1G8SA

Methanococcus jannaschii fibrillarin pre-rrna processing protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
230
structure length
230
Chain Sequence
MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN
publication title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikshii Fibrillarin
rcsb
source organism Methanocaldococcus jannaschii
total genus 69
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1g8sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g8sA02
5E7RA 5CEPA 2PX5A 3OWLA 4U8ZA 2GH1A 1Q99A 4H0NA 3KGAA 4D0WA 4R3CA 2WFYA 5FTGA 1ZAOA 4R78A 5F4NA 3NDIA 2UV2A 3DBEA 1K2PA 4RX5A 2WNTA 3BHHA 4K18A 1RJDA 3VSEA 4MHTA 4N6YA 4FZFB 3MFTA 3F3VA 4FC0A 4J53A 4PX6A 3DXXA 2UYQA 3C4ZA 4ER6A 3LE6A 3W32A 3D7ZA 4YNOA 2BZHB 3QTWA 4AOTA 3EFLA 2QNJA 2EB3A 3B3GA 2IW9A 3OU2A 4IWPA 1OIQA 4X63A 1XKKA 4C2VA 2PL0A 1D2CA 3VBQA 4CFXA 2RIOA 3FZPA 5FD2A 2H00A 4O91A 2X8EA 3BI6A 5F20A 3PRIA 4YJQA 3F5UA 1X19A 3UNKA 5CI7A 3V5WA 3LFCA 4BKJA 3FMLA 2HV9A 4YV0A 4IAIA 4QYGA 2BVAA 2OXXA 3AY0A 5L2SA 1G8AA 4U7TB 2HY81 2OFUA 3LXKA 1CSNA 3W10A 5DEYA 3I0OA 3MWUA 2OICA 3COIA 4BGQA 1G38A 3OUNB 5GINE 5H8EA 5HD4A 3FZTA 4B8MA 3R1YA 1YHSA 1FMOE 1SZMA 1H1SA 2R3OA 3WIKA 4DFBA 1W84A 5CU6A 4F7NA 1OIUA 3VVHA 1KIAA 4OBPA 4G56A 5H02A 4ZTSA 2ZYBA 4F85A 1KOAA 3Q60A 4CTJA 3I60A 4RTSA 4U5JA 2PWLA 2QU6A 2C6LA 4Z9LA 1ZQ9A 3ZXTA 3ZCLA 4EJNA 1RJGA 4YMHA 4AF3A 3FLWA 1DM2A 2VD5A 4MAOA 3EQRA 3RALA 5K09A 4LL5A 3ZZEA 3KXNA 4G5JA 3OCSA 3LLTA 5D1JA 3OE4A 2X2MA 3RHKA 2R9SA 5JZJA 1NW5A 1SVUA 2ZCJA 4G1WA 3NCGA 4BDFA 2X39A 4JNWA 3TJDA 3RAWA 3UG2A 4QMPA 1IA8A 3FXXA 3D14A 4KVZA 1YQJA 4DM3A 3FZSA 3ACJA 3Q4TA 5T3QA 4YLLA 2Z60A 3FMKA 4DA4A 2B9FA 5HIEA 3ZDUA 3WILA 4EQZA 4BP1A 4V04A 4NM7A 2I7CA 3RPOA 1NW3A 3KRJA 3VN9A 1RI1A 5EOLA 4A9SA 5DTMA 2AOTB 4DFZE 5JH6A 4YZBA 4J8MA 4U7PB 4CMTA 1TVOA 5CENA 4JOAA 4C4HA 2CWWA 1QPDA 4DG2E 3A8WA 3HV7A 1R0PA 2ZB0A 5M4FA 3OF0A 3NUXA 1Z3CA 3UQGA 5IISA 2DWBA 3PRFA 4E4MA 5CEMA 1PYXA 3U9NA 2F7EE 3D5XA 5B2KA 5T64A 5EW9A 3G2FA 3O7LB 5AV0A 5HIKA 1VQ1A 5DTQA 2BDFA 4YR8A 4E2XA 4XBUA 3K6RA 4RTRA 3R1SA 3DXQA 2YX1A 3IONA 2XKCA 2WEIA 2ZWVA 1GOLA 2ZBPA 4CV8A 3IEIA 3HZTA 4M0YA 4ZJJA 4RX9A 4JDJA 1Z9XA 1OKYA 4O7VA 2QC6A 2BTRA 3FYCA 4BTMA 3PA3A 2E9PA 4BBEA 4N0SA 3HMPA 3ZONA 3FE3A 5C9CA 4MTAA 2WQMA 3QA0A 9MHTA 4P4CA 1LP4A 3ZH8A 2XBMA 1BX6A 2PVFA 4ZS4A 2PT6A 5I9WA 2QR8A 3L9NA 4EKLA 1LEZA 3VS1A 3HA3A 4K33A 5EM5A 5TOZA 5JQ5A 4BCNA 4FSYA 4FTOA 4KD1A 2ZM3A 3ITZA 1H01A 2Y4PA 3R7UA 2PVRA 1BHJA 4M38A 5C9ZA 4RJ3A 5DR6A 3RM6A 2CMWA 3DMGA 1XCJA 3Q9XA 4JR3A 4M8TA 4D28A 4D5KA 3TV6A 4O27B 3M6UA 4YC6A 3DZOA 3V5JA 4XG2A 2F49A 3FUUA 3FZOA 3C1XA 4Q9ZA 5IMXA 5CVVA 3HRFA 5LOHA 4U44A 4RLLA 1TKIA 1JKTA 2EUFB 1SKMA 1FGIA 3EPPA 1REKA 5EI2A 1PXKA 3MFRA 4FKWA 1XH6A 3VUIA 4R05A 3SG9A 3SSMA 4FSDA 5ETFA 5KMLA 5IU2A 5C8MA 2PVKA 1I09A 2R3FA 4FSRA 1OB3A 2Z2WA 1KE8A 3T7SA 2P3OA 3G88A 4FG7A 4RTKA 4I5HA 2W9ZB 3JVRA 2I6LA 3JWJA 3A2CA 1OIYA 2QG7A 3FPJA 3W55A 2QHNA 3R22A 2PMLX 1JKSA 1TPYA 4GUEA 4DTBA 2PVNA 3CKKA 3F69A 5E1DA 1U5RA 4G6NA 4GK3A 2PMOX 3R02A 3OEFX 5CSHA 3PB3A 4N6ZA 3COHA 2G2HA 2R3RA 3KA0A 2PULA 5A4EA 4HYHA 2VTPA 3PWDA 2P3LA 2QOQA 2QRVB 1YDTE 3ZO1A 4EVIA 5B1SA 4RVFA 3MBLA 2PWPA 3LQ5A 2ZTHA 4Y83A 4RJ7A 3M2WA 2YIQA 4E5AX 4EOLA 4PONA 2OBFA 4IVDA 2WTVA 4WG3A 5GJDA 1PF8A 3MVLA 1H0WA 5JRSA 3JWHA 5DSXA 3Q4UA 4KUJA 4ASDA 3OXTA 4Z7GA 1ZOHA 3DULA 4FKQA 4ITIA 4QQKA 4A7CA 2VWBA 4JX3A 2VTAA 2X0GA 3FTFA 3LHJA 4GW8A 1Q8UA 4RWKA 2B9IA 3VHKA 5DT4A 2VDVE 3FL4A 5KUPA 4RX7A 1V0BA 3M11A 1YRPA 4GJ2A 3P9IA 3IW5A 2V0DA 4G34A 4D1ZA 3QZHA 1H1QA 4F0FA 1B38A 1R74A 3FSKA 5HE2A 5BNJA 3AMYA 3EQIA 5B2LA 4ACMA 4FV1A 1T46A 1KYWA 2CKEA 2QE6A 4QQNA 4JBVA 4QDJA 1AD5A 3KF4A 3TNIA 4IDVA 4XLVA 5IQHA 2WKMA 4WD5A 3KQYA 4IQ6A 5EKUA 3HLLA 3F2NA 2HMYB 5CASA 2J0MB 4FTKA 2GS6A 4P5QA 4U7ZA 1XJDA 3HV5A 4D4VA 3NIZA 3KXMA 3NUSA 4PCAA 4EK8A 4FKUA 1SVEA 1H26A 4YUYA 3FKOA 1VR2A 5IH5A 1OUYA 4FL1A 3ZRMA 2VDWA 2NXNA 4G9CA 10MHA 4WOVA 4R8SA 2BR1A 3ORKA 3R6TA 1UKHA 2XA4A 1OL2A 1IASA 2C5NA 4J95A 4ZJIA 4M0ZA 4PTGA 4TYJA 5IEVA 5A54A 5MHTA 5HG7A 1R8XA 1PXIA 3O7LD 2B0QA 3FY0A 4WT6A 2LAVA 5HO8A 1QAMA 3DR5A 4PMMA 2BRMA 4WA9A 2I0EA 4DKJA 5BVFA 5JGBA 2X2LA 1BC5A 1GIHA 4RJ5A 3TN8A 3P08A 3U55A 4L67A 5D9HA 2YIRA 4RBLA 4EHGA 3AG9A 1KR5A 3PUPA 5CNOA 4YUVA 4GOND 2WTWA 4QNYA 5ANIA 1MHTA 2AUHA 3JR1A 3E93A 3GC9A 4IFGA 1DS5A 1BOOA 4CV9A 4JRNA 4IB1A 3LXNA 3TIZA 5AP1A 4JXJA 4QP6A 4ZY4A 3IOPA 3RPVA 4KIPA 5M5BA 3TLJA 2W0JA 5BW5A 3M1SA 2C5XA 1K9AA 2AS0A 4YNEA 1Q4LA 2FSOX 3SA0A 4O2ZA 2XM8A 2WIHA 3OE5A 3G6GA 4I6FA 4F9YA 4FP9A 4O81A 3DZQA 3FUPA 3GOKA 5LVNA 3FTDA 4AN3A 4ALWA 4EHVA 4L43A 2VTRA 1XH5A 2VAGA 1ZKDA 4RZWA 1YOLA 3PFGA 3UBTA 1IY9A 2QO2A 5EI8A 4YPDA 4NTTA 3D7TA 3IPHA 3OTVA 4E6AA 3UQCA 4DH3A 3C4EA 4AGCA 2RFSA 2HWOA 3Q9ZA 4R3PA 4M69B 4GYGA 4C08A 3DBQA 4J52A 2VDUE 3W2OA 3ZO3A 1SNUA 4H1MA 4H3BA 4ZK5A 1BKYA 3R73A 3IDBA 4QPSA 3VBWA 3EQDA 3UZRA 3BZBA 1JTFA 1ZGAA 5K0EA 3WOWA 4ENYA 5HNBA 3VS7A 5E91A 4W4XA 3NDJA 4FNYA 1BI8A 2XEYA 4ORKA 4JT3A 3R9NA 5EM6A 3E3PA 5LCJA 2EXCX 