1G8SA

Methanococcus jannaschii fibrillarin pre-rrna processing protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
230
structure length
230
Chain Sequence
MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN
publication title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikshii Fibrillarin
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 69
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1g8sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g8sA02
5I0BA 2GFCA 2XYUA 4E70A 2V0DA 1IAHA 3OBJA 2FYSA 3GU4A 3V5JA 2PUUA 5K03A 3FSFA 3FPHA 10MHA 4F63A 3IDCA 2I0EA 4TXCA 2AVNA 1WY7A 3S2PA 2WQOA 4I4EA 4O0XA 1NE2A 2UZUE 2W4OA 4FTUA 4NU1A 3CJFA 2A2AA 2UW0A 4C4IA 3RPSA 3UIUA 3UWPA 3MTIA 4MWIA 5CEQA 3GU7A 2XYNA 4E2WA 1YDTE 2VRXA 3O51A 3O0GA 2P7HA 5HILA 4ZIMA 5AUVA 4NKAA 3QTIA 2NYUA 4EYMA 5BP7A 5K01A 3A7EA 3C4FA 4LMUA 4QPPA 3S3IA 2OZAA 4Y72A 5HI2A 1XJ5A 2CN5A 3BYSA 1S9JA 4RTMA 1ZYDA 3EFWA 5A54A 4FIGA 1Q3WA 4IZYA 2P0CA 3RKBA 3B7PA 3BWMA 3KQTA 5C1QB 3OZTA 3PPZA 3TKIA 4BI0A 4X63A 3FL4A 4D55A 1FOTA 4I21A 5CI7A 1BMKA 2VWZA 3LZBA 2V7AA 2OU7A 3D5UA 5JRSA 1XH9A 4AXAA 3SOCA 4JG6A 1SG9A 3QRJA 5FXRA 3F2AA 5DR2A 5CQUA 2CN8A 3DNEA 2OZAB 4EHZA 1WVYA 4APCA 4MTLA 4I5CA 3IW4A 1XKKA 3PDTA 3V8TA 4YO4A 3W8LA 4FUXA 4I6HA 3CE3A 4CTKA 3HVIA 5DYJA 3HDNA 3OUNB 1IASA 5GM2A 2GB4A 2PL0A 3QYWA 3LDUA 3C4CA 3C0GA 1HNNA 5BVDA 4ZSEA 5MHTA 2OJGA 4JDJA 4PRJA 1R0PA 3MJ1A 3QD2B 3IGOA 4RPVA 3VJNA 3FZOA 4NH1A 2XK6A 2J6MA 5BUJA 2W96B 4KRCA 3NUYA 3D4QA 4IB0A 3UPZA 3TUBA 3F61A 7MHTA 4DFNA 4R7HA 3TACA 2GTMA 5LVOA 4XV9A 3TNQB 3GU8A 4GJ3A 4TYJA 3H30A 3E88A 3KVWA 1VP3A 3OTVA 3IQ7A 4Y5QA 1X1AA 4F1OA 4RJ5A 1ND4A 3QCSA 4GSBA 3ZLWA 1JG1A 4FSTA 4BI2A 2HY0A 3C3PA 2VTOA 2CKQA 1KV1A 4UYAA 4XOZA 4QO9A 5HIJA 5AP5A 3NW5A 4O0UA 5J9ZA 2W1GA 4XP3A 4DLJA 4LV5A 3UZRA 3BWJA 4NJ3A 3JWGA 4LL5A 2XYQA 3HKOA 3A7FA 5LQUA 3NW9A 4DITA 2PJDA 2XCKA 3EH9A 1SMHA 2CLQA 2Q0BA 4EQCA 4MF1A 4FVQA 3TZ9A 3OXIA 3GOPA 2IW6A 4F65A 4F9AA 4N6YA 2R3SA 2J0MB 4V0RA 1WZNA 2GS7A 3BHYA 3BYMA 5I4NA 3UBTA 4LRJA 3BQRA 3NUAA 3SC1A 3UVRA 4HPUE 2FGIA 4GC5A 3KRRA 3UG2A 3B2TA 5C26A 3KPWA 3KR9A 4HSGA 5JR3A 3JWHA 4HZSA 4YJOA 3GDHA 2PBFA 4P5ZA 2XIYA 2HW7A 3P86A 3R8LA 3F3VA 3U4UA 3DXYA 4L44A 2ZM3A 3ODZX 2ERKA 4YPDA 2YXDA 2PX5A 5EMKA 2H9VA 5HG7A 3Q3BA 5EIWA 1OKYA 1XVAA 3HCFA 2EUFB 1Y57A 4XUEA 3TR6A 3FLSA 5ANDA 4UX9A 3DZQA 2HWPA 1YKRA 2OF2A 3VNTA 5AP6A 4WUNA 1ZRZA 2DWBA 2VWIA 3NUXA 3RNIA 2CMGA 2GNLA 4BHNA 3MQ2A 3P79A 3UQFA 1M0EA 3P9CA 5EOVA 4RJ7A 2XUUA 1Q5KA 5CF6A 2W9FB 2UZVA 3D83A 4YC6A 3KRLA 3M6UA 4Q5EA 4QMWA 3L9PA 3BE9A 5HIIA 1JR4A 3P9KA 2ITOA 1WMKA 2PVFA 3QGWA 3W2OA 3QGYA 2C6MA 3IDPA 2C0OA 2JGZA 1J91A 3PVWA 4BDFA 3TCPA 2BHHA 3NAYA 5ERGB 3SW7A 3MA3A 4U0IA 3QZIA 3QTZA 1P1BA 3PG1A 1YZ3A 2IW8A 4BCNA 4AFJA 3PLSA 4CV9A 3MY0A 3NRMA 3HV3A 4AA5A 2C6LA 1CM8A 1BL7A 3KQPA 4YTHA 5DX8A 3RVGA 4R8RA 1LUFA 3NVMB 2NP6A 2WA1A 4EH5A 3UVQA 2UW5A 2WMTA 3MSSA 5L6OA 4QNAA 3OCBA 3JY9A 4UXQA 2DYLA 3EN4A 2QOBA 2B52A 4OBWA 5B2KA 5G02A 2QU6A 5I9VA 3TQSA 3LCOA 3D5XA 3F3UA 4FTAA 4AZTA 4Q2AA 3PE2A 1OL6A 2W1DA 2O64A 1XH4A 3BQCA 3DOUA 3GNLA 4Z2YA 3ZSGA 3W33A 3WYXA 5M08A 2RG5A 3QXPA 3C0KA 3TPZA 5HNIX 4RV9A 4BCJA 2XF0A 4DEAA 4PONA 3LLAA 4D1XA 3H3CA 3ZRMA 4JI9A 4O7LA 5E8VA 3R9XB 5AUZA 4EH6A 2W5HA 3QUEA 2BFYA 4IFCA 3ZSHA 2UUEA 4DCMA 1PMEA 5LCJA 2PZ5A 5IEYA 4YMGA 4HC4A 1M2QA 3ZOSA 1Y8CA 1AQJA 4PINA 2R0UA 3BLHA 3P0MA 3DV3A 4O7RA 3CBGA 2Y4PA 4ZLOA 2F2UA 3GRVA 3PS9A 4NYEA 3OCJA 3ELUA 4ACDA 2BDJA 5DM4A 1A48A 4AWIA 4UBAA 2C6TA 4UOEA 4QDJA 4X0MA 2VX1A 3KPUA 4NFNA 4GOLD 1U4DA 4GYGA 5EHGA 2ITZA 4YP8A 4MXCA 4OTIA 2YFXA 4X3JA 4G3GA 1DAYA 3M6XA 2I7CA 4JT3A 4ER6A 3E8DA 5IUGA 3NCZA 2ZWVA 2VTSA 3IO7A 5AAGA 3EEOA 4PYOA 5M06A 5D7VA 4RIYB 3TV6A 1TVOA 2J7TA 1URWA 5EZSA 4PV0A 1YXXA 5FTWA 2ZIGA 2NRYA 4NJDA 3QOWA 3LFDA 4MCVA 1NT2A 3VF9A 4IX6A 1YQJA 1KE8A 4L45A 5BVKA 2PHKA 1VYWA 2YIQA 5ETIA 4JX7A 2Y7JA 4BGHA 5AWMA 2HR1A 3EYHA 3M42A 3EVGA 5AA9A 2PULA 4ZZOA 3DK3A 3QF9A 4MQ1A 3TL8A 3WIKA 4TYEA 4ER7A 4M14A 2B55A 2JHCA 2UVXA 1JG4A 3F9NA 5T68A 4TYIA 3GU6A 3V5PA 3FAAA 1LEWA 1QPCA 1P1CA 4PNIA 4BCOA 5DXJA 4BYJA 3FI2A 5EYCA 3E62A 4KWPA 2GHLA 1JKTA 4P7JA 4O7TA 4FP9A 2EXCX 4RVHA 5EKXA 3BKBA 3KRWA 4FT4A 4CNHA 2UZDA 2WB8A 4IFGA 4CSVA 2CMHA 4RTSA 3T7TA 4U3YA 3GCVA 2REIA 4YHJA 4LRMA 1ZGJA 1VLMA 1OR8A 4IM0A 4I92A 2R3HA 3DA6A 1XDUA 4H3PA 4HCVA 4JR3A 3R9OA 4YO6A 3GRUA 3HV6A 2O5KA 2QU5A 4J98A 4C4EA 5BYLA 4J7BA 1F3MC 2XJ0A 4JDKA 5E2BA 3AMYA 3Q52A 3R8PA 3ZLSA 5H9BA 3HNGA 2C69A 1KPIA 3OP5A 3NWWA 5AV4A 5BVFA 4Y83A 2B78A 5BYZA 2ONYA 4I5HA 3FJQE 3LBYA 2P41A 3PRIA 5K0NA 3LFBA 3I64A 1IRKA 3OVVA 2VWVA 2BIYA 5IF1A 2W1ZA 3OE4A 1WS6A 2RFSA 5KMKA 2OB2A 2WOTA 4FKGA 3V01A 2VTTA 3COMA 1VBFA 1XDSA 1TQMA 4EQMA 2Y4IB 4QMOA 2PT9A 4RJ3A 2VZ9A 2OSCA 3N4UA 1MP8A 3BWBA 4G6LA 4CRSA 3PVBA 3ZUVA 4E6AA 2W99B 5BVOA 4YZMA 3ORIA 4IDVA 3HECA 4F85A 1Y6AA 5K5XA 2BVAA 3Q4CA 2XNOA 1PXOA 2XKFA 4JBPA 2QI8A 5JGAA 3BBTB 1IM8A 3OROA 4YZDA 3TMAA 4H1JA 3MGYA 1UIRA 3CQUA 2X8EA 4GK3A 3VSEA 2R64A 3P2EA 2ZVAA 3EL8A 3OFMA 2R2PA 3G8AA 2GTNA 