SA 3KN6A 4KIQA 3KPWA 3C4CA 2O5KA 2R3IA 3KL8A 4TW9A 5GNKA 3DLZA 5K0FA 4ITJA 2PK9A 2WMXA 4IWDA 3EYHA 1WBNA 4NTTA 5DR2A 2A14A 2UZVA 4KIPA 3UVRA 2JAMA 3KGAA 3ZZWA 3G33A 5I5ZA 2BM9A 4CMTA 4RVHA 5DSXA 4E6AA 2X1NA 3EQDA 5EG3A 3MY5A 1OKYA 4AOJA 3ZUUA 4WRGA 1NKVA 4DGMA 1RW8A 2VTHA 5E9WA 4BDDA 5JMSA 5M07A 3OHTA 3R7EA 3PJCA 2YJRA 4LL5A 5BVOA 3UFBA 2VTJA 4GT4A 4LOOA 4MX9A 5K0EA 3L9PA 4Z16A 1ZARA 4BP3A 1R1WA 1SZMA 1RDQE 3I0QA 2J7TA 2QU6A 4TRLA 1SNXA 2BHHA 3ALOA 3N4TA 1SNUA 2WMTA 2C7PA 4NK9A 2B9HA 4GOMD 1X8BA 2HY0A 3HV7A 5CT0A 2HZNA 4GH2A 3SHEA 3BYUA 4FTJA 5FBNC 2YAAA 5CVUA 2QCSA 3DXZA 1PJKA 3I7CA 4KABA 5IQDA 3KQPA 4EKLA 1UWJA 4DH7A 3DBQA 3GRVA 5I0BA 3S4QA 4FT9A 3NUXA 5AP6A 3Q96A 2REIA 3E64A 2YXDA 5L6PA 1U54A 4HGZA 3LKDA 4MKCA 2OICA 2VV9A 3I5NA 3NCGA 3HCDA 3AXTA 2W1HA 3CCNA 3MJ2A 3P08A 3FZ1A 3PXKA 5FM2A 5JN2A 3UQFA 1BC5A 2QRVA 3LM0A 4FSDA 5CXHA 4A4LA 3DMFA 3KKVA 1WVYA 4GV1A 2QO2A 3QFVA 3KRXA 2XEZA 3JXWA 4I20A 4I22A 5IA5A 1URCA 3F3ZA 1XH8A 5HCZA 3TIZA 1W83A 2VAGA 3D9VA 3HA3A 4UXQA 2AC3A 3D5WA 3LAUA 3EQCA 4D0XA 5C4LA 3TUDA 3NW5A 3RP9A 3DTWA 3EMDA 5EMKA 3UVQA 2P35A 1KE9A 2UZDA 3UIBA 4MNFA 1LP4A 4XP2A 3NNWA 5ICPA 4RG0A 1R39A 2WHBA 5E8UA 4U9AA 3VRZA 3VYWA 3SLSA 5J95A 2CN5A 3F82A 5ICCA 3BYSA 1ZY5A 4WG3A 4ER5A 2WMVA 3LQ8A 3VJNA 4B9DA 3CIKA 1I1NA 3TTJA 2CMWA 2EWAA 4P4CA 3O7WA 5LQCA 2XCKA 4IFGA 4AGCA 4NUSA 4FKTA 3I58A 1IA8A 4NZWB 4KB8A 4JJRA 3A7JA 1JTEA 4RWZA 1G3NA 1WBVA 2WMAA 3FMLA 1U5RA 3IS5A 4MD7E 4K6MA 2R64A 5D1HA 3FL5A 3RTPA 5DHJA 4I5MA 4CWAA 4GL9A 1NV9A 4LQMA 2ITXA 4ACCA 2F49A 5BYLA 1Q8TA 5KE0A 4CTJA 2A4LA 5LQKA 3ZSIA 2IGTA 2GH1A 4LL0A 3KPUA 1J1BA 4FV2A 5K3YA 5DRDA 2QOFA 1WXXA 3EB0A 3H9OA 4FIHA 4C4IA 1VYZA 3I79A 3MH0A 2YN8A 3EZRA 2WA1A 4TT7A 1YOJA 2BZJA 4YTIA 4DTKA 1R74A 5CYIA 3JWGA 5DG5A 2OK1A 4EK8A 4ZEGA 3HLLA 5LARA 4ER3A 3KU1A 1EIZA 5AA8A 5JFXA 4PYLA 1GZ8A 3SVVA 4AT4A 4DCGA 2XNGA 2UZEA 4AZEA 5BUJA 2AC5A 3HNRA 3OWLA 3QUEA 1IRKA 1OZ1A 4GKHA 2A0CX 3R9RA 3W2OA 4YLLA 5DFPA 1CKIA 2WGJA 3E62A 2QO7A 4PMPA 5CEMA 3GRYA 2C5YA 4YGAA 4E5AX 3LPMA 2BDJA 4E2WA 4XEYA 5M53A 4RIXB 3FPHA 2CHLA 3T8OA 2PVFA 4Y72A 5CEIA 2JDVA 4YLKA 2BIKB 1V1KA 2UVYA 1XWSA 2QC6A 2YJSA 3KPYA 4IVCA 3O31A 3IEIA 5DYJA 2HW7A 2VWWA 4M3QA 2OFVA 1OPJA 3OPNA 4Y46A 1Y6BA 5CVDA 3MFRA 4FTAA 5HHWA 3AWIA 3GXLA 1A48A 2XJ1A 3KK9A 4O7LA 4OA5A 4RIWB 3ZOSA 3EWHA 5IH3A 4X7QA 3UOHA 3M42A 4ZMEA 3C4FA 1OKWA 2C0TA 1SVHA 4ZZMA 4E2XA 4R05A 3VF8A 5KUPA 4MWZA 5LQAA 3W2SA 3BWBA 4JBVA 4CSVA 1YUBA 3QX2A 2B4SB 4AW0A 4AOIA 4DGNA 4ZAUA 5LVPA 3EQHA 4DZRA 3U51A 3EVEA 3R22A 1KV2A 3HA6A 4MCVA 3ZONA 2PXAA 3IG7A 4KBKA 1UA2A 1GOLA 2DS1A 3T3UA 3PLAE 3JPVA 3LXKA 3SD0A 3ENHA 4PINA 4FX3A 4MBJA 3M70A 1XHAA 2PE2A 4JQ8A 1VE3A 2ACXA 4YBKA 3C3YA 2BRBA 1W7HA 2JDSA 2C6MA 4CCBA 2R0UA 4JIKA 4C59A 1R3CA 4OR5A 4C04A 4BCFA 3KCFA 1J7UA 3P78A 3Q3BA 3TV4A 1LPUA 4AF3A 2B78A 3DNDA 2R3JA 4BICA 4RTLA 4Q5HA 4D58A 3BIZA 4O6LA 3F2NA 2XVDA 2ZOQA 4U44A 3QTUA 3FPEA 3GCZA 5M06A 1H1SA 5E91A 1WG8A 4HYHA 2IO6A 4FOBA 3K0BA 2XUUA 1B39A 4TWNA 5CALA 3K5UA 3NTVA 3P9IA 4ACDA 2V62A 1M7QA 1SUSA 1VL5A 5GM2A 2XYNA 3FQSA 2WZJA 2VDWA 3WYXA 3TUBA 2VTIA 3AD5A 3BRBA 4IQ6A 2FA2A 5EDPA 3H3CA 5FBOA 3UODA 4ZTBA 4FIEA 2IN6A 3O50A 3LM5A 5D7AA 2PVMA 3KVWA 2W0JA 4E4LA 3SW7A 4CZUA 3EQFA 3ZXTA 4ALVA 1ZZ2A 3UG2A 2R3QA 3ZXZA 2CDZA 3O71A 4ZTRA 2FHPA 4ISCA 3OWKA 3PE1A 2FGIA 5HICA 4C05A 2P40A 4NW6A 2RG6A 2C6DA 3Q60A 2QOOA 4BR3A 4EWQA 1UFKA 1YXXA 2O65A 2VRXA 1GZKA 3FC1X 1ZMWA 2ORED 3QOXA 3U6IA 2J5EA 2ZDTA 5L6OA 2HXLA 3JY0A 3P97A 4E2ZA 3HCAA 5GINE 2XKDA 4V0RA 2QKRA 4QMVA 1F3LA 1XH9A 2PWPA 1RI1A 3DK3A 4FV4A 5ANOA 3UZRA 1XBAA 4AUAA 3H10A 2BRNA 3A99A 1F0QA 3ET7A 5KMIA 2YM8A 1QPJA 4RRVA 4ZJVA 2RFDA 3E7PA 3GDHA 4DH1A 4RIYB 4FNXA 4BDCA 2Q83A 5DRBA 3ERCA 3C5UA 1WCCA 4BDJA 2GQSA 2PSQA 2VX3A 2XEYA 5EW9A 3TIYA 1LR4A 2NXCA 4WBOA 4O0VA 1FP1D 1L3CA 4FSTA 4UWCA 3EVZA 2F57A 3VBVA 1R8XA 1A9UA 3SGCA 3WILA 2BCJA 2Y1XA 4L3PA 3G51A 4AE6A 3NDJA 2W5BA 3MB6A 4KNBA 3REPA 4BTMA 2OF4A 4C36A 3TMAA 2OXYA 4U3ZA 5DX1A 4LWOA 5CU3A 3H9FA 4RSRA 4AAAA 1NVQA 5T68A 4DG2E 4DAWA 1HCKA 4C38A 3KVXA 3RHXA 2ZM1A 3RZBA 4ZK5A 4W4WA 5E9JA 2ZVAA 1ZOGA 2YFXA 4ASDA 2C6TA 2XYVA 3GC0A 3OT8A 4FK6A 5KHXA 3E7VA 2OXXA 1N2XA 3NNUA 3GI3A 1WZNA 3RINA 2XVMA 1WVWA 5ACKA 1PXMA 3EJ1A 3W33A 3RK5A 5HU3A 3MH1A 3DKOA 4JRNA 2FB8A 4YZMA 2HR1A 2OFUA 4AA0A 3E93A 2XRWA 3KFAA 4DLIA 4IMYA 4TYIA 4ANBA 3G2OA 2IH2A 2G8NA 3E88A 2JDRA 3NLBA 1DAYA 3QGWA 1P2AA 4KWPA 2XB7A 2VNWA 3R30A 3WI6A 5HZMA 4D4VA 3FUVA 4RC3A 3OXZA 2WTJA 1JVPP 1AQ1A 3KULB 5C03A 2GTMA 3UOJA 2O57A 4GBED 4F1TA 2OSCA 4IACA 5E2BA 2YITA 3P1AA 3IW7A 5JFSA 3BV2A 3OUNB 1KR5A 4DLJA 1O6LA 2GDOA 3CEKA 4RGJA 1NBHA 3VBTA 2IZTA 3P23A 3TJDA 4BDBA 3COMA 3BBWA 4AZVA 2CL5A 3GU6A 4FEVA 4NJDA 3FPQA 5DA3A 4C4EA 3NR9A 5CU2A 4D4YA 4P2KA 3OG7A 3RIEA 4KKHA 4FA2A 3DULA 4RTNA 4FKIA 3MV5A 2XNEA 4GJ3A 2CLXA 5JEBA 2R5TA 4EC8A 4FT7A 3BWMA 1QZZA 