1G8SA

Methanococcus jannaschii fibrillarin pre-rrna processing protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
230
structure length
230
Chain Sequence
b'MEDIKIKEIFENIYEVDLGDGLKRIATKSIVKGKKVYDEKIIKIGDEEYRIWNPNKSKLAAAIIKGLKVMPIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAERENIIPILGDANKPQEYANIVEKVDVIYEDVAQPNQAEILIKNAKWFLKKGGYGMIAIKARSIDVTKDPKEIFKEQKEILEAGGFKIVDEVDIEPFEKDHVMFVGIWEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN
publication title A Structural Approach to Gene Function and Structure Quality for Pyrococcus horikshii Fibrillarin
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 69
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1g8sA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g8sA02
5HE0A 3BKBA 4D9TA 3KKVA 4EH3A 5A4EA 3M6UA 1Y8GA 3QFVA 1GNGA 3E3PA 2JGZA 2J7TA 3FAAA 5CT0A 1VYZA 3NRMA 2XNGA 3EL8A 4BDBA 4FV1A 4KINA 4IM3A 2HV9A 4FSZA 2UW5A 5CNOA 3VIDA 5HG9A 1BKYA 1O54A 2YA9A 4U7TB 4MD7E 1XH5A 4FYNA 3H0YA 1X1CA 2QQ7A 1QAQA 1IA9A 5JFWA 4IKPA 1QPJA 3QV2A 2GS2A 2B9FA 4DFXE 3QD4A 2YAAA 2W1IA 1EJ0A 4ZEGA 3HMPA 2WGJA 1KOAA 3CC6A 4FSYA 4MWHA 3F3TA 5KNJA 4EH6A 3VC1A 4CTKA 2XIYA 2VTLA 3C6KA 3SDJA 2PVKA 5CF8A 2BILB 1BKXA 1N2XA 2PX2A 2ZBQA 4M69B 3UOHA 5DHJA 4FA2A 5KE0A 4XRLA 4W4WA 3PJ3A 4YZBA 3TR6A 1KIAA 2V0DA 2AUHA 3GRYA 4FUXA 2PMOX 2VO3A 1GY3A 3ZXTA 2B78A 3BYVA 5HVYA 4I0TA 4ER0A 5DX0A 3KULB 3OWKA 4O22A 2QHMA 4H05A 4GIHA 3G2QA 5CCXA 2YJSA 4MD9E 2YM6A 3LMIA 2VWBA 3E88A 3ELUA 2CKEA 3T9TA 5IH3A 4QPNA 4BYIA 4CQEA 4QQTA 2R7BA 4KRCA 3F5UA 3GP0A 3QD2B 2KULA 2PZIA 4KBCA 4YNOA 1KV1A 4RJ7A 2AOTB 1AQ1A 3OCSA 2ZZNA 2WMUA 4UZHA 2ZW9A 3I0QA 3NUYA 3RM7A 5FA5A 2K4MA 4RX8A 4FKWA 3R8MA 4ZZOA 3ZRLA 4R6XA 4RG0A 1RW8A 3G6GA 4BZDA 2PV0A 5HTCA 3P2EA 4M67A 5CXZA 3G2PA 3OW3A 2R3FA 2GNFA 4FT2A 1DL5A 5LSAA 3CPBA 2JLDA 3LCVB 3UQCA 2UYCA 3FYJX 2G2HA 1B39A 4CKCA 2IG7A 3RPSA 2DQ7X 2F4JA 1UU3A 2ZAZA 4QMNA 2FRXA 4L6QA 3HEGA 3IONA 1DAYA 5G1XA 1O6YA 5JH6A 3EMBA 3Q5IA 3F5GA 4O83A 3G2FA 5CI6A 3TT0A 5GJDA 2C6MA 4FSNA 3HMNA 4ACDA 3FXWA 2Z8CA 2X8EA 3TRKA 3JWGA 3DJ5A 3N4VA 4AZTA 4BIDA 2BRNA 2PKWA 3LHDA 3P97A 4R3RA 3ZLXA 5D11A 4KBAA 3LX6A 4A9RA 4NFMA 2QR8A 3L8XA 4FKPA 4RX5A 4E2WA 1OIRA 2PVLA 4UOEA 4PYJA 3E23A 4QNYA 2YM7A 5AUTA 2OXXA 1RQQA 4QYFA 3AMAA 3CCFA 1BC5A 4U6RA 3VHKA 4QQNA 3C0KA 4KIQA 4AFEA 4E6QA 4E7WA 1L9KA 3FQEA 1JWHA 3K5VA 4TWOA 1HCKA 3ACKA 4IV0A 2AYPA 3OP5A 3FRHA 3ALOA 3O7LB 3HA8A 5TKDA 1PJZA 2IZTA 4X3FA 4IX3A 3WI6A 3BIZA 5C8MA 2X39A 1IR3A 4USEA 1OBDA 3MV5A 3VUGA 5ICFA 5CALA 5LCJA 4IAIA 3GUBA 3BUSA 1DI9A 2EU9A 2PE1A 1VZOA 2HTEA 5HE2A 3DUWA 3DMGA 1OMWA 2XVDA 1YI6A 2OZVA 3CD8A 3D2IA 4OBPA 4HC4A 3NPCA 4PRJA 3G5DA 2C6DA 2XA4A 1XH9A 3COIA 5H9BA 5KZ0A 4G9RA 4TPTA 2ZV7A 4TYHB 3ZS5A 2ZB0A 4WUAA 1P5EA 4F6SA 5D1HA 4ZSEA 3A4TA 2VNYA 5JZNA 2G2FA 3GVUA 5LQJA 1OVEA 5IQFA 1KHHA 5IDNA 2C6IA 2XK7A 3FLYA 5IQIA 3IGOA 4YPDA 1WBVA 3TZMA 3SD0A 4QQCA 5HIIA 5IH5A 2OU7A 3WF8A 2C6OA 3FLWA 2RFEA 2C47A 4K33A 5CEPA 3W2PA 3DDPA 3TV6A 4PL5A 2WQBA 3UNZA 5L2WA 4H3PA 4K2RA 4A7CA 2VWVA 4EUTA 4UV0A 4RIWB 2ZV2A 4C4GA 3A99A 4F9CA 3OFMA 5F2NA 3DKFA 1UWVA 5E1BA 4IZAA 1KR5A 1H1RA 1FINA 5DFPA 4RTKA 4CG8A 4UX9A 1SVHA 4IAKA 1Q99A 1XDUA 3GCUA 4ZSJA 3I9FA 1D2HA 4C61A 4I92A 3G6HA 4QP4A 1JSZA 3TPZA 4O82A 1TQIA 3AWIA 1INLA 4YHFA 2CGWA 3MH3A 5AV1A 3F7ZA 3NX8A 2QI8A 1M2QA 1OB3A 4FTTA 3R9NA 3B3JA 3LLAA 2PVFA 3W8LA 5M56A 4BLUA 3D5VA 2PK9A 1Q8ZA 5HBHA 4C03A 1QMZA 4DEAA 4PGGA 3A7HA 3I5UA 4RTJA 4A06A 1RDQE 3OCGA 1G3NA 4FGZA 4XG3A 1ZRZA 2BRMA 4FUYA 3KPYA 5KCVA 3R9XB 3R7EA 1H1WA 3R7UA 2WB8A 3OWJA 5G6VA 2BDJA 3QKMA 5KKRB 1AQJA 4WO5A 4MQ2A 1XCJA 3A60A 5KMLA 1VQ1A 3MVMA 4EOIA 3KPWA 5ETIA 4E2YA 3THRA 3EQDA 4O29A 3EVCA 5I4NA 3LCCA 5KO1A 2QOIA 2WO6A 4EH5A 3U9NA 3KL8A 4RTQA 3DJ7A 3EYGA 3ZDUA 1OKWA 5DNRA 4I0RA 2VGOA 4BCQA 4E8AA 5CU2A 2NXJA 4AE6A 2NP6A 3MESA 3QLFA 1XDZA 5DIAA 3VQUA 1Y8CA 3RPYA 3D15A 3HVCA 2W9ZB 4AF3A 4V04A 3S3IA 3QU0A 5DM4A 4S31A 4X2NA 5DPMA 4C7TA 3UO6A 3KREA 4X6QC 1K9AA 4G5JA 5AP6A 1W7HA 3W2QA 4F1OA 3EN7A 3O7WA 4F9AA 3KPUA 3DS6A 2QE6A 4EQMA 1CSNA 3BWBA 2OIDA 3L8DA 4RGJA 3BX5A 4U40A 1UWJA 3JPVA 5A6OA 5DWQA 1G60A 3OFKA 4LMUA 2QRVA 3GFWA 4LRKA 1F3MC 3DTCA 4YJPA 3R30A 5GHVA 2VO7A 4P7KA 4DZRA 4EZ5A 1SYKA 3R8LA 3LBYA 1QPCA 5LMBA 4ANQA 3KY2A 3UIBA 3PJ1A 4ASZA 4OGRA 2FYTA 3A7JA 3K54A 2C5XA 5FEEA 3PZHA 3FZSA 4D4RA 1DI8A 3ZH8A 3TUCA 3ZUUA 5KMJA 4C0TA 4M13A 3QRJA 4AACA 4TW9A 1J1BA 1H1PA 3D4QA 2J9MA 2CKQA 2OZAA 4O7ZA 3LKDA 2ZMCA 4FKTA 3DULA 3GRUA 1B6CB 3A8XA 2R5TA 3KEXA 5ETCA 4D5HA 2W5AA 5FUBA 1GOLA 4NTSA 3F5PA 2G1TA 3SKCA 4BTKA 1PRYA 4PWNA 4B9DA 4RPVA 4FKGA 3FYCA 5CZHA 4ACGA 4GUEA 1NW6A 3ORIA 2I0HA 5A4LA 3DBQA 3KXGA 4ZY6A 3ROYA 3E64A 5CVHA 4AS0A 1NVSA 3W2RA 1OL7A 2XJ1A 4QMUA 3LECA 4DG0E 3GFEA 4XS2A 3EVDA 5KQSA 2YWVA 3GCQA 3C1XA 2XJ0A 4YZDA 3UO5A 3DB8A 3LSTA 5FEQA 1I44A 3GCSA 4FKIA 2N47A 3OVVA 2P33A 3KR9A 3F9NA 3U54A 1MQBA 4YC6A 4DCEA 1SQGA 3QA0A 4KABA 1XDSA 3L8SA 2P2HA 3HVKA 3BE2A 3BXOA 4Q5HA 4DEGA 3T0IA 4D9UA 2AOXA 4U7PB 5C0OE 4XLIA 1VR2A 2B0QA 2XIXA 4PYNA 4EOMA 2BAQA 4ISCA 4JAIA 3PZEA 3SR4A 2P0CA 4Z16A 