4GKHA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor 1-na-pp1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
254
structure length
254
Chain Sequence
NLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gkhA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4gkhA02
3QCYA 1H4LA 4TNBA 4AT4A 4FT9A 3FQEA 2QOLA 2BZHB 4KWPA 4EH9A 5M06A 1CKIA 4EK3A 3KA0A 3U4UA 5I4NA 4AUAA 3FSKA 3MA6A 3CSVA 3QBNA 3QZFA 3DZOA 4RX7A 4RC3A 2WEIA 4QMSA 5JT2A 1WBOA 4IQ6A 3E88A 2CGXA 3LCDA 3G6HA 3PA4A 5HVJA 3T9IA 3W8QA 1Q8YA 4ZY4A 1FMOE 2I40A 3OOMA 4HNFA 5IQFA 3HV4A 4E6AA 3OXTA 4QP7A 3K2LA 3QTRA 3LAUA 4MQ1A 2GQGA 3N9XA 2XYNA 5EHYA 3QX2A 5AFVA 4QP2A 3RNIA 2B1PA 3DK7A 1H0VA 4GMYA 1SMHA 4QTEA 4QTBA 2YZAA 3QQJA 3QRKA 1F3MC 2R64A 2YHVA 3C5UA 4GK2A 4ZTQA 2PE1A 4DEEA 5CAPA 3W10A 5AA8A 1T46A 4R1YA 3F69A 3DFAA 3NR9A 2KTYA 4F7LA 2W4KA 5HO8A 3D14A 4QTCA 3RJCA 4XG2A 2VWIA 4U5JA 3HV6A 3GCQA 5CTPA 4MBJA 3TDVA 4ITIA 4FNWA 4M67A 1KE5A 1H08A 3IW7A 4ZJJA 1PXMA 4AA4A 2W05A 3RZBA 1WCCA 4ANBA 4BZDA 3HGKA 5HGIA 5AMNA 5ETFA 3IO7A 3EHAA 3NYVA 5C8MA 5B7VA 3EQPA 5FRIA 4ENXA 2QR7A 2R9SA 4MQ2A 5GIOE 3FLZA 3PXYA 4WSYA 2W5HA 2C6TA 4IVCA 2BDWA 5DEYA 4ZSJA 2R0IA 1MP8A 4AOJA 5IUGA 1W0XC 3NRMA 2JC6A 5LVOA 3QZGA 4IW0A 3DZQA 3JYAA 1UKIA 2X8DA 4U80A 1JWHA 3DLSA 2VTAA 3NZ0A 3L8VA 4PMTA 4FYOA 3FMNA 4DFYA 3DCVA 2DUVA 5I9XA 4EWHA 4KKGA 4I21A 2OIQA 2ZV2A 3FKNA 4FC0A 1UVRA 1OPJA 2BAQA 3UG2A 3JPVA 3GI3A 2W0JA 4EK5A 4PDYA 5DI1A 5KMMA 3FLQA 3WZEA 2JKOA 1GNGA 2R3OA 2YWPA 3WYYA 4G3CA 4I93A 3I6WA 3U4WA 4ACMA 5IEVA 3KXGA 4FSRA 4ZSEA 4CG9A 4JDJA 5IDNA 1PMVA 4ZTRA 3FLYA 4JG8A 5JFXA 4A9RA 1ATPE 3AGMA 5AP6A 5HQ0A 1YXVA 4YTHA 1WBWA 5ANIA 3GC9A 3DT1A 3VUHA 4CFNA 4B99A 2FH9A 4USFA 3FLWA 4Y73A 3MY1A 5LVPA 5HI2A 