5L3AA 5A6NA 2OKRA 2VTJA 4AA0A 3SMQA 3R73A 2OLCA 4DMGA 5JFWA 5DT0A 3LM0A 2ERCA 5F2OA 3VBWA 3THRA 4YJVA 3Q87B 4ZP5A 3R1SA 5G1XA 2VNWA 3R7IA 4FNYA 3R7EA 4UZDA 2I40A 3KREA 4JJRA 5CEOA 4DG3E 1XCJA 3BBWA 5E4HA 4CEGA 3UJ9A 2YZLA 3I1AA 4EHGA 5HD4A 2YDJA 1O6YA 3A7DA 4E6CA 4MQ4A 3DDQA 2B53A 5DFPA 2OK1A 4PNEA 4EWQA 5BVNA 2QD9A 3KCFA 2EJTA 3FYCA 3NNVA 3UZUA 4MD9E 3LFQA 5KKRC 1KOAA 4PP9A 3LFEA 4PGGA 2GS9A 4AUKA 4G34A 3HL7A 3NW7A 1Q0SA 1UWVA 5GIPE 4JXJA 2RFEA 3MAGA 5IH3A 1SYKA 4ITJA 4XG4A 5ICPA 3MGGA 2JC6A 4O0RA 3NVKI 2HXLA 5JQ8A 3CGFA 3A27A 4BCIA 2UV2A 5GINE 4YUZA 4GG7A 4CCBA 5H02A 3FZTA 4FEXA 4NK9A 2G8NA 5GNKA 4FSNA 4QYHA 4C37A 4O7WA 1M14A 5ANGA 4IJ9A 3K5VA 3F7WA 2YTZA 4TKSA 4FSDA 4FSQA 1OKWA 5EDPA 3E64A 3HV4A 5CTPA 4L42A 4P7GA 3C0HA 3H9OA 5A4LA 2C3KA 5IEXA 4EZ3A 2WIPA 2GFSA 3FV8A 1Q4LA 4BZDA 5FTOA 4CVAA 3F82A 2J90A 2AC5A 3M2WA 2PZRA 4LMNA 2CPKE 5EFQA 2FK8A 2JFMA 4F0IA 2GHGA 4E6QA 2XNMA 3K54A 2C7PA 2BAKA 1KSWA 3FZ1A 4PDSA 1IEPA 1H4LA 2CHLA 3UNKA 5CEKA 5CVVA 3OCGA 5JSMA 3IW8A 3B8RA 3BYUA 3ZC5A 3ZO2A 3F5PA 4JAIA 5D41A 4F4PA 4YSJA 3MB5A 5A9UA 1KE9A 2VN9A 3DLIA 4MVFA 4BIDA 2HOGA 3PSDA 2XRUA 4YNEA 3E8NA 2J4ZA 4DFBA 1FP1D 3FPJA 3TM5A 2VTHA 1YI3A 3EQCA 5ANOA 1RI5A 2GQRA 2YM7A 3CXWA 2P3QA 1YOJA 2CDZA 3SVZA 4FE2A 2V7OA 4F0GA 3QZHA 5FTGA 4HRAA 3ORKA 4IJPA 3ZDUA 4KKEA 1ZOGA 2VWUA 3LFSA 2WIHA 2UZ4A 3LL7A 4FKWA 5T3QA 1CKIA 2P35A 5CEMA 4MHAA 4FT7A 1KPHA 4LG1A 3NZ0A 5BW4A 4TW9A 3REPA 3KMMA 5BPYA 3ANXA 2WELA 4ANQA 4FZVA 4W8DA 5E1OA 4AU8A 3AGLA 4AA4A 4QVGA 3I79A 3DBFA 4GF5A 4DTKA 4GFMA 2QKWB 5L6WL 3LW0A 3L8VA 4FEWA 5CSXA 3GC7A 3E8EA 1WBWA 4EH7A 4EBVA 3ACJA 3Q2JA 2JLDA 4FG8A 2PPQA 2EJUA 3NJRA 3HNRA 4ZTSA 5AV1A 4U5JA 5HCZA 3DH0A 3QALE 3ZFYA 4IHPA 1AD5A 1W98A 5AIKA 1I1NA 3ZXTA 1L3RE 3ORHA 3W16A 4L43A 4FEVA 3TDWA 3QBNA 3KMWA 2YERA 2IH4A 5EH0A 3G2QA 1V0PA 3HX4A 2UW9A 3P23A 2WTDA 3SKCA 3VYWA 4YZBA 3FMHA 2WTCA 3D0EA 2OFVA 4EI4A 4X2JA 3UFBA 1CMKE 3NNXA 4BDDA 4F6SA 4Q9SA 5IH5A 2B9FA 3TKAA 3HCBA 2IVVA 4PIMA 3OCSA 2XH5A 4DM3A 3OU7A 4S30A 3R9NA 2HELA 3Q4UA 2BR1A 5FD2A 5E1EA 2F7ZE 2SRCA 4K2RA 4F7LA 4NW5A 1QAOA 3MW1A 3UNJA 3O2MA 3U8WA 4XHKB 3DKOA 4M36A 3DJ6A 1WBVA 4QP9A 4GL9A 4B8LA 2JIUA 4XV2A 4NM5A 5EM5A 5HBEA 4MH7A 4QTBA 4O0WA 5CQWA 3GWZA 3T3VA 1G6Q1 5BVWA 4G5JA 3MYGA 2P2HA 4Y5HA 3C0IA 1LP4A 2R7BA 2ESMA 3O7WA 4DZRA 5DM1A 1R74A 3C1XA 2V5QA 4QYEA 3PXZA 3R02A 3NDJA 2I0YA 3NNWA 5EM7A 3O50A 3FI4A 5J95A 3LPMA 3FI3A 3F69A 1QAQA 3FZSA 2VTNA 4O81A 4LOOA 2QO2A 3A26A 4RVFA 5C8MA 3VUIA 2IBTA 3QZGA 5K4JA 4OUCA 2QO9A 3DT1A 4HCUA 5CSWA 4YURA 4RX8A 8MHTA 2VO7A 3F88A 3BT7A 4X3FC 2HCKA 1L9KA 4FTCA 4AGUA 5HZNA 3HCCA 2PXXA 3KPYA 1PJKA 4EZ5A 1VQ1A 3LQ5A 3L8DA 1K2PA 4DH1A 2IWIA 1Y8GA 2I7QA 4GK2A 4FNWA 3VHKA 5HORA 1H27A 5DBXA 5E90A 1XTPA 4M8TA 1I44A 3JWJA 4ZLYA 3OMVA 5HX8A 2J9MA 3LIJA 5CU4A 1YW2A 3QX2A 2PVHA 2UZNA 3I4BA 1W83A 4C4JA 1R8XA 2UZBA 5T64A 2F7EE 2FO0A 2BROA 2X4ZA 2BM8A 4RFYA 4RWLA 2QOHA 3RJCA 5EEHA 3OHTA 5ETFA 2LGCA 4I22A 2VP3A 4E73A 3G2PA 4IADA 2RFDA 4FTJA 4FT2A 4FYNA 3PXYA 4GU9A 2QOQA 4QP7A 1M52A 3BGQA 4RVMA 3EPPA 2NXCA 2BM9A 1PJZA 4AT5A 1OM1A 4EOPA 3HCDA 3POOA 4TWPA 3C4ZA 3UA4A 4BDIA 3LKMA 4A06A 1OKVA 2PWYA 4R6VA 5ANKA 3PSBA 3OXTA 5DI1A 3MERA 2IBSA 3JVRA 4OTHA 5DT2A 5FUBA 2P2IA 2UZTA 4HPTE 5A14A 3SX0A 4AW2A 2XNNA 4XP0A 3ORNA 5IQCA 4CQEA 3I81A 2WQBA 4AX8A 4ZTBA 4FTTA 3G5DA 3BWYA 1L3IA 5AM7A 4QP6A 4FKVA 4RLLA 4EK4A 2I1MA 3DFAA 3WE4A 4S2ZA 4EH3A 1Q61A 3SGLA 3KU2A 2W1FA 3AT4A 4FOCA 3TG1A 3SHEA 3A2CA 2F49A 4A6EA 1OPKA 3U6JA 4LOPA 3AC3A 5AV3A 2B1PA 3FYKX 3DJ5A 1GZ8A 4JBVA 1N2XA 3AQVA 4RTPA 3BLQA 1EH4A 3P1AA 4MWZA 4FV8A 1YDRE 3C6KA 4H58A 2H11A 4IWDA 5D9HA 4E6DA 3QUPA 1QYRA 4XV3A 3G6GA 5DTMA 2R5TA 3F4KA 3R1QA 3U6IA 3PG3A 3DXQA 5FULA 5LWMA 3KK9A 4JDHA 3QTUA 4DYMA 1H1DA 3QFVA 1OPLA 3MB6A 4HVIA 3E7PA 4XNEA 4RYLA 4FZ7A 5M4FA 4GMYA 4LWOA 4RIXA 2B9IA 4AN3A 5A4TA 3VUMA 1SVGA 3ELJA 3UTOA 4ZAUA 2PVRA 4ASXA 2B54A 5CALA 1NW8A 3LJ0A 4J53A 3ALNA 5CENA 3NSZA 3G5TA 2B3TA 4G9RA 5CD1A 4N6ZA 5L8JA 5KMOA 4AT4A 2E9PA 3KEXA 4A9TA 4FV3A 3HEGA 3V3VA 2WMXA 2C3IB 3WZUA 1RW8A 2WXVA 2XS0A 5IQDA 1EIZA 1NVSA 1MQBA 5L2SA 3SXRA 5AMNA 1ZYSA 3U6HA 5ETAA 2V62A 3FUXA 2C0TA 1KXZA 4IX4A 5IA3A 4RWZA 1FBNA 3PY0A 2YISA 4PMTA 4XRJA 3EGEA 4YHTA 4OA5A 4AGWA 4QQCA 5DSXA 5GIOE 3R04A 4RIXB 4I6FA 5JZNA 4XRLA 5AM6A 2CNUA 4P2KA 4IWNA 4DT8A 3KPVA 2HAKA 2IH5A 1P5EA 2XBJA 3EB0A 4OBXA 4EUTA 1GAGA 1M7QA 1RJDA 1KV2A 4WNOA 3UGCA 2YIRA 5BW5A 4IX3A 5FA8A 2YAAA 5AAFA 5JFSA 3BYVA 4E4NA 5U4XA 3CQWA 3UZPA 4CWAA 4X2NA 1NXKA 3FE3A 4TTHB 3VUGA 4KKHA 2B7AA 3DTCA 1ZLTA 4BF2A 3CTHA 2X9EA 3PXRA 5C4KA 4FTMA 4PYQA 2KTYA 4GKIA 3PX3A 2Z6AA 3W2CA 3BIZA 2OXYA 4DF3A 2UW7A 2AN4A 3QRTA 5EM6A 2ERZE 3QAME 3ZXZA 5LSAA 3AC5A 3TFWA 4QMMA 1ZY4A 4IV0A 3GNIB 1UU8A 2CNVA 3G2FA 4KA3A 2YA9A 3D2KA 4P7FA 5DEWA 5JN2A 5CUQA 4ALWA 5C8NA 4PUZA 4TT7A 3QU0A 2HIWA 3EQFA 3KRXA 3MFTA 2VTAA 4BLWA 4YV2A 1XH8A 1OL1A 3THSA 4RFMA 2QR7A 2PE1A 4QMVA 4ZMFA 5M4UA 1NV8A 2B0QA 4F9WA 4MXOA 3CGGA 2JDTA 4BBMA 4QTCA 4BC6A 4E33A 1CDKA 2HENA 2Z6QA 4D1SA 2UYHA 3A4PA 4GEOA 4F84A 5DN3A 4ACCA 4O7NA 