3CJTA 2OFVA 2Y4IC 2GTNA 3F3UA 1R8YA 2OZAA 5DBXA 4MEDA 3NUPA 2OK1A 3PP0A 3PPKA 3H3CA 3ZBXA 3RAHA 3I79A 2IVSA 5AM7A 3MPTA 4PYNA 3ODYX 3SXJA 2WU7A 3FZGA 3ZBFA 3B5IA 1MRYA 1L1EA 3JS2A 1YXTA 4E6CA 5IA1A 2C1BA 2QO7A 3ALOA 4IDTA 4A6EA 3DBDA 1T43A 4MQ1A 4XG8A 4RVDA 4YPSA 4IAAA 4AZTA 3QC4A 4UEUA 3Q6UA 3MJ1A 5C0OE 2XEZA 4FV4A 3FDNA 5AJQA 2O65A 5GIOE 4C4EA 5G6VA 2UZEA 3V5LA 2CJMA 2BZIB 3LXLA 3SW7A 4RZVA 4AU8A 3RGFA 3EQGA 4YZMA 1KPHA 5BUIA 4FSUA 5L2TA 4Q5HA 1U54B 3GRZA 2X6DA 3M70A 3LZBA 2Z8CA 3A7GA 5K3YA 3ORNA 1Q8TA 2R3NA 4U43A 3QLGA 2VTLA 3DLZA 5C8KA 3KPWA 3FZ1A 4YO4A 2R3SA 4GT5A 4H05A 5KMOA 3MCTA 1ZYDA 4RFMA 3HCAA 2XH5A 3FYJX 4H39A 2QHMA 5E8WA 2J4ZA 4RIOA 1ATPE 1H8FA 2C0TA 1VEBA 3L8XA 1SG9A 4DC2A 4C06A 3NUUA 3C5IA 4BCQA 4DEIA 3AQVA 5K01A 4BZOA 5BMSA 4GKIA 1F3LA 4A9YA 2C7QA 3EGIA 5CLPA 4FR0A 5LSAA 4C4FA 1F0QA 3PXKA 3QKLA 3BWYA 3M42A 5F1ZA 4CT1A 4DTKA 2ITWA 4C62A 5AAFA 4F64A 1R3CA 2XNPA 4EK5A 4XCXA 4DEBA 2GHLA 4CFNA 2J51A 4EQMA 3ZM9A 1FPQA 3F5XA 4OBOA 2ONYA 4C34A 3L8DA 4FS8A 1VBFA 5HGIA 3VWAA 3W16A 2B55A 3UVPA 2B7AA 3O8UA 3G6HA 4HYUA 1ND4A 4XP0A 2VNWA 3D5UA 4BRXA 4IX4A 3C13A 2PY6A 2FK8A 5JFXA 1KXZA 4WO5A 5EQEA 3CR0A 4I6BA 2V55A 3PXFA 5FHQA 3REOA 2YIYA 1XDSA 1Q41A 2IIPA 3IG7A 4XRJA 4LOQA 4IVAA 3GC7A 2ZIGA 2WTKB 5BXYA 3E5AA 3VUGA 2CNVA 4CKEA 3VRYA 3A7EA 5DFPA 1FVTA 1U59A 4FTUA 2H8HA 3BWJA 2QKWB 4YZCA 3AC8A 4QT1A 4DGMA 2OU7A 2P2IA 2WMBA 4QMMA 3CC6A 4MKCA 3DFCB 5LMAA 2AOVA 4IV0A 4EH4A 3GO4A 3EQHA 3KQQA 5CSPA 2Y4IB 3GCUA 2GQGA 5KX8A 3P86A 3QKMA 3PVCA 2NXEA 5A9UA 1SVGA 1YHWA 1RI4A 3JY9A 5JKGA 3QTSA 3ZMMA 3F82A 2JHPA 1MP8A 5DNRA 4AAAA 3I9FA 3FPHA 5IG1A 4XEYA 4FK6A 4LMUA 3QALE 1YZHA 1RI3A 2R3PA 2VN9A 3CGGA 3E3BX 5ETIA 4RVHA 2GCDA 3BUSA 2ZZKA 3E8NA 3EN9A 5AUTA 5C1QB 3PJ1A 3BU3A 2CL5A 3FPFA 3GCZA 2IH5A 2P0CA 4IZAA 2C3JA 4WKQA 2ZOQA 3QQFA 4IJPA 5HO7A 2JKQA 4DFYA 3G5LA 1Y8YA 4XG9A 3HA5A 2HZNA 2Y6OA 3KPUA 5HKMA 1XBAA 3GC8A 3E7VA 4GFMA 5IA3A 3P9JA 4A4OA 4G31A 5E8RA 2R0IA 2QG5A 3IGOA 1M6EX 2PVYA 4S33A 2JLDA 5D41A 2ZIEA 5FUBA 5AIRA 5ANDA 3HEGA 2YIWA 5ETAA 4GG5A 2BUJA 2IBTA 5AP2A 2FH9A 3QCSA 2ETRA 5EOVA 3V5QA 3H0ZA 3ZLYA 2QKRA 3POZA 3SR4A 4X2KA 4BTKA 4FT5A 4B4LA 4EL9A 1FVRA 2OIQA 5E8UA 2C3IB 3UOJA 3S0OA 3QZIA 4AZVA 3ORZA 5HVKA 4FTRA 5DR9A 2Z7QA 2QI8A 3HCFA 3FKLA 4JR7A 4F86A 4HSGA 4YC8A 1HCKA 3C3PA 5E9EA 5HU3A 4ER5A 3CKXA 3R7YA 2GQRA 5IH3A 4FZ6A 4NW5A 5CEKA 4ZJVA 3DUWA 4FKLA 4YLKA 2HW6A 1RE8A 2HXLA 2DS1A 3PXYA 4F9AA 3E64A 2BKZA 5HILA 3OD6X 3OUKA 2O0LA 4HPTE 1REJA 3LL7A 4FGRA 3MVHA 4MXZA 2ZVAA 4EH7A 3O31A 5BVOA 1DUSA 1O6YA 2W1EA 1W82A 3RCJA 1NW1A 1YWVA 3A4TA 4XOZA 4PYIA 4F1OA 2HELA 3MPMA 4EWQA 4HVSA 3BU5A 5AV4A 4Y95A 4QMNA 4V0QA 2EX4A 2QOBA 3B2TA 2W5BA 3M6XA 4PDSA 4ACGA 3AD4A 4BDHA 3UJ7A 2HYYA 2VTNA 3B8QA 2J7TA 4EQCA 1KWPA 4FSQA 1ZOEA 4E8AA 5JN2A 3LOKA 5JMSA 5LQNA 3OTUA 4QOXA 2PKWA 5AMNA 1OPLA 5FULA 2WMAA 4BLUA 4L52A 4CFMA 4IW0A 2FCAA 1I44A 3R9XB 3HP2A 3LCTA 1LUFA 2UW5A 3B3JA 4HPUE 3KVXA 3R7IA 1O6LA 2ITNA 3CSVA 3NLBA 1X1AA 3KCKA 3QWJA 4PDYA 4P90A 4L3JA 3IDCA 4MD9E 5D7AA 4HC4A 3HRBA 2YJSA 2PK9A 3T3UA 2FSLX 3QXOA 3AWIA 3A61A 4Y72A 1CTPE 2HAKA 1J7IA 1OZ1A 3O51A 1N7IA 4X2GA 4O7TA 2BALA 3V01A 1LEWA 4USDA 5IQFA 4C4GA 3RAIA 4E4XA 4OUCA 3FV8A 5IQGA 4WRSA 1ZYSA 4W4VA 4CG8A 5LWMA 2ZAZA 2HXQA 3O2MA 4CMOA 1OI9A 3VC1A 5AP6A 5L6WL 2ZM4A 1L3CA 3SOAA 2WA2A 3MY5A 1CMKE 3PXQA 2ZULA 2UZVA 2VTMA 3DXYA 2JC6A 5FWAA 3R28A 2WPAA 3UPXA 4GUBA 4LGHA 3U51A 4APPA 5C4LA 4ALVA 3MN3A 5EHLA 1WMKA 5D1NA 4E33A 2YIXA 2VWZA 2XRUA 4PP9A 4GL9A 4BBFA 3ZOSA 3T0IA 3F7WA 3QD4A 1ORHA 4BTFA 3QTRA 4I4FA 4BLVA 3CIKA 4MTLA 2RFDA 2AVNA 3E23A 2CN5A 4M36A 3GEQA 4FIEA 3VF8A 3CKWA 4R1VA 5IQEA 3QQGA 3UG1A 4O38A 1O9GA 3HUCA 2CMGA 4OA5A 3UIXA 3HL7A 4F63A 1T45A 3PJ2A 1BLXA 1QAOA 4FNWA 3JY0A 4KWCA 1U5QA 3EYHA 5AX3A 3LW0A 1KYZA 2OJJA 3QZFA 4IADA 2W4KA 4WNMA 5ICPA 3OT3A 5FXQA 4KS7A 3DBFA 4R3RA 3UTOA 3IS5A 5AP3A 3I1AA 4DN5A 2W1GA 5DN3A 2OLCA 3NUNA 3DH0A 2VS1A 1WVXA 2Z6UA 4TY1A 2BKKA 3AT4A 1ZGJA 4L6QA 2JBOA 4ASXA 3GQIA 4FKRA 2UZLA 4IZ7A 2W1IA 2VO7A 3AJDA 4F6SA 4GVJA 2DUVA 5JGAA 4PYJA 4Y30A 5EHIA 5E8ZA 4OTHA 5T68A 4N57A 1IA9A 3MS9A 4U80A 4EHEA 4F0GA 2C5OA 4FTLA 4UYNA 2WTJA 3VS5A 2JDVA 2RFNA 5L6PA 4RSSA 3ZFYA 2W5HA 1XWSA 4FVPA 2VWWA 4BI0A 3EN6A 4QQCA 2YAKA 4ZTBA 1L3RE 2I7QA 4XYFA 5CS6A 3ANXA 3O71A 3M6WA 5CAUA 4YURA 3SLSA 4WHZA 4RTMA 4I92A 3V04A 4NJDA 1Q0TA 1Q8ZA 3HECA 1GZKA 2OZVA 3CY3A 3FMJA 4G3CA 4J96A 3B3FA 2XM9A 2Z7RA 2A0CX 5HX6A 5EMMA 3TWJA 4FZ7A 4QTDA 4ITJA 4U3YA 3LCSA 3BEGA 3P7BA 2BM8A 3VW8A 2W7XA 4ZTMA 1K3AA 3TNPC 2R3IA 4DFXE 1KP9A 2BFYA 2PWYA 3UOHA 4JL9A 3QZGA 2BZKB 2CLXA 5CEIA 3MVMA 1WBPA 5H2UA 3KPYA 4A4XA 3K0BA 5HOQA 5DX0A 2UW4A 4ZTNA 3CJQA 1Y57A 1LR4A 4QTUB 2UVYA 1HCLA 3GU3A 1SYKA 4E6DA 4FUYA 3ZRLA 2JKKA 2JAMA 4WSYA 5BVKA 4RQVA 4HCUA 4HVGA 3R24A 3SHEA 4MBIA 3KQPA 5HIIA 2BROA 2PZ5A 2UZ4A 3AXWA 3NMUF 4L01A 1GIIA 4BDAA 4PGHA 5F95A 5AUYA 3K5VA 1NW6A 4I20A 4BYIA 2XK8A 4EK6A 3DJ5A 3RMFA 5EGSA 3VJOA 5JR3A 3ZEPA 2Z02A 4UZDA 3LDGA 5HIBA 3VQUA 3WSTA 4XV9A 1BUHA 4C61A 3G2OA 5CQWA 5JRQA 3W1FA 4RLKA 2J0IA 5HIMA 3TRKA 3RPSA 