3UPZA 5DX8A 4JR7A 5D41A 4A9YA 1ZYSA 3OY3A 5EQPA 4BDFA 3MCTA 4XUCA 3OVVA 3QD2B 5DOSA 2J5FA 4IE9A 3II5A 4G3GA 3R7IA 3T9IA 4Y2HA 3MPTA 1RI3A 4XG4A 4LGGA 1ZGAA 4EOOA 4YSJA 2HNKA 2PXCA 5AP4A 3E92A 2YX1A 3F5UA 4XG8A 2VDVE 2ITPA 5CSPA 3E05A 5AIRA 3R24A 3H4JA 3R7YA 5AEPA 2BM8A 1PXJA 2VU3A 4QMOA 3D2LA 5DPMA 4XP3A 3HAVA 3T7RA 3DA6A 4TYJA 2OZOA 5M4IA 2YDJA 3VS6A 2YCSA 3WARA 4E6QA 5C1IA 3OC1A 4CCUA 3P86A 3CPBA 4R5YA 2B25A 3F2RA 4IW0A 3NMUF 5IQIA 2PTKA 2XJ2A 3B2WA 4F9YA 2BAJA 2X2MA 3AOXA 4FICA 4ITIA 4M13A 2Y1WA 5IH4A 1REJA 3PSCA 3PPKA 3KN5A 4XG2A 1SG9A 3FPMA 3PS9A 1Q5KA 3A61A 1IAHA 3LXNA 3ZCLA 2O07A 4U8ZA 2ZWVA 3CKWA 5CCXA 3M11A 4QMXA 4XG6A 4X2NA 3M33A 1TPYA 4FTRA 3QHRA 4IDTA 3QTXA 3V6RA 4U79A 4DT8A 1SQGA 1AD5A 2KULA 3UE4A 4FEQA 4MYGA 3AT4A 3EMGA 3R71A 2GHGA 3DKFA 4ARKA 5JUWA 2PY6A 1K3AA 4O0WA 3MPMA 2O2UA 3BHHA 2VTLA 3BYMA 3GU3A 3F2AA 3F61A 4A07A 4QDJA 2PVRA 1MRUA 3D0EA 4QP8A 3LHJA 5HIDA 4CFVA 4OT6A 2WEIA 4IH8A 4RFYA 3FUUA 3Q87B 2I0HA 1Q8WA 3HX4A 4GG7A 3R7VA 3VC4A 5DR9A 4EOKA 5CANA 2FPOA 3KR2A 3MHTA 4JL9A 2PVLA 1U4DA 3OOMA 3D15A 3AXWA 3RCJA 4DC2A 4YMGA 4QYGA 2XZSA 4V0GB 1AGWA 3DBCA 5DEWA 4PNEA 5EQEA 5M08A 5HG5A 5C01A 3R1YA 3HA7A 3L9NA 3ZRMA 2YIRA 1JBPE 3FLSA 3AD6A 4YBJA 3MGGA 3OZTA 4P7JA 3KXXA 5EKNA 3MVMA 2NXJA 5EMLA 4I93A 3MH2A 2P1DA 4LUDA 4U7TB 4B8MA 5CVEA 2C1AA 3CTJA 4QMNA 4DA4A 4ORKA 5HZNA 3OBGA 4JS8A 4ANQA 2P3LA 3LLAA 3OE5A 2HAKA 3U81A 5FXRA 4YC6A 1OUYA 1VIDA 3EVAA 2XP2A 2PZPA 1KYWA 3D4QA 4YMHA 4C08A 3CJQA 3TRKA 5KMKA 5IA2A 5HIKA 4P90A 3A7IA 5AWMA 4DT9A 4YURA 1I9GA 1UWVA 4GEKA 3PXYA 3LFAA 1FINA 5DTRA 3MIAA 2Z7RA 4U43A 5CXZA 2OLCA 1Z3CA 5LJJA 3SSOA 3WF5A 3DUWA 1BOOA 4AZWA 4MNEB 5E8XA 3A4TA 2WIPA 3NPCA 4I0SA 3VWAA 3R28A 4DEGA 2EFJA 3SXSA 3EMBA 3HP2A 4FV0A 4TTHB 4XJ0A 5AIKA 3TKHA 3OCGA 2BTRA 5C8NA 5FADA 3HUCA 3O7LB 5FTWA 3WE8A 4B99A 4XG3A 3H30A 2ZV8A 2C3LA 5CQWA 1ZHFA 4RVLA 1H27A 3KQ7A 4OTFA 4USDA 3WF9A 4DA5A 2CKDA 3R6TA 1Y6AA 3F69A 3PXQA 5DPVA 5E1DA 4G1WA 3EOCA 2RFEA 3FWQA 1YKRA 4GMYA 4JX3A 5IA1A 1NV8A 3N4UA 2PLWA 3QCYA 1TKIA 4FC0A 1MHTA 4QMUA 4C0TA 4DINA 3ZLYA 4LG1A 1G5SA 4IANA 4KKGA 5A4TA 2VWBA 4F64A 3UO5A 1KIAA 3DXPA 4EKIA 4AW5A 3ENMA 2H11A 3DB8A 4FODA 3FZTA 1PYEA 5HCXA 2OWBA 4WA9A 4FSMA 3PIXA 4C62A 3CSVA 4DE4A 2IVSA 4PGHA 4A6DA 2BZIB 1GJOA 4JX7A 1WBTA 4U40A 3ORZA 2YDKA 3Q4UA 3HA5A 4BIDA 1JSZA 4OX9Y 4QTUB 1TQMA 4OBPA 2B0QA 4PL4A 1ERKA 4GSBA 2VO7A 5HBEA 5M51A 3QD3A 3R21A 4PP9A 5E7RA 3NNXA 3W2RA 4I94A 2GS2A 2YCFA 4KIOA 3ZEWA 4AN9A 2BZHB 3OS3A 4I1ZA 3MSSA 3UJDA 5C26A 1M2RA 5CU6A 4HGYA 4GW8A 2VX0A 2PYWA 1UKHA 4RWLA 1X1BA 2JKKA 3LMIA 1YOLA 4AZSA 3JVSA 4I4FA 4PTCA 4FZDB 3OXTA 4A7CA 2G72A 1GIHA 1UU8A 2RIOA 1ZQ9A 1FP2A 3SSNA 1JKTA 5A4CA 4YJUA 5LR6A 2XK7A 3VS7A 3FYDA 4DTAA 5CF5A 3LFSA 1LEZA 4MHTA 4RIOA 4QNAA 2G2FA 5AV1A 3GB2A 4BIEA 5I9WA 4EJ7A 5IG1A 3NW9A 2X7OA 3ZH8A 2XIRA 4D5HA 3MA6A 2HENA 4XG7A 2ONLC 5K0GA 4HCTA 3ZSHA 4QP3A 4WO5A 2ONZA 2NXEA 2VX1A 3L9MA 1UU9A 1WZYA 4K77A 4MXCA 2XS0A 3PFHA 3HMPA 3KR1A 4X61A 2Q0BA 5TT7A 1WY7A 3FI8A 5CIYA 1KV1A 3PVGA 4K33A 4FV9A 2BR1A 4WBBB 3ALNA 4FUYA 4J97A 3BYOA 5AJQA 4O84A 2CNVA 5EI6A 3UIUA 4N6YA 2WEVA 3I9FA 4TZRA 4Z9LA 4A06A 4UX9A 1G60A 1NW5A 3U6HA 3NW6A 2XRUA 2AUHA 4WVLA 2QQ7A 3PTGA 4O29A 4DBXA 4EKKA 5LMKA 3OF0A 3D94A 2OG8A 4TL0A 4ASZA 4PGGA 1TW2A 3CQWA 3A8XA 4XCUA 5E1MA 1IA9A 3JR1A 4TWOA 5CEKA 2OGVA 5K8VA 1PKGA 2ZJWA 3G0FA 4B17A 2H96A 3ORKA 4YSMA 5H2UA 3OU6A 1PXNA 4C37A 1YWNA 5FRIA 5FA8A 3D7ZA 5A4LA 3BQCA 4IZAA 1XH6A 1FVRA 5HEZA 3O8TA 3DK6A 2CNQA 1NW8A 1V0BA 2X39A 3TZ7A 4B4LA 4D5KA 1ORIA 1R0PA 1VPTA 4PCAA 4DEAA 2Y8OA 3IONA 5K5XA 5K03A 4FIFA 3OCTA 3GCVA 4FSWA 2C3KA 4C4HA 4FKGA 1CKPA 2AOTB 5HG8A 3W8LA 2BR5A 4C3RA 3CR0A 5CAPA 4JIAA 3VBQA 3MTLA 2FSOX 3B3GA 2GMXA 4L52A 4YNEA 4TN6A 4A9SA 5BUEA 4LWPA 4FT5A 3RWQA 2JFLA 3PLSA 4OQDA 3GU8A 2FO0A 4JT3A 4MEDA 3WZDA 4KIFA 3ORLA 3V97A 3LFQA 3F66A 3PZEA 4MQ4A 3OCBA 1J7LA 1G8SA 3EL8A 4FOCA 2PVHA 4Q2AA 5E8RA 4C4FA 3TLJA 1VJYA 2HY81 2JIVA 3FJQE 3LBYA 3AMAA 2WKMA 4QP6A 4FGBA 2HK5A 3I7BA 2X0GA 3R02A 2FCAA 4KWCA 4QQKA 4GVAA 4FUXA 2JFMA 3EHAA 3I53A 5EEHA 2BPMA 2BKZA 5DT4A 3MY1A 4HTFA 4EQUA 3S68A 4C33A 2PV0A 1G55A 4HVHA 3RPOA 3ERKA 3HA8A 2PXXA 4RX1A 3VS4A 5DNRA 3AXSA 4R6XA 4EH6A 3NAYA 5JRQA 3QCQA 4ZTLA 1XDZA 3VIDA 3FQEA 4F7NA 1RI5A 4FKQA 4UZDA 5BMSA 2YZLA 2CGXA 1IM8A 1EJ6A 4HCVA 4O83A 1Q8UA 5JFVA 2OBFA 1YZ3A 4XUFA 5CVGA 4RVMA 4BDKA 5CQUA 1URWA 1AF7A 2V55A 3UG1A 4RX7A 3EN4A 1BI7A 2BVAA 3PVWA 4UYAA 1YXSA 4YJNA 3K54A 2LAVA 1Q3WA 3QQHA 4UBAA 3TNPC 5A9UA 5CEOA 3FSFA 4F70A 2P7HA 4FKJA 3BELA 2PL0A 3QZGA 4AN3A 2VD5A 5JZJA 4HVSA 4U97A 1HCLA 3TCPA 3DXYA 3S95A 1QAMA 4QP4A 2K4MA 3VSEA 4QTBA 3LKMA 4XV9A 4YO4A 4HVDA 3ROYA 4IAYA 5BMMA 3LPBA 3T9TA 1D2CA 2GNHA 4C03A 5IUHA 1P91A 4ZY4A 2ZV9A 4WNOA 5HGIA 5IQCA 4C7TA 3UZUA 4FTLA 5DSTA 5KQSA 5LQNA 3W55A 5DTMA 4C4GA 2PUPA 2H00A 4M37A 4PYJA 3A8WA 3DR5A 5ETCA 1KUTA 1ZYCA 1P39A 