3AG9A 3EFKA 2WD1A 2X4FA 2XRWA 3LFDA 3D15A 3AXWA 3TJDA 2C6OA 3FSFA 1YXUA 4WRGA 2VTOA 2VV9A 4QNAA 3RM6A 3W8LA 5KX8A 4TZRA 4QQTA 2EU9A 2YIYA 3P78A 5CZHA 3D7TB 3O2MA 4OTHA 5F9EA 1OKYA 4S30A 2DWBA 5EW8A 3TXOA 3ANQA 2ZVAA 3LJ1A 2ZB0A 2F2CB 2WNTA 2XYUA 4TYGA 1ZMWA 3WI6A 4DGLC 2NO3A 3HUCA 4EEVA 3S00A 3BPRA 4LI5A 4IX5A 2ETKA 5DNRA 5HTCA 5KMLA 2A27A 3PZEA 4MTAA 3VF9A 2WQOA 1JAMA 3QA0A 4YBJA 1J1BA 1VR2A 2DYLA 3F5XA 4L52A 4YU2A 2ONLC 4IHPA 1W82A 2VTQA 3P08A 3C4EA 1RE8A 5CVGA 3KF7A 4EH2A 4HVHA 3ZOSA 4O0VA 1I09A 4N57A 4U40A 2C6EA 4I0SA 2C5OA 4FKJA 1IEPA 3BHTA 1REKA 4I3ZA 5T68A 4BR3A 2VTLA 5HESA 1H1RA 3C7QA 3P7AA 3IOKA 1CM8A 2QCSA 4NCTA 4NJDA 5IH6A 3LXLA 5AADA 1J7IA 5M51A 5I9VA 3ZRKA 5CU6A 3MTFA 4F7NA 5BVKA 4EOOA 3O23A 2XP2A 3AD4A 5JFSA 3TYKA 3P0MA 4TYEA 5IPJA 3BLHA 3EZRA 1Q62A 3BGPA 3G0EA 2EXCX 4GW8A 4R6VA 1V0BA 3QF9A 4RIOA 2W1IA 4DHFA 1L3RE 4USDA 4OTRA 3JVSA 5E92A 4FSWA 3RM7A 1OIQA 5HNGA 3H9OA 3SXFA 5HG9A 4HZSA 1EH4A 2QLUA 2VX3A 4TWOA 3QU0A 3VIDA 2I0YA 3NCGA 1XBAA 3DAJA 5JQ5A 2VGOA 3O7LB 4RWIA 5AUZA 5KKRC 3TZMA 2ITNA 3Q4ZA 4JBQA 4O2ZA 4IB5A 3Q32A 4RIYB 4FBXA 1JKSA 4IJPA 1J7LA 3BV3A 4Y46A 3OWLA 4RLKA 5C27A 3QKKA 4XG9A 3P5KA 3H4JA 4D5KA 3ID6C 4C37A 4ERKA 3RK9A 1DM2A 4FV9A 5CAOA 4BTKA 2XK6A 5M57A 5EKNA 4LOQA 3SXRA 4WOVA 3UO5A 3NUPA 2PVKA 4WRSA 4AGDA 5KHWA 4J8MA 2J0MB 3P7CA 4QO9A 3BI6A 3RHKA 4M13A 3PTGA 4LMNA 3NNUA 4XX9A 5KO1A 3Q4CA 2I0HA 3FEGA 2I0EA 2BHHA 3R8UA 4E1ZA 3T8OA 4QTDA 3H30A 4QMYA 4DEIA 4IDVA 4I23A 4LFIA 3GENA 4OTIA 4R3PA 4XUFA 2OU7A 2UVYA 3F2NA 3M11A 4RGJA 5CYIA 5IG1A 4JDKA 2NNWB 4I5CA 3TNHA 4ZJIA 1FVVA 3QUPA 4KABA 4CT1A 3RCJA 3MW1A 2PUPA 4L3PA 4QMWA 1BX6A 5HEZA 3P86A 5BYZA 5IH4A 3TCPA 1OVEA 1FINA 2J0KA 3DDQA 4BDIA 4EOLA 5E8WA 3HAMA 3HMPA 2PK9A 