3PYYA 2PJDA 3Q87B 3R71A 2AZTA 3PIZA 1YWRA 5AA9A 2VTQA 3R2BA 4F1MA 3HMNA 5AFVA 5KMNA 1G6Q1 5GJGA 2OO8X 4F7JA 3MA3A 4WG4A 5DM2A 1EJ0A 5LMKA 2P41A 3VYWA 5EHYA 2YM3A 2NXCA 2YUIA 3MDYA 2PY3A 5FEDA 2QQ7A 3ORXA 4FK3A 2NXJA 2JFMA 4I0TA 4C37A 2H6DA 4LRKA 2FO0A 2QOFA 2NYUA 4YUZA 4ZTHA 1Q62A 2GNHA 5HE3A 2YTZA 1D2HA 3PLAE 3G0FA 1KHHA 3HV3A 4ZLYA 3LCVB 1URCA 4YO6A 4ZAUA 3F5GA 3EVDA 2IH4A 1XVAA 3U87A 3TMAA 3NAXA 2JFLA 4Q5EA 5J7HA 4W4WA 2ZZNA 1IRKA 2ONLA 3DMFA 3CY2A 5M56A 2ITVA 2X8DA 4EOJA 5A14A 4W4YA 4MVFA 3W2QA 5I4NA 3LFBA 3C4CA 1P39A 1IG1A 3WIGA 5HTCA 4IH8A 3OZTA 5AIKA 4E31A 1H28A 4F9BA 2PT9A 3H30A 5DGZA 1R1WA 2HNKA 3GCSA 2AR0A 4GF5A 2GHGA 4EC9A 1ZARA 4CG9A 1PXOA 4OTFA 3Q2MA 3GI3A 1ZYJA 5LVMA 4P7JA 3LJ0A 2AOWA 2QLQA 2HZIA 1A06A 4MHAA 3ET7A 5FXRA 5TF9A 1PY5A 3I7BA 4AT3A 3GRVA 2CKPA 4KB8A 3E88A 2WXVA 1L8TA 4GCJA 4OR5A 4FTIA 3TNWA 4ANQA 3RPRA 4RSRA 5H8BA 4M14A 3GU4A 2GNFA 4RFZA 5AUWA 2ITYA 4DH8A 3O17A 3AC3A 2VTTA 4OBQA 3KC3A 1R6AA 2Y6MA 2HW7A 3OCJA 2WMVA 1ZYCA 5BX0A 2XJ1A 3OPNA 1OPKA 1OIRA 3QYZA 3QU0A 1VJYA 5C01A 2BDWA 4C4JA 3F3ZA 4GMYA 1YDSE 2G15A 4FTTA 1Z5MA 4M15A 1JQDA 1UNHA 5L2WA 4F7LA 3HKOA 5CAVA 3OXZA 4OBWA 4X6QC 5KHXA 3IW7A 4QQ5A 3PZHA 4M7RA 4TTHB 1M7QA 3DLCA 4CTBA 4PNIA 4JG6A 4IMYA 2ZZMA 4XV1A 2VWIA 3FUVA 4HJOA 1YI4A 2CMHA 2RKUA 4GH2A 4RPVA 3A7DA 3U54A 4DAWA 4EEVA 1VYZA 4D1XA 2F2CB 3TXOA 5IUHA 4BDKA 2BRGA 1JG2A 3ULZA 1OPJA 5FM3A 4CFWA 2G71A 3ZLWA 1BL6A 2YEXA 3OT8A 2NP8A 2R4BA 5EHOA 4AFEA 3JXWA 3Q5IA 4B0GA 2XK4A 4NW6A 2YAAA 2J90A 3NNWA 2IW8A 4BTJA 3TI1A 1GZNA 4AA4A 3DAKA 2UZBA 4WNPA 4NWMA 3TEIA 1RDQE 2B54A 3TT0A 3MB5A 2BRNA 1NW7A 5E1BA 3EN7A 3QXPA 3TKUA 3FWQA 3PA5A 5ETCA 3DKGA 3A7IA 3VS2A 4HGEA 2F8LA 4D2SA 4ER0A 1WXWA 2O05A 4EOSA 1QPEA 3DQXA 1OR8A 1PKGA 1AQJA 1WVYA 2VV9A 3V5PA 3MVJA 4EKKA 4TN6A 3FRHA 4JBOA 2PUIA 2A14A 3GVUA 4EZ5A 3AD6A 3PTAA 4KA3A 4RJ4A 3W2PA 4AGWA 4RV9A 1PXPA 4OTQA 2OB1A 2XJ0A 5M08A 5IUGA 2J5EA 5FQNA 5DLSA 3D7TB 1GY3A 5BQ0A 5J9ZA 2QU5A 4DBNA 3EB0A 3FHRA 3VULA 3P7AA 4Y46A 3SSNA 3CS9A 1XO2B 3CBLA 4MWIA 3GIWA 4MQ4A 4DFNA 3FLZA 4IJ9A 1YF3A 2UZUE 4X3FC 3BHYA 3UJGA 5I9ZA 3D4QA 2QD9A 2ZMCA 1ZMVA 3LFFA 2FHPA 3UJCA 4C58A 3S2PA 3QQHA 2OZAB 4I24A 3VUMA 2V7OA 2VTIA 1RW8A 5DX8A 5HZNA 1E9HA 5DI1A 3OS3A 4EOPA 1PMEA 3AGLA 4Q9SA 3Q7EA 5K0JA 2WMXA 5ICFA 3QWKA 3QX2A 5EDPA 2ITOA 2CGXA 2QOIA 2B9HA 2XNMA 3TM5A 5CVGA 5BYYA 1W8CA 3LJ1A 4BI1A 3BLHA 2X1NA 4P58A 2Y1WA 4E4LA 2WOUA 5LWNA 3ZO4A 3D0EA 2FK7A 4HCVA 4E26A 2PLWA 3UC4A 2C6IA 3QUEA 2XZSA 4O0XA 3OOGA 5LR6A 3W18A 1V0PA 2XKEA 1ZRZA 3BQCA 5K8VA 1ZMUA 4PL5A 2V62A 3JWIA 3KR0A 4KKEA 4LOOA 2IBSA 3EZRA 5FM2A 2OG8A 5K0FA 3KY2A 1GNGA 3CGOA 5CSWA 1P1BA 1S9JA 3GWZA 4PYOA 4XP3A 1B42A 3MY0A 3HDNA 5G02A 4O0UA 3DP7A 4C3PA 1YXSA 3HNGA 2GMXA 2E9UA 2OF2A 3FHIA 4AGUA 1INLA 2NPQA 3ZO2A 1PJZA 5DXJA 3RHXA 2VWYA 4XLIA 4ZSJA 4QTEA 5CEQA 3BYVA 5CZHA 5DRYA 3G2PA 2VU3A 4NH1A 2ZW9A 3BV3A 5KZIA 2R3QA 2GB4A 5DH3A 3SMQA 5FCDA 2XUUA 4U42A 3RIEA 4BN1A 2J0KA 3T9TA 2PYWA 3KR2A 3UZTA 5DT3A 4RTOA 4OT6A 4G17A 3KR9A 3L9MA 4FYOA 3BE9A 3P2KA 3D94A 5K0NA 2JDOA 5IQIA 4FV7A 4JX7A 4KWPA 5AWMA 2ITZA 1I4WA 4AS0A 4TNDA 2OF4A 5B0XA 4O2PA 3ZYAA 3OWKA 4TWCA 1R0EA 5IEXA 3Q04A 1XDZA 3PG1A 2IPXA 4UWBA 2W05A 2OXTA 4E73A 4QP2A 4ZSLA 4IB3A 4RJ8A 2E9VA 4XHKB 4ZZNA 3VC2A 2HZ4A 3LIJA 2Z7LA 1AV6A 4ACCA 3R9DA 2YITA 2ADMA 2PZIA 3KQOA 3FAAA 3U6IA 3LAUA 3RINA 4II5A 1UU9A 4DA5A 1X1CA 2XIYA 4FEWA 3LFAA 4MIKA 1WZNA 4IM3A 2GFSA 3Q6WA 4HCTA 4PNKA 5KKRC 1SUIA 3EFJA 3R1NA 4HNFA 2EJTA 1RI5A 5BVDA 1WBSA 4P7EA 3OWPA 4ARKA 3KXZA 5CEOA 3PZEA 4MXAA 4RC2A 3THBA 2ETKA 3N4UA 3DLIA 3UO6A 1OL6A 4RX1A 3C0IA 1ERKA 2YFXA 1SQGA 5IPJA 2AC5A 4ZY6A 3WYXA 3PVUA 1Y8CA 2CKOA 4PMSA 3TNHA 5JSMA 3PX3A 2C69A 3B89A 5K5NA 3OZRA 4CLJA 4FVRA 4UY9A 2BAKA 3LFNA 3EMDA 2EXMA 5A46A 1J1BA 4UBAA 3QLFA 4JS8A 4B8LA 2OYRA 5CF6A 4GFOA 1YFLA 4AQCA 5GOZA 3HVJA 4HG2A 5T67A 4YZDA 2IVTA 1MJFA 4HYIA 2QOLA 2YDJA 1OL7A 1YOJA 4JQ8A 4AP7A 4NJ3A 5E8JA 2RL5A 5DSTA 3MHTA 2O3PA 3QCYA 4HNIA 4B6LA 1OBDA 3OW3A 1RJBA 4BDJA 3SRVA 1KE5A 4DTAA 1FOTA 3BPRA 5IMEA 3EOCA 4C4IA 4PL3A 3R8UA 4DLIA 4I21A 4I93A 5P8WA 2PZRA 3KRLA 5F94A 3ZRKA 3KU1A 2PVLA 1JVPP 3UVQA 5EH0A 2ZVJA 1JSTA 2Q83A 2YABA 2W9FB 4BCOA 2HIWA 5CU0A 3EQPA 1AQIA 4A06A 4FV5A 3BEAA 1XTPA 3CVOA 5AP5A 3UBDA 4M7IA 4AG8A 5CZIA 1L3BA 8MHTA 4FTJA 2C47A 4ANMA 3KB7A 1M17A 1YFJA 3V8TA 3D9VA 3TKAA 3QOWA 1B39A 4I0RA 3U8WA 4QP8A 4GOOD 5ACBC 4BCGA 5BMMA 2YDIA 4EOQA 2ITTA 4IHPA 4QMUA 3VS4A 4ZS0A 4YHFA 3TIYA 3D15A 3QKKA 4DGGA 2UW0A 1OKZA 3DA6A 3L1SA 4XX9A 4R1YA 4ER7A 4FIFA 4OW8A 3EVZA 4O7ZA 2PXCA 1NKVA 2PX4A 2W1FA 4XBRA 1XBBA 3ATSA 2QURA 4K6MA 2RG6A 3QL8A 2BR5A 3LMGA 2C5YA 4ANLA 1WAKA 4QRCA 2XMYA 3EL8A 4FT4A 4UALA 5M53A 3KF7A 3HMMA 2CNQA 5FTOA 2IDKA 2JKOA 2XIXA 2PSSA 2VGOA 3II5A 3QRUA 3FYDA 1JSVA 5FDXA 4LRJA 2YR0A 3NCZA 3W8QA 3O50A 4BCHA 3MAGA 3E8DA 4QDKA 1E1VA 2RG5A 3EQFA 1QYRA 1S9IA 1J7LA 3NW5A 4FKGA 3I58A 3SXRA 2HZ0A 5KKRB 3SOCA 3TZ9A 4GRBA 1ZLTA 3E05A 1H07A 2GU8A 1YXVA 4NT4A 1WBNA 4O7LA 3R9HA 2OBJA 1P91A 2NO3A 4YJOA 3K3JA 2B53A 4TNBA 3V6RA 4CRSA 4RC4A 3IYLW 1MQBA 1YWNA 