1D2GA 4ERKA 4EZ5A 2QO9A 2W9ZB 2WMBA 2WOTA 3F5XA 4GFGA 5CI6A 4YJVA 4E4XA 4ZSAA 1UV5A 3CJTA 2VZ9A 3T7TA 2UYHA 4DFLA 4GYIA 4QP1A 4JG6A 1OIRA 3EKKA 5EM6A 5HIEA 2ZIEA 3AQVA 1OL5A 4M97A 1Y8YA 2RGPA 5HEKA 1H1PA 2VWVA 3OUKA 4S34A 4FVPA 4UXLA 2OKCA 4O0SA 2V7AA 3R0TA 3OZ6A 4FKWA 4BF2A 3EGEA 3QLGA 4XOZA 4F09A 4ALUA 2QD9A 3THSA 2VWUA 2XNMA 4DHFA 4QPAA 4P7EA 5EYCA 3LECA 3PA3A 2ZW9A 2BUJA 3BWFA 3DLIA 5FUBA 5FWDA 1RQQA 1UU3A 2IH4A 2X9FA 5DTQA 2UUEA 1U5QA 3VJOA 3AT2A 5EG5A 3A4OX 4E31A 10MHA 4PDYA 2R3LA 4E26A 2B7AA 3BEAA 5L2WA 1I44A 4CZTA 2OXDA 2CKPA 2PUIA 3FC2A 4PDPA 3QBNA 5IQEA 3EN5A 4NYEA 3TWJA 3U4UA 4FSUA 5FP6A 4EVIA 5A54A 3TOSA 5LSAA 4PMSA 4DG3E 1HNNA 2ITZA 1T43A 3ANXA 3LX6A 4R7HA 3FTFA 4E30A 3HTXA 2X8DA 4PV0A 3HCCA 2JIUA 5L2SA 1FMOE 2OB2A 4D0WA 3ELUA 4QTTB 5GJFA 3PP1A 5BW5A 4F85A 4JG8A 3IPHA 5DWRA 4DFBA 2HZ0A 3QTWA 3E23A 3NWEA 1CDKA 3KXMA 2CWWA 5ANJA 3C4XA 5H8EA 4U80A 5HLNA 3PIYA 3BGPA 4D4RA 5CF6A 3EVDA 1Q0TA 4F0FA 3R01A 2OB1A 4RPVA 2IFTA 3CE3A 4E7WA 3UJ9A 3V8VA 1W84A 4BCJA 2OIBA 2UW3A 4J53A 1YXTA 2ZULA 4KDCA 4HSGA 4F9CA 1PXLA 3LFDA 4OBQA 4OUCA 2YXEA 3FE3A 3QRJA 5A6NA 1TW3A 4F6SA 5DT3A 5IA3A 3ORIA 1M52A 4L3LA 5L2IA 2YM6A 2NNWB 3BKBA 4MBLA 5EM7A 4HYUA 4NCTA 3ACKA 4WOVA 5TF9A 3B2TA 4E5BA 4NCTC 2R6ZA 3OCSA 3FYKX 5F95A 5CAQA 4QMWA 5FEQA 2Z7SA 3UO4A 2EJUA 3BHVA 3PFQA 1YQJA 3UYTA 5E9EA 1XJ5A 5BVEA 4EQMA 4CTCA 3HEMA 8MHTA 2NRYA 5DRTA 2WMWA 5LVMA 1R18A 3KPVA 3G6GA 4DCEA 3RPRA 1YVJA 2H6DA 4AT5A 4X63A 5FHQA 4EORA 5EIFA 4RZWA 4FT4A 5FQNA 4ZSLA 3GT8A 4YUQA 1CM8A 3KQQA 3E7OA 4DEBA 4AN2A 3I60A 4QMSA 4IAKA 5IDNA 4F84A 2I0YA 1Y91A 3R1QA 3TG1A 3V5JA 5IUGA 3OROA 4FE2A 3VUDA 2J0MB 3HMIA 4YV0A 4H1JA 4MNEA 1APME 3UA4A 3MN3A 4AX8A 3G2QA 4GC9A 2F9GA 3S0OA 4YZCA 3ZTXA 5I4NA 3EEOA 3OU7A 4ID7A 2ZMCA 3DY7A 2X81A 2F7XE 2UW7A 3EQIA 3DXNA 2X6DA 1SYKA 3VUIA 3WE4A 4MWHA 3RMFA 2A1AB 3ELYA 3FPGA 4IWNA 1XH4A 1ZKDA 2BKKA 3SKCA 3CCFA 2R3NA 5C9ZA 4HCUA 4I21A 3ZEPA 3BV3A 3LFNA 3TM4A 3G9LX 3DPKA 4M8TA 3ZUTA 5ITAA 4L7FA 2J51A 2JBOA 4PYIA 2XK6A 3CY2A 1UWHA 2PVJA 2Y4IC 4E6DA 4RFZA 1H25A 2RKUA 3NIZA 4F6UA 3W32A 2W96B 3NVMB 4S32A 1M6EX 3HVKA 2NP6A 4WRSA 1KYZA 1WXWA 2J6MA 1UNHA 4QTAA 1JAMA 2B9JA 3IYLW 4PX6A 3CC8A 3QYWA 4U7ZA 3GRZA 3P2KA 4KBCA 1M6YA 3JUHA 2G2HA 3V6SA 4RA5A 4OQEA 1JG1A 4OBOA 2GQRA 3V5QA 2W4JA 4O0YA 3FMNA 2FYSA 3F5GA 3HAMA 4BB4A 4AG8A 4X3FC 4ACGA 3KQWA 4O7ZA 5DE2A 4HYSA 2R9SA 4GFMA 1O9GA 3LZBA 4YV1A 2NP8A 2OJJA 4FGRA 4JDIA 2YWPA 3ZYAA 2Z6QA 3R9OA 3TT0A 4FSXA 3R1SA 3KF7A 2IBTA 3UJAA 2PZ5A 4OTGA 3AY0A 2GQGA 3LOKA 1XJDA 3HUBA 4RWKA 5U4XA 3VW6A 2WQNA 3CTHA 3CD3A 5T3QA 4Q5EA 5D11A 3LCTA 3CQEA 2CSNA 5IEYA 2GHMA 3PT9A 4E32A 3VS3A 2F8LA 2PGXA 3BU5A 2UZLA 3MYGA 2I9KA 4YUYA 5DBXA 2OY0A 3TKAA 5HD4A 2ZTHA 4AUKA 3R63A 4RWIA 3M6VA 1GAGA 3R9DA 3KKZA 3FTCA 3SW4A 5EEGA 3UGCA 3LFEA 3P71T 3QRIA 3LFCA 3CBLA 2XYUA 3H0YA 4A9RA 3FZSA 4HPUE 4C3FA 4FSYA 2HELA 4Z7GA 3B89A 2AOUB 4KVZA 3OEFX 4U0IA 4YLJA 4LRKA 5FDPA 3BPRA 5IEXA 5G02A 2I40A 2OKRA 4IAZA 4BRXA 1QPEA 3B8RA 4YJTA 3SV0A 1UNGA 3ZLXA 2Q41A 5FDXA 2PZYA 2JIIA 2OZAB 4BKJA 3FDNA 3DCVA 2A27A 4FTQA 4HGLA 4MD9E 3SDJA 2XCHA 1WMKA 3DS6A 3PWYA 4RJ3A 4B7TA 4FV5A 4EC9A 3KPJA 5HILA 4FTCA 3QGYA 5LMBA 2ETMA 3I6UA 3O7LD 3QYZA 4FS8A 4X1OA 5DWQA 5KYGA 5HG9A 4YUVA 3LQ5A 3PPJA 4YC3A 3UZTA 1QANA 2B2CA 3GGDA 3KY2A 1OI9A 4X2KA 1YOMA 3OEZA 4CGAA 5BW4A 5HLPA 3PPZA 4EOSA 5IH6A 4CTKA 4GK2A 5EI2A 1DAWA 1JQHA 1ZGJA 3FMJA 4QQCA 4CFMA 5ANGA 2PU8A 3CP9A 5AUZA 3NX8A 2VWZA 4J98A 4JNWA 4FV8A 3LCSA 3GC7A 3L8VA 4D28A 4IVDA 3LCDA 3A7DA 1BX6A 4XYFA 2PSSA 5D12A 1Y8GA 2P4IA 4EI4A 5E1SA 4O38A 1J7IA 3QU0A 2R3MA 5HFJA 1X1AA 4RTKA 4PYQA 1NVRA 5GOZA 3RPSA 3UQGA 3WF8A 3CJRA 5K0JA 3Q9ZA 5E8YA 4QMQA 3BGVA 4RTJA 4TYGA 5HESA 4O96A 4EYJA 5E2AA 4G17A 1JTFA 2GNLA 3TZMA 3A62A 2X4ZA 3LFBA 4NM3A 2PUUA 2DULA 1CMKE 2ITWA 4HW7A 1MQ4A 4L68A 4M38A 3OWJA 3IW8A 4CKEA 2GTNA 5K05A 3ELDA 5A4EA 2Q0NA 5G1XA 1QPDA 2PX4A 2C7RA 4P7GA 2OH4A 2YABA 4I5HA 4EK5A 2YM5A 3QWJA 2BAQA 2KTYA 3TNHA 3FZGA 4UOEA 2YA9A 5FQDC 5I9XA 2F2UA 2WMQA 4K1BA 4XUEA 3TKYA 3SMQA 2OU7A 2YM4A 3EL7A 2O3PA 4FIIA 3UA3A 4MVFA 4JVGA 4CTBA 4L53A 3TDWA 4AACA 4PTEA 4EEVA 3HP7A 4QVGA 1OBGA 1RJBA 4K8AA 3V8TA 3TUCA 3GC8A 4RVKA 1H1RA 3NS9A 4O7NA 4TNBA 1H1DA 4PNIA 2QM3A 4P7KA 4L44A 5D1JA 5A46A 4APPA 1PXOA 1Q97A 3BWJA 4TYHB 2W1ZA 5HE1A 3PA5A 2B54A 5HBJA 3GWZA 2PVKA 4IZYA 4MTAA 1PHKA 2CGVA 4TWPA 1PW2A 5EDQA 5JQ8A 3L1SA 2PULA 4R3PA 4HC4A 1BL7A 3QKMA 5HTBA 4FBXA 3GU7A 3FQHA 1XCLA 3FTDA 3IDPA 4FR0A 1RJFA 4FTTA 1FBNA 4FTOA 3G8BA 4UWYA 3NSZA 3F6XA 2C0OA 3LFFA 3PXRA 2IW6A 4E8AA 4BP1A 3BQRA 3OOGA 4I6FA 2PX8A 4EOQA 3RCDA 3N51A 4R78A 1SMHA 5KNJA 1J91A 3JS2A 1JKLA 1V0OA 2PE0A 3BLRA 3BX5A 3V5PA 2JH8A 4RTPA 5EVJA 1GY3A 3FKOA 3MJ1A 1KHHA 1H00A 2QOQA 4D2SA 4QQ5A 1WBOA 2BHEA 3Q2JA 2GS9A 3BLHA 5FUTA 2ZBRA 2HWOA 4TPTA 2Y7JA 2R7BA 3I81A 3QAME 3O51A 2JLDA 2JHPA 4DYMA 5H9BA 5C0OE 4ZS0A 3DU8A 5JKGA 