4FI1A 2FSMX 2WEVA 3FLNC 4C07A 4HVSA 1UU9A 4FTKA 3DLCA 3KCKA 4J52A 4HOKA 4FVQA 2QY6A 4RSRA 4XV3A 5EKUA 2R3KA 2C3IB 5DM0A 3W2SA 5F20A 2CNVA 2XB7A 5A3XA 1X1BA 5K0LA 2AZTA 5EW8A 5JK3A 4IE9A 1ZG3A 4CFMA 5IA4A 4U7ZA 4NCTC 4CT2A 2OIBA 2Y6OA 4FSMA 4P90A 3EQCA 4UEUA 4Y46A 3KRRA 3E93A 4IW0A 4QOXA 3KQWA 3FZGA 1OKZA 4QMQA 2PWLA 1J91A 5KKRC 4CFVA 3ANRA 4IVBA 3BU5A 3QTSA 3BYSA 3KXHA 5I9UA 1N7IA 5DT4A 5GIPE 1JTFA 3FZPA 1A06A 5IEXA 3TACA 3CJQA 3E7OA 2VTQA 3EZRA 4ZTLA 4R5SA 3QCSA 4GG5A 3L1SA 4GC5A 4EKLA 3QZIA 1KPGA 4PIMA 5D1NA 3TM4A 2HY81 2QG5A 3HMIA 5DH3A 5EK7A 4ALWA 4E5BA 2EG5A 4RFZA 3PYYA 4YNEA 4TNBA 4U8ZA 1D2CA 4XG7A 3RTPA 2PUIA 1DAWA 2YIXA 3QX4A 5IA5A 5HLPA 4DC2A 2FK7A 2O05A 3E05A 2P1DA 3BYOA 1E1XA 2PUUA 4MXXA 4XV9A 4RTOA 3BQRA 4U79A 3JYAA 3UMXA 3CTHA 5GP1A 4E2XA 4ASDA 2C4GA 4IWPA 1IG1A 3DXYA 2JIUA 4UXLA 3W1FA 1SVEA 3MCZA 3EVEA 3V5TA 2EJUA 4RVTA 2R3MA 5JMSA 4GJ3A 3BWMA 1XO2B 4OBQA 5JN2A 3PLAE 2XEYA 3GOKA 4RQKA 1P14A 4JBQA 2UYQA 4DFZE 3A7DA 4J8MA 4BBFA 4RTPA 5IEYA 4NH1A 4C3FA 4EKKA 4ENYA 3G9LX 2EUFB 4I20A 3R24A 2HNKA 2IZRA 5ACKA 1BHJA 3D5XA 3TDWA 3UJBA 2CN8A 3AD4A 9MHTA 1AD5A 1XR1A 4FODA 4FP9A 4DH8A 3FQHA 4ZZNA 4YMHA 3BHTA 2PULA 1YDTE 1JG4A 4MTAA 4EJ7A 3SXSA 3DXQA 3HP7A 3RPOA 4L53A 4E31A 3DA6A 2XRWA 2QG7A 5D41A 5A14A 1OGUA 2NO3A 3MPTA 1M17A 4BP3A 4WKQA 2HIWA 2RF9A 3M6VA 4BRXA 3O8PA 2CMHA 2B9HA 1YFLA 3ZOSA 4XCXA 2UW8A 4KAOA 2X6DA 4I6FA 2QOKA 5F9EA 5CI7A 5HFJA 3BRBA 3FZOA 4DCAA 3QBNA 3ZFXA 2ETMA 3LVPA 1IAHA 3V5JA 4EONA 2GNJA 1SQFA 3QLGA 2J51A 5BYLA 2DWBA 5T68A 3OTUA 3HL7A 3WZEA 1NXKA 4OUCA 5CENA 3G88A 3EMDA 3RK7A 4F6UA 1H25A 3ZFYA 4XG9A 3JVRA 5EMKA 4Q9ZA 4DLIA 2ZWAA 4P58A 5ICCA 5E91A 4YUWA 2R3LA 1M6EX 2A27A 3QUEA 3LXLA 3BPRA 3SA0A 3UJ6A 4RWIA 2CPKE 3A62A 5FA8A 4BCFA 3NYXA 4PMSA 3FPGA 1T46A 3VJNA 2OI4X 4E1ZA 4O38A 3R83A 4HRAA 2E9PA 5AIRA 4A4LA 3BWCA 4F99A 1S9IA 3CY2A 2QOLA 2V7EA 4RX7A 4PGHA 4LGGA 4XRJA 3ODYX 4HGEA 5E8ZA 5BXYA 3HVHA 5K01A 5HOQA 2YQZA 2GDOA 2VZ9A 1R3CA 4YV0A 4RWLA 4D1SA 2PMLX 2J5FA 4XUFA 3R9RA 2P41A 2Z2WA 1M52A 4O7LA 3JY9A 3AC8A 4FOCA 3ZONA 4FVPA 3N4UA 4Q2AA 5J8IA 3VWAA 3GCPA 5IQHA 4P4CA 4IZ7A 5T6BA 5E9JA 1QL6A 1Q8YA 3IW8A 3L9MA 4MBJA 4PMMA 3GB2A 4II5A 3FTEA 2Z7RA 3EN4A 4QP8A 2BDWA 4YP8A 4AZWA 3ORNA 2PVCA 3ER8A 2V74B 4OTWA 3V5LA 4IDVA 4IMYA 4HVGA 2AVDA 2G15A 2XK8A 3RPRA 5DR2A 3RCDA 3QWKA 3TJDA 5EMLA 3MERA 3FMJA 3SXFA 1STCE 4WBOA 4UWCA 3AC1A 2AOVA 1CMKE 3BEAA 4P7JA 2OY0A 4EVIA 4UB7A 5K0GA 1ZMWA 2UW0A 2W1EA 4PQNA 3R8PA 4XBRA 4DITA 1RJFA 2X2LA 1JKTA 3W10A 5EQYA 4BZOA 3PJ8A 3KQVA 3PA4A 3RIEA 2R0IA 4F63A 4BDAA 5LCKA 4OTQA 2VO0A 3IYLW 3TLJA 4X21A 4O7TA 2PLWA 4HTFA 1FGIA 3KK9A 4W4VA 3N9XA 2YTZA 4CRSA 3EEYA 3FRIA 4F85A 4TT7A 2ETRA 4GMYA 3DGKA 4DEBA 3H9RA 1PXIA 5HCZA 3TNWA 3DBEA 2FA2A 3NDMA 2V7AA 4FKOA 5LWNA 2Y6MA 3QL8A 2CHLA 3AC5A 1WZYA 4FNXA 1JQEA 3VJOA 3MTEA 3KVWA 3LFFA 5K4IA 3E7VA 3I6UA 2BZGA 4YUVA 3QOXA 2WQMA 3FXXA 2HAKA 1F5QA 4ZAUA 3E8NA 2WAJA 5K0BA 4CTCA 4C06A 4FG7A 1XWSA 4FTAA 3CBGA 3NDJA 4EL9A 2XKEA 4L44A 5E8JA 3C0IA 2CGUA 2BCJA 3PY1A 3WARA 2F2UA 5DX1A 4F64A 4YLLA 3UYSA 5M4FA 4RVDA 2W1DA 4FGRA 5HEKA 3UJAA 3HUCA 3EQBA 3IO7A 2OFVA 2H6DA 3FUPA 2O57A 1H08A 5DVRA 1E1VA 3HMOA 3DTNA 3NNWA 4IAAA 3PJ2A 3RJCA 5DTRA 4UWBA 4WHZA 3GRVA 4FC0A 3F4KA 3IDPA 4ZXTA 3G90X 3WYXA 2O0LA 4AT3A 2FH9A 4A07A 3SXRA 1UU7A 4GC9A 4E5WA 4IQ6A 4YC8A 5BUJA 5FG8A 3B3FA 3SW4A 4DA5A 5ANEA 4EKGA 2GS6A 3Q6UA 1SVGA 3NUXA 1JBPE 4IJ9A 5E2BA 1JTEA 1KYZA 3UFBA 4YC3A 1XVAA 3HRBA 3QHWA 3QQJA 3LCUA 2C6LA 2WTJA 4IFCA 5B0XA 2PZRA 4ZS0A 3RZBA 2B55A 1BMKA 3MQ2A 3B8QA 3DNDA 2O5KA 4QYHA 1UNHA 4EOJA 3UIXA 2IZSA 3ZSGA 3PXFA 5LMKC 4DT9A 1LUFA 2EXCX 4D55A 3FUTA 3I7BA 7MHTA 4QMOA 3Q4ZA 3Q96A 4Z7GA 3ETAA 3COHA 3OE4A 3O7LD 4WNKA 3WSTA 2ONLC 2HCKA 4J96A 5BW4A 4FICA 5H8BA 1OL1A 4N6ZA 5IUIA 2WOTA 5KUPA 2HXQA 2YM3A 5HX8A 3NCZA 4S34A 5M51A 5FWAA 3GOPA 3HCBA 2CNQA 5IQCA 3KN5A 5KMKA 3PFHA 4E4LA 2GS9A 2YDKA 4GS6A 3DPKA 3GGFA 4IAYA 2QD9A 3HA7A 2WKMA 3VUHA 4GEKA 3PXRA 4O27B 4UYAA 2X9FA 4M97A 3ZC6A 4O84A 4F1MA 3NYVA 3D14A 2R3NA 3Q5ZA 2DUVA 3P78A 2X4FA 2FYSA 4IWDA 3RINA 3ZO4A 4A9YA 3WOWA 1AV6A 4EI4A 3BLRA 3G8BA 4YZCA 5CF4A 5EDRA 2Q0BA 2WQEA 3VBVA 2OJFE 3REOA 3MTIA 4AW1A 4EOOA 4FZAB 3GRRA 4E33A 3MY5A 3QTWA 2PT9A 4ZTHA 3VHEA 3HA6A 4APPA 4H0NA 3CPCA 3RHXA 3TM5A 2GMXA 5HNBA 1EJ6A 2I9KA 2XBJA 3G0EA 5K05A 3C4CA 2WTIA 3ZMMA 4U0IA 3B2WA 3OOGA 2PVJA 5LJJA 4XG8A 4MYGA 3B7PA 4PMTA 4F84A 4BDFA 4X60A 1W0XC 5EOLA 4B7TA 4D4SA 4D58A 1NE2A 1WS6A 4ZTBA 3ORXA 4OLIA 1VEBA 4RVHA 4RSSA 5JUWA 5D7AA 3KR1A 3PXQA 4H1JA 2CLQA 4C58A 2RIOA 2BIKB 2G71A 5JR3A 3IOKA 1QPEA 3TMAA 1URCA 1KXZA 1PYXA 3BHHA 3PPKA 4RYLA 5HLNA 5EMJA 2F57A 4G6OA 5FHQA 3GC9A 4NM3A 1J7LA 3R8UA 4C33A 4R5YA 3GCVA 3QRTA 4D2RA 2DS1A 2IH4A 3GI3A 3E7PA 1GJOA 5DN3A 3FZRA 4KIGA 2PX5A 2ERCA 5AM6A 3OXTA 3T7SA 3UJCA 3QTUA 3IG7A 1R1WA 3FPHA 4S32A 4FK3A 5DRDA 2IGTA 5A6NA 2QO2A 3VS0A 4G2FA 3Q9ZA 1YQJA 3IW5A 2G2IA 2XNPA 2Q0NA 2XRUA 2NXEA 4LMNA 4DMGA 5CASA 2JJQA 3ELDA 4G9CA 2BRGA 1ZYCA 2OKRA 3NNXA 4UZDA 5A4TA 3EVAA 4I0SA 1ZZ2A 3W2CA 2OO3A 1LR4A 1L8TA 5EHOA 1K2PA 4DF3A 5BVNA 4M8TA 1OUYA 4FTNA 4XBUA 4C3RA 