2RG6A 5EG3A 1SNUA 1XQZA 4KRCA 4QYYA 4FKTA 4M14A 1LEZA 2PSQA 3O96A 4I0RA 3I5ZA 3PWDA 2CLXA 3FPMA 2YCRA 1Q61A 3V6RA 3V5JA 1KE6A 2Z60A 3F82A 4H36A 5DT3A 4FV1A 3SOAA 3ACKA 1OL6A 3RPYA 3ZLWA 5AUTA 2BROA 4QMVA 3DOGA 4YO4A 1YWRA 3IGGA 4WG3A 1U54A 4FKUA 2IZUA 3RHXA 3FE3A 4F7JA 4O86A 2WMQA 5IDPA 4DGOA 2C0IA 3QD2B 3PXRA 5FGKA 2ERZE 3R63A 5F4NA 3HUBA 3CXWA 5IA3A 2VWWA 3A62A 2E9VA 1WBSA 4W4XA 5E4HA 2ZM4A 2LGCA 2JIIA 4ENYA 4II5A 3FPQA 2GTNA 4U6RA 3NNWA 4S32A 1SVEA 5CSPA 4I24A 3QQKA 5HVYA 5HCXA 3LOKA 1PHKA 3E5AA 1WVYA 4W4VA 2YFXA 4YZ9A 1I44A 2VO0A 4MD7E 1YHWA 2VGPA 4LL5A 2QU5A 3F5UA 4NT4A 4PDOA 5E8VA 2YJSA 4AGUA 3C1XA 4FGBA 3UZPA 3DBDA 3D94A 3GU5A 4MCVA 3UMWA 3UYSA 3E63A 2W99B 3MH2A 4YSJA 3GCSA 4ZAUA 3B2WA 5AUYA 4O7ZA 3R7VA 2CKEA 2YCQA 3QTIA 5AX9A 5JFVA 5FXQA 1WBNA 2YN8A 3ORLA 3OUNB 4DH1A 3SGCA 1DI8A 2HZIA 3QQGA 4FVRA 4WHZA 4F64A 3F3TA 4EYJA 5GIPE 5J8IA 3GC7A 3MFRA 3AC1A 1KE8A 3R01A 2ETMA 3MIYA 4IAYA 4FR4A 4E8AA 4YJVA 3OCSA 4BCOA 3DLZA 2W1EA 2WZJA 3OW3A 3W0MA 5DR6A 3R7OA 4M97A 2YM4A 5BNJA 3R28A 3W16A 4GYGA 4YZNA 4G5PA 3PSBA 3BRBA 2YIWA 4DA5A 3I60A 4DG2E 3FHRA 4ZMEA 3OW4A 5K4JA 4FKGA 4MWHA 2JDRA 4F0FA 4HVDA 2Q83A 1FGKA 4FTRA 4BCFA 3VWAA 4K33A 5GHVA 3G5DA 4BTMA 2C0OA 2R3JA 4ACCA 4CTBA 2O3PA 4D4RA 3NVKI 4JOAA 4XS2A 2QNJA 2VTHA 5DR9A 4OTWA 3TKIA 2IZSA 5G1XA 3UE4A 3WARA 3EL8A 3GU7A 4BDGA 5FTGA 3ZBXA 2VX0A 4KKEA 4LG4A 4IVAA 3EMGA 3FY0A 3EIDA 2PWLA 3CLYA 4WNPA 4NM3A 2RKUA 3Q4UA 4L7FA 2VTTA 4CQEA 2WO6A 4FG7A 5DHJA 3S1HA 2RFEA 5EHOA 4XBUA 4Z3VA 3IONA 3OCTA 2P33A 5HD7A 3NUXA 3VQUA 3LCKA 3ZM9A 2BZKB 4BB4A 3DBCA 3FQHA 4M69B 1SYKA 2QO7A 3KN6A 2QHMA 5FP5A 3EQFA 4D9TA 4FKRA 5L8LA 1M2RA 4DFZE 5KMIA 4QPSA 2QOIA 3TIZA 4RIYA 3NW7A 3IDBA 3REPA 4RJ8A 3GNIB 4O96A 4O7VA 3DDPA 