3QCSA 4L7SA 3IGGA 1NW1A 3FBVA 3P7AA 5AP0A 2WTCA 4BCKA 4MD8E 2G15A 4OTQA 4BZOA 1U59A 1LUFA 4AT3A 3KQMA 2C69A 3PX3A 4FVQA 1NW7A 1ZRZA 3ACJA 2R0IA 3C6KA 3R2YA 2NP7A 1HOWA 4JDHA 5BX0A 3P9KA 3G2MA 4F9AA 2NRUA 3UNKA 1INLA 3V3VA 5EPEA 5JFWA 3P9JA 4PYKA 3BGZA 4WT6A 4YZDA 4EQZA 3BHTA 4N0SA 3R8VA 2ZV2A 2YEXA 3SG8A 4R6WA 1H0WA 5CF8A 5B2KA 3P8ZA 3NVKI 1WBWA 2C6EA 5HVKA 3GFWA 1JPAA 4DF3A 2V74B 5EGSA 5BXYA 3CBGA 4IAIA 3GJYA 3GVUA 2YCQA 1F5QA 3MBLA 2V7OA 5CNOA 3R9HA 4DKJA 2W1EA 2PVNA 4V01A 5AP7A 2O06A 4QTDA 1H28A 1ZYDA 2JKQA 3HVCA 4AFJA 4JBPA 1JSXA 3P9CA 1OL7A 4GOND 2WTIA 4NU1A 4YHTA 2G9XA 1QYRA 2XIYA 4BLWA 3FUTA 4IKPA 1FGIA 1OL6A 5CZIA 4ENYA 3U54A 3DTNA 4E73A 2ZFUA 4ZJIA 2W1GA 4W4YA 3EH9A 2YR0A 4XOYA 4TYHA 3DH0A 3HCEA 5DX0A 2ZCJA 3PYYA 1JNKA 2WFYA 3SXFA 1OR8A 4DTBA 5FHRA 5FQOA 3ORTA 1NW3A 3G8AA 4GEOA 4AP7A 4YPDA 2IW9A 4FV1A 4EYMA 5K9IA 2JKOA 2IBSA 3QRTA 4AXAA 4YUXA 3OCJA 2X2KA 1XBBA 2GS7A 2BH2A 2P55A 4P7FA 4PMMA 1VP3A 1U46A 3D83A 3Q52A 5EZSA 4E1ZA 3V5TA 1KOBA 3GQLA 5KO1A 3BGDA 5LCJA 3UBDA 2Z02A 2IPXA 3COHA 4KDRA 4M68A 2Y4PA 2ZMDA 3FLNC 4BCGA 2HV9A 3GIWA 4JOAA 2W1CA 4BGHA 2I7QA 5TR6A 1L3RE 2WQEA 4LG4A 4WNPA 4KSPA 4HZSA 4B6LA 4EH7A 2AYPA 2XKEA 4FKUA 2W1FA 3T3VA 5B2MA 2PE1A 1Q62A 3G15A 4ACMA 3I1AA 4HVGA 4C61A 1ZXEA 1L1EA 5CSWA 2PKWA 4RJ6A 4YU2A 1FVTA 2C5VA 4EQCA 3HGKA 4A9TA 4MAOA 4YTHA 1UKIA 4W4VA 5C4KA 5K4IA 3OFKA 3FTEA 2F7ZE 4C02A 2BROA 2ESRA 1WBPA 3H9RA 4FKRA 2IG7A 2JAVA 2XBJA 3DGKA 3FI2A 3KXZA 4I5PA 4R3CA 2VUWA 2EXCX 2QI8A 4YO6A 4Y83A 4CXAA 1YHSA 5BUIA 3TNIA 4H3PA 3OT3A 3SOAA 3TDVA 3Q4ZA 1JQEA 5ETIA 1AQJA 5CM2Z 2X4FA 5DM0A 2CKOA 3OW3A 5IKMA 5M5BA 2QG5A 4IWPA 2ZIFA 4DN5A 1JKSA 1QAOA 3PJ1A 4RTMA 5AUXA 2BR4A 3KCKA 5HVJA 3Q9YA 3W2CA 4R7BA 3RW9A 5EH0A 3FKLA 4JXFA 4LYNA 3R7UA 2OO3A 4YUZA 2C6IA 3FV8A 4XLIA 4BC6A 4EL9A 1H0VA 2OJ9A 4FT2A 4JXJA 2FSTX 1MUOA 2R3PA 3FXXA 4L43A 3IV6A 1YW2A 3IGOA 4X6RA 1Q3DA 2XNNA 3DFAA 4WIHA 2ZZKA 5IMEA 1OGUA 3DDPA 5ICFA 4LV5A 2FK8A 2UW9A 3IK3A 2BFYA 2Y0AA 3RAWA 5HO7A 1VEBA 5EYDA 3PSDA 4WSYA 4J99A 2GFSA 2W1DA 5B0XA 1L9KA 4DH3A 4H05A 3QQGA 2C4GA 5BYZA 3R9NA 1GNGA 4USEA 3QQKA 4CT1A 4KSQA 1H24A 2YERA 3QKLA 4ER7A 1XTPA 2Z8CA 2BZGA 3BWCA 2NPQA 4G2FA 5CSVA 1N7IA 5JGAA 3HECA 2AOWA 3GOKA 2AZTA 1W0XC 3DMHA 5LQRA 4CLIA 2I7CA 3ZDUA 1IAJA 2C6KA 3PSBA 4CG8A 2E9NA 1JKKA 1JSVA 2VZ6A 3H0ZA 3PUPA 4G9RA 4L00A 4M7IA 4NKAA 4IB3A 4U6RA 3MVHA 2ZWAA 4IBMA 2GHLA 3FMHA 4FGZA 4O0RA 4ZOGA 5BVNA 1ZOHA 2AVDA 2VO3A 4BCQA 3FMDA 5BP7A 3L9LA 4M0YA 4YJOA 1G8AA 2X6EA 3TM0A 4I92A 4P58A 5LMKC 3EZVA 7MHTA 3G2FA 5IQHA 3V8SA 3EGVA 2P3OA 5TOZA 2JEDA 4BN1A 2UZUE 1FPUA 3VHKA 1O6YA 5FTOA 2UYCA 3E3PA 4OGRA 4OBXA 2XK9A 4FTUA 4J71A 3ZBFA 1XBCA 4GF5A 4UEUA 3RAKA 5A6OA 1F3MC 2WTKB 3MQ2A 4AS0A 3GCPA 2W9FB 3FEGA 3BUSA 3VN9A 2VO6A 2B9FA 3Q4CA 2OIQA 3LDGA 3LCCA 4PIPA 3AMBA 4YUWA 4L8MA 3RAHA 2UVXA 5HTCA 3P5KA 2VTSA 2ZM4A 5JH6A 3NDMA 5TO8A 5J87A 3R8MA 5K0BA 4YNOA 3U87A 4X3FB 4U3YA 3QOWA 2UZBA 3JY9A 1O9HA 2ZZMA 1OIYA 4RMZA 5IH5A 1FMKA 1QL6A 3KF4A 4AOTA 1I09A 1JG3A 1YFJA 3C6MA 3UP2A 3DQWA 4DCAA 3SA0A 5F1ZA 2Z2WA 4S30A 3FHIA 3AJDA 2H1RA 5JR3A 3KULA 2CNUA 2E9UA 4HZRA 4O0UA 3U9NA 4CKRA 2YQZA 4IV8A 5ETFA 5HIMA 3PJ3A 1STCE 2BDWA 4NM7A 2BDFA 2RG5A 2QHNA 3BU6A 3DAEA 4FIJA 5DM2A 5EMMA 1R78A 3LBFA 2R3HA 2XBMA 4EOMA 3U8WA 3THRA 2UV2A 3NYXA 3C4EA 2G71A 3OE4A 4KRGA 5H8BA 5J1WA 5F2KA 3EQGA 2X7GA 4CRSA 3PJ8A 2O8YA 4K2RA 4ERWA 4K11A 4KS7A 2QRVB 3DP7A 1DCTA 5AUVA 5LQFA 4BTKA 3OTVA 4EHVA 2UYQA 2YIWA 3MA3A 3NIEA 4D9UA 4RX5A 3OP5A 2NXNA 3KQVA 4KA3A 3LCOA 2W4KA 4JQ7A 3UYSA 2EJTA 2CPKE 2WQMA 4YJPA 5IQBA 3MW1A 4TXCA 2WK1A 3BWYA 3TM5A 3ZS5A 4EKGA 1YFLA 3DNEA 3PVCA 2CGUA 5DVRA 3PVBA 4ZS4A 2Z7LA 3Q9WA 1T46A 4L9IA 2WPAA 3ZFYA 5CZHA 3RJCA 3E8DA 1N7JA 3VQHA 2GU8A 4XV3A 4WNMA 2PVCA 1MJFA 2OIDA 1UNLA 3UC4A 3WIKA 3IOKA 3G9NA 5HX8A 2NYUA 4IC7A 3GBZA 2I6GA 4KW7A 5DM1A 3EKNA 2EB3A 1YWRA 1XH5A 2DWBA 2VTRA 2P3QA 4GKIA 3GGFA 3BGIA 1H26A 5DN3A 5E8VA 2YIYA 2CLQA 3LW0A 3MFUA 4O7WA 5JGDA 4DCMA 4FKOA 2QE6A 4M14A 3A7EA 2ITOA 5BYYA 3I6WA 2F4JA 4ZY6A 4RQVA 2XNBA 3LXPA 4U45A 2HIWA 4O27B 4D1ZA 2AOTA 2P41A 4C2WA 3ZDIA 3NUYA 3GNLA 4NECA 3AC1A 4OTWA 3MTFA 4QYEA 4EH5A 4EH2A 3DTCA 2E5WA 5EOVA 5CAVA 5E4HA 4BI0A 2ZAZA 3P2EA 2J50A 1O9UA 2UW8A 3S2PA 3V01A 1X19A 1OBDA 4IZ5A 4JG7A 3DLCA 3AC2A 3GCQA 3P7CA 4MXYA 5K09A 5FA5A 3Q4TA 5ETAA 3FKNA 3ZO2A 4BDIA 1K2PA 4ZZOA 2QODA 4RVTA 1OL1A 1PXIA 4F08A 3SRVA 3ELJA 4I6QA 5HKMA 3I5UA 3JYAA 1YHVA 3MIYA 2PJDA 3OY1A 4FKVA 4WUAA 3DQXA 3G88A 3HCFA 4K0YA 3HYHA 4X3JA 4Y85A 5I9VA 4NTSA 3EVFA 2R2PA 5EOBA 2UZOA 2QOLA 3QTQA 1X1DA 4BYIA 2R3OA 5M4CA 2WD1A 5J7HA 3LMGA 5E1EA 4EH3A 1SVEA 4MWIA 4RZVA 3O8UA 2VO0A 4I24A 1E1XA 4O22A 1XO2B 4QO9A 4RJ8A 1R0EA 1MP8A 4GU6A 4IC8A 4AWIA 5C1QB 2G70A 4RV9A 4FIGA 3RAIA 2V7EA 3KQSA 4D55A 5LOHA 2EXMA 2BZKB 2XM9A 5CVFA 4E70A 3N9XA 3KQYA 4F65A 3OMVA 4GU9A 4U81A 3VS0A 2BRMA 4C34A 4EZ7A 3VC1A 5ERGB 