4YV2A 4I4FA 4L68A 1JSXA 2XK6A 4HGZA 4IH8A 5BYZA 1WBPA 2V55A 4AT5A 4EQZA 2XCHA 2V5QA 4FSDA 5H8GA 5F2OA 2B2CA 2YUIA 3P9JA 4E2ZA 2GPYA 2BUJA 5M06A 3R1NA 5EM8A 5AUVA 4Y83A 1IM8A 4C36A 3KRLA 2ZM1A 5AA9A 4MIKA 5DX8A 2W9FB 3WIGA 3BT7A 4BDIA 2WMVA 1CM8A 4R3CA 3PXYA 2QLUA 5LVLA 1KE6A 4ITIA 4BDDA 4YJOA 4XV2A 5EFQA 4RT7A 1YXSA 4DE4A 5J87A 2CWWA 4B8MA 1PF8A 1YOMA 3P2KA 3GT8A 3AXTA 4P7GA 4AOTA 1WBOA 1P91A 2UYOA 3TFWA 3TQSA 4Z7HA 3ZO2A 2C68A 2ZDTA 4QYYA 1U54A 4FIFA 2PMIA 5AV2A 2Z7QA 4HTFB 4AFJA 1R6AA 1ZLTA 3KQPA 2X4ZA 4CTBA 2O64A 2VUWA 3TCPA 3H30A 5HILA 1OIUA 2OW3A 4YV1A 3E8EA 4QP9A 1ZOEA 3HEMA 1OPKA 4CFWA 2B9EA 5EZSA 5CLPA 1YW2A 3VULA 3ZEWA 4FZ6A 2PYWA 3HX4A 3MPAA 3B8RA 4RTRA 1SG9A 2RFNA 5JZJA 2QONA 3D7ZA 3OOMA 5BYYA 3QZFA 1R18A 4CFFA 3F2NA 4DH1A 3QUPA 4QP3A 3QX2A 1MRYA 4Z9LA 4ZTRA 4AGWA 1UV5A 3FKNA 3H9FA 1YXUA 3R8VA 3ZSHA 4NJ3A 1Y57A 4WSYA 5CVGA 4O7NA 3VUKA 2VD5A 4G56A 2HZNA 2WTKB 2JH8A 2XM9A 1VL5A 1TQMA 2VWIA 4C59A 3CCNA 4FSWA 3RAHA 1RJBA 4KS8A 1JPAA 4G31A 2C3LA 4WA9A 5EW3A 1XJ5A 1OIYA 1M2RA 2XYRA 5BQ0A 3LMHA 3BE9A 3UIUA 2BTRA 5DM1A 5CSVA 1M14A 3ORLA 1SNUA 5D7VA 5LQNA 1BYGA 2FO0A 1KPHA 5AP1A 4PMPA 4XUCA 3HVIA 4I5MA 5H3QA 3LPMA 2PVMA 3CSVA 2DYLA 3UWPA 1Q8TA 1H1DA 4JDKA 3KXNA 3VBYA 3I4BA 2X0GA 3TZ9A 3NCGA 2C30A 2PBFA 3G8AA 3MIAA 3IV6A 1BL7A 2R3IA 5HZNA 3NW6A 3DP7A 3OEFX 3OBJA 4ACHA 4N70A 3R9HA 4USFA 4FGBA 5DGZA 4DFNA 4ZSGA 4AU8A 5M4CA 2P3OA 1SZMA 2JIVA 5CF6A 1NV8A 2W5HA 2RFDA 5HU3A 3DB6A 3RWPA 3CBLA 5K5NA 1PMUA 3U55A 2YM8A 4BCGA 4IAZA 3GU8A 5LQCA 4YLKA 5IQGA 3MFUA 4CTJA 3FMMA 1G55A 2P35A 2XEZA 1YHSA 1Q61A 2OK1A 2PVRA 3PJCA 5DRBA 5GM1A 1U59A 2YIRA 2YM5A 4NTTA 4GUBA 3NUUA 3C51A 3CJFA 4M36A 4LYNA 4ASXA 4DFYA 3GC0A 2IIPA 4QP2A 1PYEA 3BWJA 4LOQA 3FY0A 2YXEA 2W1GA 1VP3A 3O2MA 5IU2A 2UW4A 1YVJA 3OS3A 3TKHA 5IA2A 4EEVA 2XYQA 3FMKA 4RC3A 1OECA 3O8TA 4Y30A 3LFDA 1KWPA 4XLVA 5AA8A 5IDPA 1Q0TA 4G3GA 3V8VA 2GTMA 4LM5A 3FL5A 2XKDA 4HYSA 4ZZMA 3WE4A 1W82A 4GFMA 2BALA 5CY3A 3T3UA 2JIIA 5CX9A 3IW6A 2FGIA 3KULA 4TYEA 3TNPC 5FTOA 5BVKA 3MN3A 3E5AA 4EWQA 2NYUA 4KWCA 4FSQA 2ESMA 2G1PA 2UZDA 3SAYA 5BUIA 2C0TA 3TV4A 3TNIA 4HVDA 5BPYA 3UE4A 4D28A 5C03A 1NV9A 3FUWA 3AMBA 5DSTA 2VP3A 5E9EA 3AT2A 5LVPA 3MSSA 2VX3A 2AOTA 5AP7A 2Z6QA 3HRCA 3ORTA 2ZIEA 4NU1A 3HCCA 4EOSA 1WG8A 4FSXA 2GFCA 2UVYA 3SSOA 4PYIA 2Y7JA 4K11A 3EIDA 4PTEA 2I0VA 5CU3A 2P2IA 5E8SA 4GUAA 3OMVA 4JDJA 2YIYA 3IS5A 4AW0A 4RZVA 4BDHA 3ELJA 1YWRA 2PSQA 4DAWA 4KUJA 5EHLA 4MBLA 4O86A 3FPFA 3OTVA 5HORA 2WPAA 4ZY5A 2ITOA 3NDIA 4JOAA 3AG9A 3ORZA 2H9VA 1FVTA 3BHUA 2YVLA 4AXAA 5ETAA 3K6RA 2W4KA 3F3VA 4RWKA 5J95A 3R9OA 3ORMA 3O0GA 3W32A 4HYUA 3OD6X 3TNQB 3BV3A 3S2PA 5DI1A 4PYOA 1XH4A 2WELA 2OXYA 3KU1A 4PYMA 1J1CA 4AZVA 2WTKC 2HY0A 3SC1A 4GOOD 1FPUA 4R7IA 5K3YA 3SRVB 3CQUA 4CZTA 3F69A 3QQGA 2RG5A 2WA1A 2YWPA 2AVNA 4HGYA 2BZIB 2CKPA 4AOJA 4TRLA 5B2MA 2Y9QA 2A2AA 3OWLA 2H96A 4FIHA 4IHPA 5E90A 3F3UA 5ANIA 3QD0A 4QTEA 3IDCA 5F94A 5IQAA 3RPVA 3V3VA 3M6XA 3FDNA 3B5IA 4EHGA 4EOPA 3HA5A 4MKCA 4RTSA 3PE1A 4X1OA 2ZV8A 2YCFA 5CAPA 4AZEA 4X0MA 3M70A 4GKHA 3EHAA 3Q4TA 2W06A 3HV4A 3TL8A 5DYJA 2YN8A 4FE2A 3D9VA 3EVZA 1ZZLA 5EKXA 4RBLA 3ZTXA 3SV0A 3Q87B 4AN2A 3FMDA 3FPEA 4O7YA 4TY1A 3BBTB 2V7OA 3FMEA 3QC4A 4ENXA 3FUVA 1CKJA 2JDSA 4JR3A 4RA4A 3LOKA 4N4SA 3D0EA 5EC8A 2CJMA 3EWHA 1PKGA 1JQ3A 4AN3A 1FJXA 1J7IA 4E20A 5LQFA 3HZTA 2HELA 3CKXA 3PIXA 4IM0A 4CGAA 3R7YA 4AZSA 3HCDA 2P7HA 4TYHA 4AA5A 5L6WL 2BTSA 3A2CA 3H2BA 5BMSA 1U54B 2W5BA 3IOPA 3WF5A 3QTIA 3FUXA 3PFQA 2OJIA 1WXXA 1YXTA 4JAJA 3E3BX 3HCAA 4JIKA 1RI2A 3SMQA 5L2SA 4DGGA 4RJ3A 3FBVA 2W0JA 4G1WA 3U51A 3FZ1A 4RLLA 4QTCA 3GQLA 2YZLA 4FTOA 4RX9A 5J9YA 2GNIA 3QCQA 2WMWA 3T3VA 4FS8A 5FULA 5DLYA 4JX7A 5CVDA 2WQNA 2AN3A 3OCJA 4ATNA 1CKPA 4RIWA 5AAEA 3C4WA 4DCMA 4C4FA 4YZMA 3FLZA 2W4JA 3HGKA 3HMMA 3BHVA 3V8SA 3I79A 2HMYB 5IH4A 4BDEA 4MNFA 1NKVA 1L3RE 2UVXA 3RM6A 4PYKA 4IX5A 2YJRA 2BZJA 1FPQA 4O0VA 4XG4A 5EIWA 1WBSA 3TIZA 3W18A 3BHYA 4ZJVA 4DG2E 1RJGA 4YSMA 2WIPA 2PX4A 4UY9A 2UZTA 4P2KA 2IW6A 3UA3A 3GBZA 5AP5A 3SSMA 4FKVA 4FV8A 4IX6A 4DBXA 2JDTA 5EH0A 4GL9A 4MX9A 5DEYA 5C9ZA 3I64A 3GQIA 3AT4A 5KMMA 3CTQA 4FT0A 4CD0A 3LAUA 3ER9A 1OZ1A 1R0PA 2YX1A 2BKKA 2ZMDA 1Q3DA 5TO8A 4KIPA 4EQUA 3EL7A 4BIBA 4Y85A 1PXPA 3AJDA 3EQGA 2O63A 5HLWA 2AC3A 4BN1A 4HGTA 2C0IA 5ITAA 2AS0A 3HYHA 2F7XE 5EYKA 3G5LA 1MQ4A 3E8DA 4XG6A 4GOND 5I0BA 1KV2A 5CSPA 3VF8A 3BLQA 2IVSA 1MRUA 3FHRA 3GC7A 3T9IA 2C1BA 3JUHA 5FLFA 2OBFA 3OPNA 3O71A 3KPJA 1ZYSA 1P39A 1JSVA 4PCAA 2HW7A 5L8LA 3CS9A 2Q41A 3PP1A 4TN6A 1OM1A 3W33A 2B4SB 3ULZA 5AEPA 4QVGA 4V0QA 1WY7A 4CMTA 2JKKA 5CU4A 1J3HA 3GU5A 4NKAA 4A6EA 3M42A 2VAGA 1Z57A 5AM7A 5KZIA 4NWMA 4W8EA 5FEDA 5ERGB 3QCXA 3UG2A 5HIKA 1MJFA 3U8WA 5BVOA 4A9TA 5CAVA 1WVWA 5DXAA 4OA8A 4A6DA 4M14A 1JNKA 3V8WA 4JJRA 4HZRA 2R3QA 2YM4A 3HDMA 3CGGA 4RLKA 5CVUA 5EG5A 4NKSA 2W1FA 2NP8A 5C1QB 1GZ8A 3MY0A 3DZQA 4FV3A 2R2PA 4QNAA 5ACBC 5FADA 3PTGA 1Z3CA 1Q4LA 2XM8A 4G6LA 4EZ7A 4CXMA 3HVJA 3CQWA 2JBPA 5FUTA 3EVBA 2GS7A 2WMXA 2R9SA 2JFLA 1F38A 2PZPA 3L9LA 3U9CA 5LVNA 4KDRA 1FP1D 5DBXA 3GNIB 2PXXA 2PVYA 5LVOA 4DBNA 5B1SA 4JRNA 4ZLOA 