3RJCA 4USFA 5KMMA 3OZ6A 4CQEA 3LKDA 1JBPE 1ZY5A 1YI6A 5FTQA 2C6DA 4C35A 4G6OA 3EN5A 1JSZA 4ASZA 1H27A 4RT7A 5DLYA 4JQ7A 1JQ3A 2EWAA 3GC0A 1AF7A 4RMZA 4MF1A 4AACA 2ITXA 1ZZLA 2GNGA 1ZG3A 5D1HA 3A26A 3O96A 5DVRA 4IAZA 1BL7A 2X7GA 4CCBA 4QMWA 2DPMA 4CXMA 3KULA 5CF4A 3SXFA 1Q3WA 2BR4A 5BW4A 2XNOA 4ENXA 4CSVA 3SQQA 3DS6A 1NV9A 1WBTA 2XCKA 4E30A 2VTOA 2UW8A 3ATTA 1P2AA 3VW6A 4EOIA 3DJ6A 1UKIA 5I9UA 3RAKA 4AX8A 5AAEA 3IO7A 1PYEA 3PJ3A 1JOWB 4GK2A 5EDQA 3KKZA 3Q96A 4GKHA 2BIYA 3F6XA 3IDPA 3D2LA 4YLJA 2UW3A 4S31A 1F5QA 4E4NA 3LSTA 3NUYA 7MHTA 5EZSA 3QQJA 5ICCA 3RWPA 5EYCA 3UYTA 4D58A 4AN2A 3ER9A 2OJFE 4OTWA 2C30A 3QTXA 3R01A 4HYSA 4ITHA 4IX3A 3CBGA 1QPJA 3HMOA 2HY0A 4AT4A 1DL5A 3MTEA 4FNZA 3UA3A 3CJRA 5L8KA 3TUDA 1J91A 2IWIA 3ZUTA 4PWYA 2O0UA 4Z3VA 3GOPA 2P35A 4QPPA 4FG8A 3BZ3A 4IZ5A 3UNZA 5J1WA 3FQSA 3C9WA 4L00A 3GDHA 2VGPA 4PINA 3CP9A 3F66A 2GPHA 4XS2A 3BIZA 1FP2A 4Z7HA 2WB8A 4FKIA 2CSNA 5EIFA 4GYIA 1SM2A 4KABA 3E8EA 2E5WA 1XH4A 4FTAA 3NWBA 3HA8A 5K4IA 2R7BA 3R3HA 1KOBA 2QVSE 4QNAA 2JKMA 4AOJA 2C68A 1KSWA 3CJFA 2JH8A 2IGTA 3OOMA 3SGCA 4DHFA 2O5KA 4UV0A 1ORIA 3R21A 4W8EA 3VUDA 1M52A 3H4JA 3GRRA 3A8XA 3AMAA 3WARA 4RRVA 3KKVA 2K4MA 4CTCA 3A4OX 4A6DA 2EG5A 4I6HA 1YI3A 1XCLA 3EVFA 1GJOA 3MIAA 1Q24A 1NY3A 3KRRA 2X81A 3BLRA 4RWIA 4I4EA 3QRIA 3PE2A 1JWHA 4I41A 4C03A 3RK9A 1OL1A 1QPCA 3UIUA 2X8IA 4PIMA 5F2KA 3ZFXA 4GC5A 3R9RA 3PPZA 4HRAA 2FA2A 2YXLA 1NVQA 4DH1A 1HNNA 2GAFA 3ORPA 3F61A 2X6EA 1SNXA 3KHKA 1RQQA 4YTCA 1CKJA 5DIAA 3DAEA 4JBQA 3VS0A 4BIDA 4TYGA 3BKXA 2BTSA 4PF4A 2KW5A 5A3XA 2P8JA 1GIJA 3WZDA 3C0HA 4FKVA 2O63A 2P7IA 5FBNC 2GDOA 5CY3A 3ZXZA 1P14A 4CWAA 4V0GA 3LDFA 1GZ8A 3RI1A 5FWDA 2WZJA 4FOCA 4J8NA 4RFYA 2EU9A 5E9QA 2QCSA 2VRXA 4YUXA 2XIRA 4UXLA 4J71A 3MH2A 4QTTB 3S3IA 4CRLA 1NV8A 4LOPA 3HP7A 2HENA 4CTKA 3MERA 3KVWA 5HG8A 5L8LA 3AC2A 1XXLA 3ZTXA 4YP8A 4CKBA 5IA0A 5CF8A 5FP6A 3C4WA 3HA6A 3ELDA 4FKOA 4FV8A 5U4XA 5M4UA 4PDOA 3M6VA 4OTGA 5ANGA 4WVLA 4KW7A 1H0VA 5JZNA 4U40A 4FOBA 4YTFA 4DLJA 3IHTA 5CALA 3HAVA 3DMHA 3BELA 3WZJA 3VS6A 4X1OA 4EOMA 5DR2A 2ITQA 3GFEA 1PJKA 2PHKA 4AXAA 2XVAA 1FP1D 4FSNA 2VWUA 4XCUA 3BYUA 5H8GA 4YC3A 3QGYA 4EH8A 5JGDA 4C0TA 4QMVA 4BZDA 4AZSA 4JAIA 3HGKA 3G8AA 4QMXA 4K6ZA 4AN9A 1H4LA 4G2FA 2VUWA 2ERZE 2WQBA 4DT9A 5HBHA 4RG0A 3BYSA 4WBOA 4HVIA 2BAJA 3TG1A 3RNIA 1O6KA 2DQ7X 1UU8A 2GLUA 2WK1A 4WNOA 4NZWB 3IQ7A 3BGQA 4B17A 3WZKA 4O84A 5AEPA 3GU8A 2H1RA 4FEQA 4FX3A 4AA0A 4FV6A 3SVZA 4U41A 4XG3A 2BRHA 2C3LA 2R5TA 5JT2A 5CM2Z 1PMVA 5HD7A 3VF9A 5HI2A 4FVQA 4U0IA 3MI9A 4ANBA 2PUNA 3K5UA 3DXNA 3LFEA 5IA4A 5HE1A 3R7EA 3EMGA 3KXHA 4Y2HA 3DGKA 4JG7A 2I1MA 3LGAA 3A25A 4EH5A 1Q97A 4PQNA 4N70A 4XOYA 5CVDA 5LQCA 4H36A 4NSTA 5IDNA 2AOUA 3IKAA 1J1CA 3ORTA 2XIZA 1KE6A 3QD2B 1W7HA 3MB6A 3MH1A 4GU9A 3A62A 4IIRA 4YZ9A 2C6EA 3NVKI 1VL5A 3NNXA 1OMWA 3VUKA 4A07A 2HWPA 4F6UA 2FRXA 3AXSA 4NM5A 5EZQA 4FEVA 5EKNA 3FJQE 3V97A 3BWMA 5I9YA 4EOOA 3HRCA 3GFWA 4S2ZA 3PVBA 4D1SA 1OGUA 3DJ7A 4WRGA 4QVKA 3LX6A 3EQBA 4RIWA 4EQUA 2ZDUA 3PT9A 3BGIA 1KPIA 2B52A 1UIRA 3MYGA 4WIHA 2ZJWA 3CQUA 3FLYA 1EIZA 5IEYA 2J2IB 5JK3A 2WTKC 1P4FA 2IH2A 4HOKA 4L7FA 4DGNA 5ICEA 4LM5A 2WAJA 3DLSA 3DT1A 3UJDA 1M2PA 4MCVA 1JNKA 4BGGA 3QX4A 1R00A 1W98A 4NIFB 4EK3A 5E9JA 4J99A 4IX6A 4XV3A 2I40A 5KCVA 2CGUA 1KV1A 2V7EA 5M51A 3LXPA 3N4TA 5BYLA 3NTVA 5E2AA 4QQJA 3U9CA 3ERCA 1Q61A 4FIJA 2OY0A 3QRTA 2P55A 4RA4A 3QGWA 2J50A 1V1KA 3WF7A 3MCZA 4KDCA 4Y73A 4RA5A 3HCBA 3FMMA 4BGHA 4G5PA 3R8ZA 3I6UA 4N4SA 2Z6AA 4F0IA 2R2PA 3G5TA 3V8SA 4PRJA 3CE3A 5HBEA 3TTJA 3TZ7A 2AN3A 4S30A 3RTPA 4R6WA 4BP3A 3S68A 2WIPA 5E1SA 2UVXA 1G5SA 2CCHA 3DTWA 2A19B 2Q0NA 3SV0A 3LHDA 2PPQA 2FGIA 3EQCA 1IM8A 3KFAA 3WF8A 3NS9A 5CNNA 4YJRA 3R30A 4BB4A 5CTPA 4JI9A 4OLIA 4DH7A 4HGSA 5IQAA 4AT5A 2WOTA 1MQ4A 4NUSA 1NBHA 4YJNA 4O6LA 2R3LA 4YZNA 4RVGA 2BFXA 4GOLD 2V7AA 5BYZA 2CGWA 5EYKA 5LXMA 4AW5A 1MRUA 3AGMA 4D0XA 2OWBA 3VBTA 4RYLA 4MD7E 4PUZA 5DEWA 3QD0A 4CMUA 4U6RA 4FSZA 3E7PA 3R0QA 4FG9A 3BE2A 5D10A 4C05A 3K54A 4MX9A 3KXXA 4LRMA 4PCLA 4L7SA 5T6BA 3NYOA 2CHLA 4J7BA 4CNHA 2O2UA 1L3IA 2W99B 4QYYA 2B1PA 2A1AB 4HH4A 3GGFA 1XR1A 3P1AA 5BUJA 2OKRA 4OBXA 3NW7A 3P2IA 3DKCA 4ALUA 3ZLSA 2QOCA 3PA4A 4F9CA 3LKZA 5LVPA 2XB7A 4FUXA 5J5SA 5AP0A 3BWCA 2QONA 3F4KA 1CDKA 3P0MA 3G0EA 3HEMA 5DRTA 4Y5QA 2JIUA 3DB8A 3OFKA 3KMUA 2JDTA 4F9WA 3P79A 3FY2A 2W96B 4AA5A 4IWOA 3ELJA 4E5WA 4C04A 3FI8A 1FQ1B 3KL8A 2WHBA 4MNEA 2PX8A 2ERKA 5HX8A 3TNQB 5A4TA 2JHAA 5BVNA 2GTMA 5IZFA 5EYMA 5M55A 4GBED 4X61A 3V51A 4HVHA 3JWGA 4MWHA 3V8WA 2OXDA 3OG7A 3LKMA 4AZFA 2BR3A 5K4JA 4WG5A 4C4AA 3DK6A 4IVCA 2ZBQA 5A6OA 5LMBA 4FKTA 2Y0AA 4QMLA 4TZRA 4FYNA 4ASEA 5E1OA 3FTEA 4A9TA 4RQKA 4MBLA 3FTCA 2ZDTA 5KMJA 5EEHA 2PUPA 4GEOA 3ALNA 3C3YA 3LJ2A 3WZEA 1FINA 4GK4A 4ID7A 2YXEA 1XH8A 3UJAA 5E1EA 5KVAA 3BYOA 2ZSUA 3VRZA 5HU9A 1NVRA 3C6KA 1ZWSA 1V39A 2XYVA 4OTDA 3NAYA 5I9VA 1JSUA 5AX9A 3H10A 3DPKA 3N51A 1X1DA 2UUEA 5J9LA 2IO6A 2XYRA 2YM5A 2G70A 4ER3A 1W0XC 3A99A 4PMPA 3UVRA 4FL3A 4MH7A 4L45A 5GP1A 1ZXEA 1GZOA 4EONA 4IX5A 4DITA 3UC3A 3PY1A 2XCHA 2BM9A 4EYJA 2AOXA 1ZOGA 