3U55A 4ZLOA 2X2LA 3WSTA 4JBQA 1WS6A 2GB4A 2W5HA 2IZRA 4BI1A 5AUWA 1NA7A 2XNOA 4HNFA 4L3JA 4O7TA 5T6KA 5J9LA 1TQIA 1M2PA 2LGCA 2QNJA 3SG9A 2R7IA 4PL5A 5M56A 3A4PA 3LLTA 3ZM4A 4DGGA 2UYOA 4DH5A 3KEXA 3ME5A 1H8FA 4ZJJA 4CG9A 4HGTA 5IA0A 1I4WA 1BHJA 3KK8A 2QURA 3NUSA 3QTRA 1SVUA 3BEGA 3W18A 4OA8A 3HMOA 1Q61A 4WUNA 4DMGA 4NWMA 3PFGA 3UDBA 3AD4A 3UIMA 3F88A 3ER8A 3BGQA 3UVPA 5IA4A 1O54A 3F9NA 4YHFA 4AW2A 3B8QA 5HU9A 4GC5A 5EC8A 3COIA 4OTDA 4GQBA 5E1OA 1KE8A 2GSFA 4YZ9A 5DT0A 3QV2A 5T6BA 4BCPA 1NT2A 4WKQA 3TJCA 5M4UA 1EG2A 4BYJA 3MTIA 4M67A 5M57A 3KB7A 5CS6A 2VTQA 4GUBA 5D9HA 2XIXA 4RC4A 3ROCA 4FG7A 3UJ6A 2X8IA 3CS9A 3GCSA 4UWBA 1ZZLA 3E5AA 1YHWA 3FMKA 1QPCA 1QMZA 4ZZNA 3NEWA 3LIJA 4PL3A 4XLVA 3LMHA 5IQAA 1VBFA 2W1IA 3B3JA 4JLCA 4RIXA 4PUZA 5ANIA 5FXSA 4YPSA 3ZFMA 2QVSE 3HL7A 1CKJA 3WOWA 4HG2A 4R1YA 4CLJA 1AQIA 3GENA 5E8JA 5IDPA 3MESA 3ITZA 4L46A 4CKCA 3QQFA 4W8EA 3ZLSA 5AP2A 1XQZA 4D9TA 2B3TA 3MVLA 3D2KA 2VWIA 5DI1A 1YF3A 1VR2A 2CKEA 3DK7A 3O17A 5AM6A 4OTIA 4AQCA 4PRJA 1ORHA 2Y6OA 1U54B 4AA4A 3D14A 3ANQA 3SXRA 5K0NA 1JQDA 3HP5A 3TQSA 5FULA 5KQRA 2SRCA 3C9WA 2UW4A 4C58A 4Q9ZA 5DM4A 5GJDA 3SR4A 2GCDA 3WIGA 4QMZA 2AOXA 4FSRA 3LXLA 3VBWA 3RK7A 4POOA 3UMXA 2WOUA 3P0MA 2BILB 1FPQA 3HV4A 5IISA 4IAAA 1ZMUA 5EHYA 2R4BA 3NGAA 5HQ0A 4DFUA 4EMSA 3ZUVA 1PXPA 2XK3A 4IZ7A 4V04A 4RVGA 5FCDA 3ULIA 2FRXA 2PT6A 3UJBA 4FKLA 4KUJA 4IAFA 3LHDA 2WXVA 2AOUA 3DZOA 4PNKA 3IO7A 2IZUA 4GYGA 5A3XA 2J9MA 2BIYA 4QQNA 5M09A 2ONYA 3UJCA 5EDRA 4EH9A 5AUYA 4JR3A 1WFCA 3SVZA 1RJEA 5KMLA 3BE9A 4IJPA 1RJDA 2HCKA 1SM2A 4APCA 4QDKA 4EK9A 4I5CA 5CUQA 3IW6A 3QQUA 2CMHA 3WF6A 3G89A 4H0NA 1H1QA 2GS6A 5EHGA 3VS5A 3LE6A 5L8JA 1GZOA 5ANDA 3QA8A 4X0MA 3NUNA 4A4XA 5EM8A 4BCOA 3QD4A 4RA4A 4FZ6A 2WTVA 5HLWA 3S00A 1P1BA 3S3IA 5F20A 3W1FA 4AFEA 4AGUA 3FUWA 3FYCA 4BDHA 3HDNA 3Q04A 4DGLC 3PWDA 3R0QA 2R3KA 5HG7A 5EKOA 3PTAA 1OMWA 3C50A 3NUAA 3QRUA 1PMVA 2ZBQA 3LVPA 3RK9A 4XRLA 1BUHA 3PRIA 5GJGA 2PMOX 2VGPA 5E92A 2WA2A 5CCBA 4F4PA 5GWXA 2ZDUA 1PMNA 4EH4A 2ESMA 3TPZA 1OM1A 2J0IA 3OTUA 3OW4A 4EONA 3NAXA 3CQUA 2B1PA 5AP5A 2Z60A 5AA9A 3TI1A 5FGKA 2C7QA 4CKBA 2W99B 2IZSA 4QYFA 3C51A 4BCMA 3KXNA 4BLUA 2BALA 1YXVA 2I0EA 4D1XA 3UQCA 3FUXA 4CXMA 2GNGA 4GIHA 1PY5A 1W82A 1Q24A 5BPYA 4AGWA 3EN6A 3RM6A 3MWUA 4FI1A 4LI5A 1BMKA 1G38A 3UNZA 1YDRE 2ETKA 2UZTA 3ZC6A 4FR4A 3KQTA 3KREA 4G5PA 3TACA 4EZ3A 4G3EA 2JKMA 4USFA 2ONLA 3DXQA 4RLLA 2JDTA 3FPJA 4RBLA 1PRYA 4Y5QA 4DBNA 3DOUA 1L3IA 1T45A 4YV2A 2ZIGA 3PDTA 4F1OA 4G3DA 3QX4A 4F7LA 4HVIA 4F86A 4DGOA 4UN0C 5BVWA 3U6JA 2QKWB 3D5XA 5L8KA 1JG4A 2WIHA 3GRRA 3GQIA 5GIOE 4NM5A 1ZMVA 2C68A 4M84A 4HOKA 5EYKA 3V04A 3W16A 3C3PA 5HIIA 3ZO1A 3IECA 5IZFA 3E87A 3TNWA 4IX5A 2PPQA 2E9VA 4BIBA 1XKKA 3TKIA 4I23A 5AAEA 3WZEA 4J95A 4YZNA 5T64A 2J90A 3WYYA 2XH5A 3RHKA 3M4XA 4EJNA 3CGGA 2PT9A 1M17A 1QCFA 3EYGA 2P7IA 4UZHA 1S9JA 3O8PA 4FSNA 4I4EA 3W10A 5LVNA 3ELWA 2ERKA 5K4JA 4YJQA 1OB3A 2E9OA 3BHYA 2JD5A 3DT1A 4S2ZA 4EOLA 1OUKA 3FLZA 3G0EA 3VUGA 1OPLA 4AW1A 3RPYA 3DAKA 4P5QA 4QPPA 3QC9A 3P9NA 3W2QA 3BBTB 5HD7A 1YXUA 2ZV7A 3QTSA 4NM0A 5CU0A 2C30A 3AGMA 3OBJA 2EG5A 4DFYA 4WNKA 4FTKA 5C8MA 3ORPA 3R2BA 4FK3A 3ZM9A 2IVUA 2HXQA 4CFWA 3EQRA 4FG8A 2QOBA 4QRCA 4G9CA 5J9YA 4ZLZA 3K5VA 3NWWA 3DXXA 3EGIA 2V5QA 4PP7A 1JWHA 4BDGA 3NYVA 3DBEA 3Q5IA 3K3IA 4ITHA 4O2ZA 5E90A 2XMYA 3HEGA 2OJGA 1KE5A 4GK4A 3BKWA 4O81A 2EU9A 4MIKA 3MPAA 4G3CA 4F1MA 4DEIA 4ZY5A 3ZSGA 1NVSA 1EH4A 3EN9A 1ND4A 4RWJA 2O05A 4QT1A 3IQ7A 4BZDA 5KMNA 3PP0A 1KPIA 2I1MA 3P7BA 3PJ2A 3QD0A 4O0TA 1ZYJA 4O91A 4M12A 5DR6A 4GVJA 4WD5A 1XCJA 2ZVJA 2Z6UA 3A7FA 3E63A 4IDVA 3FI3A 4JQEA 2YCRA 3HV3A 3KR9A 1YWVA 3TXOA 2I0VA 2HOGA 5AV0A 4IEBA 5KMJA 4ENXA 3SAYA 1CTPE 5AMNA 4L6QA 1ZWSA 5D10A 4YP8A 5C8KA 2GNIA 3T0IA 3R9XB 2G2IA 2HW6A 3KXHA 1UU7A 4H3QA 2OH0E 1VQ1A 3VF9A 4E2YA 4MF1A 5E8WA 4ZIMA 4Y30A 3QLFA 4D4SA 4D2RA 3T7SA 4QMTA 5CD1A 1B38A 3N4VA 5FP5A 4DEEA 3HM2A 3LL7A 4CMOA 2FH9A 4DEHA 1SUIA 3KQOA 3DKCA 5LMAA 3PA4A 3BXOA 3TZ8A 3PRFA 3ORHA 4B8LA 1OPKA 4CMUA 2VTPA 4PONA 4FEWA 3QZHA 3POOA 5AUUA 5AUTA 3A27A 4JDJA 3ZRKA 2O64A 4NT4A 2VDUE 4O2PA 2IP2A 1YB2A 1IXKA 2P2IA 5FEDA 4Z2YA 2OBJA 4TNDA 3M6UA 5IUIA 5LCKA 2C5OA 3A7HA 3I5ZA 3MS9A 3KHKA 4KAOA 2PVYA 4LM5A 4R77A 4X21A 4L67A 4UYNA 4ASEA 1XXLA 3MGYA 4FEXA 4TWCA 3LDUA 5DT2A 4ACHA 3BT7A 3K3JA 4DH8A 2FK7A 4ZLYA 5KHWA 4RX9A 1OVEA 3C1XA 4N57A 2BRHA 3ORXA 5KMOA 3I64A 4LOPA 4PCLA 5HOQA 1VZOA 3Q6WA 2YTZA 4G5JA 1NY3A 4CFXA 3PX2A 3HRCA 3C4ZA 4K9YA 5B7VA 4KIGA 4NJ3A 5CAUA 3KRRA 3O0GA 4U5JA 4BGGA 3TV6A 5BVFA 2QOKA 3LJ1A 3OWPA 4RTQA 5ICGA 2QR8A 4FV6A 2C0IA 5FLFA 3FXZA 4F7JA 5H02A 5L8LA 1YI6A 3FUPA 2OO8X 4FZVA 3A26A 2AN4A 4UALA 1ZLTA 4UY9A 4XH6A 3DAJA 4I0RA 3VQUA 5HE2A 4CFUA 2YUIA 5J1VA 5LVLA 4CV8A 1NXKA 2O0UA 3NDIA 2FVDA 3FAAA 3QXPA 5LWMA 4S33A 3BCEA 5DXJA 5I9ZA 1W8CA 2F2CB 5B2LA 1R00A 1E9HA 3QZFA 5CU4A 4UV0A 5CENA 5H3QA 3FY2A 5EFQA 1M2QA 