5BVEA 2CCHA 5EG3A 1A9UA 5EMMA 4DN5A 2OF2A 4GJ2A 4M15A 1IXKA 1MUOA 3EGVA 2ZIFA 3D2KA 4UWYA 3ZRMA 1MRVA 3DOGA 4L52A 2IW8A 4YURA 1KYWA 3D2LA 3LIJA 3PIZA 2OYRA 4TYIA 3KQOA 5J9LA 4PNKA 5HIMA 2XJ2A 4EYMA 5IKMA 5CAQA 2P55A 2IVUA 3GXLA 4RC4A 5E7RA 3QTXA 2IPXA 2HWOA 3BGZA 4IB1A 4O96A 4YJQA 1Q41A 3LCTA 4D0XA 4QMXA 3LMGA 2ITVA 3A61A 2JD5A 4FV6A 4F0FA 3FJQE 3ZM4A 4YJRA 4JIAA 1H26A 4LWPA 2ERZE 2O65A 4I24A 2BZKB 2OH0E 4IZYA 2XKFA 4BTMA 3MGYA 2VX0A 3A7IA 1OPLA 3EGIA 2R3PA 3AMYA 4XHKB 2ONZA 3RVGA 5KYGA 4AT4A 1TVOA 4K77A 3UVQA 3R7VA 4WRSA 4TYGA 4X2KA 3ZUTA 4QMVA 3CE3A 1JQDA 1Q62A 4DKJA 3V6RA 3DAEA 1HNNA 4A4OA 5IUGA 3H10A 4Y72A 3ITZA 4IADA 5EHIA 1U5RA 3GEQA 4HSGA 2YERA 1JOWB 3MCTA 2WMRA 2BIYA 2GU8A 5EM7A 4MBIA 3HDNA 4PCLA 3TNHA 2SRCA 4C08A 5HI2A 4MHTA 3NS9A 5AP4A 4I5CA 3KRXA 4DINA 4F7JA 4G5PA 4L3LA 3ENMA 3AY0A 4P5ZA 4FKSA 5EHYA 2PL0A 1NW8A 3O96A 2ACXA 3UPZA 1IEPA 5BP7A 5AFVA 4ZSAA 4J7BA 5JGDA 3QWJA 5CEKA 3O31A 1NT2A 2VV9A 2ITYA 2J0LA 3R7IA 4M38A 3GENA 3ZYAA 1CTPE 5AUXA 3HAVA 3SX0A 2BAJA 2G9XA 2UW3A 2XP2A 4GFGA 3LDUA 3Q9XA 5BUEA 5CEIA 2XMYA 3ET7A 3OCTA 3CJGA 5IQDA 4HPTE 4U42A 3AC2A 2JG3A 1BI7A 5CSWA 2VDVE 3UJ7A 3MVLA 5EYCA 2QCSA 3UMWA 3Q52A 1H00A 3F88A 2H11A 3IPHA 5JKGA 4FMQA 4QDJA 3TV7A 3FHIA 2Z6UA 4L7VA 3UJDA 4ZJIA 5TOZA 3G7UA 3FMHA 4IB0A 2JAMA 1QYRA 3FE3A 4I23A 2R3HA 3OY3A 1QAOA 3MA6A 5HCXA 3BGPA 4YJSA 4IJPA 5K4JA 3FYKX 3ERCA 3FTFA 5M4UA 3EN5A 1R00A 2NPQA 2EVAA 3DK6A 2ITNA 3MW1A 4C2WA 3BGIA 1HMYA 2X1NA 1OL5A 1QZZA 3GJYA 2H34A 4ZTSA 1FP2A 5L3AA 3SSNA 4EK4A 3HP2A 4E5AX 5J9ZA 3QHRA 3FI4A 3Q9YA 4GT3A 4K0YA 4QQ5A 5IG1A 4JXJA 4O6LA 4HJOA 2ZWVA 3JS2A 3WZDA 2W96B 3NUPA 3OT8A 2ITPA 5DEWA 4YHTA 4JG6A 3ANXA 5EYDA 2PHKA 4I6HA 1YHWA 3KVXA 3E62A 4ANBA 2JKMA 1JLUE 3CGFA 3CC8A 3ERKA 5C8NA 3NSZA 3PA5A 3QCYA 3HECA 4F09A 1X8BA 2ZBPA 5FDPA 4YLJA 3CJTA 5BVWA 2JKOA 5DTMA 5DXJA 4HPUE 1BUHA 3L9NA 1H0VA 3F66A 3OXIA 2UZNA 4ZTQA 4QP6A 1B42A 5E9WA 3JY0A 4DFUA 2E9VA 3TDVA 5HTBA 3QQFA 4CSVA 3UA4A 3BWYA 1G8AA 1V1KA 1OR8A 1ZQ9A 1U46A 2J0JA 4AG8A 4TWCA 3GGDA 4GYIA 4BCHA 1SVUA 3OROA 5EGSA 4FEVA 4HCVA 3KQTA 1I09A 1YI3A 5CQUA 3VYWA 1TPYA 3MVJA 2R3JA 2PGXA 2ITXA 3V97A 4GKIA 4JS8A 4DH3A 5C9CA 5G02A 1EQAA 5TR6A 3PG1A 3G2MA 4NIFB 4QMLA 4OTIA 2YCQA 1YWNA 3RNIA 3DZOA 2HOGA 4H3QA 3QTZA 5FDXA 4GG7A 1Q0SA 1OL2A 4M7IA 2PTKA 1ZMUA 3GNLA 4FT7A 5LMKA 3E8CA 4UYNA 2BROA 5EVJA 2ZM4A 1REKA 1YOJA 5FBNC 2ONLA 1TQPA 5EHGA 4HW7A 1JAMA 5I9YA 5DLSA 3LJ1A 1Q8WA 3P7CA 3I0OA 4CT1A 5E8YA 5CUQA 1XXLA 2GAFA 3LGAA 3IK3A 4HGSA 4H3BA 3GRZA 3S95A 1JSUA 2C5OA 3NYOA 4CVAA 3EQHA 1JKSA 4FVRA 2PWYA 1ZOGA 3ZRKA 3DLZA 2FSTX 3HV7A 5FTGA 3FPJA 3KHKA 3TKAA 4YZNA 4QYGA 4JLCA 3D7TA 2UYHA 3CD3A 3GIWA 2GHGA 5C4LA 4O0SA 1OUKA 3CP9A 2OH4A 5IA1A 1U2ZA 5B2LA 2BDFA 3HM2A 5BW5A 3Q32A 1OI9A 4FK6A 5I9ZA 4CG9A 3RW9A 2B9IA 5JQ8A 4FKLA 4CWAA 4RIXB 3FPQA 5IUHA 5AUZA 1Z9XA 1JSTA 2R4BA 1H8FA 3NVMB 4FV7A 2EJTA 2KW5A 4R77A 3PPJA 5M07A 1RJDA 4F86A 3KF7A 4BI2A 2YEXA 4NM0A 4ACCA 2F7EE 4M7RA 5U4XA 5EDPA 4EK6A 3S4QA 3VUIA 4O0TA 5TT7A 3NIEA 5T64A 3C4XA 3G0FA 3MAGA 4I4EA 1HCLA 2HZIA 1OIQA 2CGVA 3C13A 5CT7A 2FVDA 2PPQA 2P8JA 2W99B 4JG8A 2DULA 3HKOA 4FL3A 5AP2A 4TWNA 5EQEA 4ZP5A 3VF9A 4BY9E 2PE2A 5CTPA 4I5HA 4ER3A 1Q24A 4EHZA 3R21A 4HNFA 3R2BA 2F7ZE 1ZKDA 4RMZA 2Y8OA 4QMWA 1NY3A 3EVGA 4F08A 1Y6BA 3TIYA 4RX1A 4CMOA 3P9CA 2JBOA 4TNDA 4RQVA 4QTAA 3PFGA 4LL0A 3KRJA 1ORIA 2FUMA 2AOWA 4FKQA 4FKJA 4RJ4A 4Y73A 4QTUB 2I6LA 2W05A 3FZTA 3PVWA 3DLIA 4I94A 2ITTA 4RVMA 2X6EA 3SG9A 2CKDA 3LDGA 3PDTA 2C5NA 4BHZA 2FHPA 4O2ZA 3FI2A 4YU2A 5LXMA 4E6AA 4RTLA 4NT4A 3KQSA 5HBEA 3RKBA 4CFUA 2BM8A 3ZDIA 3O4FA 3FYDA 3B2TA 3UZUA 4BCOA 1UWHA 5M44A 2WA2A 4V01A 5A9UA 3KXXA 2BR5A 4F6WA 4FG8A 4KIOA 5CEOA 4BP1A 2GB4A 4WG5A 3DR5A 4QPPA 3FLQA 2BFYA 4K8AA 3II5A 3Q4CA 5FXRA 2UV2A 2YR0A 4DEIA 2UZWE 4GF5A 2QM3A 3LFCA 5E8UA 2CCIA 4GRBA 4YBKA 2A14A 5J7HA 3P0MA 2GA9A 4XX9A 5JRSA 1JG2A 4BGHA 3ZXZA 4OBXA 3R8ZA 3FKLA 3TTJA 4R7BA 5I9VA 4L9IA 5CVFA 3BWFA 5KBRA 3LM5A 3PUPA 3CY3A 2ZFUA 1HOWA 3FKOA 3U6HA 5FXSA 4PX6A 5E8VA 4E70A 2QURA 4JR7A 4H39A 4AX8A 3CKKA 5EW9A 4EK3A 2R0UA 3THBA 1NBHA 2VX1A 4DLJA 5IEVA 3OU6A 4L43A 4QMSA 4GK3A 2PUNA 2PVNA 2VWZA 3S68A 4HGLA 5J5SA 5HO7A 3KA0A 1OL6A 4M12A 4YJUA 4HCUA 3RGFA 4DT8A 4ZSLA 4AGUA 3KMUA 4BCIA 1VJYA 4XEYA 3Q2JA 5HG7A 3EPPA 4H36A 4EZ3A 2XBMA 3QXOA 4IAFA 4KIFA 4MK0A 5C1IA 4BYJA 2OZOA 1P2AA 5CS6A 4OQEA 3K3JA 1R74A 1R0EA 5FWDA 5CSHA 2Y1XA 4DQ0A 4WXHA 4BC6A 4BDCA 2NXCA 4NJDA 4GSBA 1YZHA 3F2AA 2AR0A 5EQJB 3IKAA 3V5QA 5JGAA 4L8MA 4ZMEA 5AV3A 3R0TA 1YI4A 3H3CA 1VIDA 1IRKA 1ZGAA 3NW7A 4U43A 4FKRA 3P7AA 3BGDA 4DFBA 2GHLA 3O8UA 4WG4A 3HRFA 3PVBA 3GU7A 3MHTA 3Q6WA 4C4HA 3MH1A 3VC2A 2X8DA 5IF1A 3NWWA 5KMOA 4E93A 5AX9A 4U80A 5AUUA 5FHRA 3PWDA 3UIMA 5I9XA 5FBOA 3P9KA 3EN6A 4CRLA 2IVVA 2HW6A 4U81A 3FY2A 4ONAA 4RC2A 4AUAA 4IC7A 4FV5A 4Z3VA 3PRIA 1KP9A 5EI8A 3V8TA 1OKVA 5DR9A 2NRUA 2XUUA 4RVLA 3OU7A 4FTRA 2BRHA 1JG1A 5FRIA 4FTCA 3ZC5A 2HWPA 2QU5A 1PY5A 5HG5A 2QYOA 3QF9A 3P7BA 4DHFA 5CU6A 3SW7A 4LOPA 3P79A 3DQWA 2WQOA 4RTNA 2BZHB 4EHVA 4O0WA 5EEGA 4R8SA 4FZFB 2I0YA 5EI2A 5C01A 3VUDA 3QQUA 3MA3A 2Y4PA 