2A14A 2IIPA 3V5QA 5ANIA 5C9CA 2Z8CA 5CVEA 3R1NA 2GS6A 5HVYA 2X2MA 3UYSA 3MV5A 3ZUTA 4X3FA 2ZIEA 3G33A 2IZSA 2QY6A 1ZYJA 1G3NA 1J1CA 3DGKA 4JAJA 4FEQA 2VDVE 3RALA 3A4OX 1KPGA 3GB2A 4YZNA 3R7YA 5FA5A 2NXEA 4CTCA 2CKPA 2GQGA 4IIRA 1FGKA 2R3RA 1TW2A 2CLXA 3HAVA 3BU3A 3GRRA 3UJ7A 4RTNA 3GQIA 3KR1A 1MHTA 4BYIA 4YLJA 3FZGA 1PRYA 4E7WA 5C8KA 3EVBA 4M7RA 3UJ8A 1DI8A 2GMXA 3U54A 1DL5A 5HG5A 4HYUA 4AS0A 5E9WA 1P14A 4BN1A 3PFHA 4FL2A 4EK8A 4LI5A 4X3FB 3AG9A 1WBSA 1UVRA 1JPAA 3FKLA 5AUTA 2QHMA 2P33A 3A7GA 4EOOA 4FT5A 1Q62A 3VS6A 4FV7A 4HOKA 4RQKA 3OU6A 2R3JA 5ITAA 5AV0A 1D2CA 2J5EA 4KBAA 1V0OA 1XR1A 5EHOA 3V5WA 4BHZA 4RC4A 4XLIA 1JSZA 2BFXA 4ASDA 4DEHA 3ID6C 3T0IA 2YUIA 3MI9A 3BWFA 3WF9A 4BCFA 4ITIA 3DBCA 5DLSA 4IAKA 4QMSA 1H08A 3UOJA 3CC6A 3V8VA 4R3RA 3HCEA 5AUWA 4P4CA 5KX8A 3COHA 3EL7A 3Q4ZA 2CKEA 4QPAA 4R6XA 4FTLA 1J1BA 4DGNA 2QOIA 4AGCA 3GP0A 3QWKA 4FZ6A 1NW3A 4OTDA 4E4MA 4QP8A 3EMDA 3IECA 4CFVA 3Q2MA 2R9SA 4YHFA 4G3CA 3BGDA 1JSVA 3EEYA 3Q9WA 4JX3A 3BGVA 2ZDUA 3VF8A 4EOKA 1PXLA 1APME 2ORED 4FGBA 4NM3A 3EJ1A 1F0QA 4JG7A 1WAKA 2WMBA 4ASZA 3KFAA 3A4TA 2O57A 1MRYA 4EHVA 2IDJA 4AZSA 3FC1X 5HE1A 4ANSA 1ZOHA 2JDRA 3KA0A 2PVLA 4O84A 3O7LD 4HGZA 1GNGA 5DTQA 3CCNA 5I9ZA 5FBNC 2X9FA 2UVYA 2BKKA 4M37A 4FVPA 4BBFA 4YUVA 3OWJA 2W06A 2O2UA 3PP0A 3LDFA 1ZXEA 3NLBA 4L53A 4RVDA 4I4FA 3MTFA 5E9JA 1KYZA 3HTXA 3L9LA 5E1BA 4LGGA 5J1WA 5B2LA 4GVAA 3TDVA 2OBJA 3ZZEA 5CF8A 2VS1A 5DM2A 1Z9XA 3R8ZA 4O0YA 3RAIA 3LMGA 5FLFA 4C7TA 3L9NA 4I5PA 1OIRA 5CF4A 5HU3A 1PXNA 4WHZA 5H8BA 2AOWA 2QO7A 3ELDA 5CNNA 1SUIA 4QMUA 1OITA 4WIHA 4Z55A 3SSNA 2HTEA 3M33A 5CASA 1L8TA 5KS2A 4M38A 3MN3A 3HA8A 3HUCA 3LLTA 5HO8A 5KUPA 2YJRA 5LMAA 3WF7A 5AJQA 1XJDA 3PRFA 4FK3A 2QNJA 4RTOA 4QMYA 2B2CA 3IW5A 2XVAA 4H39A 5KO1A 4O22A 3TZ7A 4PYKA 3B2WA 4C36A 4AZVA 4C4HA 3UP2A 4C33A 2W5AA 2AZTA 3ODYX 3OU2A 3C51A 2WQNA 4IC8A 3M4XA 1JVPP 4C4FA 1NW7A 3LFNA 3AXTA 5HKMA 4GUAA 5FEQA 5DVRA 3EVDA 4QP2A 3A60A 4JG8A 3TKUA 5DT4A 1YF3A 1I4WA 3UIXA 5EI6A 5HCXA 2PLWA 4IZ7A 3E05A 5CZIA 3NUSA 5BMSA 2ZV2A 4MEDA 3OXZA 2PVCA 3DBQA 5CU2A 1MQ4A 1ZARA 3ETAA 2BIKB 4XG3A 1OUKA 1W0XC 2JD5A 1T43A 1B6CB 4QTUB 4EC9A 3ME5A 2R3IA 3H9RA 4CKRA 3OY3A 3OF0A 2O0UA 2AOUA 4YTFA 1Q0TA 1JTEA 3UJCA 3Q6WA 4RJ8A 3TLJA 2VWBA 2JITA 5K3YA 2QR8A 3QKLA 4YUQA 2R7IA 5LQNA 5KHWA 3OS3A 2R3OA 1FJXA 4CKCA 3FQHA 3TIZA 2P3OA 4EKIA 5B7VA 5LWNA 3JVSA 4MD8E 4I0TA 2GPYA 3LCDA 3SM3A 3AT2A 3UJBA 3A62A 5KMJA 3EZRA 1OL7A 3KPJA 2YCSA 3UO4A 5LQFA 3PYYA 4RWKA 2UYQA 5JFVA 1H26A 1TKIA 3F3WA 4KNBA 3TTIA 3MS9A 5AIRA 4B7TA 3MVJA 4HGEA 2W4KA 5AADA 3ORPA 3OFKA 3R8UA 4HTFA 5ICFA 2PZIA 2B9JA 1OI9A 1BUHA 5IQEA 1A9UA 5JFXA 5FP5A 2RFNA 4OT5A 1SZMA 2HZ0A 5EKUA 2QCSA 2AOUB 4KSPA 3QLFA 3HZTA 1KIAA 3TM0A 4YUYA 1M2PA 4Z7HA 3VW8A 1QAMA 2WMSA 4AE6A 2FUMA 3BZ3A 3HMOA 3ORTA 4JDIA 3P2IA 4GT4A 4ATNA 3C7QA 5E91A 4RX9A 2C5VA 4R77A 3NDMA 1Y8YA 5DPVA 3CY3A 4U40A 3KHKA 3WARA 4MBLA 3VIDA 2ETMA 3SSOA 3BE2A 3H10A 5F4NA 3DTNA 4U45A 4ZSGA 5TT7A 5DOSA 4HTFB 5DEYA 4E5AX 2B4SB 3KXHA 2YIWA 1Q24A 4M7IA 1XBBA 4G16A 2PUNA 3EVAA 1K9AA 4QTTB 3OY1A 3CTJA 1OKZA 5GJFA 4USDA 5C4LA 2G01A 4FSRA 5JKGA 3SG8A 3EQGA 3FUTA 1B38A 1FMKA 4ZS4A 3AJDA 4D9UA 4BIBA 1Z57A 5C27A 4XCUA 4O27B 2ZB1A 1S9IA 1UNLA 3VQHA 2FPOA 2CGUA 4YLKA 4QQKA 4W4XA 4TZRA 3LCKA 4C3PA 3EVEA 3VAPA 4F6UA 2ITNA 3E3BX 1JG3A 3BXOA 3P7CA 1GY3A 2JHAA 5HVJA 5J9YA 5GJDA 3TUDA 5EK7A 1BX6A 2YACA 3GU3A 5KBRA 3BHHA 4CLIA 5K0GA 1VIDA 3LKDA 3KQ7A 1FQ1B 5HEKA 1P4FA 5CI6A 4P7KA 4X21A 1YWVA 4FR4A 4QTEA 5M55A 4Z16A 5FG8A 3KQOA 4A4LA 3DQXA 3R83A 4BCQA 2WPAA 2GQSA 1XWSA 2ITQA 3TNWA 3IS5A 4NSTA 2G1PA 4QRCA 5IMEA 3QV2A 3EQHA 2XRWA 4BZNA 2ZJWA 2JG3A 1NA7A 5LOHA 4I94A 4ERWA 3GFWA 1X8BA 3CC8A 3K0BA 3PPKA 3SQQA 2BALA 4V01A 3FXZA 3CJGA 2IH2A 3LCCA 5K5NA 3G90X 2FRXA 3OG7A 3PZEA 3HA3A 4CZUA 4WKQA 2GSFA 3EN7A 5EKOA 2OXTA 4FIJA 1WVXA 3RIEA 3VBQA 4ZZNA 2YN8A 5L2IA 4DA5A 2C7QA 4YTCA 4FNZA 4TNBA 4G31A 3EKKA 3UOLA 2FSTX 5LQAA 1B39A 3H0ZA 3MPAA 4IQ6A 4O83A 5HE0A 5ANJA 4FEUA 4L68A 4KAOA 3AC4A 4DT9A 1ORIA 5AUYA 5CYIA 3OTUA 4C08A 4O7VA 1JG2A 2PYWA 3OCTA 4MKCA 5BNJA 1KP9A 5HE2A 4IAIA 4DG0E 5M4IA 3IOKA 4D4RA 4XBUA 2PUIA 3FRHA 2IZTA 4DG2E 2O05A 2WTJA 4FKLA 3NDIA 5K0LA 4LL0A 3RPOA 3UE4A 5AX3A 4CCUA 2CKDA 1H28A 4C04A 3TI1A 1QPDA 2AC3A 4JNWA 4J96A 4ER3A 4CXMA 3F2RA 1UWHA 1L1EA 3QYZA 4DN5A 5CAOA 4RTRA 3HVKA 4DINA 1ZMVA 2XKCA 4PY1A 3O7LB 2ITPA 3GCQA 4ZJJA 2A0CX 1ZMWA 4IWOA 2ETRA 4RVLA 4DFZE 3M6VA 1YWRA 1FP2A 4GV1A 5LMKA 1OMWA 2YZAA 4TPTA 1V39A 2Z7LA 3S0OA 2YM5A 2J0IA 4XBRA 4Y8DA 2NXNA 5DR9A 3PVCA 3HA7A 4QP1A 2R3GA 4V05A 4D4VA 3PJ1A 4MBJA 2ZV7A 3RHXA 5E92A 4XCXA 3Q9YA 5K05A 3ROCA 2WEIA 2VWYA 1H1WA 2C5XA 2VNYA 2K4MA 3I5UA 3BELA 3SA0A 5F2NA 5CM2Z 5L6PA 3R2YA 5EZQA 3IGGA 4DAWA 4DEEA 2J0KA 1ZMUA 3F66A 1FINA 2YM4A 1IA9A 3AOXA 4ZXTA 3KR2A 3MVHA 1TQIA 1O9GA 2QQ7A 4GS6A 4U7PB 5K8VA 3LDGA 3FHIA 3IYLW 4O0TA 5CXHA 2WA2A 1ZG3A 1Q8WA 2QLQA 3JWIA 3FMMA 3KQWA 3R01A 4QP4A 4GT3A 2J51A 2AN3A 3GGFA 4IWQA 5HNGA 3VBXA 4FKQA 2ZW9A 3GC0A 3FPGA 3QUDA 4BI1A 1YOMA 4GCJA 2OZOA 3V8WA 2X7FA 4ZMEA 1WBNA 2X2LA 1HCKA 4D0WA 