2Y9QA 5EOLA 4O7YA 1JOWB 1JR4A 3EIDA 3HRBA 3ZU7A 3QTIA 3NWBA 3NNVA 2DPMA 3SX0A 2W05A 2C6LA 3UJGA 3TTIA 5DH3A 4JBOA 4PMTA 3DV3A 4LRMA 3CKKA 3HVIA 2PHKA 5FWAA 2Y4IB 2B53A 4M15A 5HBHA 3AC5A 1UVRA 4G34A 4F9BA 5M55A 3DB6A 3F3UA 4QYYA 2R3FA 3V5LA 3GCUA 5BNJA 3UBTA 2BAKA 5IU2A 3VW8A 2LD4A 4I0TA 2YHVA 1R8YA 2BR3A 2GFCA 4J8MA 5BVKA 4ANSA 4X41A 4IX3A 2BRGA 2OJIA 2EX4A 2VWXA 3HZTA 4A9UA 3MAGA 2YM7A 5F2OA 2VTAA 2WELA 3GC9A 4IB0A 3ZRLA 2YAKA 3RGFA 4BCNA 4FV3A 4FZ7A 3LDFA 2UW6A 2XNPA 4U42A 2HMYB 2RFNA 3FSKA 3KRLA 3EFWA 2VTNA 1H07A 3C13A 3NCZA 4FL3A 4IB1A 4Y5HA 5CSHA 3TL8A 3G90X 1Y57A 3M1SA 4IHPA 5ACBC 2AR0A 3MB7A 2VNYA 3PG1A 2W5AA 4FSZA 3OZRA 4GS6A 2ZYBA 3RI1A 4F9WA 4XBUA 3R8PA 3A7GA 4M69B 1EQAA 1JG2A 4RVFA 3PY1A 1DM2A 4EH8A 2YDIA 4N4SA 2PZRA 5CNNA 3E3BX 5AX3A 2WU6A 1RE8A 4RYLA 4QVKA 3POZA 3MDYA 2ZB1A 3C5IA 2WQBA 4YR8A 5LVOA 5BVDA 3VVHA 4F6WA 3ZC5A 4FL2A 3M6XA 4NKSA 4QOXA 4IJ9A 5HO8A 4QMLA 3VS2A 2VN9A 4YMJA 2JHCA 5CVJA 4FSQA 1BL6A 3CJFA 5EI8A 4HTFB 5IMXA 4IVAA 4IVBA 2IWIA 4J52A 3F3VA 4FTIA 4QPNA 4RTOA 4XG9A 4Y73A 4FTMA 2UW5A 4ASXA 4LOQA 5KKRC 2HTEA 2JGZA 4QP7A 2QLUA 2XIZA 3G5LA 2HWPA 1H1WA 4W4XA 5KBQA 3NUUA 4CFNA 4FEUA 2PX5A 2NO3A 4ZTSA 3OFJA 4G3FA 4FKSA 5GP1A 2JBPA 4L42A 1F38A 3KRWA 3VNTA 5EMJA 4IM3A 4N70A 4EK4A 2OW3A 2XVAA 4LECA 2W7XA 4CKIA 4X2JA 4I3ZA 5HE3A 2X9EA 3BZ3A 4FT3A 4CD0A 4ZTMA 5AV3A 4BI2A 1VLMA 3IOPA 4BBMA 3CKXA 4EK6A 2PMNX 4XBRA 2OXTA 5CLPA 4BHNA 3JWHA 4MQ1A 4C4AA 1D2HA 4RIYA 5FXQA 2ERCA 1OIQA 4O21A 2IIPA 1Q8YA 4FMQA 1L8TA 4CNHA 4I41A 3R3HA 2Z6AA 3UZPA 3RODA 3K2LA 4A6EA 3GXOA 4TKSA 4CVAA 3B7PA 2RL5A 3BE2A 3AC4A 2PZIA 2QU5A 4NL0A 3DMGA 1BI8A 1DI8A 1PKDA 4IFCA 4XX9A 4E4NA 3SOCA 4J1RA 4K18A 3LJ2A 4UB7A 3X0DA 1ZOEA 3Q32A 2YXLA 2OI4X 3ULZA 3GOPA 3JWIA 1U2ZA 2HYYA 3RALA 4GJ2A 3FPFA 2J4ZA 4KKEA 2GPHA 2UVZA 3MFTA 4IIRA 4JAJA 3RPVA 3ZO4A 5CASA 4XNEA 3FZOA 4FV7A 5J8IA 3B3FA 5ANEA 3EEYA 3TR6A 2WTKC 2WTDA 3TEIA 5KMMA 3R73A 1NW6A 4MXZA 2WNTA 2P3GX 1P1CA 5EQYA 3W8QA 2QOHA 3HV6A 4NW5A 2H9VA 3RNIA 3QQJA 2XYRA 3BKXA 5EKXA 1AV6A 4FT0A 2GAFA 3VAPA 2H34A 2JITA 2X7FA 5CTPA 3VBYA 2VTOA 3W2PA 2IVVA 3K6RA 3IW5A 4JRVA 4CFFA 1KP9A 1GZNA 3UWPA 3ZBXA 5EW3A 4LGHA 3JVRA 4DM3A 2F7EE 5FEEA 5CF4A 5EHOA 2V22A 3QKKA 3F7ZA 4ZP5A 4ANLA 2GA9A 4J7BA 4XP0A 2VTMA 5EW8A 4EHGA 1XDUA 3UOLA 4NFMA 4DFNA 4E93A 1FQ1B 1O6KA 3C0HA 2ZM3A 3PXZA 3KMUA 2UZNA 4O7RA 4YTCA 2ERZE 2YISA 3QZIA 2BTSA 3QALE 2C5XA 5DLYA 1M7NA 1KPHA 2BMCA 2C5NA 2WTWA 4P5ZA 1FOTA 1WAKA 1OIUA 4PQNA 2OZVA 3R6XA 4GRBA 3ZLWA 2XJ0A 4LMUA 4RIWA 5G6VA 3AG9A 4FNZA 4QYHA 4RTRA 2J2IB 3DOGA 4OTRA 3SRVB 1OITA 4I6BA 3R8LA 3RM7A 3NRMA 3GRUA 5MHTA 3P4KA 3EFKA 4DG0E 1SVGA 3U4WA 5IPJA 1P5EA 3FMEA 4YHJA 4FL1A 2PMLX 4QQJA 2CJMA 1Q41A 2WMUA 1VP9A 4M0ZA 4OW8A 2EB2A 3V51A 2YIQA 5DIAA 1P4OA 4PY1A 3VS1A 3ZFXA 3U9CA 3OU2A 4BBEA 4KS8A 4QNYA 3TFWA 1DI9A 3PY0A 4U7PB 3VUMA 5CWZA 3SGLA 1ZY4A 4XRJA 4BVUA 5HORA 3R00A 2DYLA 3BI6A 4ZMFA 1IEPA 5FTQA 2ITQA 1Q99A 3DLSA 5TKDA 3G5TA 4EOJA 4MXXA 5KZ0A 3D7TB 3QA0A 3UTOA 4ZSGA 3FI4A 3F4KA 2G1PA 5K0LA 1M14A 4RVDA 1YI3A 5FM3A 4YJRA 1BLXA 4EBWA 1B42A 1Z57A 2XA4A 5IQGA 4BTJA 4PTGA 3QUDA 4FG9A 5EYMA 4CKJA 1QAQA 3Q2MA 3L8DA 5LXMA 2WQOA 4BHZA 2P8JA 2JJQA 3CTQA 3BHUA 3LSTA 2IH5A 4FTNA 4N6ZA 3QCXA 2P0CA 3E8EA 3CGFA 3CLYA 1PMEA 3CXWA 3IW4A 3ORMA 4LMNA 3C0GA 2ITYA 3GP0A 3PE2A 3Q7EA 5E9QA 2Z7QA 1Y8CA 3HVJA 2FSMX 2OYRA 1H01A 4II5A 1GIJA 1JSTA 3CD8A 3FXWA 2E9PA 4DFXE 5HNBA 1S9IA 3R8ZA 5HIJA 2AS0A 1DUSA 2DQ7X 4R1VA 4ZSEA 4E5WA 3ODYX 2QOIA 5K01A 2ITNA 3HVHA 3VUHA 1YDTE 3IHTA 5HE0A 4G6OA 4YJSA 2C6OA 2CCHA 2W06A 2WAJA 3WBLA 5HCYA 5A4QA 4R8RA 2CN8A 3ODZX 3D5VA 1XR1A 3CJGA 2IDJA 2B52A 3OXIA 4D1SA 3UIXA 5L6WL 2BFXA 4FYNA 5DEYA 4MTLA 3SX9A 4KRDA 2OZAA 1KE6A 4PDSA 4EWHA 1RJGA 4GOLD 5AX9A 1IY9A 5E1BA 1X1CA 3KMWA 2C1BA 5K0CA 2FUMA 3I4BA 5AFVA 5EHLA 3TN8A 4BZNA 2GNFA 4MQ2A 3L8PA 3O96A 4EUUA 2R3GA 2VWYA 5D1NA 3LJ0A 1V39A 4MXOA 1IASA 2B55A 1REKA 3COKA 4JAIA 1OKZA 2XKFA 3GU5A 5KZIA 1Z5MA 4BGQA 4R5SA 3I0OA 1Q4LA 3DJ6A 5H8GA 5C9CA 3UP7A 3Q5ZA 2UZ4A 3D2IA 2CGWA 2C3IB 4CRLA 2QY6A 4RC2A 2J0LA 2QHMA 3DBDA 1L3BA 3F7WA 5M44A 4G56A 5P8WA 5JK3A 2YIXA 3ATSA 2VP3A 1B6CB 3HV5A 1YZHA 4IB5A 4EK3A 5CX9A 4QMMA 1BKXA 4ZTNA 5I9UA 2PBFA 5I9YA 4ANMA 4RJ4A 4LRJA 4ZSJA 2GLUA 4HH4A 3VC2A 4I6HA 4JDKA 4HRAA 5EQJB 5E8TA 1IR3A 3PY3A 3M2WA 2GNJA 3O23A 4V0QA 1K9AA 3TZ9A 2AN3A 4DQ0A 1PXKA 3ZMMA 5HVYA 4HPTE 4W8DA 4XS2A 4EOIA 4WHZA 1GIIA 3F3TA 3FLWA 4AU8A 2WU7A 3QXOA 3DBFA 3MVJA 5FG8A 2VGOA 3HMMA 4WXHA 5LWNA 2YACA 4BDEA 5CEQA 2QYOA 4L01A 5L3AA 2FYTA 3CVOA 1VYWA 3NUPA 3UJ8A 2WO6A 1Q0SA 3CGOA 4E33A 2PMIA 4IM0A 4HGSA 3V8WA 4Z7HA 1P14A 2XBAA 2QONA 2QOCA 4L45A 2R3SA 5F2NA 2XKCA 3PB3A 5DXAA 4FZFB 1IG1A 5J9ZA 2OPBA 4RQKA 4XHKB 5JZNA 5ANKA 3LCKA 4ONAA 3LCVB 5AP3A 3SSMA 5CSXA 5F4NA 4ALWA 2J0KA 4XV1A 3LCUA 3Q9XA 3A25A 2VS1A 3LKZA 3CPCA 3M6WA 3QTZA 3ID6C 3IDBA 4GOOD 2B9IA 2WB8A 2EUFB 4LV8A 2DUVA 