3VBXA 3U87A 4L7SA 5E1DA 5GM2A 4JDIA 3SG8A 4R78A 1Q97A 5FP6A 4MD8E 2B1PA 5EPEA 3K5UA 4B17A 5LQRA 3FV8A 4JBOA 1FVRA 2IFTA 4U97A 2QHNA 3IW7A 4EKIA 1M2PA 3T8OA 4NSTA 3AT3A 3NEWA 4LUDA 2OBJA 4C3PA 2BM9A 2PX8A 4RJ8A 2XNNA 3PPZA 2R3OA 3WF7A 2W1CA 2GFSA 3DU8A 3ODZX 4F7SA 5BNJA 5IH6A 4EWHA 4DTAA 2C6KA 1ZY5A 2ZLBA 3PSDA 5EM6A 4RTMA 5ETFA 5I9WA 2F8LA 4JQ7A 5JGBA 1L1EA 5A4QA 2X2KA 2ONYA 4JX3A 1YF3A 4IDTA 4CV9A 3WE8A 2C5VA 3G5TA 4YR8A 3VQHA 1S9JA 5F95A 4IWQA 3UNJA 4GT5A 4RWJA 1EH4A 2QOOA 5ANDA 4USDA 3FMNA 3BKXA 4CKEA 2JAVA 1WBTA 3W8QA 3DXZA 4QQKA 2WK1A 5CVJA 1Y91A 4DA4A 2WTCA 4W8DA 2VTHA 4O21A 3A25A 4ARKA 3VS3A 4MWZA 3KMMA 3EEOA 4TKSA 4ZJJA 2BAKA 3OWPA 2YIWA 4F9BA 2H8HA 1SM2A 1W83A 4APCA 2QOBA 5LOHA 3VRZA 3D7TB 4MWIA 2XH5A 1B38A 3A7FA 2YCRA 2XF0A 1NW3A 2P3QA 4MTLA 1PXMA 4FEQA 1PXJA 3BQCA 3AQVA 3TJCA 2XYNA 3OUNB 4FNWA 4BBEA 2FSOX 5HVJA 5D1JA 5CCBA 2OB2A 1I4WA 1AQIA 4XP2A 3TKIA 3R00A 2C3JA 3F61A 3H9OA 3A8WA 2VTMA 4P7FA 3DXNA 5HEZA 4ZIMA 3SVZA 2ITQA 2XNEA 1UFKA 4CCBA 3OHTA 5IQBA 4KRGA 2I7QA 5FXQA 1T45A 2PT6A 4KD1A 1SNXA 4HZSA 3UQGA 3JXWA 3KMWA 2G01A 2YITA 3LKZA 4YMGA 4XV1A 2PMNX 2E9OA 2C1AA 4ANLA 3MTLA 4NZWB 3ZO1A 4EK5A 4DEHA 4TYJA 3EH9A 4KVZA 3Q7EA 3QOWA 4RVKA 2X7FA 3KXZA 4MHAA 4AW5A 3AD6A 4L45A 4Y5HA 2CSNA 2P7IA 4RJ6A 3Q9WA 5FQOA 4C4IA 4D1ZA 3QRIA 3OZSA 4JL9A 4NW5A 4BKJA 2QLQA 4IVAA 3GCZA 4I21A 3C4ZA 3DFCB 2X2MA 2OPBA 5L6OA 3ZLSA 3OW4A 3EN9A 3W2OA 3LCDA 1XBAA 4UALA 3R0QA 4A9SA 4QTTB 2OO8X 4C4AA 4NUSA 4K1BA 4R1YA 1W84A 5IMEA 2XZSA 2G72A 1YHVA 3FQSA 3MPMA 3TZ7A 2CMGA 1UU8A 5KHWA 5AV0A 3TKUA 3MJ2A 1VE3A 3P9NA 4CV8A 3Q2MA 4TTHB 5AWMA 4M3QA 2YXDA 2J50A 4LV8A 2WMSA 1GZOA 3CXWA 4O7VA 2QKRA 4O7SA 3LFQA 2B9JA 1TW3A 4IM2A 4O91A 2P4IA 4LG1A 3TUDA 1PJKA 4DH5A 4AE9A 3PX3A 3UZRA 4ZK5A 3JWHA 3LXKA 3LPBA 3PXKA 5GOZA 3NLBA 2ZVAA 5E1MA 3DKOA 3SXJA 4UXQA 3UOJA 3JR1A 4DFLA 3NVKI 1FOTA 2VN9A 5DT0A 3R7OA 4YTCA 3NGAA 4BLWA 3KQYA 3RALA 4EBWA 1LP4A 3K0BA 3P1AA 5GIOE 3R28A 4FTJA 3N4TA 1P4OA 3WF6A 3U4WA 2ZV9A 2ITZA 4BB4A 4FKUA 4EC9A 3FC2A 1QCFA 1CKIA 4KDCA 4POOA 4N6YA 2WMTA 4FIJA 4BVUA 1G8SA 3VSEA 4EH2A 1PW2A 3SOCA 4FOBA 5I5ZA 4WNMA 4O7RA 4IBMA 4ANMA 5CSXA 5K09A 3EJ1A 2ZVJA 3NUSA 2R3GA 3EQFA 3F2RA 3MB7A 4QVKA 5JFVA 3VRYA 4JDHA 2JEDA 1WMKA 2OKCA 4X6RA 5CNNA 4E26A 3SM3A 5CEQA 2AOUB 1I9GA 1H0WA 2BR1A 1YDSE 5HIDA 2VDWA 4LFIA 2FSLX 3BLHA 3EB0A 5HQ0A 4PDPA 4YJTA 3ZUVA 1DCTA 1ND4A 5C8KA 2Q83A 2JFMA 3FC1X 4YUQA 4RWZA 2PWPA 4PNIA 4YTFA 3D83A 1ZOHA 2WU7A 1LEWA 4GT4A 3DQXA 3DTWA 1X19A 5LMAA 3ENHA 1JG3A 3FSFA 5DTQA 4MXZA 4O81A 3UNKA 4Y95A 4DGNA 3QQLA 3MB5A 5HHWA 1V0PA 4BDKA 4IWNA 5LVMA 1H4LA 1JQHA 3VS7A 4KSQA 5F2KA 3BGQA 5AJQA 3R1QA 2YHVA 5K5XA 4M37A 3ZU7A 3FSKA 4CMUA 3S0OA 3ORKA 4F4PA 3KXMA 3ZSIA 2C69A 3P8ZA 5FM3A 3D5WA 4X63A 3RAKA 4OTGA 1XH8A 3FMLA 5FTQA 3VBWA 1RE8A 3UC3A 3RAIA 3T7RA 2I62A 5IMXA 1PMEA 3G15A 4OBOA 3P2IA 3ZBFA 2OICA 3UGCA 1X1AA 3ZM9A 5EM5A 3WIKA 2VTOA 3DKCA 3R6XA 3VO3A 3HCFA 4Y5QA 3UVPA 5CEMA 2VGPA 2YFXA 2FCAA 5L2TA 5DT3A 2Y0AA 3CJRA 5JEBA 2A4LA 5F1ZA 5HO8A 4MVFA 4BGGA 2HR1A 2JDOA 4KW7A 1IASA 3LCOA 2UW9A 5LWMA 4FR4A 3VC4A 3B3GA 2VNWA 2RGPA 2ZM3A 3TN8A 2EXMA 2QC6A 2WU6A 2R7IA 3TUBA 3BEGA 2B25A 3BGVA 3PE2A 5HE1A 2YISA 2XNBA 3VS4A 4OW8A 3FWQA 3CTJA 2VZ6A 5IA3A 3SLSA 3THSA 3ALNA 3ZZWA 3MB6A 5E4HA 5EIFA 3ACJA 4AP7A 3W55A 3SRVA 3I81A 4IB5A 4FEXA 1UA2A 3POZA 1O9HA 2ZBRA 3TG1A 5FQDC 4HNIA 4N0SA 4NECA 3FTDA 3Q3BA 4PUZA 4FX3A 1ZMVA 4FIEA 4J95A 3KKZA 5HGIA 4E6DA 5T6KA 2GLUA 2B54A 3DMFA 5P8WA 5E8TA 3GU4A 1WBWA 1OITA 5DRTA 5HBJA 4D0WA 4NK9A 3HA3A 4NYEA 2R64A 2BFXA 3PY3A 4RIYA 3W16A 1FBNA 4BCNA 4EH8A 3I5ZA 4GU9A 3LJ0A 5HESA 1H24A 4YUYA 5BVDA 3QQHA 3BZ3A 5K0JA 3OBGA 4FEWA 1FMOE 3BYUA 5CF5A 1APME 4YUXA 2OLCA 1RI5A 2UW6A 4MAOA 3KR0A 1FVVA 5MHTA 2XK3A 2WMAA 3L9PA 3E87A 4KA3A 2R6ZA 4PY1A 1ZXEA 2PVHA 3GDHA 3SGLA 4P5QA 3OUKA 4LV5A 5DT2A 4DTKA 3CEKA 1NW1A 3VS6A 1PHKA 4WOVA 4EHEA 3A4PA 4KKGA 4ALVA 3LJ2A 3CVOA 4U41A 4XJ0A 2OXDA 1VPTA 2EFJA 5DR6A 2OF4A 3EQRA 2XYUA 1YXXA 4GFOA 2YDIA 4QPAA 3DBCA 3UQFA 5KHXA 2GNGA 4AA4A 4U3YA 4EORA 2NRYA 4QMPA 4QQJA 4AWIA 5EEHA 2F2CB 4OQDA 3RMFA 3V01A 4G3DA 1NBIA 4A4XA 4PP7A 3MH0A 4CFNA 5CIYA 4IEBA 5AADA 4MXOA 4QMMA 3UZTA 3ZO3A 4IB3A 2IW9A 3OG7A 4KRDA 3LFBA 3D5UA 4KB8A 4PF4A 4Y8DA 4F1TA 3NWEA 4F9YA 3NMUF 3P9IA 4FV9A 4QO9A 5K0CA 1PXKA 2GCDA 4GV1A 4RV9A 2C7RA 3TI1A 5CAUA 2WHBA 3I5NA 5IISA 4EJNA 4F7LA 5EOVA 2Z02A 3X0DA 4XP0A 2C7OA 5EOBA 3UP2A 3V51A 3WF9A 4X3FB 4FTLA 4KKEA 1V39A 3TZ8A 2GSFA 2J0IA 4W4XA 2GH1A 4LI5A 3A4OX 2QR7A 4X41A 4J1RA 4XP3A 4L01A 2CDZA 2O8YA 2IH2A 1XQZA 1ZYDA 3PP0A 1XH6A 5M53A 2ZSUA 3TOSA 3TXOA 5JT2A 2P40A 3HUBA 3NYNA 3UDBA 4OX9Y 3KC3A 4MQ4A 4QRCA 3NIZA 3LFEA 3E63A 4PDOA 3JWIA 4YSJA 3BV2A 3R02A 2I1MA 4FL2A 4FTMA 4TL0A 2YCSA 2AN4A 1J7UA 4LQMA 3WILA 1RJEA 2C6EA 4LUEA 3R2YA 4GOMD 3SQQA 1P1CA 2ZTHA 4PYQA 1ORHA 3E8SA 4EK9A 3DCVA 2OIQA 2PY6A 4BCMA 4AW2A 1UIRA 1RI4A 5HIBA 1NVRA 4YTHA 1CDKA 4YPSA 3PX2A 3ELWA 5DE2A 5BX0A 5DRYA 4U44A 2XIZA 4FEUA 2BMCA 3CKWA 2I6GA 3GU6A 2C6TA 4PTGA 1XBCA 4ZY4A 2VTNA 4PL4A 2WTWA 5L2IA 5CYIA 4KBKA 3P71T 1TW2A 4BI1A 4FT4A 4BTJA 1H1QA 4OTRA 2IN6A 4B4LA 