3KQ7A 2PGXA 5DPVA 3UODA 5HESA 4ZTLA 4TW9A 4FT3A 4B9DA 4M37A 2JDRA 2A4LA 1APME 4L9IA 3G2MA 4WUNA 2QODA 2RFEA 1HMYA 1O54A 2EB2A 3N9XA 4C59A 4I94A 5KQRA 4F1TA 1NW8A 2HTEA 3L9PA 2VO3A 4FKPA 3FKNA 3OU7A 5EK7A 4OX9Y 3BXOA 4EK4A 5FG8A 5IA2A 4PMTA 4ZSEA 1QMZA 4BCKA 2XVMA 4YJVA 5EKOA 3F3TA 3MH0A 1H25A 3QTUA 3BLQA 3COKA 2LGCA 3ROCA 4O6EA 1TW2A 3HVKA 3PY3A 3MQ2A 3FMHA 3PS9A 4FT2A 4L44A 3V5TA 3G5DA 3UZPA 1YXXA 3GRYA 4J97A 5CAOA 3ORHA 5CIYA 5C26A 2PE1A 3LM0A 5JFWA 4IAKA 4RGJA 3HUBA 3WYYA 1YB2A 2UW9A 4DH5A 2ONZA 4X6RA 4LQMA 5ICGA 3LBYA 3ME5A 4O7YA 2PVJA 3FLNC 2KTYA 5M09A 4TYEA 5E8TA 3EVAA 4ZZMA 3WBLA 3EVCA 3NJRA 1PKDA 3SSOA 2FYTA 2VWXA 2I0VA 3OFMA 3T8OA 2FSMX 3IV6A 1EG2A 3QYWA 3UQFA 4FTQA 1OL5A 4IZYA 3A7JA 5KS2A 3ORMA 3SVVA 3KU2A 3G2QA 4PGGA 1F3MC 5HNIX 3MV5A 4X2FA 4EMSA 1P5EA 4O83A 4FE2A 4FIGA 2WMTA 2O64A 4L68A 4BDEA 2CPKE 4MBJA 5FQOA 5J8IA 4BZNA 2BAQA 3SX9A 1PHKA 3OW4A 2P4IA 4QPAA 4HGTA 5EYDA 3KN6A 3BHTA 3DFAA 5FXSA 2ORED 4QTAA 4CKJA 2PTKA 5M44A 3KREA 2XVDA 3WF6A 3MJ2A 4RVTA 1JQEA 2R3GA 1I1NA 5FRIA 2V74B 2J9MA 3QHRA 1PMNA 4CGAA 3QUPA 4K2RA 2YWPA 4F65A 1H1RA 4AFJA 3ACKA 4M12A 5EQPA 3EWHA 3SRVB 1JPAA 3TDVA 2G72A 4E6QA 5EQJB 5DYJA 2P1DA 3PFHA 4E2ZA 3FI4A 5DWQA 1QL6A 1Q0SA 4PP7A 3PJCA 5ANOA 4O7RA 5CQUA 2XNBA 3FI2A 3TKIA 1FJXA 3QTQA 4JXFA 2UZOA 4C36A 4JDIA 1CM8A 4GJ3A 2XYUA 3RK7A 3GGDA 3TV7A 5HIDA 5B2MA 5H3QA 4TYIA 4KBAA 4JRVA 4GIIA 4LV8A 3RPYA 4X41A 4OTRA 2XNNA 3FXWA 4LV5A 4DG0E 3TKHA 2HR1A 5DWRA 5CAPA 3QFVA 4FODA 3NX8A 5FADA 2OSCA 3TFWA 4ZY5A 4CFUA 5K9IA 3KK8A 5J9YA 4BDIA 3DXZA 4FMQA 5D11A 1CKPA 2IG7A 3IW4A 3CTJA 2FSTX 3NGAA 3Q52A 3OMVA 3P97A 5K0LA 2C5VA 3COMA 3K2LA 1G60A 4F4PA 2YCQA 2C7RA 3VO3A 5CVEA 3AC5A 1U4DA 2ZFUA 2YHVA 2PZPA 4Z16A 4O7WA 3IW8A 2FB8A 4W8DA 4BDCA 4TL0A 4DINA 5HCZA 3NW9A 1WBWA 2JG3A 3SD0A 1OITA 5E8XA 4M13A 3DTCA 4ZSAA 4BDGA 5EC8A 5AM6A 2GHMA 1XH7A 2UZTA 4L7VA 3TZ8A 3NYVA 1OVEA 4O86A 4CZTA 1JSXA 4KIOA 4PYMA 3VHEA 2VWVA 2YCSA 2G01A 4M3QA 4XUFA 3E92A 1UU7A 2X4FA 5JEBA 3QBNA 4TYHA 4C2WA 2KULA 3ZS5A 4BIEA 4ZTRA 4FTNA 3X0DA 1EAMA 1F38A 2OW3A 2CNUA 5HORA 4CFVA 3P9NA 5LVOA 3GB2A 1BYGA 3UO4A 2QYOA 3GCPA 4O82A 4GQBA 4MK0A 4I1ZA 4LFIA 5IH4A 3FUTA 4YMJA 5M07A 4DZRA 4MNFA 5FDPA 4FV2A 3MSSA 3VIDA 1OECA 3EJ1A 5CXZA 5ERGB 4Y85A 3U6HA 4KKGA 4KDRA 4OQEA 5HZMA 4F6WA 5CX9A 3NIEA 5EG5A 3VNTA 4KKHA 3S1HA 4FGBA 5ANEA 5KMKA 5EKXA 4FSWA 2J6MA 1Q5KA 3GENA 2O07A 4EH9A 4KIFA 5E90A 3UJ6A 3F3WA 2ITUA 3ETAA 3DNEA 5HVJA 2X7OA 3UOKA 3GNIB 4ZIMA 3KULB 3VJNA 4D9UA 4O22A 3PLSA 4TT7A 2CN8A 1PXMA 4TWOA 2GNLA 5KQSA 1V0OA 5HEZA 3OFJA 5M4IA 3WE4A 3UJ8A 4E32A 4IB5A 2JIIA 2YCRA 3AOXA 4L3PA 5IDPA 3HV4A 1WS6A 1FGKA 3QCXA 5KO1A 4DQ0A 3AC4A 5FTWA 1OBGA 2XF0A 4U81A 3U4WA 2REIA 3S4QA 4LG1A 2CDZA 1SUSA 2W1CA 4BVUA 2YM7A 4E7WA 3ELWA 2B9EA 4LUDA 2CLQA 4R77A 5AAGA 3CPBA 4U97A 2VO0A 4CXAA 4F7SA 4I23A 3ZSIA 4O0TA 3Q2JA 3MTFA 2R7IA 3FC2A 3I5NA 4YBKA 5E8SA 2YQZA 5CANA 3QUDA 3UOLA 1O9UA 1UVRA 2AN4A 3DU8A 5HVYA 2PSQA 4RIXA 3I5ZA 4O0VA 2XK6A 4YV1A 4P2KA 4NYEA 3R8VA 3TKYA 2WA1A 5EOBA 1Q8WA 3L8SA 3I64A 5IF1A 2IFTA 4YHJA 4EORA 5EPEA 4UX9A 2ZV8A 3PIXA 3KRWA 3DXPA 3LM5A 5JFSA 3EGVA 3NNVA 3D5VA 4YGAA 1UWHA 4P7FA 4PTCA 1DAYA 2O06A 4POOA 2ERCA 3W2SA 2F4JA 1AQ1A 3BGPA 1PXLA 3UA4A 4K8AA 4JVGA 2VZ6A 3WZUA 2G8NA 5HLPA 4FV0A 4C02A 3F88A 4CEGA 3FMNA 3TM0A 2XP2A 4ZTQA 2Y7JA 2C6MA 4M67A 1P4OA 4I6QA 5ANJA 5DT0A 3VS3A 3NWEA 1H1WA 4RTPA 4LECA 4HTFA 2OJ9A 3UP2A 3BCEA 3M33A 2BRBA 4BCMA 4DT8A 2GNIA 1UV5A 3NPCA 3T9IA 5CT7A 5HBJA 4NKSA 3SGLA 3V8VA 4C3FA 3CLYA 3QA8A 3PSCA 4QO9A 3QRJA 4UN0C 1TQPA 2XRWA 4HZSA 3ZHPC 2EVAA 3QTIA 3WF9A 3PSBA 3P78A 3G51A 4EH2A 2B25A 3CPCA 3MFSA 4DEAA 5AP4A 1CKIA 3R00A 3R9OA 5HNGA 4IANA 4DE4A 2X9EA 3BHUA 1AGWA 4ACDA 1QZZA 3REPA 2XNEA 5HTBA 2YM8A 2XKFA 2ZLBA 2HCKA 3Q4CA 4EUUA 3FBVA 2GFCA 3P7CA 3G90X 1M0EA 3ZM4A 2G2IA 5CU4A 4JJRA 4JIKA 3CTHA 3QAME 3ZC6A 3DKFA 3I6WA 3IOKA 4IACA 3G89A 4NM0A 5IQCA 4CLIA 3THRA 4L3LA 4JDKA 2C4GA 3MFUA 3EHAA 4IFCA 2A2AA 3OP5A 2UZDA 2BZJA 1RJEA 2W4OA 3SAYA 5BPYA 3EZVA 1LPUA 3UGCA 4BHNA 3LPMA 4C33A 2OPBA 3HTXA 1JG1A 4V0GB 2BZGA 3POOA 2QO9A 3ZU7A 1JG4A 3EKNA 2WMUA 3AC1A 4E2YA 3SX0A 2W1HA 4O29A 2PE0A 4RTJA 4EI4A 2F7ZE 5K05A 3KPVA 3CCFA 5K0GA 3NSZA 3P9KA 3OHTA 1JKLA 3R6XA 3C7QA 4YMGA 4EKIA 2RF9A 4RWLA 1UFKA 4EH6A 4PYLA 4ATNA 4EK9A 5K03A 2XJ2A 2HK5A 4E2WA 3R8MA 1WFCA 5JUWA 2G2FA 4YTHA 2W17A 4E20A 3MGGA 4KNBA 4FT0A 5TR6A 2P3GX 4G3GA 4ACHA 4QYFA 2JHCA 2E2BA 5HLNA 4O0YA 4ZZOA 3LQ8A 3FRIA 3PY0A 2B4SB 4YJSA 4RVLA 2QOKA 5CUQA 2ZB1A 3BV2A 2WTDA 5K0CA 1PRYA 4F84A 2W1ZA 4X0MA 2IZSA 2BILB 2I9KA 4QP3A 3UO5A 4FKJA 4R7IA 2J5FA 4OTIA 4QYHA 4EOKA 3PJ8A 3F5PA 2Y1XA 1ZMWA 4JG8A 3TZMA 4I5PA 4XUEA 1WG8A 1JR4A 2I62A 4QYEA 5DG5A 2OXYA 4DBXA 3B7PA 2YM6A 2WQEA 2GPYA 3FLSA 4UWYA 2YWVA 4IWNA 2VX0A 2G1PA 5AUZA 1YDRE 3NYXA 4GV1A 2R6ZA 3TM4A 3TUBA 5EW8A 5EEGA 5HE0A 1WBVA 3Q4ZA 4XG7A 1NBIA 3UMWA 2ZV7A 5EMLA 2LD4A 4P7KA 2W5AA 4DF3A 3UFBA 3QHWA 3AT3A 4QTCA 2H9VA 2CGVA 4EJ7A 1KUTA 1OKWA 4HVDA 2QM3A 3UP7A 3BRBA 1DI9A 3UWPA 1XH9A 3KQSA 4EC8A 5B7VA 4C38A 3BGDA 4S34A 4AOIA 3UJBA 4X21A 4IAYA 