1JKLA 4V0GB 4CD0A 3R1QA 3ORMA 2WMRA 4A06A 3EJ1A 2JKKA 4L42A 1NVQA 1U46A 2B9FA 2PZYA 4BIDA 4IAAA 3OEZA 5LMKC 3LVPA 4EZ3A 3BHUA 5CALA 2ZDTA 3F3VA 4ORKA 4EC8A 5HE3A 1GIHA 3JY0A 3FAAA 5FTOA 4FKWA 1FVTA 5DT4A 2A4LA 4AZTA 4PP9A 1Q8WA 2J2IB 1OZ1A 3PLSA 4IEBA 3TJCA 2XNMA 3W0OA 2Z02A 4FKSA 1KOBA 2ITXA 4M12A 4OGRA 5CEPA 2X2MA 2PZRA 5JK3A 3IDCA 2R3FA 4GH2A 4JDIA 3UC4A 2X39A 3DXQA 3TKUA 4ZK5A 2BVAA 4JL9A 5EYMA 3ATSA 1JKTA 4GJ3A 5J5SA 5IMEA 2KULA 2ZOQA 4YJSA 4U3ZA 2GCDA 3DKFA 3GOPA 4BDCA 4L46A 1R3CA 4LOOA 3DKGA 2YM3A 2QG5A 3PY1A 3FMEA 2YEXA 4UXLA 4GT4A 1ZARA 4J98A 4HYHA 4EC9A 4Y72A 4D1XA 3BYUA 3FC1X 3S3IA 3K3JA 5ITAA 2CCHA 3QUDA 3O8PA 4MXXA 5AP1A 3PG3A 2G15A 2H34A 4NSTA 5J9ZA 3NWWA 2XNEA 1MRYA 2X2KA 3VJNA 2GSFA 4FKLA 4GVAA 4KBAA 2V0DA 4CFUA 3SG9A 4JG7A 2Y7JA 3EN5A 5JZNA 5ANGA 3BU6A 4DF3A 1MQ4A 4EQCA 4Q5HA 5AWMA 2OW3A 2X7GA 5CSXA 1KV2A 4QPAA 4GUBA 5EQYA 5M4CA 4CT2A 4DLJA 4EONA 1PMUA 2XM9A 3ZZWA 3EQRA 4OT5A 2CDZA 4MNEB 4ZS4A 3UVRA 4FTLA 3MI9A 5C03A 2WQBA 3ATTA 3FZSA 4G3FA 3ZHPC 4IB3A 5A4TA 4TYIA 2QOHA 3L9LA 1JSVA 1YKRA 3R71A 3DJ7A 4ARKA 2UW9A 4W4WA 5I5ZA 3DJ6A 3G33A 4A9SA 4PTGA 1VYWA 5FM3A 3PY0A 5BMMA 2NRYA 5H2UA 3PFQA 4C4GA 4L7SA 2CPKE 1YHSA 4BIBA 2RG5A 4PMMA 2PYWA 3FMLA 3CGFA 4XV1A 4TPTA 3D5VA 2C1BA 2XEZA 3MTLA 3LM5A 3OY3A 2R3RA 4QYGA 5J95A 5FM2A 4RQKA 2GS2A 5FEEA 4O7PA 3W0PA 3CBLA 3QTQA 4I4FA 3RAHA 3TNIA 4CCBA 4NU1A 3MH0A 3OVVA 5FUTA 5LXMA 2GFSA 3C4XA 3G51A 5D11A 5KMJA 3ZFMA 4CLIA 4E93A 4FEVA 4MBLA 2R3NA 3DNEA 2GDOA 1R0EA 4IAKA 2YM5A 4YLJA 4CFVA 4FKVA 5D7AA 5DG5A 2J0LA 3AQVA 4ANLA 3TDWA 4KNBA 4RIXB 2VUWA 4S33A 3NMUF 4TL0A 4XP3A 5EYCA 1WBTA 5CWZA 4H58A 2A1AB 4S34A 4Q9ZA 4BZNA 4FUXA 4YLLA 3KRXA 2FSTX 3BU5A 4XOZA 3F7ZA 4CFMA 4M8TA 4LYNA 3IG7A 3Q6UA 5ACKA 4H39A 