3NAXA 5AUWA 4XH6A 3MBLA 4ZLYA 3TWJA 2ZULA 2FPOA 4YO6A 3EQIA 2RG6A 2QOQA 5CWZA 2WMBA 5K0NA 4I5PA 4WBBB 2FK8A 3F6XA 2VTPA 4B99A 3IGGA 3GU3A 2JHPA 5LARA 3HV6A 4I1ZA 4J97A 3RCJA 1ZYJA 3M6WA 4F0IA 4I6BA 2C0OA 5EDQA 4C4JA 4O7WA 2OGVA 3LM0A 1JKLA 4ZTNA 3DV3A 1REJA 4PL3A 5T3QA 4AGCA 1L3BA 4C04A 4FIGA 4HYHA 4O0YA 1I1NA 4PDSA 4D4VA 4GEOA 3LFAA 4U3ZA 4L67A 1YRPA 2JC6A 3G9NA 4EC8A 2QODA 4E73A 4D4YA 3QZGA 3FXZA 3DBDA 2BHHA 3ZEPA 1BOOA 4RVGA 4CEGA 4EOQA 2NP7A 4F0GA 2JKQA 3ZCLA 4AAAA 3ATSA 3CQEA 4Y2HA 4R6VA 2PZ5A 5CVEA 3UYTA 2LGCA 4FT5A 4O2PA 5E1EA 5M57A 2NNWB 1D2GA 5CZIA 3LXNA 3O51A 2HK5A 3Q04A 1EIZA 1RI1A 3BBWA 2HWKA 1PMVA 2DPMA 3JVSA 2UZVA 2WZJA 3PVUA 3C5UA 3EYHA 4XCUA 4Q5EA 4V0RA 3UP7A 3EKNA 3PTAA 3K2LA 4H58A 1UNLA 3KFAA 3QUDA 3LQ5A 4TZRA 4JG7A 3POOA 4YUZA 3AOXA 4K6MA 3KB7A 3WZJA 5HG8A 3VBQA 3REPA 2BVAA 2QRVB 2E9NA 2QOCA 4IANA 4EOKA 1GIJA 4OTFA 3FLSA 5HIJA 2AN5A 3C7QA 4ITHA 4O0UA 3UZPA 1O6KA 2JH9A 3SGCA 2VRXA 5A54A 2XIKA 4JVGA 3KK8A 2VS1A 3KPVA 5E1OA 4X3FC 2UZOA 1IAJA 3IEIA 3AXWA 2O2UA 4HCTA 2B7AA 2JHCA 3DKGA 2OZAB 4U45A 3KU2A 5IZFA 3AD5A 4FZDB 4X2GA 2EB3A 5HICA 4A9UA 5ICGA 3GXOA 2W17A 4G17A 2VO6A 1Y6AA 5H2UA 4ASEA 5KX8A 3MFSA 2OFUA 3ZLYA 4PP9A 3I58A 3KRWA 4DYMA 4AUKA 2BPMA 4EQCA 5HCYA 3DOUA 2I40A 4GQBA 5AUYA 4RRVA 4MH7A 2XNMA 3PRFA 4ZLZA 2OJJA 4C02A 3QALE 1SMHA 5GNKA 4ANSA 3PA3A 2IBSA 3R22A 2C7QA 4RIYB 1F0QA 3PVGA 3C5IA 1H27A 5LQKA 3UG1A 2PSSA 2C5YA 1SKMA 4FSRA 2UZEA 2Z7SA 4R7HA 5HU9A 5K0FA 2E9UA 4GW8A 3NWBA 3SHEA 2WTDA 3LBFA 3V04A 1O9UA 1H28A 2GQSA 4MEDA 2BRBA 3K3IA 1KE9A 5CD1A 3QGYA 4V0GA 5AV4A 2R3RA 3R3HA 4BCKA 4DEEA 1F3LA 2CLXA 1M6YA 3UBTA 4RA5A 5KBQA 1WCCA 3R73A 3EFKA 2GNHA 2WIHA 2GTNA 1BL6A 2HXLA 3UODA 3S1HA 3OCBA 1U5QA 4YTIA 3F3WA 3DNEA 4WT6A 3CR0A 1QAMA 4UBAA 5JQ5A 3MI9A 3A26A 5HNGA 1R8XA 2OXTA 4XUDA 5DOSA 4BHNA 2F49A 5DA3A 3EVFA 1XKKA 4B8LA 2CN5A 2WTVA 3OEZA 5M5BA 2XVAA 3I6WA 4HYIA 10MHA 5L8JA 2YIQA 5HIEA 4BLVA 2OJ9A 5DG5A 4FSTA 4IZ5A 5ANJA 2REIA 4R3PA 3C6MA 5CAOA 4QPSA 2PJDA 2GNLA 4XYFA 4OTHA 2X9EA 4GIIA 2QNJA 3LLTA 2XBAA 3MDYA 1V0OA 1KE7A 2IVTA 1PXLA 1UNGA 4O6EA 3MTFA 3H0ZA 3MH2A 1BI8A 3EFLA 3LZBA 2PE0A 1JVPP 4M0YA 3ORHA 2BHEA 3M11A 5JFXA 3QKKA 3PS9A 3SVVA 1NW7A 1M0EA 5H02A 3VNTA 1GIHA 4EYJA 2VWYA 3LE6A 1ZHFA 3VN9A 5EKNA 2BR4A 3M4XA 1DM2A 4TXCA 3UPXA 3UOKA 1G5SA 2OG8A 5EQPA 4GVAA 4AN9A 1KE8A 4CKBA 1NVQA 4EH4A 4G3CA 5KMNA 3PSCA 4J53A 4YJNA 3VW8A 3DJ6A 4R1VA 1Y8YA 5EKOA 5A4CA 3DMHA 4FL1A 1KE5A 3QAME 3BZBA 3KF4A 5TF9A 1TKIA 3M2WA 4YGAA 2VTJA 4PIPA 4CLJA 2XCKA 4GCJA 1M7QA 1P1BA 4AGDA 2UZUE 3VS5A 2UZLA 3EQPA 4NL0A 4LECA 2IDKA 5HNIX 4Z55A 4EK8A 3WZUA 3HV3A 5J1VA 3MJ1A 3OT3A 3MY1A 1M7NA 5DWRA 5M08A 5HZMA 4WNPA 4LOOA 2VU3A 3NW5A 3EFJA 4DTBA 3U6IA 3WZKA 1PKDA 3HTXA 2OB1A 1X1DA 4WD5A 1WFCA 1K3AA 3TM0A 3LCKA 4X2JA 5AP0A 5FM2A 2G70A 2XS0A 5FQNA 1O6LA 2VWXA 3C0HA 4C2VA 3BU3A 2YAKA 2W7XA 2PXCA 5IA0A 4FBXA 4K9YA 3UJGA 5K9IA 2XK9A 3FUUA 2J2IB 4DG3E 3DXXA 4RZWA 3O50A 5JRQA 3P08A 4FV0A 2ORED 3OU2A 1XBBA 3TEIA 4LGHA 3PG3A 3NTVA 1V0BA 1XHAA 4GK4A 3KQQA 4B6LA 4L42A 2YABA 4C62A 3DAJA 3VBTA 3IW4A 3QYZA 5E9QA 1NA7A 4F70A 3P86A 1YOLA 2JDVA 2WMQA 4W4YA 2HYYA 3G51A 2PUPA 3ME5A 2CMWA 4IFGA 2J4ZA 2G8NA 3COMA 2NXNA 3P23A 4EH9A 4RIXA 4F7NA 2IO6A 2E2BA 2GPHA 3LQ3A 3FPMA 3WBLA 3OE5A 4D5KA 3EKKA 1BX6A 1L3CA 2H00A 4DH7A 1DS5A 1VYWA 2WNTA 3VW6A 3I60A 4U9AA 5FCDA 4MXAA 2VTSA 2CGXA 2PZYA 3MFRA 3Q53A 5LQAA 2CNUA 4X3JA 2V22A 4CCUA 3C3PA 4IC8A 2FB8A 3LFSA 1G6Q1 4GU6A 1O9GA 4GH2A 2OSCA 4RFMA 1OKYA 4G16A 1XH7A 3BYMA 2ETKA 2ZZKA 4ERWA 4QT1A 1WZNA 3OC1A 3OZRA 4JRVA 5FGKA 2VTAA 3F3ZA 3AGLA 4L3JA 4BCPA 3ATTA 4M68A 2Y1WA 1LPUA 4I93A 4OT5A 2XVMA 4FR0A 3NR9A 2X7OA 4G34A 4YJVA 4FT9A 3VVHA 1W98A 4E6CA 4XMOA 5CM2Z 4KWPA 2OWBA 4DEDA 3F82A 4F65A 4MF1A 4S30A 2IWIA 3NNUA 3QGWA 1WBNA 3OFJA 4L00A 1R8YA 2B3TA 3ID6C 1OPJA 4HVIA 5LR6A 4YZ9A 3N51A 4JI9A 4S2ZA 3QZHA 2BKZA 4JNWA 2EB2A 4G6NA 1URWA 4V05A 3LQ8A 3DK7A 5ICEA 4G3EA 5J1WA 2YXLA 1ZY4A 5LQUA 2WOUA 4O0RA 5L8KA 2XKCA 1MP8A 3LFNA 2A19B 1YZ3A 3E92A 5HE3A 3JWJA 3LDFA 2VTIA 4K18A 2UUEA 3IECA 4JT3A 1VP9A 4G3FA 4L7FA 2I7CA 3UBDA 3HCEA 3RODA 3PT9A 4NFNA 2O0UA 2ERKA 2VDUE 3NUNA 2ZIGA 3HAMA 2EX4A 2XYVA 4Q9SA 4EMSA 4MNEA 1W8CA 4F9WA 4LL5A 2B53A 1Z5MA 2GHMA 5HVKA 3ANQA 4EOLA 5HD7A 2A0CX 4LWOA 3BCEA 5GWXA 5D9HA 2PXAA 4C38A 3HNGA 3AC4A 3KQ7A 4L46A 1Q3WA 2ITUA 3KGAA 3DH0A 1H1SA 3EOCA 5GINE 5M09A 1WXWA 3R1YA 3NAYA 3KQMA 5B2KA 4J71A 3QD3A 1PMNA 3C4EA 3LHJA 3R6TA 1PXNA 4GVJA 1OBGA 5JSMA 3DDQA 3D94A 3KR2A 4U5JA 2RKUA 4J99A 4LRMA 5C27A 3OZTA 4CXAA 3MS9A 3S00A 5T67A 4P7EA 4C37A 1YDRE 4OBWA 1YUBA 3G89A 4HH4A 2QVSE 2VTTA 4J8NA 1H07A 2UZBA 3GC8A 3RAWA 2X81A 4V0GB 4GYGA 3OF0A 5E8WA 3T7TA 2B52A 2ZB1A 5EI6A 3IDBA 4ZTMA 3NJRA 3V6SA 4FG9A 4PV0A 3AGMA 4I3ZA 5CU0A 2IP2A 2IBTA 4ID7A 3ZLWA 1DUSA 3PXZA 5C4KA 5AX3A 4CKIA 4GK2A 3UOLA 3DXPA 3F5XA 4PNEA 3EGEA 5FP5A 1XTPA 5HD4A 2RL5A 3UJ8A 2WXVA 4ITJA 4QP7A 4FZVA 3U6JA 4IVDA 3A27A 2JDRA 4DGOA 3RK5A 1GZNA 3UO4A 1ZARA 3ROCA 2A1AB 4JQEA 5DPVA 2Y4IB 4OA5A 2XK4A 3B89A 4HVHA 3EMGA 1ZGJA 3FI8A 3F7WA 4RVFA 4PINA 5JFSA 3PY0A 3LKMA 4C4EA 2BH2A 3QKLA 3H4JA 