4EH8A 5EW8A 3ORZA 3PY1A 3LCVB 2E9NA 4EKLA 4NWMA 4PGHA 1JQEA 4N70A 4UYNA 1U59A 3GJYA 2IPXA 4ZOGA 2O0LA 2PX2A 2H00A 2ZFUA 3QTWA 3UJDA 4KD1A 3JPVA 3VQUA 5HE3A 4ZTQA 4PMSA 4JOAA 2XNGA 4NT4A 1NW1A 3GXOA 4RSSA 2XVMA 3OFJA 2G71A 1PMUA 1JAMA 4MYGA 3RINA 1ZGAA 2Y4IC 3KL8A 2J0JA 4RJ4A 4L3LA 3PT9A 5IQHA 2YDIA 2JDVA 4FKJA 5CY3A 3EVFA 3SXJA 2EU9A 2WMWA 3OPNA 2GNGA 3DU8A 4L7SA 4E8AA 3PTAA 2I0HA 1XDZA 3CJRA 2O06A 3QRKA 2X2KA 2FVDA 3NWBA 2OO3A 4XG8A 5CEPA 1NV9A 4O7SA 5CANA 4L6QA 4ID7A 3LOKA 2XBAA 4NIFB 3QCYA 1NW6A 5J9LA 4M67A 3F3TA 4JRVA 4FG9A 4ER0A 5TR6A 2QHNA 4F08A 1UFKA 2FH9A 4NECA 2JEDA 4RIWB 3R7OA 3L9MA 3AC8A 4JBOA 5D7AA 3LCTA 3LJ2A 4L7VA 5HFJA 3R8MA 1M2RA 3DB8A 3M70A 4RTQA 3CKWA 4AN9A 1SM2A 4QMLA 2PV0A 1O54A 3E7OA 3DXPA 2UW4A 4D58A 2OW3A 4D5KA 2ZOQA 2GHMA 3PPJA 4O96A 5HOQA 2YHVA 1WCCA 4N4SA 4G1WA 2R3QA 4R05A 3I5ZA 4YBKA 2O65A 3ORLA 2ONZA 3VW6A 5CXZA 4ANMA 2ITWA 2YDKA 5AUUA 2OIQA 2BILB 2X7OA 3G2MA 4K8AA 4NTTA 3BKXA 4MNEA 1YDSE 3MH2A 3AD4A 5IA4A 2C30A 3ZUUA 3TNHA 3SVVA 2WD1A 2F57A 3KRJA 4M97A 1YB2A 4FKRA 4EEVA 4K1BA 4LUDA 1JSUA 4ZTLA 1RJFA 2OYRA 4E31A 3C4WA 3MJ2A 4JS8A 5JGBA 4KBCA 4PYMA 2VTLA 4IVAA 3SLSA 2QKRA 3FMEA 2P40A 1NBHA 2PVYA 3RODA 2WOUA 3SOAA 3B3JA 4C2WA 1JSXA 5IQAA 1JBPE 3R9HA 1Y6BA 3W2PA 4BY9E 4KSQA 2PMOX 3NR9A 2A27A 4RC3A 3PB3A 3VS4A 1J7LA 3Q60A 3D7ZA 4RIOA 3Q6UA 3R9RA 4S33A 5ICGA 2ZB0A 4IAAA 4CT1A 4RVTA 2OH0E 1X1DA 4MNEB 2IVUA 5BQ0A 3MDYA 3BCEA 5KQRA 5EOLA 1O6KA 3CKXA 5JQ5A 5IA5A 5HLWA 5KE0A 3ELYA 2HZIA 3N4TA 4MXXA 5CAQA 4EOSA 4JIKA 4ZSLA 4EQUA 2G15A 2QE6A 4PTGA 4PTEA 4DE4A 2OY0A 2V22A 1AGWA 4CG9A 2BZHB 5CSHA 5KCVA 4DFXE 3N51A 3ET7A 2W4JA 4CKIA 3OT8A 4QTDA 5K0BA 3HUBA 2X39A 4M12A 3DXNA 4V0GB 3MWUA 2VWWA 1NVQA 1OIQA 5DE2A 4PF4A 4U3ZA 3LQ8A 2IN6A 1ORHA 3TKYA 4MQ2A 5IH4A 4WNPA 5EHYA 3B3GA 4OQDA 1KE7A 4GBED 1JWHA 2ZSUA 3KN6A 3EQBA 4CZTA 3L8SA 4TY1A 4DEBA 5CAVA 3MBLA 4E5BA 3WI6A 3R0QA 3FI8A 3FZRA 4RIYA 1RI4A 3RP9A 4FV5A 3QZFA 5KMNA 1R0EA 2C1AA 4I1ZA 4QDKA 3U51A 3LXPA 3GU5A 4UEUA 5HCYA 3I0QA 4FSZA 3LSTA 4TNDA 2IGTA 1H0WA 4TWNA 1R8YA 3MPTA 3ER9A 1XXLA 3SRVA 3DXXA 2PZPA 2PTKA 1DCTA 5L2WA 2GDOA 1JKSA 2JKMA 4IW0A 4QOXA 5EHIA 3MIAA 2QG5A 3LQ3A 1H25A 2PVMA 3PLAE 1VP9A 5DPMA 4XUFA 1JSTA 2QOLA 2VUWA 1YOLA 5M09A 2PMIA 2C6DA 4WG5A 4D28A 2DS1A 4C3FA 5BX0A 1A06A 1H24A 3SD0A 2RG6A 1MRVA 4EONA 2Q41A 1QL6A 5FXQA 3PZHA 1SQGA 4MK0A 4QMTA 5I5ZA 3K6RA 3CIKA 3MFUA 3QRIA 1AV6A 2NO3A 3I7BA 2ZTHA 1E9HA 1OZ1A 3BX5A 3SRVB 4AT3A 2W5BA 4RG0A 5F9EA 1L3CA 4YUWA 4ISCA 4WBBB 4IEBA 4AN2A 3O8TA 3PJ8A 2WO6A 4E2YA 4GFOA 1JKKA 3EQRA 4AOIA 5K0FA 3O31A 5BUEA 4N57A 2CNQA 4FVRA 5FQOA 2O8YA 2ITYA 4NFMA 2C68A 3UG1A 3P7BA 3GENA 4DCGA 5A4CA 4BLVA 4A9YA 1KHHA 3E87A 4HGTA 1OIUA 3IONA 1OL2A 3FY0A 5D1JA 2YWVA 1SVHA 4IANA 5HIDA 2QLUA 4G5PA 4M0ZA 3DUWA 2OI4X 5FDXA 4ZLZA 3QD0A 3RZBA 1G60A 2BR5A 3I0OA 4JRNA 4DCAA 4DTAA 4ZK5A 2GNIA 2PY6A 4YJTA 4CT2A 5HLNA 2YIYA 2UW3A 3LVPA 3ZO3A 4CFXA 5K0CA 1U2ZA 4YGAA 1TQPA 4ZEGA 3R7VA 3W2QA 3O17A 4AZFA 3WZDA 3E8SA 2C3JA 4A9RA 1Q8TA 9MHTA 1ZZ2A 4KIFA 5CEIA 3SG9A 2VGOA 3DAKA 5DA3A 4FIIA 2YXLA 3QTXA 3CQEA 3BGZA 4IVCA 2WMUA 4L00A 3D94A 4FIHA 2ONLA 3PJ3A 2Z2WA 4F70A 3V5TA 3P5KA 3R9DA 2C5NA 3TTJA 2W1EA 3NW6A 3E5AA 5DWRA 2WKMA 2X8DA 2WNTA 1H1PA 3QHWA 4LECA 4OA8A 2QOCA 4O6LA 4F1TA 5DNRA 4O0SA 2BZJA 4M84A 3BKWA 4C07A 3RCJA 2BAQA 5JRQA 1UNHA 4RT7A 1DAWA 4HNFA 1P39A 2YCFA 3GO4A 2WU7A 5JK3A 3NUNA 4YPSA 2VO6A 2AOTB 4KKGA 2YCRA 4XG6A 3RAWA 1RI1A 3KQQA 2PX8A 3RM7A 3FZPA 1YHWA 2N47A 3N9XA 4BDCA 1M7NA 1JQHA 1R00A 1Q97A 3COIA 5FM2A 2XIXA 3C3YA 3FTFA 1H1SA 3IG7A 5HIKA 2VO0A 5JUWA 3C4EA 3DQWA 1FVTA 5D10A 5HIEA 3PVGA 2XJ2A 2J5FA 4HGLA 5E9EA 3FQEA 3P2KA 1CKPA 2NPQA 3GI3A 3GOKA 2WQEA 1Q8YA 5KNJA 2BKZA 5DLYA 2PU8A 4HH4A 4R1VA 2C5YA 3FXXA 5B1SA 1BHJA 2GS2A 5IQIA 3RTPA 3TWJA 4FSYA 4KRGA 5E8JA 3LX6A 5FXSA 3Q9ZA 3PVUA 5EQPA 2PXCA 2Z7QA 4KABA 4Y85A 3VUDA 4C06A 4PDPA 1I09A 1H00A 4WOVA 3FLWA 4ZTRA 3HV5A 4QPSA 2ZIFA 5CVUA 4U7ZA 3ZLYA 2VDWA 2Y6OA 4QPNA 3S00A 2CKOA 2G2HA 5FHQA 2PGXA 2P1DA 3KN5A 4XOYA 3FYJX 5M07A 4YZ9A 1OB3A 4YC3A 1H1QA 4A9UA 4YJNA 2OJIA 2WMVA 1DS5A 3DKFA 3PWYA 4U41A 4FKOA 1KWPA 2GNHA 4EOIA 4OTRA 4OTWA 3E8CA 3KQMA 4H1MA 3DK7A 3P78A 1WZYA 3OZSA 5IISA 1SNXA 3EZVA 5LQCA 2UZLA 4DFUA 4EKKA 3M11A 5H2UA 1RJEA 2YJSA 3H0YA 5DTRA 3MY1A 2VZ6A 3UA3A 3VVHA 3HA6A 4CTJA 1Y91A 4DEIA 5IQGA 3RAHA 5K0JA 3ZRKA 2WQMA 1NKVA 4RQVA 4UXLA 3FEGA 3R21A 3B3FA 4ACHA 3RPVA 4FYOA 4B9DA 4G6NA 3COKA 3OEFX 4PL3A 2ZMDA 3U9NA 2PT6A 4ER5A 3G7UA 5LCKA 4AQCA 3LE6A 4RVGA 4R3CA 3WZJA 4POOA 4CKBA 3P7AA 3TZ8A 1STCE 3OOGA 3AXSA 4I41A 4RX5A 2YVLA 4B99A 3KGAA 3QTRA 3E92A 4BCHA 2OIDA 3ZBXA 2WMQA 4ZY6A 4AFEA 3UYTA 4XV1A 2UVZA 5HU9A 4O91A 2UYCA 4U81A 1IA8A 2JBPA 2XZSA 4EOJA 2ZV8A 3QQGA 2WZJA 3ZSIA 2QM3A 4D0XA 4EHEA 3GBZA 4Q5HA 4YJSA 4RVKA 3PXFA 3UPXA 2ITVA 1NY3A 2YWPA 3RM6A 1M17A 4YR8A 2OJFE 4HVHA 3FRIA 5TOZA 1OBGA 3GT8A 4GOND 3GCZA 4U80A 2PE2A 2ZM4A 4KIPA 4A07A 4J1RA 3PXQA 2OXDA 3Q53A 1JTFA 4R3PA 4KS7A 1D2HA 4EL9A 3DB6A 4X41A 3BEAA 3LAUA 4JLCA 5LVMA 1FMOE 4B8MA 2QOKA 2Y0AA 5IKMA 2A1AB 4FZFB 5CX9A 4FTQA 