1XVAA 4GFOA 2JC6A 3GNIB 4ER6A 4PWNA 3QRKA 5C27A 5A14A 5GM1A 4FZAB 4FKPA 4PYNA 4XV2A 2KW5A 3MCZA 4O86A 5AADA 3A2CA 5HX6A 2RF9A 4KD1A 1OKVA 1PMUA 1TVOA 3FL4A 4KRCA 2I62A 3C0KA 4DFZE 4PIMA 4FYOA 1SQFA 1Q8ZA 1E1VA 2WMRA 4ZTQA 3QF9A 4YZBA 3S1HA 4QMPA 5J5SA 4HNIA 2ZLBA 3BZBA 2PWLA 2OF2A 4RTSA 3SXJA 2E2BA 3GUBA 3QUPA 4Q9SA 2P2HA 4GT3A 5K5NA 5JQ5A 4WG5A 2ETRA 5KX8A 4MXAA 2Y6MA 4IV0A 2I6LA 4PYMA 2ZB0A 4A4OA 3GEQA 3GO4A 2W17A 5DRYA 1MQBA 3D5UA 2IVTA 4IM2A 3OD6X 3FHRA 3MTEA 3FRHA 4ATNA 4KBAA 3HKOA 3HMNA 3ORNA 3UOKA 4BDAA 4EHZA 4IWOA 2O0LA 5JT2A 3P2IA 4M7RA 5AP1A 2PX2A 3FLYA 3HDMA 3RWPA 3FZPA 3OFMA 2PY3A 2UZWE 4MBIA 1XDSA 3SM3A 2XF0A 3E8NA 3VUKA 5LQJA 1LEWA 5CEPA 4RFMA 3UJ7A 4C06A 3G5DA 1PF8A 1KE7A 3EFJA 4F99A 1YRPA 4RJ7A 3AGLA 3AT3A 5EK7A 2IDKA 4XUDA 3NJRA 2CKQA 2H8HA 3FYJX 3HNGA 3MFSA 3MY0A 4NSTA 3JWJA 5L2TA 2XIKA 3EPPA 3DJ7A 5AV4A 1KXZA 5HNIX 5KBRA 3VO3A 2QLQA 5DLSA 4H3BA 4F63A 1NBIA 4OTHA 4F7SA 3H2BA 3UMWA 5FTGA 4EBVA 5EHIA 5ICEA 3L8XA 4Y95A 1KSWA 3E8SA 4MK0A 4QMYA 5LQUA 4F0IA 4H36A 9MHTA 3UPXA 2ZBPA 2R3RA 5HIBA 1YI4A 2VTTA 4EUTA 5E8ZA 5JGBA 1OL2A 3D7TA 4C2VA 2G1TA 3B5IA 5CVVA 2ITVA 3NW7A 4E20A 2W4OA 2EVAA 2YM3A 3TV7A 5CAOA 3O4FA 2IW8A 3AC8A 5IQFA 2A19B 3FLQA 2CCIA 3ER9A 3C0IA 1KOAA 3MH3A 2QR7A 4O0XA 4V0GA 4CEGA 4HYIA 4HJOA 4QP2A 1EJ0A 5AV2A 4FNWA 4B0GA 4C07A 3DDQA 3LQ3A 4TY1A 2ZZNA 5DGZA 5F9EA 3ZZEA 2JHAA 3PVUA 4RT7A 3KR0A 4H39A 2WMSA 3EVGA 2N47A 3HCBA 3EVCA 5AM7A 3C7QA 3F5PA 3KXGA 4EOPA 3THBA 3VHEA 4IADA 4WG4A 4L7VA 4C4JA 4LUEA 3VBXA 3MI9A 3ZHPC 4AGDA 5IF1A 3R1NA 3SC1A 5GIPE 2ADMA 4DITA 4IX4A 1CSNA 3NYNA 1V0PA 4J8NA 3SQQA 4H1MA 1KWPA 4BLVA 3Q53A 4BBFA 1W98A 2YWVA 1DL5A 3AMYA 1NE2A 3AC3A 3FMMA 3R7OA 1FVVA 1WVXA 3L8SA 3QQLA 4CV9A 4R3RA 4PYOA 4J96A 4Z3VA 3P79A 3PZHA 1ZAOA 3IKAA 3VRYA 5EZQA 3UNJA 2AOVA 2ITTA 3IDCA 3EQBA 3GFEA 4O6EA 4GK3A 5CVHA 5HNGA 2AN5A 2JG3A 4GUAA 2B9EA 2ZSUA 1A06A 4O82A 1HMYA 4YTFA 2C3JA 4OLIA 5CT7A 4RSSA 4G31A 1H4LA 1SKMA 3KRJA 3KU2A 1RI4A 2YVLA 4IX6A 4QP9A 4MH7A 1TQPA 2FSLX 4X6QC 5JRSA 4DEDA 3CY3A 4FP9A 5EKUA 4PDOA 3WF7A 4BCHA 2HZ4A 3UO6A 3WZJA 3G2PA 5B1SA 3NZ0A 4O7VA 2QG7A 3QL8A 1MRYA 4HGEA 2HWKA 2YZAA 1BYGA 4R6VA 3EVBA 1EAMA 3RKBA 2ITUA 4ZXTA 2XM8A 3A60A 1MRVA 4K6ZA 4GIIA 1P4FA 4AZFA 1YDSE 4M36A 3O2MA 4BTFA 4QQTA 1JLUE 5M4FA 4ER0A 3EN7A 4GUEA 4R7IA 4OT5A 3TNQB 3ZO3A 5E8SA 3ANRA 1RI2A 2PWYA 2XK4A 5KVAA 4JI9A 3BU3A 1J3HA 4U41A 2J0JA 2HZIA 4PWYA 2JDOA 4BY9E 4E4MA 4MHAA
chains in the Genus database with same CATH superfamily
4EHJA 3GROA 4NFNA 5AJHA 4ZTHA 3GVXA 3BMQA 4PS1A 1R6AA 1DAOA 4H58A 1QZUA 4L0MA 1OAOC 4L4XA 2PT5A 3GOHA 1JSUA 1EP3B 3SOZA 1AXGA 3L8YA 3QWKA 2C9YA 5KTMA 3O4RA 3G3EA 4NJEB 4RJJA 5GNKA 3DLZA 2KE5A 4AJ2A 3N28A 1LQ2A 1H2XA 3UVRA 1IPEA 2OHXA 3X1DA 3AUTA 3RC3A 3R3XA 2TYSB 2VTJA 4Y67A 4DDIA 5DW3A 2HZNA 3BYUA 3DLHA 3URMA 2O50A 1OV4A 5ARDA 3E64A 1G2OA 3NCGA 2GTPA 1QIFA 4PVDA 5CGQB 3A6EA 4YN3A 1Z73A 2QRVA 2QO2A 3QFVA 2XEZA 1R0WA 5CPBA 1ZU4A 5HCZA 1W83A 4PHFA 2C58A 1CQXA 3X0DA 3SNKA 3K0AA 4B82A 3H8JA 4EYSA 4OHFA 2Q3EA 2EWAA 2X6RA 4QSHA 3DOEA 4QIHA 3B6MA 4Y2VA 3UHFA 3SIXA 2VPZA 3RTPA 3DA8A 3K3PA 1A9TA 3ESDA 1ORRA 2VRNA 1CEYA 2BCJQ 2H4ZA 1K6IA 5LQKA 3K05A 1G5IA 4JZKA 4YX9A 5CDTA 4C0QC 3ENWA 3KU1A 1E7RA 3WA7A 2HA2A 3FNHA 4GKKB 1ZN9A 3OWLA 3E62A 2AG1A 1FMTA 4REMA 5FEUA 3WLPA 5ESRA 1I2DA 2F67A 4OU4A 4BJHB 2XJ1A 3LW7A 4K6GA 5B4TA 2V1UA 1F0KA 3FGZA 3VF8A 4AW0A 1P2SA 5AXCA 2W6IA 1UKEA 1SMKA 4BFXA 2LR0A 2JGRA 4HL6A 1DOAA 3QMWA 4X45A 3BH7A 3GFSA 4C59A 3RJ5A 2D1FA 4MMYB 2D5BA 1AQYA 3FW1A 1LPUA 2EG9A 2R3JA 4Q5HA 4IGAA 1K86A 1VIYA 1NA5A 3WV5A 4HYTA 3ZUPA 1IDN1 3FQSA 2BGTA 4TRJA 4L72A 4QYSA 4YCCA 4BQEA 2EGUA 4D46A 4E4LA 3ZXTA 1Y4SA 3CYFA 2R3QA 1V6AA 4ZTRA 3JSXA 2FEWB 3A6KA 3FC1X 2ZYTX 1X39A 4IH9A 3UZRA 1SVLA 2YM8A 4CIAA 2VBCA 3LA8A 2NO5A 4MV5A 4OGWA 3WFIA 3GRAA 2QLLA 2FF7A 5L3VA 2CDNA 3F6CA 5L7WA 2W5BA 5DX1A 4LWOA 1SK9A 5CB6A 4KR2A 1QORA 5B2FA 1OXXK 3RZBA 4RA6B 4W4WA 3G8DA 1Q83A 3WQRA 3GI3A 1DP4A 2D1TA 4JRNA 2HR1A 3E93A 2XRWA 3CLRC 1DAYA 4ZI7F 1UJ4A 1W87A 3A14A 3C3BA 3M9WA 3KULB 2OSCA 5ECDA 5CW2A 5JFSA 2DY0A 4NJDA 4BO1A 3DULA 4HEA6 4ND2A 4DDKA 5D41A 3EQ2A 1ESMA 3CX3A 3QMMA 2BM8A 5KINB 2VU3A 3ROPA 2P6RA 4TYJA 2VF5X 2YCSA 2TRSB 3P86A 3CPBA 3NMUF 4F9YA 4HDQB 1HDIA 1GNSA 3ONFA 1SKUA 1JFVA 1PGPA 2G40A 4O0WA 3F2AA 4XCQA 1FYEA 4RFYA 5IVPA 4EOKA 3MHTA 2DFLA 2PUFA 4JEUA 4QYGA 3WNZA 3ZOZA 5LOVF 5AH0A 4PNEA 2NPFA 2FDCA 5HS4A 2DR3A 4O2BA 3OZTA 5F2EA 3JZMA 1M1NA 5EMLA 3WYDA 5IDWA 5AVYA 1SHTX 4U7GA 2C1AA 4DY6A 4JODA 3KT0A 2ZIVB 4P90A 4U7FA 2ZE8A 2PK3A 3AUAA 2OLCA 1TLTA 5GONB 3OJEA 1X7XB 2PEYA 3KQ7A 3SZOA 3HR7A 5EJIA 3NP9A 1QHNA 4AP5A 2RFEA 3FWQA 2PLWA 3AEQB 3JQ6A 4DMFA 3OIGA 4BFLA 1BRTA 1FFYA 1MG5A 4DLWA 4DLKA 3ENMA 1PYEA 4WA9A 4FSMA 3BFVA 1W46A 4LRTB 3R5XA 4DLXA 1SPBS 4I4NA 4O1HA 2QMQA 5M51A 1V5EA 1SRRA 1GFZA 2DBYA 4BVBA 5JD4A 4YO7A 1ZQ9A 1DG9A 5ALQA 1WDTA 