1NA7A 4PIPA 3A60A 4PTEA 3GU5A 2JIVA 3O23A 4HW7A 5GNKA 4KINA 3FC1X 3DOUA 3GU6A 1JG3A 3HA7A 4X3FA 4BCPA 1U2ZA 4IM2A 3LBFA 2QOHA 4RIYA 3TACA 3LCCA 2AOUB 3LCOA 3LCKA 2C6KA 2OH0E 3NDMA 1XHAA 4KBKA 1TQMA 3WE8A 1DAWA 3A4PA 2EFJA 3OEZA 4FZDB 4J1RA 4MXYA 4RWZA 2ZV9A 5F2NA 5FA8A 1PXJA 4XRLA 5CI6A 4GT4A 2V5QA 3TTIA 4PV0A 3LMIA 3VC4A 1EJ6A 2IDJA 2VP3A 2YJRA 4RIWB 1HOWA 3GJYA 3Q9WA 1YUBA 3MTLA 4V0RA 5BP7A 3OZSA 4L53A 2GA9A 2PVHA 1DCTA 4GOMD 3DDPA 1YHVA 4BC6A 5L6OA 3G7UA 3DK3A 4IWQA 4DFLA 3HVIA 4U3ZA 4HZRA 2W06A 4YU2A 4ISCA 4IAFA 3FPGA 3VAPA 5LQUA 3LLAA 2IVUA 3E7OA 5HQ0A 5KBRA 2PVCA 3QD3A 4O0SA 5HFJA 2VX1A 2YZAA 1GAGA 2PZYA 3W2CA 4L42A 5KMIA 4FNXA 4FTCA 3DB6A 5TKDA 2ZWAA 4DEDA 4QVGA 2BH2A 3BT7A 2PMNX 3PDTA 1JTEA 4BLWA 3KQTA 3FQHA 1MUOA 4O0WA 4BHZA 5AADA 4XUDA 2PMIA 3JYAA 5CU2A 4P7GA 5J95A 4I3ZA 4CVAA 2YM4A 2G9XA 4XH6A 4YBJA 4U79A 1E1XA 3ELYA 3MY1A 4C3RA 4CT2A 5CVJA 5A6NA 4G3DA 3NWWA 2GSFA 4FV9A 2OI4X 3BHVA 5DOSA 4XG6A 3HDMA 2QY6A 4FL2A 4FT7A 5FUTA 3TJCA 3LFSA 3NRMA 3QQLA 5HICA 4EYMA 2R64A 4QP7A 1XDUA 4UXQA 3LMHA 4UB7A 5KBQA 4PY1A 3ERKA 4G6LA 4NFMA 5I0BA 4PWNA 2YERA 1IR3A 3TCPA 5J87A 1Y6BA 5I9XA 3SC1A 5FBOA 3ZUVA 4GUAA 3CCNA 1PW2A 3NEWA 4G3EA 3VBXA 2R3HA 3FPMA 3BWFA 3ENHA 4YUWA 4CKIA 3EEOA 3D2IA 5EM7A 3Q53A 3F9NA 3BWBA 4AE9A 5HEKA 3I81A 5ANKA 3V3VA 1NVSA 1DI8A 3D2KA 1M6YA 3EVEA 4RTLA 3HNRA 5CU3A 3KR1A 4WXHA 3ODZX 2QLUA 1UWJA 5KZ0A 4UOEA 3DK7A 3EMBA 2NRUA 3C0KA 3O8PA 2ESMA 4QP4A 5K5XA 3PVGA 5DE2A 4NCTA 2IZUA 3CQWA 3GQLA 2PUUA 3Q32A 3P23A 3U81A 2IN6A 5FP5A 5LQRA 5CD1A 4MNEB 5DA3A 2WMSA 3FYKX 3FQEA 4Y8DA 4DCAA 1I9GA 4LWPA 3NNUA 3IW6A 2PE2A 2OB2A 4MXXA 4PYKA 4IVBA 1Y6AA 4QMSA 1H1PA 3C4FA 4GS6A 1VYWA 1BKXA 3FMEA 2AOTA 3CTQA 3VBYA 2W1DA 5DPMA 1BMKA 1OUKA 2IJMA 3WI6A 3UZUA 2YN8A 2NNWB 2XIKA 3C4XA 4LMNA 5KNJA 4GU6A 2UW7A 1IAHA 3RKBA 1YXUA 4Z2YA 2NP6A 2AVDA 5AV3A 3OCGA 3D5WA 2E9OA 3FUXA 4JQEA 3AMBA 2F57A 3UDBA 4DYMA 1Y91A 2VX3A 3NZ0A 4ZMEA 3DOGA 1XQZA 2YZLA 5FEEA 2YCFA 3Q3BA 2CKQA 3S95A 5CYIA 4NFNA 2YVLA 3T7RA 4IC7A 4DCGA 2ZMDA 1TQIA 3PXZA 4EZ7A 5E1MA 4RTQA 3A27A 5EG3A 2WMRA 4QP9A 1YOMA 2C0IA 1PMUA 4H3PA 5DM1A 4FV3A 4RJ6A 3KEXA 3G9NA 1R18A 2XKDA 4HGYA 3B8RA 2JEDA 4KIGA 4XJ0A 2YXDA 5J1VA 4J98A 5HLWA 4X7QA 2B78A 3P5KA 3RZBA 4DGLC 5E2BA 3DCVA 3T7TA 2R3KA 4G3FA 4DCMA 4D9TA 4FIIA 3DY7A 4TRLA 3RP9A 3H2BA 4XUCA 5IKMA 5DX1A 3LFQA 4ERWA 5F2OA 2R3JA 5HCYA 3G9LX 5LQAA 3EFWA 3PP1A 3K3IA 3P8ZA 4L46A 4APCA 1OM1A 2ACXA 2XNGA 4YJPA 5L2IA 1G55A 2GS2A 4DEGA 5G1XA 3EL7A 3DTNA 2UYCA 1RI2A 1Q3DA 4BCJA 2X2KA 2JAVA 2X4ZA 1M14A 5TO8A 4MYGA 3BBTB 4QMOA 4Z55A 2IZRA 4F08A 4RX8A 4EKGA 1YW2A 1J7UA 3R63A 4DCEA 5DRDA 2GS9A 3ZDIA 4K11A 4M97A 2YDKA 4QPNA 5DM0A 3BQRA 3HM2A 2PV0A 2G1TA 2VNYA 4GC9A 3PG3A 3KQWA 1A48A 5CVFA 1R78A 4OA8A 4FSTA 4D5HA 3GU7A 3UE4A 1ZHFA 3L8VA 4RVMA 3D83A 5CAQA 2BDJA 2JJQA 3GCQA 5KHWA 2WTIA 4NM3A 3I4BA 1IEPA 2GQSA 3PSDA 3TV4A 2F7XE 2J0LA 5IA5A 3ZC5A 2QRVA 3RCDA 3EGEA 3AT2A 4KSPA 2H96A 3UJ9A 4YHTA 3JUHA 4R8RA 2P7HA 5HIJA 3ZSHA 2P33A 4MXOA 1WY7A 5AUXA 1L9KA 1JAMA 4M68A 4FR4A 4BICA 3G33A 3L8PA 2F2UA 3DNDA 4QMZA 3DDQA 3C6MA 1VP3A 4AUKA 4BIBA 5ITAA 4R5YA 5C8NA 4R7HA 3UNJA 4NKAA 4E5BA 3FI3A 3GUBA 2OH4A 3QF9A 2WD1A 4CZUA 1WVWA 4X2NA 1ZY4A 4HGZA 3QQKA 3SW4A 1YKRA 3GXOA 4F70A 3ORLA 2JD5A 3Q9YA 2VTJA 3P71T 3KMMA 3ZEWA 2PX2A 3H9RA 5CCBA 2XK3A 4FEUA 4RWJA 4WBBB 4A4LA 2R3MA 3O7WA 3TPZA 3KK9A 5E8YA 3HVHA 3VBVA 3CD8A 2A27A 5HG5A 2OIDA 3R1QA 4IC8A 4ZSGA 4OT5A 4EWHA 5GIPE 3ZZWA 2FUMA 3I53A 2WQOA 4NECA 2Z7SA 4QMTA 2XK7A 2BMCA 5KE0A 4KS8A 1U46A 5EDRA 3SKCA 4EZ3A 5BUEA 2B3TA 3E8SA 4UWCA 2OJGA 2WO6A 4C07A 5EM8A 4G9RA 4AWIA 3HMIA 5DT2A 4EH3A 2AN5A 4EBVA 3I0QA 4H3QA 1WCCA 3LCDA 3R04A 5D7VA 3KXGA 3O8TA 3VUHA 4FZVA 4BDBA 2BPMA 2Y9QA 3ULIA 1X8BA 3FLQA 3DKOA 2CCIA 4O7NA 3R2YA 4HGLA 4GSBA 3V6SA 4YUQA 4YV2A 4QP1A 2R0UA 3PVWA 5FQDC 2OIBA 4FGZA 3DV3A 1IXKA 5HG9A 4QMQA 2HOGA 4LGGA 1N2XA 2C6TA 3JPVA 4BCIA 4NU1A 3KRXA 5CSXA 1FVVA 4TYHB 5EMKA 5IUIA 3MESA 4CKRA 3DAJA 4OGRA 2ETMA 2WTCA 2XBJA 2C1AA 2ZBRA 2IZTA 4P5ZA 4IWDA 5LMKC 5IQBA 4BI2A 5ACKA 4X3JA 5CXHA 4WUAA 2XS0A 4JAJA 4AGDA 2QR7A 3O0GA 1KV2A 2BIKB 3G15A 4NL0A 4G16A 3E62A 2WGJA 3PIYA 4I0SA 1NE2A 4FICA 4D55A 3C50A 4B99A 4DGOA 1RJFA 4BF2A 5CSVA 2VTHA 4ZOGA 2H11A 3B2WA 4YSMA 2AC3A 3OBJA 3F7ZA 2XK9A 5CCXA 4CKCA 5EIWA 4ZLZA 5AUUA 5EW3A 3GP0A 3EH9A 5IH6A 3BGVA 4EBWA 2N47A 3QTZA 3RM7A 2PXAA 5BVEA 3C5UA 3GT8A 5CVHA 5FEQA 2XYQA 5IQDA 3HCEA 3IK3A 3FL5A 4BDDA 4K1BA 3EVGA 3ANRA 4R6VA 4U9AA 3GNLA 2IP2A 3NW6A 4Q2AA 3OBGA 1VPTA 2EJUA 1QAQA 4CFFA 3HYHA 4JIAA 5CT0A 3G8BA 2ONLC 2C3KA 3OVVA 3HCDA 3ELUA 5C4KA 4R7BA 3QOXA 3FZRA 5C03A 3EIDA 3BX5A 4GIHA 1OKVA 4YTIA 4I22A 3R8PA 4FT9A 3UPZA 5AV1A 3QV2A 1XJ5A 2WEVA 4MXCA 1UNGA 3W33A 4LL0A 5AA8A 2UW6A 1PXNA 4TXCA 2C0OA 3LPBA 2WQNA 1YZ3A 2J0JA 3LCUA 2QOOA 3I7CA 2H34A 5LQKA 1H00A 1P1CA 5LJJA 3VQHA 5I5ZA 2X9FA 2ZV2A 3PWYA 3SM3A 4AW1A 2NP7A 4B7TA 4AW0A 4L8MA 3HAMA 5EVJA 2ZM1A 3W8LA 4AZWA 4IV8A 3ZFMA 3E8CA 4RIXB 1SVHA 3HVCA 3H9FA 5L3AA 4BR3A 3MB7A 4KRCA 5GM2A 4E1ZA 1KPGA 3LQ3A 1H1DA 1EQAA 3TR6A 1VLMA 2BHEA 1VE3A 2P3QA 