1WXWA 4EK6A 5FWAA 3DLCA 3CJTA 2UZWE 3NYXA 3PE1A 1Q99A 3UODA 4NUSA 5D12A 3SGCA 1BYGA 1ZYCA 2PMLX 2O07A 2XNBA 4CFNA 3ZLXA 4USEA 1QMZA 2WFYA 4DGGA 5HTBA 3DMFA 5L8KA 5BXYA 3ATTA 4F9YA 1QPEA 4II5A 3DDPA 1U5RA 2CMWA 1UA2A 3ZS5A 2OFUA 5IA2A 4PQNA 5AV2A 4WRGA 3CD3A 5DX1A 2BDFA 4ONAA 1PXJA 4RWJA 5EKNA 3BZBA 1OVEA 4H0NA 3ZEWA 3F2NA 1BLXA 2XEYA 3ENMA 2E2BA 2OIBA 4DQ0A 5M44A 3SW4A 5T6BA 4QQTA 5JH6A 1LEZA 1OL5A 5CCXA 5GJGA 1XO2B 2BHEA 1NW5A 3UDBA 4GVJA 4HCTA 5G6VA 5FTQA 5HBHA 3EGIA 2WTKB 2GA9A 2WK1A 5HG8A 1FVVA 4YZCA 2GLUA 4PL4A 3O71A 5IH6A 1UWJA 2XMYA 3MTLA 3QKKA 5FUTA 3FTDA 5E2AA 4C0TA 2BRMA 4KIGA 2HZNA 4I6QA 4WT6A 3UNZA 2A4LA 2YAKA 5CCBA 3LCSA 3ZHPC 1ZAOA 2Z7SA 3S68A 5KZIA 4JQ8A 2CWWA 4DH7A 1RJGA 2YXEA 5IDPA 3UMXA 3WIGA 4J71A 1DM2A 4WUAA 2BMCA 3FMLA 2QC6A 3FLQA 4EKGA 3JR1A 2VTIA 3U4WA 3VO3A 4PNKA 3IHTA 2JKKA 3IW6A 2FHPA 1XBCA 3BHTA 4F86A 5DWQA 3QD4A 5HLPA 4U43A 4EOQA 4OBPA 1PHKA 2W1CA 1CSNA 5HG9A 3VC4A 4JIAA 2R3MA 4C02A 2EB3A 4DA4A 2WU6A 3KF4A 1TPYA 4MAOA 3ZTXA 4XEYA 4GYIA 4ANBA 3BLRA 3CBLA 4P7EA 5CIYA 3PFQA 3BRBA 4TYGA 2XNEA 4O0VA 5KMMA 5GHVA 5LMBA 4IMYA 2AR0A 4YUXA 3H4JA 4D2RA 3AD6A 3OW4A 3R71A 3G15A 4AAAA 1BI7A 3GQLA 2IG7A 3AD5A 4IACA 2BDWA 1W84A 3G0EA 4GJ2A 2HY81 4BCPA 4YJQA 2C3LA 4J95A 2Z6UA 4C3RA 4IH8A 5E8RA 3QTQA 5EIFA 2JHPA 3Q04A 1YUBA 4O6EA 3M6WA 3PP1A 3QC9A 4FTRA 4F6WA 2EX4A 3T7RA 4CTBA 3SXSA 2ZULA 5IQBA 3UP7A 4BP1A 2OO8X 2YM6A 2JJQA 3VC1A 4UV0A 3A99A 5F20A 2BRHA 3ZONA 2C1BA 3QTSA 3FDNA 1Q8ZA 3A8WA 2YQZA 1PYXA 4H3QA 3G5LA 3T7SA 5GP1A 2C6KA 5B0XA 2JBOA 5LQRA 3R28A 2F2CB 4GH2A 4NCTC 3CS9A 4JQEA 3F3ZA 2PMNX 3G2OA 3R6XA 4PIPA 4G3EA 4Y73A 2VTRA 4XG2A 3EKNA 4P58A 1AF7A 1J7IA 5HX6A 2YCQA 3C50A 2E9OA 4EUUA 1PW2A 3V6SA 2I6GA 5GOZA 3GEQA 3LHJA 2OICA 2I6LA 3SDJA 4U79A 4XJ0A 2KW5A 4QYYA 2UZOA 5K4IA 4PCAA 5DH3A 4UB7A 5F94A 2AS0A 4C4GA 4FKSA 5EQYA 4RC2A 1M6YA 2OKCA 5DG5A 2X7GA 3GIWA 4R7IA 3EHAA 5CVHA 2G72A 2XIZA 3I6UA 3RWQA 3KMUA 4C35A 4B17A 2IVTA 4UALA 3KB7A 2WEVA 1H01A 3FLZA 4JR7A 4LWPA 3QA8A 3ZU7A 2DULA 4F9CA 3OWLA 3ZM9A 2F9GA 2XA4A 2AOVA 4OW8A 4G9CA 3HAMA 5EMMA 3U81A 3FY2A 1DUSA 4KVZA 5TO8A 5C0OE 4EYJA 1VR2A 2BH2A 1JOWB 5A3XA 1SQFA 3V6RA 4BGGA 3ZFMA 4WNKA 3MCTA 5AX9A 3GUBA 4D1ZA 3MH3A 1O6LA 4ACGA 3TV7A 4AOJA 1NVRA 1UNGA 1FPQA 1PMNA 1Z5MA 4CFWA 1X19A 3JS2A 2ESRA 4PTCA 2VTPA 1EJ6A 2RF9A 2I62A 4FICA 4R5SA 4KW7A 5EVJA 4KDRA 2PUPA 2FYTA 1YXTA 1VE3A 5CVGA 5I9UA 4RBLA 5A4QA 3RK7A 5I9WA 3D14A 4WSYA 4BRXA 5IEVA 3WF5A 5C01A 3PWDA 5JZJA 2P3GX 2P7IA 5FWDA 3L8XA 2F8LA 5EYKA 4D4YA 4OX9Y 5CWZA 3ZO4A 4QYFA 4N0SA 5M56A 3D2LA 1WVWA 2NP7A 5HTCA 4B6LA 5E8SA 2P8JA 1ZWSA 1HOWA 4L67A 3DLZA 4KIOA 2P3LA 4P5QA 2XK3A 4D2SA 3LMIA 2JIVA 3DBEA 4DGLC 4LGHA 3KKVA 2Q0NA 3K3IA 3QD3A 2Y1WA 2B9EA 4FI1A 2Y6MA 3TV4A 1XH5A 1E1VA 4ERKA 4YC8A 5D1HA 3VUHA 2PZYA 3Q32A 3NCGA 3QQLA 5EMLA 2OH4A 2HMYB 1UU7A 5DHJA 3KCKA 4EZ7A 4JXFA 1GZKA 5FM3A 2HWKA 4IZ5A 1OPJA 3DPKA 4EJNA 2BTRA 5BMMA 3ZYAA 4IAFA 3HEMA 3S95A 3DP7A 3UOHA 4M13A 2OG8A 1YXUA 2BPMA 4GG5A 3IDBA 2JDOA 3N4VA 4EBWA 1URCA 4LYNA 2XIRA 3HP7A 3LFFA 2AYPA 4PWYA 5C1IA 2PWLA 3NPCA 5J7HA 3THBA 2FK7A 2XP2A 3DKGA 4O21A 2H8HA 2RL5A 3OWPA 1W8CA 4KBKA 2AVDA 4BDEA 3HP2A 4W4VA 2B25A 3PA3A 3SSMA 3FMJA 2AUHA 5M4CA 3P9JA 4E2XA 4FIFA 3OD6X 1IY9A 4AW5A 3ULZA 4BCGA 4GOOD 2XYRA 2W05A 2X81A 3AC1A 4ARKA 3VULA 1UU3A 4CLJA 4HGSA 3U55A 2YR0A 5H8EA 2XBMA 4FKIA 4E2ZA 1F5QA 2G2FA 1NBIA 4QQJA 4BDGA 4MXZA 3GC9A 3ZDIA 4TN6A 4E4LA 4MHTA 3PTGA 3BV2A 4DFLA 1R3CA 4QNYA 5GM1A 5FDPA 3ANQA 3NX8A 3GCPA 5BVEA 5CAUA 1K3AA 3QHRA 1RJBA 2PXAA 3POZA 2JH8A 5E8YA 5CVJA 5LR6A 4XUDA 4O38A 1YI6A 4U44A 5F1ZA 2VWXA 4G3DA 4BDJA 2C6IA 5IA1A 1PXPA 5M53A 4IVBA 3VS0A 4RZVA 3MH0A 4XMOA 4PDOA 3OC1A 3VS1A 3HVJA 2I9KA 2UZEA 2NP8A 3B89A 3ERKA 3MFRA 4FT3A 4FSMA 3TRKA 4AE9A 2R3KA 3T3UA 4NZWB 2VTMA 2HYYA 2UW8A 4LUEA 1RE8A 5K0EA 3AXWA 2XK4A 3RGFA 1EQAA 5E1MA 5AP4A 4AZWA 3KF7A 1PXMA 3K2LA 3TIYA 4R6WA 4EK5A 3KXZA 3UOKA 3FMNA 1SNUA 5E8UA 2R3LA 4XS2A 3WBLA 3FWQA 5EW9A 2OB1A 3WSTA 5FQDC 3CJQA 2WMAA 2ZYBA 3Q4TA 1PXIA 1PXKA 4C4AA 3V5LA 2V7EA 5FGKA 1WXXA 3E63A 3W32A 3JYAA 3UJAA 2GNFA 4NL0A 4HJOA 3SX9A 1V1KA 2Y9QA 3K5UA 4BZOA 5HHWA 2H6DA 5EDQA 2FCAA 3E23A 3LKZA 2XK9A 3LCUA 3FSKA 4NCTA 4CG8A 2HK5A 4P90A 2A19B 3E3PA 4MWHA 5CF5A 2XJ1A 5EM8A 5BUIA 5LXMA 1L3BA 4ZSJA 5L8LA 4W4WA 2WTIA 3VN9A 3BEGA 4F09A 1MUOA 3F6XA 1QPJA 2FSOX 3V51A 4AACA 4V0QA 1YFJA 4C58A 3FYDA 2Y1XA 2IVSA 4ACMA 3FMDA 2OJJA 4RA5A 2LAVA 3KY2A 4FBXA 4ASEA 5EI2A 1ERKA 1YXVA 3TZMA 5HNBA 3OZRA 1UKHA 3PIZA 3WF6A 3U9CA 4K77A 3F5XA 4L8MA 3A7JA 5EMJA 4IAYA 3QCXA 4F7SA 5F2KA 3KC3A 1J3HA 4M69B 5LQJA 2ZVJA 4YBJA 3W10A 3ULIA 3P08A 1UU9A 2E9UA 5IDNA 1VJYA 5D11A 5IZFA 3TOSA 3UO5A 5I9XA 3NGAA 2DQ7X 3ALOA 3IEIA 3ZBFA 1PKGA 2J0LA 4W8EA 5KBQA 3ELWA 4BKJA 2BUJA 1ZKDA 3FXWA 2G1TA 2DUVA 5ACBC 3UQCA 5DSTA 1WFCA 3NIEA 1H1RA 5CU6A 3BU6A 2ZAZA 2XEZA 2XKDA 5HO7A 1G8AA 1XH6A 4Y2HA 4QYGA 4F0FA 3MTEA 4F99A 3KXXA 3BYOA 5KMIA 3W2SA 3G51A 4DTBA 3VBTA 1ZZLA 3OBGA 1O9HA 4X60A 4BIEA 4BTJA 3HDMA 5KYGA 3UIBA 3O4FA 1R1WA 1R39A 4BCMA 3NAXA 4AOTA 4NKSA 3PA4A 5HICA 3QQKA 4R8SA 