1RHKA 3FYUC 3LCJA 4KO8A 3NW9A 2UU9B 1FSSA 1ODSA 2JFOA 2NUTB 1TEXA 3RTBA 1Y7TA 1ISPA 2PKQO 3QV1A 1N5KA 3HFSA 4N6YA 1KFJB 1VLJA 2P6NA 4DBXA 3CWZA 3D94A 3A8XA 5T4BA 2NMVA 2H96A 3ZDDA 5B55A 1MJGA 3C4QA 4DLVA 4BO2A 2BIFA 1XH6A 4RA9A 3GLKA 5IEBA 3ZGLA 2FO0A 4KIFA 4BE7B 3EMVA 1Z0FA 2F43B 4RE5A 1RBZA 1Z3IX 4AY4A 3TLJA 2A84A 1R0LA 4OQQA 3E0XA 2P4SA 4FUXA 3I9MA 3I53A 3PEFA 4P86A 2BPMA 1ZMOA 3TTTA 3TG2A 4KQKA 3HA8A 4F1WA 4EH6A 2Z5VA 3KSZO 1LK7A 3ITKA 2CGXA 1GHTA 5JFVA 1BWQA 3CMCO 3U09A 4YJNA 3EN4A 3Q8MA 2P7HA 3ZVLA 4FKJA 2PL0A 4XWTA 1BMQA 1PR5A 2IOFA 4YP5A 3VSEA 4QTBA 3T9TA 4MVJE 1IZ8A 1L7BA 4AG6A 4ETNA 3OA0A 2HGZA 2QO9A 4FBLA 5E1OA 5CI6A 2C5LA 2G1JA 5LOVA 3UWSA 3AQVA 5B30A 4UXLA 3OUKA 5KYKA 3R0TA 1UBOS 1JEAA 4D9HA 1THGA 3TLZA 3PA3A 1OU4A 4ARUA 4DXHA 3PG5A 2UUEA 2GNOA 1DJOA 2I8AA 2CJWB 1RS0A 4MR9B 4NG4A 2FG6C 1EVKA 1KMHB 1OI2A 4LX8A 5DBIA 1CIPA 2ZT8A 2J0UA 3K1YA 3PIYA 4YMWA 4LYHA 1DELA 3V8VA 3S2UA 4KKVA 4OBBA 3PGJA 3CE6A 3JD0A 3DMYA 2XXJA 5EM7A 1ACMA 3USES 2GCOA 4ZCTA 4GICA 5CAQA 2EBUA 4QMWA 2Z7SA 1KU0A 1AUQA 3RBZA 2X0NA 4WLFA 1L5YA 2NRYA 2Y99A 1F6DA 6REQA 4PFQA 5FHQA 4FSHA 2QN6A 5EIFA 5LFAA 1ILEA 1Q91A 3RV3A 4YPVA 3AJEA 5BWNA 5ESXA 1I4EB 4BNVA 5DLQC 1APME 1T6NA 4YZCA 4CVNA 3ZYZA 2ZMCA 1EFVA 1SYKA 2V7XA 4IWNA 1ZKDA 2BKKA 3SIPA 4I21A 3GZNA 3KJQA 3G9LX 4PYIA 3H42B 1SCQA 1H25A 5THKA 1E61A 1XVTA 3L0YA 4OFWA 1WUYA 3DM5A 1UBHS 2OWDA 1O6ZA 4X20A 4Z7JA 4HYSA 4RPIA 2C04A 1LVUA 3RTAA 2GYUA 4IQ4A 2HN9A 4GBJA 4ID3A 4ZC8A 4Q5EA 2GPWA 1MQ8B 3PT9A 1UBFA 2UZLA 3INYA 3IA2A 1P2DA 2VT7A 4MPDA 3KOOA 3H0YA 3JD3A 2CW5A 2VZ8A 1KKLA 2I40A 4BRXA 4YJTA 1E20A 3EW7A 5HCIA 4OP3A 4FTCA 4YJGB 3BSFA 3KY2A 3CLRD 3OEZA 3CX7A 1TUBB 4N8SA 1PU2A 2PUHA 3FMJA 4LZNA 4J98A 3GC7A 4AQKA 2V7WA 5FA6A 1ZUNA 1SCJA 1NT4A 5E2AA 3OLYA 1CUCA 2BFFA 2GTNA 4K6FA 2OH4A 1I6LA 3LUDA 1A77A 2OBXA 2ZJ5A 2FN4A 4G9GA 4KN9S 4JVGA 3ZZ1A 3GC8A 3BWJA 4HNGA 3OZBA 3L7NA 4N5HX 4JKOA 1PW2A 3NTXA 4RENA 5DN6A 1RJFA 1SD1A 2OV6A 3E1SA 2KWIA 3BQRA 2PX8A 5THQA 1V26A 1ZH2A 5DWDA 1RAFA 1GL9B 5K6TA 2QTVB 3ULKA 1B6TA 2HV8A 1UZMA 2ADFA 2ZRAA 2JLDA 1FNCA 2GEJA 2M9MA 1SUCA 5AP0A 5LJLA 2WWYA 1LUFA 1NW7A 3ACJA 1OOEA 4O4JA 5G4LA 4WT6A 4LHVA 1XNRB 4KNVA 5HVKA 4BRSA 5LZ4A 4Y2YA 3R9HA 1KY4A 3DMTC 2ZR7A 1GZDA 4GOND 3D8HA 4U7HA 4OJYA 4NBLA 4E73A 4ZJIA 4U8HA 1G6HA 4INZA 1DT5A 4E94A 3G8AA 4BFSA 1S2LA 1I2MA 1NE7A 2NO4A 3M81A 3QRTA 4LVOA 5JQGA 1XBBA 5EZSA 1E4EB 1DQRA 3SVLA 1TJPB 1JXQA 3L0BA 4BGHA 4XW2A 4GGPA 2XKEA 4C61A 1L4GA 3K5HA 1E58A 1RMTA 3SYMA 2JATA 2L17A 2QWXA 2XE6A 4JGGA 1MJGM 1L8AA 1WHTA 1AQJA 2GR9A 3N3AC 5LMUB 5HVJA 3W2CA 5JCOC 4TV8F 2B1JA 4LYNA 2I03A 5D5QA 3F7TA 2NVBA 2ZZKA 1W93A 4FN4A 5HO7A 1JMKC 4NYJR 3R9NA 4KSQA 2NPQA 3SIWA 5JQGF 3GUZA 3ROTA 3FMIA 1EEHA 3WL8A 4XASA 2WUWE 1KEVA 2SHKA 1LSJA 1D8AA 3E3PA 3V80A 4OGRA 4FTUA 2G80A 4JUIA 1PGJA 2Z5FA 2D59A 3DV9A 3F49S 4B44A 2W9FB 2WM2A 1V1RB 3OA2A 4XYMA 3B2NA 2W90A 3QOWA 1Z2NX 3C6MA 3Q3JB 3H11A 3G02A 1CQWA 1OZFA 2YQZA 3OH8A 3PJ3A 4RSGA 3RFVA 3DBRA 3WVNA 1P73A 5H8BA 4TZ0A 4HWRA 2CLFB 4IRXA 4MUJA 5AVXA 2GBFA 1TQ4A 2QIOA 1T9AA 1JFFB 2UYQA 1TEHA 3GFRA 3ZS5A 1JVNA 4J1TA 3DTVB 3FWZA 2QL9A 4WNMA 3QJGA 1ACLA 5DGTA 2I6GA 3GBZA 2FGJA 1ID8A 2G06A 4WVFA 4UJ3A 4RQVA 4XX0B 4ZOBA 3I1FA 3FZNA 2F3PA 1JLLB 2UW8A 2R8XA 5DYWA 2XDAA 3NH6A 4I2VA 3K30A 4XD7A 5I9VA 1C3EA 4MMXB 2PEZA 4W5RA 3W3AD 4FMDB 2V3CC 3IOYA 2BZKB 1LV8A 1TYCA 1IG3A 2JJYA 5ERGB 1GFWA 1KR2A 4WFJA 5ALZA 3UUEA 1GLNA 3U3MA 1TQIA 2JLVA 3ME5A 3UC9A 1OH5A 3SC6A 3UIEA 3E4CA 4I2NA 3RFXA 4Z9YA 1MZPA 4AW2A 4BCPA 4WKQA 1C5KA 4EF4A 1Y3FE 3ROCA 3O26A 1HUQA 2QVSE 1FU8A 4CLJA 3GENA 3QQFA 4UEOA 2RKOA 3D43A 1ORHA 2Y6OA 1TDJA 1QQ5A 1ZOPA 1IZ0A 4HVTA 3A4YA 4L5IA 1K97A 1FPQA 1Y48E 3CW9A 3QP9A 5A3JA 1CUEA 3LHDA 4NDAA 1AM4D 4B3BA 4GEGA 2ONYA 4TTVA 4NJOA 1WFCA 1VKHA 1OROA 4EK9A 3PF9A 1GZOA 2ASEA 4X0MA 5EM8A 1M34B 5LBTA 4D57A 3NHAA 5HWSA 3PLNA 5ER9A 3RVNA 4PZ0A 4CMAA 4ZODA 3QNUA 4OMFG 5E6RB 5H59A 1RABA 5FGKA 1JA0A 1XCPA 4A27A 1ZINA 4CMGA 3CB4A 2CYBA 5F98A 2XAUA 4M3NA 3HPRA 4G3EA 1TGVA 1JEYA 1SXGA 3JQRA 4F1OA 1HR0B 4LDZA 4K0KB 2IYQA 4MJ7A 5GIOE 2C68A 3IPXA 3E87A 2PPQA 3RAJA 1G0OA 1WMFA 4EJNA 1FL9A 5IMBA 1M17A 4PHGA 4BGVA 5KC9A 2XGJA 4B79A 3DZFA 3GCDA 3FIUA 3G0EA 2RIPA 3OZVA 3N7TA 2BZ0A 4MW1A 1Q14A 5C8MA 1R6XA 3EN0A 3FYUA 3SR3A 3L41A 1DO2A 5J23A 3HP4A 3WQBA 4DEIA 2B4TO 4MNTA 3IQ7A 2I1MA 3LQYA 4PGAA 3QQPA 3VVMA 2WF7A 3QY9A 1Y6QA 2YCRA 1RXSA 2HOGA 4J7CA 1D1QA 4GNRA 1N5JA 4XWAA 1ZWSA 2XB6A 2Z8ZA 1T10A 2DWPA 4WOJA 4OHYA 3TPCA 4E2YA 3FFBA 1G59A 4XB1A 1KI6B 5AUUA 3G59A 4M2LA 5A05A 1KZ6A 2VDUE 3ABRB 1IXKA 2CLSA 3NFRA 5LCKA 5MGBA 4DHWA 4H27A 1SVWA 5KHWA 3BXZA 1V3UA 4PQGA 3PX2A 4KIGA 4IGKA 4ZHQB 3BE8A 2P9YA 3TV6A 2IJGX 2H07A 4RTQA 5M29A 5FLFA 2F48A 2NXWA 1CERA 4I50A 1A5TA 3QENA 3A4MA 5DXJA 1G2IA 3QZFA 5H3QA 2FY8A 4O7YA 3G13A 5JSZB 4OHXA 3PZBA 1T35A 1PNQA 1MW8X 1E2GA 2X3UA 4M15A 2E89A 3IUEA