4FTMA 3EFKA 4DG3E 3MW1A 3PFQA 3FUWA 5T6KA 3U6JA 3LECA 3GRUA 1U54A 4FSMA 5M57A 4MWZA 3QCQA 4AE6A 2W4JA 4GEKA 4FEXA 3SXSA 4ERKA 1WBOA 3NVMB 3WF5A 4GG7A 3KMWA 1FPUA 5EHGA 3QC9A 3S00A 3RW9A 3PX2A 3CEKA 3NUAA 1FMKA 4I5MA 4DEHA 3KQVA 4F99A 3EVBA 3MPAA 4RC3A 3MH3A 4CCUA 3ZLXA 5BVWA 5E9WA 5FA5A 2Z6QA 5A4LA 5DHJA 2I6GA 4HTFB 3T3VA 3HV6A 4K9YA 5E92A 3QQUA 4YSJA 4M84A 3EYGA 3OCBA 3GXLA 2WMWA 3GBZA 3FSFA 1N7JA 3BKBA 4BBMA 3C0GA 3H0YA 2SRCA 5LCKA 2WELA 5C27A 1TW3A 4IKPA 5M4CA 4U45A 3ID6C 2Q0BA 2JITA 4ANSA 3FEGA 2VO6A 3R8LA 4GVAA 3PE1A 2PU8A 4H1JA 2OO3A 1KE7A 3BBWA 5E4HA 1Q8YA 4D4SA 2C7PA 2YISA 4H58A 5FGKA 5KYGA 5CWZA 3L9LA 4PNEA 2JH9A 3AXTA 4AUAA 4O96A 2WU6A 2FPOA 4IEBA 5K0BA 3ZSGA 2PXXA 3CXWA 3IECA 2UZNA 5TT7A 1UNLA 3KCFA 3R83A 4AZEA 3RODA 3KN5A 2Y8OA 4ONAA 1UWVA 5E8VA 3OXIA 1ZZ2A 1O9HA 4C7TA 2VZ9A 3C51A 3P9CA 2HWKA 5EI6A 4KIQA 2V22A 5C1IA 4FKSA 1M2QA 3ROYA 3FMDA 1JKKA 4JBPA 4X2JA 2OKCA 1BI7A 3SDJA 3A7HA 1VP9A 3MIYA 1VIDA 5DRBA 5HHWA 3CGFA 3AD5A 5GM1A 3CJGA 3OCTA 4AW2A 2OJIA 3R7OA 4UYAA 2DYLA 1JQHA 3RK5A 5AP7A 2PBFA 4ZLOA 3MA6A 4XG4A 1SMHA 1G3NA 4MQ2A 2XYNA 2GNJA 5AUVA 1UU3A 4BYJA 1W83A 3I5UA 3QRKA 3NYNA 5A4CA 3MTIA 2RGPA 1G8SA 1URWA 3EEYA 5DM4A 3CC8A 1EH4A 3W2RA 3LFDA 2FYSA 3RWQA 4KBCA 3FXZA 2O8YA 3DQWA 4LUEA 4D4YA 1QANA 4CD0A 4GFGA 3OWJA 2ZIFA 4IB0A 2JDSA 3BGZA 3TQSA 4KAOA 4E93A 4BY9E 3Q5ZA 4IE9A 3SG8A 4O7SA 1H08A 4QTBA 4XMOA 1A9UA 3TUCA 3NR9A 3UYSA 4S32A 3BKWA 3PXRA 3LDUA 4ZEGA 3CD3A 2IVVA 5LQFA 1FBNA 2OZOA 3U4UA 4JLCA 4KSQA 1UA2A 3N4VA 5EMJA 3KPJA 3FPQA 3UIBA 2YACA 2B2CA 4FI1A 1MRVA 3KQMA 2UYOA 4EUTA 1KE9A 3LVPA 2C6OA 1B6CB 2OGVA 4KRDA 3OROA 3ER8A 2VTSA 4K0YA 2UVZA 3ORIA 4NTSA 2F9GA 4FZAB 4TKSA 5EFQA 3HCCA 5D12A 3ANQA 5EQYA 3H9OA 4LI5A 4NK9A 2UZWE 5DTRA 2XBAA 2ESRA 3OY1A 5M06A 1JLUE 5F9EA 5GWXA 3JVSA 4O0RA 4A9RA 2P40A 3E63A 2NRYA 4Y5HA 4DMGA 2DULA 3BU6A 4X60A 1M7NA 4I5CA 1D2GA 1Y8GA 3P2EA 3RVGA 2O57A 4RVKA 1VZOA 4GT3A 3OU6A 4UZHA 5LQJA 4TWPA 3M4XA 1QCFA 5DXAA 3EN4A 5HCXA 5AV2A 3HP5A 4IBMA 3TOSA 3ZUUA 4X3FB 2YA9A 4ZXTA 4TPTA 4FA2A 4RIYB 3A7FA 5GJFA 1WXXA 5JQ8A 2PVMA 4PYQA 1J3HA 4A9UA 4YJUA 4KRGA 4D2RA 2BHHA 3O4FA 2JGZA 2IW6A 3TDWA 3HX4A 2E9NA 4XV2A 4LG4A 2AYPA 2C7OA 4XP2A 5L8JA 4FIHA 3P4KA 2P2HA 3ENMA 4NCTC 4O21A 4LWOA 1STCE 4V01A 3THSA 3PPJA 4WNKA 2WMQA 4JDHA 3MGYA 5LVLA 2BCJA 1WZYA 1XBCA 4PDPA 1NXKA 2UYHA 4QQTA 1X1BA 3TL8A 3R7VA 5CF5A 5CVUA 1NT2A 2B9JA 3EKKA 4PL4A 4E70A 4F09A 2Q41A 4V05A 4ZMFA 5FLFA 1IAJA 4DEEA 5JFVA 2I0YA 2GS7A 1YVJA 3F2RA 2X7FA 3UMXA 1Z57A 4FSXA 1H24A 3PTGA 3CQEA 3R0TA 2CKDA 4TWNA 4D4RA 3DBCA 2ITPA 4DFUA 4K77A 5GHVA 3BYMA 4RTNA 3E87A 2JBPA 4MD8E 4QMYA 4R6XA 3GCVA 4USEA 3OC1A 4YJTA 4LYNA 4ZP5A 4R5SA 4EHZA 4XNEA 4IM0A 5FHRA 5H9BA 4BCFA 5A4QA 1M2RA 1R39A 3UIMA 3FPEA 2I0HA 2FVDA 4OQDA 1SQFA 3F2AA 3IGGA 5LARA 3OY3A 4FBXA
chains in the Genus database with same CATH superfamily
1VYTA 5CEPA 1SJ9A 2PX5A 1VDMA 3OWLA 1JN0A 4KK4A 2V9ZA 2GH1A 1IZ8A 5K3FB 4H0NA 3KGAA 4R3CA 4Z4IA 5A5FA 1Z6ZA 2BJHA 5F4NA 3GJ0A 4WZ6A 1K2PA 4RX5A 2OAGA 4QU5A 2WTXA 3IBTA 4QXQA 4FNGA 3M82A 3V00A 1RHRA 3KTDA 5F35A 5AJTA 2VSXA 4OCZA 3MFTA 4EI8A 3F3VA 2LWIA 4FC0A 1I5RA 3F3YA 3QY9A 4PHFA 4DA7A 1BA3A 1Z6PA 4E5PA 3ZDXB 4DMFA 1F1JA 3R3VA 4DUPA 2IW9A 1FDUA 4YFYA 4DVGA 1N5LA 4XJSA 2NUBA 5B1HA 3WK6A 4TYMA 3VBQA 1TUGA 3FZPA 4Z4FA 3SBDA 3A9WA 2H0QA 3O2JA 5CI7A 2NZ8A 3LFCA 3EQ9A 4IEEA 4BKJA 2J3DA 2OSVA 2NV6A 5BWCA 5B6JA 5L2SA 1POXA 3Q8XB 5I48A 3LXKA 1CSNA 1X8XA 2HIGA 3FWHA 3COIA 2ZRFA 2XTAA 4BGQA 1G1MA 3OUNB 5GINE 4YAWA 2IRWA 4YFVA 5HD4A 1AMOA 3OEWA 1SZMA 1QIIA 1PP4A 3ZVKA 4PO1A 2R3OA 3WIKA 3NV9A 3MOIA 1Z4OA 1W84A 1OIUA 4GP7A 2Z83A 3VVHA 1YCDA 1KI6B 4RDXA 4G56A 3CUTA 1G291 4MR8B 4KTTE 1Z2PX 1XVLA 2Z1NA 4CTJA 4V0OA 2OLKA 4U5JA 1GYPA 3SVLA 2PWLA 5AM1A 2WLTA 3PFWO 4IJUA 1REQA 3R9KA 3DE2X 4YMHA 3L07A 4EG1A 2WNHA 2AYZA 3AEKA 1J2RA 3EQRA 4Q3CA 3RALA 4TL9A 2Y92A 2ZSHA 4B5KA 2ARKA 5D1JA 3JQ9C 3EG5A 2DRIA 4B8ZA 3GLGA 1FEZA 3IDQA 2R9SA 2ZCJA 5EXPA 1MQAA 3NCGA 3OLCX 4N5NA 3CLVA 3WL5A 2Y2VA 4JNWA 3TJDA 2Y0BA 3NRJA 4B44A 2PFKA 3FXXA 4B34A 2IZZA 4N0PA 1R0CA 3LTEA 3IPLA 1FP7A 1AJEA 1YQJA 4ACAA 1SHTX 1QM5A 3N0XA 3Q4TA 3OA0A 4G36A 4YLLA 3T5PA 4DA4A 1JMKC 1EEHA 3ZDUA 1SC6A 3KC2A 4JVLA 3VJLA 1PUJA 1Q21A 3WRYC 3D6FA 1RI1A 1SCBA 4HB0A 4A9SA 5JH6A 4YZBA 2X7HA 3OURA 1V4BA 1TVOA 1A2BA 2IYLD 4C4HA 1TT5B 5HQJA 2YY5A 2ZB0A 3EBPA 3LA8A 3GG2A 5TMPA 1XF1A 3GRAA 1ST3A 4MRNA 5B2KA 5IFLA 3EDQA 4IIJA 1GT91 1QRRA 2F59A 5AV0A 3DLPX 4LX0A 4M8NE 5DTQA 1WZCA 2BDFA 4YR8A 4RTRA 1HG0A 5IVDA 2XKCA 3MS7A 4CV8A 2CL6X 4DG5A 4E5UA 3QNWA 3LOQA 1CR2A 3MLEA 1Z9XA 4M1WA 4Q1VA 2GAJA 3FYCA 4A23A 1YVDA 1JMVA 4F9TA 1FX0B 3ZONA 2GAAA 4F5WA 3R5SA 4LC0A 2XT6A 3AR4A 4FJVA 3QA0A 1VE7A 4KR3A 9MHTA 3NHUA 1IHOA 5I9WA 5HQ3A 3VS1A 4K33A 4AJIA 2GCNA 5DYIA 4K8RB 3LT4A 5EM5A 1ETUA 4HBZA 1FFSA 3UC9A 4FSYA 3A05A 1P61B 2A5DA 1H01A 4UM7A 5DHTA 1KORA 3I92A 1YDEA 4Q16A 5EFOA 5I51A 2NV2B 2E9SA 1NJ8A 4P3XA 3RM6A 3C85A 3OAAA 4E13A 2CMWA 3HQ4O 3DMGA 2NUPB 2P9YA 4JR3A 1YAHA 4Q3BA 5D7BA 2E2WA 3HSSA 4M8TA 1A82A 3RFCA 3TV6A 5HM6A 5EFZA 4YC6A 