2GNJA 2OBFA 4GQBA 4FV0A 4PMPA 2ZM1A 2C4GA 4QTAA 4H36A 3DMGA 1FVRA 1IR3A 3ZZWA 3DLSA 3MCZA 1V0BA 3NUPA 3AWIA 5TF9A 3DAEA 3FTEA 3EQDA 4YU2A 5DRTA 3SAYA 2IP2A 1REKA 4E20A 5EC8A 3VRYA 3HMNA 5J87A 5M57A 2QURA 3VRZA 1R78A 3BGPA 5LVLA 3C5UA 4L7FA 2OPBA 3TNIA 3O8UA 4FKUA 1R18A 5FADA 3CGOA 4APPA 4AW1A 5B2MA 1YZHA 1VPTA 3Q5IA 4OR5A 2Q83A 5LMKC 3O96A 1QZZA 3NEWA 4DKJA 4HG2A 2HWOA 4BTMA 3QCQA 2W7XA 3OEZA 4OQEA 3LJ1A 4MXYA 3RHKA 2XIKA 2C6EA 4MTAA 3R6TA 5HD7A 2OJ9A 3VC2A 5CZHA 4IAZA 5FRIA 4GK4A 2NNWB 4O86A 4PX6A 4KDCA 4G2FA 5JEBA 3A8XA 3TNPC 3IPHA 5E8ZA 3HGKA 3S1HA 5T67A 3JXWA 4S31A 4FC0A 3ROYA 3ITZA 3H2BA 3PFGA 4CFUA 4ANLA 4IB3A 2KULA 3V8SA 2YABA 4AW0A 3QQFA 5KMLA 4H3BA 4E32A 5CS6A 5CU0A 2VX0A 2R3FA 5E1SA 5A46A 3DJ7A 4RTKA 3UIMA 2ZBPA 4NTSA 4BDAA 4A4XA 4DGMA 1G5SA 5HESA 1PYEA 4GW8A 3R2BA 3EIDA 2PSSA 4S32A 5FQNA 5E1DA 5BYYA 2CCIA 2YITA 4F7NA 2VTQA 3BHUA 4X6QC 1GZOA 2F7XE 4FL1A 4BDKA 2IZRA 2G2IA 4IE9A 1J7UA 2ZCJA 5CT0A 3NYOA 5AEPA 3EVZA 1R6AA 4X7QA 3I7CA 3R3HA 4GUEA 2EVAA 1ZHFA 3MPMA 4DHFA 3OUKA 5P8WA 4I3ZA 4YJUA 2HNKA 3LHDA 1GOLA 1O9UA 5HQ0A 2CSNA 4EMSA 2Z60A 1WG8A 3EOCA 5CLPA 4K11A 3BU5A 4FIEA 1JLUE 3IW7A 4C61A 4YV0A 5IG1A 5FCDA 5FP6A 2NXJA 3K3JA 3H9FA 2RIOA 1B42A 3LBFA 5ICEA 3C5IA 2AN5A 5IUIA 1YWNA 3FPQA 4C34A 1E1XA 5E8XA 3QLGA 3R1YA 4V04A 2LD4A 3RK9A 2EFJA 3BWCA 1YXSA 2PVJA 5KZ0A 5DM0A 4MIKA 1U46A 4FSUA 3HMIA 2IJMA 4LFIA 5HGIA 4ALUA 5LQKA 4DH8A 2G70A 4E1ZA 4HYHA 3R8VA 4LOQA 4DEDA 5HVKA 4C03A 4GKHA 3WILA 2YIXA 2GCDA 1XHAA 2XKEA 5ICCA 5HBJA 4BDHA 4FMQA 4FX3A 1H0VA 4U8ZA 1Q3DA 5KQSA 3EQIA 4ZTNA 3KQVA 4HNIA 2AOXA 5TKDA 4CMTA 3JY0A 4FKPA 2X6DA 3GFEA 2QOFA 3NYNA 5E7RA 2ZZNA 5KHXA 1N7JA 2VU3A 2OWBA 3I5NA 1XQZA 1F3LA 3P97A 3W55A 3EMBA 3BUSA 1FPUA 2BZIB 4HZRA 2J2IB 4QQNA 1KR5A 3MVMA 4EK9A 4R1YA 5JT2A 4FSXA 2BCJA 1P2AA 1JQ3A 5JMSA 1PMVA 4ZY5A 3ZRLA 3CCFA 1H8FA 1OIYA 5LJJA 4BVUA 3QA0A 2R6ZA 2OXXA 2V55A 3ORXA 1YI4A 4FL3A 4YTIA 3II5A 2ZV9A 2BR3A 1I9GA 3D7TA 4FZDB 3BHVA 3HMPA 5F95A 3TN8A 4AZEA 1H07A 2JIIA 4EH4A 4FTOA 1DI9A 3NYVA 4BGQA 5KKRB 3OWKA 4X2GA 3DS6A 4FTIA 2ZDTA 3WZKA 3FKNA 4PL5A 1JQDA 4R5YA 4BTFA 3FPEA 2ITTA 3FBVA 4LRKA 3PJCA 5ANEA 3G8BA 3V04A 4XLVA 3KXMA 4UZHA 1BI8A 2FSMX 1SUSA 5HIMA 3P8ZA 4RX1A 2JFLA 5IMXA 2ACXA 4WNMA 2W17A 4HVDA 3A7IA 3F7ZA 5EDRA 3HRCA 4QVKA 4CRLA 2JH9A 4MXAA 3D7TB 3GXLA 2UW6A 4I20A 5AFVA 2P55A 3MH1A 3FKOA 3ZFXA 3TT0A 4FSWA 1EG2A 3G0FA 2PK9A 5AUXA 2CL5A 4M3QA 5CNOA 1KYWA 4RLKA 4AF3A 3D5WA 4L3JA 2CGXA 2P4IA 2ADMA 1WBPA 4PCLA 3CPBA 3L1SA 4CMOA 4RGJA 3TEIA 3ER8A 3UQGA 3CP9A 4CFMA 3VHEA 4K6ZA 3DMHA 3BI6A 2HZ4A 1LPUA 4QMZA 3I9FA 5C03A 5EPEA 2VX3A 5ETCA 2BAJA 1KOBA 3VBVA 2VGPA 2H96A 2XCHA 2R3NA 4MX9A 3DBDA 3PSCA 4X2FA 4D5HA 2BR4A 1IAJA 4IBMA 1LR4A 4FR0A 4FKTA 4FV1A 1X1CA 3REOA 2PVNA 1YHSA 4BTKA 2R4BA 3ZCLA 3R30A 1ZOEA 4DCEA 1OECA 4J8NA 4WG3A 4HVGA 3GCSA 1SVEA 2EWAA 2C5OA 4H05A 4K6MA 4EWHA 4BP3A 2BTSA 2X0GA 4IM3A 3UC4A 4FTKA 4K9YA 2VV9A 4KS8A 2PE0A 2QVSE 1RI2A 4DFYA 4HYSA 2XM9A 4FOBA 4OLIA 4EOMA 4BBEA 1BKYA 4O2PA 4K18A 4M15A 1GJOA 3FC2A 4RTLA 4I0SA 5DRYA 4KWCA 4E30A 4I93A 1T45A 1CKJA 4D4SA 4IZAA 4E26A 3F5UA 3W2RA 3OE5A 4JVGA 1P4OA 3UC3A 3LXKA 4UN0C 4RFZA 5FEEA 3CTQA 2VO3A 1INLA 2H1RA 1WBTA 4PYLA 4GC9A 3UO6A 2C47A 2W1HA 3QQHA 3G89A 5FBOA 3MIYA 4TYHA 2BRNA 1YFLA 2QG7A 1EJ0A 3EN6A 3KULA 3IK3A 5EEGA 3EMGA 2O63A 4NM0A 3NNUA 1OUYA 3ANRA 4G56A 5I9YA 3HVCA 3TXOA 4EH9A 4EJ7A 4IDTA 3DY7A 4KRDA 1VZOA 5DR6A 1QCFA 3I6WA 2GH1A 3AC2A 3S4QA 3RCDA 3R63A 2EXMA 2OF4A 4DC2A 2HV9A 4BR3A 4X2KA 3RAKA 4ZZMA 2XK7A 3F5GA 3CSVA 1XH7A 2PKWA 2ETKA 1BKXA 4WBOA 2ITUA 4Z7GA 3KR0A 3QKMA 4PMMA 2CCHA 3ZEPA 4TYHB 2XM8A 3MFSA 4MNFA 5IPJA 1AQIA 5LARA 4RIWA 1PKDA 3KULB 3VS2A 4OTGA 4FT9A 4EVIA 5CT7A 1ATPE 2BZGA 4S34A 3ZMMA 1VL5A 4ZS0A 4E4XA 3DZOA 2WTVA 5CSPA 4XG9A 4F7JA 3EFKA 4FTNA 5HIBA 2VAGA 4UWCA 4YSMA 2FSLX 4U97A 5ACKA 1P91A 2JAVA 3QL8A 4C05A 2PVKA 2ONLC 3VS5A 2OGVA 3HRBA 4LM5A 4XUCA 2IDKA 4TRLA 4TWOA 1QANA 2X1NA 3GGDA 3RK5A 5CSVA 3R22A 3O23A 4QMXA 3KVXA 4KIQA 5DRBA 5EYDA 2RKUA 2BRGA 3ACKA 4EH2A 4IV8A 3HM2A 4YV1A 3QQUA 3CEKA 4DBNA 3DCVA 3PJ2A 2W0JA 4U42A 4PDYA 4DEGA 1Z3CA 4B4LA 4PYNA 3QWJA 5LVNA 3IOPA 3RWPA 1GIIA 4F64A 1MRUA 1UKIA 1VYZA 3EN5A 3ZH8A 3WE8A 5IQFA 1FGIA 1Q8UA 2IFTA 4WRSA 2XNPA 4FV9A 3R7UA 5EQJB 5DT3A 4F1MA 2RGPA 2X6EA 4RWIA 3G6HA 3DKCA 4HVSA 2WMRA 4X6RA 3UJGA 1RDQE 3CLYA 3BGIA 4J8MA 4O2ZA 1X1BA 4O29A 2FA2A 4FNXA 4FA2A 1W82A 4JQ7A 5EI8A 3OZ6A 4RMZA 5DIAA 4EOLA 4PP7A 4FK6A 3G9LX 4FT0A 2C6OA 5EYMA 5DGZA 3R0TA 5K9IA 4XP2A 3HV7A 4Z9LA 3RI1A 4C38A 4WVLA 3Q9XA 4TWCA 3TUCA 2Z7RA 1WBOA 5A6OA 4CKJA 1G8SA 5AP2A 4W4YA 4ZTHA 2WAJA 1UV5A 4GT5A 4FV2A 3QOXA 4IB5A 4C2VA 3EFJA 3EVCA 4FUYA 3NMUF 3MHTA 4ITHA 1YRPA 2IW9A 4YLLA 2H34A 2I0VA 1BL6A 3V97A 4UWYA 5DX0A 4V0GA 5H3QA 3IKAA 3WZEA 3W18A 2BZKB 4O7YA 3R00A 4IB1A 4BICA 5FEDA 4QMPA 3SXFA 3C6MA 1GIJA 1YHVA 4RSRA 2WGJA 3LXNA 5EW3A 4LQMA 3FPMA 1KE6A 4IVDA 4A9SA 2QODA 3WF8A 2YX1A 3M1SA 5AP7A 4QT1A 3PA5A 2XYVA 4GOMD 1RQQA 2FB8A 3RPRA 1PF8A 2Y8OA 3OOMA 5GWXA 3C4XA 3PIYA 3FUWA 1GZNA 4GEKA 4U6RA 4LV8A 3FUVA 3EQPA 4CGAA 2JKQA 