4USEA 2IW8A 4O6LA 3P7BA 4XJ0A 3VW8A 3PJCA 5CEMA 4EHEA 3RTPA 2XJ0A 3FV8A 3Q52A 2ZMDA 2GS6A 2CGVA 3NNVA 2R3HA 4J53A 4NJ3A 4PL5A 5L2SA 3OXZA 4DCAA 3HDMA 3CD8A 2VTPA 2PHKA 2IW9A 2PVJA 4V04A 4WBOA 5K5NA 4E4XA 2QOCA 3ZSHA 2XIYA 4HPUE 5FXSA 4P5QA 5CZIA 4FTOA 1M14A 5CU3A 4BDDA 2RF9A 4Y5QA 1A9UA 1ZZLA 4FSQA 3VBYA 3VS5A 3R02A 5KE0A 4D0WA 2UUEA 3ALOA 1Q8TA 3I7CA 3KVWA 3CQUA 2FSMX 1ZOGA 3E8DA 3I1AA 3NYXA 2OWBA 4L01A 3NCZA 1Y91A 4CG8A 4BCIA 3EN9A 4JBVA 2VWXA 5M09A 3LCTA 3PE2A 5LCKA 3UVPA 3DAEA 2C6DA 4X3JA 1U59A 5FBNC 1ND4A 4FNZA 2XBAA 3KB7A 4YC8A 2VTSA 5JGAA 5K4IA 3EH9A 5GJDA 3R0TA 4AP7A 3UZRA 3QYZA 4HCTA 5BQ0A 2C3JA 4OBOA 4F1MA 2NRUA 3RI1A 4ZP5A 4KS8A 1T45A 5EM8A 2YCSA 2W5BA 4FSZA 4XLIA 3BV2A 4JT3A 4RQVA 5IF1A 3C0GA 3DQWA 4FZ6A 4RIWB 1ZRZA 3P1AA 4V0GA 5DGZA 3VAPA 3HDNA 4XG3A 2YISA 4GVJA 3QHRA 5IUIA 3ZUUA 2O2UA 3QQHA 3A8WA 3UMXA 2F49A 2HZ4A 1P4OA 3TACA 3IW8A 2I0VA 3G90X 2O0UA 4DBXA 2CN5A 4JR3A 2ZYBA 3LFCA 4IX4A 4EK6A 3HMOA 4FKQA 1QCFA 2EB2A 3D7ZA 4FV6A 3WF8A 2QO9A 2YM8A 2XJ1A 3KC3A 4FVQA 5EOBA 2YAAA 4BYJA 3DKCA 4JQ7A 1IAHA 3ETAA 4E4NA 3LCOA 4C2WA 4DC2A 5IZFA 3ZONA 4O82A 1YXXA 3QWJA 3KCKA 4NCTC 4TN6A 5EOLA 3TZ7A 5IA4A 5IU2A 3KQ7A 4GUEA 1UU8A 2B0QA 4IAFA 4XG8A 4YSMA 4OTQA 3QCSA 1PXJA 4BCNA 4O0YA 3SV0A 1S9IA 2IZTA 2JEDA 4BBMA 1PXLA 2I1MA 3OS3A 5CEQA 1OM1A 3NS9A 3SHEA 3I0QA 4K8AA 3KMMA 4UALA 3LPBA 4IMYA 4ITJA 4JDHA 4X3FB 3WILA 2PZ5A 4ZEGA 5EI6A 4GG7A 2E9UA 1H26A 3VUDA 3PPZA 4JRNA 4TWPA 5CF8A 2I7QA 3GQIA 1JOWB 4LUDA 4YJNA 5KZ0A 3KRRA 1ZYSA 2GHLA 5KHXA 4C4IA 1LP4A 1YOJA 1LR4A 3FYJX 2G01A 1Z9XA 4FOBA 4L44A 2ZAZA 4O21A 5AX3A 5KCVA 1OBGA 3QZHA 3TKHA 1BL6A 4IZAA 5AV4A 2OF4A 1K2PA 3BX5A 3N4TA 3PWYA 1PYXA 2CHLA 3VBWA 4MNEA 4DH7A 4ERWA 3PRFA 3QWKA 5L2WA 3E64A 1ZOHA 