3NC1C 4TLDA 1RHUA 2DQYA 1A95A 1XZQA 3OPYI 2NVUB 3M2TA 1DBVO 3FZOA 3C1XA 1NTOA 4F3YA 1YT5A 5IMXA 1ESNA 1QGYA 4HHEA 3HRFA 1W36C 1W4BA 4M0DA 1GQOA 4U44A 1WUIS 1YMUA 5LZ4A 4RLLA 3RYTC 3UAVA 1TKIA 2R5NA 4MKFA 3LZ6A 1SKMA 3WISA 1CXZA 3DHWC 3MFRA 3QVLA 2QJTA 3ZWDA 2C3MA 1XH6A 1WABA 4FW9A 5LQMA 1R8QA 3SSMA 4P0PB 4FSDA 5AQ1A 1VKNA 2JFBA 1QXSA 5IU2A 1I09A 4YECA 2R3FA 3DWFA 3G88A 5AXDA 1FDVA 4CR7A 2NMVA 2I6LA 3U6BA 3NAZA 2WUVA 4YN3A 1VJDA 3FPJA 3W55A 1JHAA 4GUEA 2A78A 5H3HA 2D5LA 2IEZA 4F9GA 2AMYA 2EL9A 3D1LA 4P4LA 3ECCA 3AF6A 2Q45A 3PB3A 3ZQKA 3C7CB 2OVBA 3VZRA 4XA8A 3WYNA 1KZHA 5CB4F 2OFXA 5A4EA 2XGSA 4HYHA 1I0LA 4R0NA 2P3LA 5AVOA 2OILA 2O8VA 1N6HA 3MTDA 2HT1A 2XSZD 1DIBA 4UNPA 1YDTE 3JY6A 4ZCQA 3ZO1A 1JIQA 1KEZA 1YU9A 3MBLA 4HVAA 2WF5A 2HMTA 1YTLA 5FPSA 2WTVA 4WG3A 2AUNA 2JIBA 4RVUA 5C81A 3U7QB 3JWHA 4XOIA 3FFTA 5DSXA 3EGDB 4ASDA 2A88A 3OXTA 4F71A 5KJCA 4ITIA 1KEEB 3E6AA 5TNXA 5K7SA 4AO6A 4JP1A 2GASA 1B00A 4PAGA 5JMOA 3LHJA 2QX6A 5I9IA 1IDOA 4RWKA 821PA 2VDVE 4B3GA 2J0UB 3FL4A 1DKLA 2VSQA 4LHVA 4RX7A 1V0BA 4YCMA 2FSUA 2C9MA 1MNAA 2X5KO 1JEJA 5BT9A 4MKGA 3GK3A 3FSKA 3CZQA 5BNJA 4RL4A 3AMYA 3EQIA 4GH5A 1EVQA 5CDYA 1KYWA 3SEFA 2CKEA 4QQNA 1ZMXA 4I1UA 1O94C 3W4IA 3OJFA 4IDVA 1AZWA 1UAGA 5LDHA 3MWEB 4EFKA 4XLVA 4O33A 3EXEB 2JAUA 2WJJA 4LYFA 3NDPA 4X9XA 5IT4A 1E7MA 5I5GA 1YACA 4HDNA 3F2NA 1MABB 4F4UA 3QIVA 1P7ZA 3VNAA 2J0MB 4FTKA 3M6FA 5FOTA 5FORA 3C6BA 1XJDA 3HV5A 4O8ZA 2I6TA 1A8PA 2GM3A 2CZQA 4FKUA 2PGJA 1SVEA 4YUYA 1UJ6A 1VR2A 5IH5A 1ZNXA 2XQVA 4FL1A 1QH9A 1O4WA 1P6XA 2NXNA 4G9CA 2BISA 3ES9A 1RRPA 4R9SA 4FGLA 3K9BA 4ZT2A 1DWQA 4TZTA 3EQZA 1UJCA 3L7AA 4DDGA 4J95A 3P5BA 4PTGA 3BK7A 1I2BA 2GI4A 2IEYA 1EFUA 1XB2A 4CQLA 5MHTA 5KOJB 1OROA 3SS7X 3WLLA 1X9HA 1J24A 3DR5A 3HLTA 2BRMA 4C4XA 4DDUA 5BVFA 3G8YA 4O3MA 4AN0A 4RJ5A 3RV3A 1WMBA 2V97A 5D9HA 4P5DA 1E3DA 4LYAA 4R41A 5D84A 3W0LB 3QSGA 1GCUA 3PUPA 5CNOA 3HBLA 3ZEAA 2FN4A 1RYBA 4QNYA 3ZXXA 2FLVA 2VNSA 2AUHA 5LZ8A 4EHBA 3EZ6A 1M72A 1C8VB 4YRGA 3HH8A 1DS5A 4MRRA 3S28A 1BOOA 1YKSA 4RM3A 2C82A 3WGIA 3UDTA 3RSQA 1GOTA 1BFUA 1L7XA 2IU4A 2E4UA 4NOMA 2QD2A 2C5XA 2BUCA 1K9AA 3BRWD 3IHWA 3JD0A 1TAHA 5EJMA 2GX6A 1M83A 1GSIA 2WJ3A 4MS3B 1QG6A 2IEIA 1PD1A 3SA0A 2WIHA 1F2UA 3ZC3A 3G6GA 3D0RA 3M3HA 1S8AA 2H4YA 2WYUA 2FRDA 4ALWA 5CMLA 1RKXA 1XH5A 2EX0A 1OJ7A 4RZWA 1ZKDA 2ZUCA 2ZTLA 3PFGA 1PVVA 2QO2A 2VQ3A 2CJWB 4ZYUA 4YQYA 4NH0A 4YPDA 4JQYA 3OTVA 4E6AA 3SE7A 1W48A 3A2KA 1W46A 1OYVA 4M69B 1PIWA 2XY4A 3M6IA 2X4IA 4R2IA 3C15C 2FEPA 3EGCA 1LRJA 4LYJA 4ZQFA 3R73A 3IDBA 3VBWA 2K2WA 4ENYA 1NU6A 3VS7A 5E91A 4IDDA 3W3AD 1E2FA 4G24A 4TV9B 2PZEA 1BI8A 4Q3EA 5DGHA 3EGOA 4ERNA 5EM6A 4H7EA 1H1TA 5LCJA 2EXCX 2NPOA 3CJTA 2OFVA 1B0PA 2GTNA 4YJFA 1KVRA 5DGXA 5C8YF 5DBXA 2IOFK 2CXXA 1CLUA 3H3CA 2I7VA 4ZCRA 3ZBXA 3RAHA 3WIOA 1QLHA 3ODYX 4BXOB 1JFVA 3BTVA 4BWGA 1IWPB 2ZB8A 1AHNA 3D5EA 2XGMA 4A6EA 5JALA 3DBDA 1A4XA 1G3RA 4OGWA 4RVDA 4DZZA 4IAAA 3ZWQA 2QTRA 4MR7B 4AZTA 2HQOA 5CAEB 3LXXA 2ADFA 4IIXA 4UEUA 2Y9PB 5C0OE 4FV4A 4NZOA 1RYZA 2Y6UA 4EVRA 5G6VA 1CUSA 4TL6A 2C59A 3CQ9A 3F67A 4C7XA 2WIFA 3V7WA 1HE8B 2O3RA 1PNVA 3K1AA 2FZLA 3OI7A 4FSUA 1O6FA 2BH9A 3GRZA 3M70A 2XNHA 4M9UA 3F49S 1M8KA 2RH8A 4DEXA 3UAWA 3VPBA 3UH1A 2OYCA 3ZWOA 3PENA 4U43A 3QLGA 2R1VB 3KPWA 4FGWA 4YO4A 4EEKA 3UGTA 2Q2VA 1PCXA 5KMOA 2QXYA 3H11A 4G4IA 3ZX5A 3A06A 1SD2A 1T9GS 3HB7A 2WPNA 1YR2A 1F3OA 2J4ZA 3THOA 3SNKA 1ATPE 2J5RA 4TKUB 5GGYA 3L8XA 3L8CA 5K99A 3MBIA 4LHEA 4PSDA 4DLXA 4IILA 4PVCA 4P2GA 1WPRA 5DNAA 3NQ41 5JQWA 1VPVA 4XEHA 5LSAA 3PPYA 4C4FA 3ZHUA 5SV2A 3M42A 4ARUA 1Z37A 5CX4A 4PHTA 2OP1A 2QRUA 4XCXA 2XITA 4DEBA 2RI6A 2GHLA 1PT6A 4CFNA 1HE5A 3ZM9A 3KT0A 1FPQA 1NJ6A 2WRZA 1T5TA 3WGYA 3OBBA 5A4AA 5HGIA 3ABIA 3MRVA 2JGEA 2V7BA 2V7VA 4XP0A 2VNWA 3D5UA 1M1YA 1TE2A 2OQIA 3OIVA 4IX4A 1L8AA 4QBFA 2HQRA 5MGNA 4I1OA 4O0LA 4O4IB 1MB2A 3BE6A 1HQKA 4LVOA 5EQEA 3CR0A 4I6BA 1KMQA 2HNBA 3RC7A 5EJ8A 3WXBA 4G4GA 4XRJA 2PANA 4LOQA 5DLQC 2BTEA 5ALYA 5B30A 1RLTA 2A5FA 4U7WA 1YZNA 4AWBA 3FFAA 5C8VA 5DFPA 1FVTA 2ZBGA 1Y3AA 4YZCA 3AC8A 2BFWA 1L6IA 2R1UA 3MFQA 4P4UA 2B30A 3I45A 2OCAA 1OB2A 1DIHA 3MRSA 4MB0A 4ALKA 3OD1A 3DFCB 4IFEA 3MS4A 4EH4A 3ILYA 2C1ZA 5CSPA 5FTMA 2Y4IB 2Y93A 2FOLA 2GQGA 4GNRA 3ZOKA 1I3LA 5CYGA 3DGFC 2NXEA 5A9UA 4QDXA 2WWGA 1N57A 2QSUA 3HJBA 2YHAA 3FVQA 3JVVA 3MCUA 4L73A 3RT9A 3A10A 2WE8A 2RBGA 1DXHA 3O1IC 3STTA 3I9FA 1WPXA 2PPVA 1JDBC 3EPHA 3TXXA 2RHTA 4WFKA 4LMUA 2Q0XA 3IGFA 1RWKA 2M98A 3W3ZB 2WKQA 4KKVA 3E3BX 1T0HB 2JRLA 2WI8A 2ZCVA 1W52X 4LN1A 3TE7A 3X1WA 3DF9A 2ZZKA 3C8DA 3E8NA 3S2IA 3L8YA 2R11A 2CHGA 3LVQE 3HB5X 4IZAA 4WKNA 2VDKB 4QQ8A 3FCYA 3QQFA 1QHHA 4ML3A 4U02A 4XWGA 1Y8YA 1YE3A 1Z26A 5AXCA 3KPUA 4DCCA 5HKMA 5K8UA 1UOEA 3F8SA 3PKZA 4OFZA 4PZYA 4AG6A 3Q1LA 4JNKA 2R0IA 2C2ZA 2RHCA 5ER6A 3VKVA 3ESXA 2ORVA 2Z3WA 2ZIEA 5AVVA 1OBOA 2GJ9A 5T8KA 2PZFA 3WWCA 2ABWA 4NFSA 5LUBA 1EIWA 1SFRA 4M49A 2BFBB 4O25A 3KUXA 3H4IA 2FSGA 4GG5A 2IBTA 1JHMA 2FH9A 3QCSA 4NZNA 2JAPA 3IAUA 1UK8A 3H0ZA 3ZLYA 3D6UA 2BFNA 4RBNA 5KHOC 4X2KA 4R0MA 3WA7A 1U8AA 5EUMA 3JU3A 4CTOA 3UV7A