3QTRA 4MQ1A 1GIIA 3CLYA 3QQKA 3OXZA 3P5KA 4J98A 4DM3A 3R04A 2W1HA 3PVCA 1IY9A 3C4FA 3MFTA 3PSBA 3NNVA 3ZZEA 1WVYA 3LL7A 1YKRA 2QO7A 5L6PA 4FT3A 1G38A 5KMIA 4ERKA 2ESRA 4PONA 4ER7A 1MHTA 3QXPA 2R3SA 3FI3A 1UVRA 1GAGA 3DT1A 4JQ8A 3GO4A 4C34A 3DK3A 5CVVA 4FSUA 5E8RA 3A7EA 2IH5A 2QKWB 3VS1A 4WUNA 2QU6A 3LW0A 3QYWA 2JHAA 2VWUA 1PXOA 4OR5A 2J5EA 4NM7A 4FTUA 3C50A 3OY1A 2P3LA 2UW7A 2W1ZA 4XUEA 4YHJA 3ZBXA 4QTDA 2ZZMA 3UC4A 3UTOA 4ACMA 4EUUA 4BICA 1FMKA 2Z7LA 4WNOA 4S33A 3MIYA 5AIKA 1EAMA 4C35A 3G33A 4LRJA 3C0GA 3DFAA 5GJFA 1T43A 4M0ZA 3C3YA 4RJ5A 4R6WA 4H1MA 2ZJWA 4ZS4A 5IPJA 1ERKA 3IQ7A 5FTWA 4OT6A 3TKYA 4GOLD 5D10A 1FGKA 5DM2A 4AA0A 4KS7A 4Z2YA 1WVXA 3NZ0A 3HP5A 4KKHA 4IWOA 5AAFA 2Z60A 4ER5A 1YFJA 4AQCA 2XNOA 3HNRA 4FTIA 1LEZA 4X7QA 4IVCA 4EBVA 1KSWA 4FIIA 3BI6A 3ORPA 3FEGA 4BDGA 3MGGA 4QDKA 5E8XA 2IDJA 5EYMA 2YDJA 4X61A 3PB3A 5K0EA 8MHTA 4TWPA 2GQRA 3QC9A 3DLSA 4E4NA 3R01A 3QRKA 4BIEA 2VTRA 4BF2A 4R8RA 5M55A 4WRGA 3ZFMA 2I0EA 4ALUA 4RFYA 4WG3A 4JBVA 3V5PA 3R63A 3DAKA 4BI0A 2ZDUA 3KCFA 1WAKA 2WEIA 4ZOGA 2QOHA 5BVFA 1UKHA 4E30A 3U4UA 3KN6A 2X7GA 1YXVA 1R39A 2YZAA 2Z6AA 1RI3A 1SUSA 4AOIA 5AAGA 4FYOA 3OZ6A 3EFWA 5CANA 4YO4A 4AZFA 4BBMA 3U81A 5DSXA 3HLLA 3V5WA 2J0MB 4EH7A 3LCSA 4DCGA 5KS2A 2HZ0A 2BR3A 3Q4UA 2C7PA 2WFYA 1UKIA 3RI1A 4CFXA 4BR3A 4CZUA 1H01A 4QMZA 4RIOA 3M1SA 1P4FA 3L8PA 5ANOA 1A48A 3EZVA 4OTDA 3DY7A 1ATPE 2F9GA 2ZOQA 4FNZA 5K8VA 2JITA 5ANKA 3MYGA 3BKWA 1U4DA 5CXHA 5HKMA 3IHTA 4HG2A 2LAVA 4FTQA 4JXFA 3PIYA 2E5WA 3M33A 4PDYA 4DGLC 2PY3A 1ZWSA 1L3IA 2C3KA 3SX9A 4X2FA 1YB2A 2Y4IC 3L8VA 4QMTA 2PU8A 3CIKA 2HZ4A 4UN0C 3O17A 5A46A 4L3PA 4QTBA 3SOAA 2EWAA 4YBJA 5AP3A 5HX6A 1E9HA 3COKA 4R05A 5H8EA 3O23A 4KNBA 3RWQA 2QO9A 2ADMA 2XIRA 3TTIA 4ZMFA 1R78A 1IA8A 5FD2A 4GBED 3VAPA 3CGOA 2OJGA 4I22A 3RK9A 5K03A 4O0XA 4IIRA 1QPDA 4BCJA 5CQWA 2X8IA 4PYLA 4XOZA 1KUTA 3AXSA 4K6ZA 2J0KA 5KQRA 4B0GA 4C05A 5E92A 4FZ7A 4XOYA 3DBFA 1N7JA 4QYEA 5BMMA 4MNEB 5E2AA 1YWVA 2KTYA 1QANA 4FV2A 4D2SA 3BU6A 3FTCA 2ZYBA 3QTQA 3GWZA 2RFSA 4CNHA 3R1SA 4E4XA 2V62A 2H1RA 1VLMA 3QA8A 4MXCA 5KVAA 4CKRA 4WIHA 3NW9A 1XJDA 4BZNA 4YMJA 3UJ9A 4ORKA 2VWWA 5IQEA 3R71A 1JR4A 2LD4A 3G2OA 4CLIA 4MXYA 1ZAOA 2YACA 3MVHA 3PLSA 3RP9A 5C26A 3UVRA 4XG2A 3QRUA 3A7GA 1NW5A 3HV5A 2IZUA 2ITWA 1GZKA 2UZ4A 3C9WA 3VUMA 4XNEA 5F4NA 2WD1A 3P4KA 4FV4A 5D12A 4LG4A 2CL5A 2ZCJA 2IJMA 2O06A 2O3PA 5M4IA 1SUIA 4BDJA 1VBFA 4KSPA 4I6QA 4QMYA 2J90A 4PTCA 3I53A 5AMNA 4BTFA 5ICPA 2AC5A 3NUAA 2HENA 4I41A 3RHKA 2AOUA 2UVZA 4N57A 3I7CA 3PWYA 2W4OA 3FL4A 5E1SA 3LXPA 5B7VA 1KOBA 4NM5A 4IACA 1EG2A 4NCTA 4DGMA 5EZQA 4E32A 2GQGA 4ER6A 1KPIA 2CKOA 4MCVA 3BELA 3Q60A 3ZHPC 4WVLA 3I1AA 3WYYA 5GJGA 4D1XA 3AC3A 4BGQA 4IV8A 3ULIA 2QOFA 1AF7A 3ELYA 1JKKA 3MWUA 2J6MA 4E4MA 1AGWA 5ANGA 1BLXA 4PWYA 4FNYA 1FQ1B 4QP1A 2O07A 4NW6A 4IX4A 2P3GX 4JBPA 3VS2A 3R9DA 4M84A 4CKJA 1Q8UA 1XCLA 1Q5KA
chains in the Genus database with same CATH superfamily
5HE0A 2W4MA 2V6FA 3JYNA 2AKEA 5AUQA 3M6UA 4HNVA 1VYZA 2PGOA 3EL8A 4FV1A 2VK1A 4KINA 5BURA 5DYNA 3RFXA 2QYTA 4KPGA 3FN4A 3UK2A 4ZO8A 3TL3A 4KNYA 3O0TA 4E1VA 4E08A 1GQ2A 5DHPA 1PNRA 3H0YA 3O8CA 2I65A 2QQ7A 3QUBA 1IA9A 3EB9A 5JFWA 4IKPA 3VR5A 1ZI8A 4OLHA 4I66A 1B8VA 4L4SA 2ASVA 3D4NA 1WE2A 1WCWA 1S2NA 4RV4A 3FZYA 4HYYA 3T9DA 3PJDA 3PQCA 4YQFA 2Y4OA 4LXYA 3ORYA 2B8NA 2FWAA 1EBFA 2DUNA 4A0FA 2PQ6A 3T5AA 3GLIA 4OMFG 4D3XA 1PJSA 2G17A 2C9YA 5JXIA 2IHBA 3W5AA 4YZBA 4DANA 4ZOLB 3ASUA 1KIAA 4PQYA 2AUHA 3GWGA 3M4ZA 1GY3A 2A33A 2EC5A 2B78A 2HSWA 2JFUA 5HVYA 4TTIA 3HH8A 3FWZA 3SFTA 4I0TA 3S70A 1W46A 3F8WA 5B2FA 4IIHA 1TFUA 2VPQA 4O22A 3RVLA 4EJSB 2PZMA 3T7IA 5E3JA 5CCXA 2Z08A 5KYNA 3E88A 5M29A 1B3BA 1VBNA 1YZLA 3B38A 2R7KA 2Z58A 4QPNA 3C6YA 4CQEA 4IFTA 3OUZA 3UH1A 4GNKA 3OQ6A 3GP0A 2KULA 2PZIA 3VSAA 1JG7A 2VJPA 3O95A 2QGFA 1Z82A 4RJ7A 1K8XB 1H0KA 3O2QB 5COAA 2FKAA 4MS3B 1WULS 3KXKA 1T9ZA 4Y2SA 2XDQA 2JHGA 2ZW9A 3AUTA 5K4GA 5CW2A 3EY4A 3K70D 4AF7A 3RM7A 2K4MA 3R8MA 2NO7A 3ZRLA 4LXQA 3WMGA 5IAEA 1JFTA 2H1HA 1W0JA 4B74A 4JI6B 1O9BA 1RJ9B 3BFPA 2E21A 3CPBA 5LC1A 3LCVB 3UQCA 1W0CA 2YXPX 2G2HA 4KQHA 4M7WA 1AXRA 2XXBA 2Q5JA 2XE7A 2A5FA 3OOYA 2F4JA 4AW9A 3KOYA 3EMBA 3U56A 3FGPA 3G2FA 4JDPA 1FSZA 2AX3A 4P3KA 3D02A 3V34A 1PD0A 2Z8CA 1OFHA 2VHCA 3DJ5A 1V6AA 5A03A 1JR2A 3DLHA 3R23A 2WIAA 3P97A 4R3RA 1BE0A 3BMOA 5D11A 4KBAA 3CUSA 2BJHA 7AT1A 4NFMA 1ST0A 2H9IA 4UD2A 4D9JA 4I50F 3QYAA 3L6UA 4FKPA 4E2WA 3S7ZA 1IDN1 1KWKA 1H3FA 4UOEA 3PKJA 4QNYA 3WBKA 1XSEA 1C41A 2EFGA 2OXXA 1GITA 3HBFA 4QYFA 3AMAA 4RIFA 1BC5A 2HSZA 2IITA 1AGRA 2DAPA 4QD3A 3C0KA 4X66B 4AFEA 5KCMA 3RS0A 1L9KA 5HQJA 2PANA 1C0IA 4ZQBA 2QRHA 1UADA 4BO2A 3ACKA 3ZWXA 2PRIA 2W70A 3CZRA 1OVGA 1ZM3A 1QLHA 5TKDA 2IZTA 5ARCA 4YJKA 2ZR9A 3DOFA 3WI6A 3OBIA 4M98A 4DIDA 3HBAA 3B1XA 3A1SA 2J5RA 1JEYA 3IO5A 3KXLA 4M88A 3BPSA 4IGEA 4USEA 1MP0A 2YY5A 4G1EB 1DI9A 2PE1A 3AR8A 2OZVA 2M6KA 3STVA 4CQJA 1Z4OA 4EUEA 2BOVA 3TDKA 1O94D 1Z6GA 4PRJA 3THYA 4QKQA 5I7FA 5H9BA 4G5YA 3UC5A 2ZV7A 4TYHB 2JARA 3IESA 1GPBA 2ZB0A 4WUAA 1P5EA 2PFKA 5D1HA 4ZSEA 4DV4B 2VNYA 3KZNA 2G2FA 2FGJA 4AK9A 1Q7TA 1KHHA 3KYCB 