4GIIA 2GU8A 3QQJA 4RA4A 2GPHA 1OBDA 4X1OA 3QXOA 3LM5A 2HW6A 2QYOA 4DBXA 3ERCA 1KUTA 3VS7A 4U7TB 4G17A 2J50A 3EYGA 2C0IA 3FLYA 2YEXA 2R0IA 3BPRA 4O7ZA 3LMHA 3TKHA 4C62A 3PXKA 3NIZA 4ZJIA 2E9VA 2BRBA 2PSQA 4XH6A 3IV6A 2YM8A 5D1NA 3CPCA 1ZQ9A 3HA5A 4FS8A 3VUKA 4A7CA 2VD5A 4Y95A 4CMUA 3P4KA 3AGMA 3O8PA 4L3PA 4J97A 4YJPA 1F38A 4MBIA 2X8IA 1HMYA 4JBQA 1G38A 3HP5A 4X61A 5M5BA 5H8GA 1GIHA 3AMAA 4R78A 5EOBA 3KXNA 2VDUE 4AP7A 3FMKA 3FPFA 5EGSA 3D2IA 3CVOA 4HGYA 4BB4A 3I58A 1XBAA 4YJRA 4ENXA 5CVDA 3SV0A 3D15A 4JL9A 3KU1A 4HW7A 1VEBA 2ZBQA 5K09A 3Q7EA 4QP3A 4OTQA 4Q9ZA 3ORMA 4BCKA 3HYHA 2ZMCA 4BLUA 3FQSA 3I60A 2CGWA 4PYJA 2ZWAA 1JNKA 4AGDA 2EG5A 1REJA 5CVFA 2WTKC 3HVHA 5EG5A 4OBQA 3FL5A 5E8TA 3MESA 4NM7A 2F4JA 3E93A 2C7OA 4FGRA 3ATSA 1AQ1A 4YMHA 3LFAA 4F9BA 3LFCA 3T9IA 5IU2A 1YVJA 1RI3A 3FHRA 1D2GA 2Z02A 4NW6A 4YMJA 3B8QA 4FGZA 2UYOA 4RZWA 3X0DA 2JKOA 3DK6A 3I53A 4G6OA 4J99A 4L9IA 4ZY4A 3A61A 1CTPE 3HRFA 3EFLA 1G55A 3L8PA 3GCUA 3FUUA 3CR0A 3NUUA 1SVUA 2PWPA 3NWEA 3G9NA 1KE5A 5E9QA 1PY5A 4IC7A 3UZTA 3PUPA 1TW3A 3QC4A 3LECA 4ORKA 3D9VA 4RX7A 3GRYA 4L46A 5JGDA 5AA8A 3DOGA 4Y46A 4OBOA 3KXGA 3DXZA 4UWBA 3OT3A 4CKEA 3KK8A 3VS3A 4BDBA 2AOTA 2E5WA 4IWPA 2W1IA 5CU3A 4DH3A 4KINA 1OGUA 3OW3A 1EAMA 5IA0A 4A6DA 2QRVA 4I5MA 2OZVA 3EGVA 3W1FA 3RW9A 3QRUA 5EHLA 2DPMA 4PYIA 3LGAA 3LXLA 1N7IA 5C9ZA 3PY3A 4KB8A 5HEZA 4QQ5A 4DGOA 4DLIA 3EWHA 3AMBA 5M51A 3EN9A 3MB7A 1W7HA 3A25A 2W9ZB 3SR4A 4OTFA 3AT3A 3RPYA 3DR5A 4Y30A 3E7VA 5DXAA 4GRBA 4CFFA 3HCAA 3GVUA 1ZY5A 4CV8A 2ITXA 4K33A 2QONA 4GFGA 3DTWA 4ALVA 3C9WA 2IO6A 4OGRA 4E5WA 5J5SA 5FHRA 3ZO1A 1U5QA 4FV4A 2C7RA 3MA6A 4EQZA 4ZSAA 2XB7A 3R24A 3DAJA 2V74B 4C59A 3AY0A 3Q5ZA 2CJMA 4M0YA 2B9HA 4RTJA 2QRVB 3P9NA 4CD0A 5E8WA 3UMWA 4FV6A 3D5VA 5J8IA 4E93A 1IG1A 4G3FA 5DRDA 3FUPA 3RMFA 3Q96A 2X4FA 2PY3A 4J52A 4ZJVA 2ZBRA 2NRUA 4ENYA 4GIHA 4U9AA 1IXKA 3QX4A 3MY5A 2XK8A 3WOWA 3VWAA 3ENHA 3GC8A 3P71T 5CAPA 2HXQA 5AAEA 4I23A 2QOOA 5AP3A 2ZLBA 1U54A 4D9TA 2WHBA 3UVPA 2ZZMA 3ZC6A 4A4OA 4USFA 4OT6A 3TJCA 5LVPA 1SKMA 3KKZA 4IM2A 5L2TA 2EB2A 1HCLA 2PX4A 1JKLA 4UY9A 3HMMA 4I6BA 4IKPA 4XX9A 3C13A 2R3PA 4WXHA 1MJFA 4K0YA 4DH5A 2XVDA 3BV3A 3HLLA 3TM4A 2YM3A 4LG4A 3KQYA 1M6EX 3CKKA 4L52A 3UJ6A 3DNDA 1XCLA 4MD7E 2ZZKA 4IX5A 2IZUA 3PX2A 3VBYA 3KQSA 4RRVA 3UBDA 4AUAA 2JAMA 3DFCB 4PWNA 4HYIA 3WYYA 5J1VA 3NTVA 1BC5A 4O82A 4ZTMA 3G88A 2CGVA 3PIXA 4WG4A 4QMQA 3U87A 3VJOA 1U54B 3GRZA 1T46A 4FODA 3T9TA 4XYFA 3NS9A 1Q41A 3P9IA 4XG7A 5AP1A 4CXAA 4QMNA 5HZMA 5AP0A 3CY2A 4WD5A 4FG7A 3ZM4A 3CD8A 2GAFA 4KUJA 1BOOA 4EORA 5EQEA 3FLNC 4Z3VA 4AG8A 4WO5A 5IUHA 5A4EA 2O3PA 4GU6A 4EC8A 3T8OA 4I24A 3LPBA 4FZAB 3FTCA 4YNOA 3B5IA 4L01A 4TL0A 4WA9A 4R7BA 4GUBA 3DULA 5T6KA 4I0RA 3JUHA 4EK3A 2WTWA 2JDSA 3TJDA 3A7HA 5KVAA 3MVLA 4RJ6A 4B0GA 5EG3A 2G9XA 3W8QA 4M68A
chains in the Genus database with same CATH superfamily
5I0BA 2GFCA 2XYUA 3A1CA 2OESA 3CEHA 2BZ0A 4I81A 4ZICA 3OBJA 2DH6A 4LNAA 3AVUA 4TTVA 3FPHA 2NVUA 5JG7A 5EMNA 3WXMA 5ALTA 3EN0A 3IDCA 2I0EA 4TXCA 1SD1A 9GPBA 5JSUA 3LYUA 1S8NA 3D0RA 3LXRA 4I4EA 3F4LA 1G3RA 2DC1A 5K3CA 2W4OA 4NU1A 3O74A 1K98A 2AMLA 3R20A 3BVPA 3UIUA 5JFOA 1NYQA 3KZVA 2HMVA 2FB9A 3VDRA 3CKMA 3VR3D 2Z5LA 1W2GA 2PXHA 3URMA 3B9PA 3B8HA 4EYMA 3OIVA 1NPTO 4CLRA 2Y3IA 1T24A 3C4FA 5F3WB 2I03A 3V7FA 2GXSA 4D4KA 2QSJA 1Z8HA 3BK7A 1T0UA 2C58A 1T36A 1S9JA 1GKYA 2VUSA 4GAEA 5EJ7A 3I0ZA 1WF6A 3L82B 4RTMA 2QYSA 4UAUA 2BI7A 3WGKA 1Q3WA 4D4HA 3RBVA 4EO9A 1HPLA 3KQTA 3O8CA 3AC0A 4X63A 2PGOA 1EA5A 2COKA 2L69A 2VWZA 1DT5A 3GUVA 4AMGA 3H9QA 3OF5A 1G9XA 4K6CA 3T0GA 5I47A 4KUEA 5TQ0A 4AXAA 4YN3A 5J4LA 2OLEA 2FLKA 2QEQA 1RWWA 4OLHA 3LX8A 2CN8A 3DMDA 1YACA 2VZ8A 1T4DA 4K86A 4MTLA 1GHTA 5TT0A 5JQGA 3PQDA 1EUDB 1XKKA 3OHMA 3EQ6A 1LJ8A 1M8KA 3F3SA 3HEAA 5KU7A 3JZAA 4JOBA 3WK9A 2E21A 2NU8B 3UKJA 4BNDA 4Z54A 3MUOA 4PCVA 3HKBB 1DPGA 3LLVA 3S40A 1KFBB 3WWCA 2AEEA 3QYWA 3C4CA 3C0GA 5BVDA 2ZT8A 2NU9B 2F1KA 5FPQA 4MB2A 4I8XA 5COBA 4JDJA 2V7QA 1R0PA 2CNWA 1MVLA 4RPVA 3G2JA 2D1YA 1I4LD 3W0MA 2Q4RA 1CQXA 5BUJA 4AL4A 1WJGA 3TLGB 3ONEA 4BATA 3VHQA 4C2AA 3NUYA 3NM5A 3UPZA 1CUDA 3I9LA 3A9TA 7MHTA 4R7HA 3IAHA 2GTMA 4LNUA 4D9BA 3GU8A 4GJ3A 3QITA 2AI1A 4TYJA 3H30A 2ETVA 3OSUA 3BBPA 3GLIB 4EW1A 2CBXA 4Y5QA 5AD1A 4ZAFA 4TXNA 4GSBA 4ENUA 3UG6A 3ZLWA 1KI7A 4TPKA 1RAHA 2G1JA 4RORA 2HY0A 3A11A 5KYUA 1Z4MA 2A3NA 2ZI6A 3QMWA 2HB6A 1E2UA 2J3QA 4JV5B 2ZOSA 2LDBA 3S7ZA 4LZWA 2HA2A 2W1GA 5LWQA 4EUEA 4DLJA 1I4OA 4LV5A 3UZRA 4M1WA 4NJ3A 5AK0A 1IRIA 2PTGA 1MOZA 3GCXA 4LL5A 1N34B 5JALA 3HKOA 1N2GA 3A7FA 5LQUA 1FC0A 1Z0IA 3NW9A 2I2AA 2WV7A 1NTRA 2R86A 1QC5A 2FSSA 3OY7A 4FVQA 3TZ9A 3PWTA 5I7RA 2Q9BA 4ZQCB 4F65A 4F9AA 1UPFA 4JLUA 1T8TA 2VYCA 4UU8A 1YJAA 1WZNA 3I45A 4PR0A 2WC1A 1WCWA 2I6TA 5KOYA 3UBTA 2YOGA 3BQRA 5I7OA 4AS1A 3SC1A 1J9GA 3HYNA 4HPUE 2FGIA 3MTBA 2I6QA 3RC3A 3N39C 2IPAB 5C26A 2RGNA 3JATA 1RYEA 2IUSA 4HSGA 5JR3A 1WIWA 2HW7A 1C8KA 3R8LA 2HMTA 2V9CA 2XYPA 2OM6A 2YCBA 4FS3A 2JJ1A 2ZM3A 3CUVA 3BGOS 1Y6RA 2OSVA 1TD1A 5AUPB 5EMKA 3WISA 3ODGA 1X7ZB 3ZHTA 1XVAA 5A2GA 1Y57A 1TI7A 3FLSA 2I3ZA 4JY7A 5ANDA 4UX9A 2BMFA 2HQRA 2FY8A 3BD6A 5LL6P 2OF2A 4WUNA 4HUTA 4ZAGA 2VWIA 2JW5A 2CMGA 2GNLA 5FD8A 4U6QA 2JCGA 4IICA 4FQ7A 3O9ZA 3P9CA 1CB0A 2FWNA 2XUUA 1Q5KA 5CF6A 2H57A 3PJEA 3C1AA 1EFCA 4QMWA 1T1RA 2QUHA 4QHSA 2GCEA 1JR4A 1TD9A 2PSDA 2JANA 1WMKA 2C6MA 1XTTA 5LCXA 4EEKA 4DCCA 4Q3BA 1XRMA 3MJHA 3WLFA 3DAFA 3P4UA 4ND8A 3NAYA 2WJVA 3NAMA 5ALGA 4ARZA 4DLLA 3DHVA 1NBWB 2ZT5A 1GGMA 2WABA 2W7TA 1OFTA 3MA3A 3G7SA 2HEGA 4BCNA 1YZ3A 3V5NA 3AKEA 1XO1A 3CLUC 3PLSA 5SZJA 3RU9A 5HUJA 3QHQA 3AOGA 3PDCA 1TZBA 1UDCA 4AA5A 3HV3A 3GROA 3KQPA 3WRYA 1QX4A 3LO8A 5DX8A 3U4IA 3AY3A 2VAMA 1WCXA 3W7VA 4QELA 2ZYDA 4ZDJA 2P67A 4I50A 4BNGA 3NVMB 2XA9A 3TL2A 1DAPA 4Z0PA 4EH5A 4DHIB 1ONBA 5IUNC 3MSSA 1U3WA 3KZNA 1U81A 1VHWA 4UXQA 3MQ4A 1QIJA 1Z3IX 3LO5A 4CR6A 4K6FA 4RHYA 3E5MA 4W1PA 5I9VA 2K2WA 1U2DC 5ADVA 2RG1A 1OBVA 1SQ0A 4Q2AA 1C80A 3T1OA 3RVKA 1RAGA 4GXRA 1OL6A 3ZLUA 1GXSA 2O64A 2IY8A 1XH4A 2F3TA 4JYZA 3BQCA 3ZSGA 1XP8A 3JZIA 5FUVA 1M3SA 5FYQA 3WYXA 2O7RA 2EC5A 1FDTA 1T1SA 3ETJA 1CDDA 1Z18A 4RV9A 4G9EA 5C5CA 1OI2A 4QUJA 4PONA 1ZHOA 3ZRMA 1KF0A 1P1RA 2IUUA 2IW3A 4A9AA 1XPOA 5E8VA 2BTQB 2FPLA 3SLGA 4DV2B 5AUZA 4IFCA 3BL5A 1OD6A 5DN6A 1PMEA 4PSUA 1KOJA 3E35A 4HC4A 4WCFA 2QU7A 1EZZA 5FR1A 4US1R 1YXMA 3DV3A 4O7RA 5IT9A 2FR1A 3NUZA 1NLFA 3HWWA 2XCIA 3PQ2A 2WG0A 1YAHA 2XUJA 2FHSA 1LF5A 4OMCA 3ENWA 3DT6A 1ISHA 1RXEA 1F2UA 4AWIA 4UBAA 5DW0A 3V7UA 2VX1A 4CYMA 1KYXA 5FV7A 4A15A 3D43A 1ZHHA 2XQIA 1W4ZA 3RTAA 3KB1A 2CLSA 5AI5A 1JHDA 3W4JA 3AI7A 1M6WA 2A9RA 4WN3A 3E8DA 4H1UA 4UC0A 2ZWVA 1WSWA 2WYIA 4LGCA 5BN3B 5D7VA 1VG0B 5EZSA 1YXXA 5FTWA 5DM70 1MRZA 2OZKA 5AVSA 4NJDA 4IX6A 1H5NA 4MPPA 1YQJA 4L45A 5EKSA 2PHKA 4AK9A 3EDRA 4XIFA 3B9RA 2HD4A 4JB8A 3CONA 4GZMA 5C3UA 3CE6A 2SHKA 2JCVA 3GDFA 3M42A 3EVGA 3ABSB 1E9DA 5FUWA 3ESAA 5BRNA 1Y3BE 4MQ1A 3TL8A 4HMQA 3S2FA 4EG3A 3KSZO 3H16A 1RPJA 3MWGA 4M14A 3I2KA 1H1LA 3GQBB 5T68A 5B30A 2ASVA 3AVPA 1F6BA 3OZ7A 2EFYA 3CO0S 3FAAA 1QPCA 3C7AA 4OSEA 1Y8AA 4OU5A 2FZVA 3N7TA 3E62A 3VR6D 1KE2A 2QD1A 4GX1A 2TRSB 1NBOA 2EXCX 3FOZA 2HU5A 4FT4A 5TF4A 4HDNA 2UZDA 1IY2A 4IFGA 2CMHA 4B6SA 4J43A 3GCVA 1VLMA 3LPLA 4IM0A 1OROA 4LC1A 3OZWA 3DLHA 4F4DA 4JR3A 1NP7A 2PMKA 3BMQA 1LK0A 4J98A 1AZTA 1QGED 2X14A 3AMYA 4KPEC 2Z4TA 4PZCA 3ZLSA 4EMTA 2VYVD 5EHXA 5ER6A 3DQZA 1QK4A 2EW1A 4MQ6A 3ESDA 3RR2A 2CCJA 1X8LA 5BYZA 3KUXA 2ONYA 4OKNA 1F5NA 4I66A 1V2GA 5BQ5A 4MMYB 1JQKA 1IRKA 1ZH6A 2BIYA 2XQGA 1YQXA 4DDMA 2QZ9A 1X39A 5GONF 5CP8A 2HTFA 2OB2A 4N5MA 3TOZA 4OOEA 2WOTA 1YRHA 1SPXA 3RB8A 5FBHA 5DB4A 3AUTA 4DUGA 4B33A 3R23A 1VBFA 5IJAA 1S3SA 1W96A 4W8HA 4LRXA 1XKXA 2OSCA 3RTDA 1BMTA 4CRSA 4LY3A 5BVOA 1EZ1A 1QGZA 4YZMA 2XDQB 4F85A 2OFXA 5K5XA 1UR5A 2IZOA 1NBMA 4JBPA 2IS4A 5JGAA 3IUSA 1W8IA 2FP4A 1IM8A 3OROA 1RYFA 2PIAA 4H1JA 3MGYA 1PJQA 4EDFA 3RC7A 3CQUA 3CVYA 1K7CA 1U7WA 3EL8A 2YRXA 2R2PA 4G1VA 5C4IA 3KZ1E 2J41A 4IHQA 1PV1A 4UCQA 4NCBA 3R09A 1GU0A 2VRNA 1X1QA 1Y89A 3AUYA 4PLVA 3FMPB 2HJVA 4DMGA 1Z73A 2Q8QA 3PA6A 3QVJA 2ERCA 5F2OA 3R1SA 2UUCB 1U8TA 3HJHA 3O75A 1UT6A 1L9XA 2GERA 4UZDA 2I40A 4MPRA 3GFTA 2CJWA 2IUFA 4XLTA 2BFCB 4JJRA 2ABWA 4J4HA 5AW1A 3BBWA 4TTRA 3ZY3A 2IS6A 1P0FA 3K1AA 1AC5A 3I1AA 4INZA 3T1NA 4A6XA 1BWRA 3A7DA 2I33A 2ZTUA 2WF6A 1WL8A 2H9YA 4F8YA 1LLFA 4HWSA 1ZM4A 3OLVA 2B53A 3MXOA 1UKYA 4ZA2A 3QU7A 1G18A 1P6XA 5ED4A 4EABA 3UZUA 5KB3A 5KKRC 2ADFA 4ZT3A 3HL7A 3KWMA 4IHJF 1OLXA 3EPRA 5GIPE 2C20A 4JXJA 2C5EA 2NUPB 3AIMA 5IH3A 1S2LA 5IARA 4ITJA 4XG4A 2UXCB 3HBJA 4NCIA 1NMYA 4RBNA 4X95A 2HXLA 2A94A 2QE7D 1Y6ZA 3SQNA 4URWR 4G3XA 4BCIA 1T3ZA 3ZWWA 4HPJB 3BD8A 4QGHA 2BW0A 2GYUA 1HGXA 5H02A 4FEXA 1RAIA 1OH6A 3OOJA 4FSNA 3DZFA 2GAJA 4C37A 1SHLA 2XWQA 4LXIA 1GADO 3EA4A 3BRSA 2JBWA 3FOFC 3VKGA 3GUHA 3UHFA 2GM5A 1TADA 2Q45A 3FI0A 2RHGB 2R96A 1E59A 3H9OA 5A4LA 2C3KA 1EBBA 4EM6A 3FNEA 4JS0A 3DE0X 1DKQA 4ZVRA 3LP6A 3OM1A 4IVPA 2O7NA 4BZDA 2XHEA 3VSBA 4FHEA 5BNWA 4QYSA 3HXLA 2AC5A 1KO4A 2WJHA 4Q93A 2PZRA 4JR0A 2CPKE 4AY4A 5JV5A 3U3RA 4R7TA 1JEYA 1ODTC 4G5XA 4YAJA 2JFOA 2GHGA 2QLJA 2DQZA 5BMOA 1WXEA 3ZE1B 2GZHA 1MH1A 2XNMA 1IEQA 3MM4A 5EQTA 3SICE 2ZS7A 1XDWA 5BRAA 4MMZB 4NENB 3F7OA 1NJGA 3PQ6A 3NHPA 2Z2KA 2WJ3A 2OHVA 3QLJA 1XXHA 2CHLA 5CEKA 5HJEA 2DOKA 2GSWA 2QL6A 4GU5A 1NKSA 2Y1OA 3KJEA 1XI2A 3IW8A 3N0XA 1RXSA 1QYIA 3ZC5A 3F5PA 3F7TA 2O8CB 2VF7A 2X4IA 4PAGA 4X3CA 3MB5A 5A9UA 1KE9A 4WOPA 1E63A 4A5OA 1GR0A 4BIDA 3QPAA 1P18A 4RCZA 4QSMA 4UEOA 2XRUA 1WX1A 3DFZA 3TM5A 3NZEA 1Z6AA 2YHSA 3HYCA 4I5FA 2KWIA 2G9ZA 4TS1A 5A4JA 4HI0E 2YM7A 3CXWA 3TNLA 3VV3A 3ASVA 4LCEA 2O8EA 4GZ6A 4F0GA 2D2EA 5JNRA 5FO0A 1T4GA 3ZDUA 1H2AS 4BQQA 1ZGBA 1WP9A 1PD0A 1Z25A 4ZVMA 2A30A 2AE1A 1P19A 4LF6B 3KT3A 1OFIA 1ZRNA 2DWQA 4EP1A 4Y3UA 2UZ4A 3LL7A 3TVTA 4RJ2A 1RLJA 1RC8A 1PEYA 2R6FA 4DSTA 2F17A 5BW4A 2JDIA 3NTXA 5KTTA 3CZ9A 1PTKA 4W8DA 3AGLA 3ZYCA 2W83A 3I30X 3DBFA 1B41A 4BKUA 4BLOA 4TTPA 2QKWB 4M1YA 5HRAA 5TQ2A 4YMSA 4FEWA 2PZJA 3V4VB 4F3CA 1GPBA 2FR0A 2WT8A 4YY3B 1NN5A 5IPFA 4EH7A 2XYHA 1XQVA 4EBVA 3ACJA 5HQ3B 2Q49A 4LOAA 2JLDA 4ZDWA 4BPBA 5KBYA 4ZTSA 4IIVA 3ZFYA 3EZNA 1R50A 2Y05A 3QBNA