5IDNA 1F48A 2XK7A 1K75A 1JDPA 3K16A 3IO3A 3BD6A 1WBVA 3D0QA 2PZLA 1SB8A 3K32A 2WTMA 4UHCA 2C47A 2YKGA 4K33A 3V6MA 4NVRA 5IUKC 4NULA 3DDPA 4PHTA 1OU4A 4F4HA 3GP8A 4PL5A 1MX9A 2WQBA 1DDIA 5L2WA 4H3PA 3M4JA 3JVDA 1Y7LA 4G24A 1XX6A 5IT5A 5JPIA 3RFFA 4LTMA 4C1NA 1JU3A 1UWVA 1UK9A 1TYCA 3VR2D 1H1RA 4RTKA 1Y4UA 3SJ7A 1SVHA 1Q99A 1IY8A 4D0NA 4HS4A 4X95A 1BSVA 3ZLUA 2G1KA 4ZVKA 4QP4A 3VFDA 1LSOA 1TQIA 4FHEA 1INLA 4GP7A 3N87A 3MH3A 1NZJA 1ODCA 2RGWA 2QI8A 3N6XA 2P5UA 1ZZEA 3F71A 3DVRX 1XMXA 4KKXB 3DE1X 3FZNA 4MUNA 2PVFA 5M56A 4W9NC 3HXQA 5LA6A 1QXSA 3WYAA 1SKUA 2WG0A 3SK0A 1Q8ZA 3CLUC 3I01A 3KIPA 4C03A 3W5CA 4PGGA 2QSZA 3F5QA 3I5UA 1OF1A 1RDQE 1G3NA 4QUIA 3L0OA 3ZE7A 3TG8A 4EY5A 5K2OA 4PQFA 1KY3A 2MSWA 2XCTB 4DUGD 2JHFA 5C80A 2P90A 2QTLA 4MQFA 3SZMA 2C84A 3QKMA 5KKRB 4PSUA 4YJHA 4MQ2A 1XBTA 3A60A 1VQ1A 4KLCA 2HQSA 4LNAA 1RYZA 2NSHA 3FVRA 1U3FA 5ETIA 4A0HA 4O29A 5LLSA 2ZIWB 3BJEA 5CYGA 4YY3B 3IERA 1DU4A 4UASA 4EH5A 2I7XA 2VDNB 2CDBA 4OATA 3FNIA 4ALMA 5DNRA 2OE2A 4CV1A 3ZJVA 1M73E 4OKIA 3MELA 4GR9A 3QLFA 3GGSA 1F8GA 2OCGA 1Y8CA 1W94A 1S3GA 5JY6A 2W9ZB 2JH3A 4YAJA 4GYKA 2V6IA 4D25A 3QU0A 2OPHA 4O4HF 4B6JA 3EIFA 4FFSA 3W3AD 1XHEA 4K26A 3OH8A 3UO6A 4G5JA 5AP6A 2JCVA 1J2EA 1XXHB 3WLEA 3AU8A 1GL6A 3EN7A 3AEKA 3CH7A 3O7WA 2B8WA 2P2SA 3IE2A 4EQMA 2QZJA 4O6VA 2VHQA 1E1YA 2JAXA 2VBGA 1ODIA 3KUDA 3BX5A 4BN5A 4U40A 5A6OA 4MO2A 5DNAA 4YECA 4LMUA 5KNDA 1F3MC 3R30A 5EP3A 5GHVA 2OBNA 4EZ5A 2Q1YA 3KHSA 3LBYA 1RHRA 3NHWA 4D81A 2BGUA 2PLRA 3JQCA 2VQSA 1L4YA 3A7JA 3PZHA 3FZSA 4CIXA 4PBTA 3TLEA 3TUCA 5DEIA 3ZUUA 4Q1VA 2W6JD 4GIBA 3QRJA 2QP3A 3T5PA 3WR5A 1J1BA 5A4DA 3RJ5A 2OZAA 3LKDA 2ZMCA 2D1YA 2Y67A 4IGKA 1LLUA 4YMTA 5T4HA 1B6CB 2EVWX 3A8XA 3AL2A 4BQQA 5ETCA 4M7OA 1DARA 3DCNA 3DOIA 3I8XA 2VJYA 1MGOA 2W6MA 3SKCA 1PRYA 4B6EA 4PWNA 1BA3A 2YDXA 5EKSA 3JZIA 4RPVA 5ANRB 3L92A 5CZHA 2F3PA 4GUEA 1CY4A 1NW6A 4M9XA 3KX2A 3ORIA 2I0HA 3DBQA 1OLXB 2HEGA 4R2MA 2Z2JA 3W2RA 3JQEA 4QMUA 4DG0E 1Z7WA 5J23A 3EZ7A 5FPKA 2YWVA 5AVTA 4UTVA 3BE8A 4M7PA 5FEQA 3NJ8A 2EQAA 2FZVA 2PYDA 5IT4A 2EBUA 3KV3O 3TRJA 2N47A 3OVVA 3KR9A 2A1UB 4DCEA 3QA0A 4ALLA 1XDSA 1TAQA 3BXOA 3WYFA 4D0RA 2I1QA 4D9GA 1G6OA 1XA3A 2IIVA 3JYHA 1TUEA 3LVQE 5A4KA 1C8LA 3T0IA 2FN3A 1VR2A 3P9RA 4EOMA 2BAQA 1S1CA 2QTMA 4OX9B 3PZEA 4KQXA 4I08A 4PLVA 1LTHR 3D8UA 4M46A 2RG1A 1PWEA 4WESA 2FSMX 2O2XA 3FLNC 4FNMA 4LYAA 4HVSA 4FTKA 2I4OA 1AE1A 2VP2A 2VTEA 4Q9KA 4BFXA 2QY6A 4RSRA 5ILOA 5EKUA 2J07A 1BQEA 1Y1LA 4PS1A 3F78A 3EC1A 3WWYA 1CEEA 2C5SA 4ZYXA 5B58C 3BCUA 3DPSA 1ZG3A 4IMIB 1Y89A 4P90A 3EQCA 2J41A 1W88A 4O4JA 4KPUB 4BVFA 3KWLA 4V0LA 2R1VB 3DV9A 1OKZA 1WTCA 3IBGA 3N74A 4CFVA 3ANRA 2OOSA 4IVBA 1DJNA 4UTPA 2AZXA 1BCRA 3DDCA 1QE3A 4OAOA 2NG1A 3C5EA 3SQDA 1H0SA 1WMDA 3WDSA 4MVJF 4ON9A 2WIBA 4R5SA 4Z4CA 1Q20A 2NOAA 3GJ7A 4YJ3A 3GCXA 4GC5A 2EFYA 4ZKDA 4UVEA 5EQFA 1O89A 1MA0A 1KPGA 3QLUA 3UAXA 2FEOA 3ILYA 4QDZA 3ZCRA 1EFLA 3NEJA 5DH3A 5EK7A 2X8WA 4E5BA 3QLJA 3BAFA 2RMKA 3GP5A 1C8KA 2J87A 5GJCA 4ZK2A 1Y6GA 4U8ZA 1D2CA 5TNXA 4WLFA 3U6BA 1U0RA 2ZSAA 3QXSA 3MWGA 1L4KA 3EGOA 3Q6NA 4PG5A 1SUPA 1T4MA 2P1DA 5CK4A 3OIWA 5TF4A 2Q5OA 3L18A 1JZQA 1EVIA 2C9ZA 3L4KA 4XIFA 4XV9A 4U79A 1OJ7A 2P9CA 3LX4A 4G4GA 4LF6B 4E2XA 4IOLA 5K6AC 2W11A 1GWNA 3W1FA 4Y2VA 4TTRA 1P2FA 1SVEA 3EVEA 5A3SA 5FL7A 3BSYA 2CBGA 1UOQA 3MILA 2R3MA 3M0EA 1JJBA 2Q07A 2QTVA 4CLHA 2ZRIA 1OXBB 3JD0A 4Q21A 3W90A 1P14A 1UDBA 2XVZA 3CX3A 4B4OA 3LP8A 4BBFA 4KZKA 1ICEA 3K9QO 4RTPA 5IYZA 3T38A 3V2IA 4DOMA 4ENYA 3LPDA 3G9LX 1XCGB 1GU0A 2HNKA 1CJCA 5AW3A 1RMTA 5ACKA 1KA9H 3UJBA 1KEPA 1LDGA 4FODA 3FQHA 2XW6A 1RYYA 3ORQA 3ZCTA 2EZUA 5CEFA 1JG4A 1N75A 4EHIA 1FMFA 4MTAA 1Q44A 2PKYX 3SIRA 4L53A 4G41A 4IQFA 3L1IA 2QG7A 4GU5A 3QE0A 3TNLA 1NN1A 3MPTA 2NZVG 3T94A 2FG5A 1DDGA 4X44A 2RF9A 4BRXA 2CMHA 3ZOSA 4XCXA 4KAOA 4NH4A 5EIEA 1L5QA 2R6JA 4I6FA 4YR9A 4IDQA 3A28A 1EAYA 3ZVNA 3EMKA 3BRBA 3FZOA 1ZX1A 2R751 2B7CA 3QBNA 2ETMA 2MYNA 3TD9A 2EW8A 2GNJA 3QLGA 1N3YA 2Q62A 1M2HA 3OTUA 1PT5A 2CCGA 2VUIB 5MFPA 1NXKA 3G88A 4OQMA 5E2IA 1BWRA 1UC5B 3PC3A 4MR7A 3AVYA 1V71A 2PGIA 1A2BA 4AZ3A 4M87A 1ZNZA 3ZK8A 5E91A 4YUWA 1QRAA 1EFTA 2A27A 1IBSA 4X1YA 3LXLA 1C14A 4DV7B 3OF2A 3FAKA 2I8CA 3LK7A 4M9RA 3FPGA 3B3AA 3VJNA 2OI4X 4L85A 1F7VA 1MTZA 4V3BA 3F3MA 5AIRA 5E7JA 3B9RA 1Q84A 2FPPA 3PFYA 4ARAA 1S9IA 1UANA 1VRWA 2QX6A 4G97A 4RX7A 5E8ZA 2TMYA 5SYNA 2YIDA 4L2IB 2GDOA 2VZ9A 2RSLA 2ZKIA 1ID1A 3ZE8A 1G1MA 3C1AA 3SEAA 1CJMA 2P41A 3UMYA 2Z2WA 2UZ1A 3U09A 1M52A 4O7LA 2JK1A 3JY9A 4RH1A 2DH5A 3ZONA 3SOPA 3N4UA 5J8IA 4JI1B 1GVNB 5LZ9A 4AQ7A 3PNMA 5E9JA 2RHBA 2C98A 1IN4A 4X7PA 3TD2A 3URMA 1N32B 4PMMA 3DEIA 1T8UA 3FDFA 3GB2A 4IIYA 3NKFA 3D7LA 4R9NA 2BDWA 1D1TA 1BXRB 3KCQA 1IHUA 2R47A 5I7RA 1RBZA 2OYSA 4BO8A 3CR3C 4B34A 4IMYA 4HVGA 4Z6KA 5EHNA 2FFJA 4R8MA 1DQPA 2XK8A 4FD3A 5DR2A 4PNPA 3BXGA 2ZSFA 1B15A 1HWYA 3AZQA 3BREA 5B2ZA 3IXMA 3BRCA 3AC1A 2DP4E 2P5YA 4BE7B 2E4VA 1U2RA 1Q3KA 4PU0A 1BFDA 1ZMWA 2W1EA 1ZRNA 4PQNA 2ZJ2A 3A05A 3R8PA 4BAGA 3D3WB 3H2GA 1PYOA 1Q1QA 3EOZA 3DJYA 1CY0A 3W10A 4Z3OA 3KQVA 2XOKD 4F63A 4BDAA 3RM3A 4UTRA 1XELA 4D5EA 2VO0A 1ZPDA 1L7VC