4JRVA 3EQHA 4IIRA 3CTQA 3O17A 2P2HA 4FG8A 3QFVA 3KXMA 4R3RA 2JDTA 4DTKA 3KU2A 4XP2A 4KIPA 4Y95A 5HG8A 3PJ3A 2HK5A 2RFDA 5HNBA 3RAWA 3RWPA 2BCJA 4I6QA 3D5WA 4IBMA 5D7VA 4GS6A 2CLQA 2XNGA 3WE8A 4BDFA 3PJ8A 4DGGA 4F1TA 1PXNA 2IZRA 5CEIA 2ESMA 5IA5A 3Q2JA 4OBPA 5HLNA 1MRVA 2PPQA 2W96B 4MKCA 3K5UA 2WTIA 2GPHA 3F2RA 3FZRA 1O9UA 3WF5A 4XOYA 4BCMA 2YERA 3QA8A 4OLIA 5CXHA 3M2WA 3V8SA 4CV9A 3OT8A 2Y6MA 1YXSA 3FQSA 1DAYA 3QXOA 3W2RA 4FEUA 4U41A 1X8BA 3P9JA 4I5HA 4Z16A 3LZBA 4D4YA 5BUIA 3OBGA 1FPUA 5M55A 4AACA 4LRJA 4IH8A 3B8QA 4RIXA 3GFWA 3S2PA 2VN9A 3KL8A 3IPHA 3CIKA 2CCIA 3HNGA 5LWMA 1JPAA 2BALA 3Q3BA 3A61A 2Q0BA 3NIEA 5IQDA 3TL8A 1VEBA 3R04A 3MPTA 4JJRA 3OD6X 3QALE 3KEXA 3AT2A 5JQ8A 3ORPA 3PA5A 2VTNA 5HE0A 1ZYCA 3QL8A 3OWPA 3V5LA 5CANA 4EH6A 2BFXA 5CEOA 3K54A 2VO6A 4Q5EA 4AOTA 4HVIA 4EOQA 4EORA 3R73A 3AD6A 3PVUA 4IX3A 3UO6A 4H1MA 4UV0A 2GFCA 5I0BA 3BHVA 4XH6A 4CEGA 4UN0C 4ZLYA 1MQBA 4ONAA 2PMLX 3ENHA 2EXMA 2C3IB 1CMKE 5JKGA 1FOTA 4R3CA 5CSHA 5H3QA 3RGFA 3VUKA 4HNIA 5LVLA 3SLSA 2ZV9A 4EHVA 3FMJA 1JSTA 3V51A 4HVSA 1O6LA 1Q8ZA 2OSCA 3TIYA 2BHEA 3OWJA 3F6XA 4CGAA 3W0RA 2GNGA 4UZDA 2PVLA 4M0ZA 2VD5A 4DBNA 2UZUE 1PMNA 3R7UA 5HCZA 1H1QA 1HCLA 4CKJA 1IR3A 2X8EA 4O83A 4BHZA 2XNNA 4EZ5A 5HX6A 5DLSA 3PA3A 1ZXEA 3RINA 1OPLA 2OIDA 4TYJA 3OROA 1Y6BA 3FMKA 1U54B 3ZLYA 4L53A 4ZSAA 3G0FA 3DB8A 4O7NA 3FI2A 4PDPA 2R3GA 3Q5IA 2OFUA 4W8EA 2YDKA 4RIWA 4P4CA 4FV8A 4TKSA 3MFTA 4UXQA 4JS8A 3GFEA 2PVMA 4I1ZA 4PV0A 2R0UA 4D2RA 1PW2A 4AGWA 3PP0A 4XNEA 4CFWA 4F6WA 4F0GA 5GJGA 2IVUA 2GNHA 3KFAA 4A9TA 4NTSA 4RBLA 4NUSA 5FTQA 3LE6A 4A4OA 5D9HA 4EHGA 4G3GA 1FBNA 2QI8A 4I22A 4QMPA 2QOBA 4NL0A 4F7SA 2J0JA 3MDYA 4FV4A 3AGLA 3ITZA 2QONA 1K9AA 2UVZA 3KXNA 3POZA 5E8ZA 4ZIMA 5JRQA 5J1WA 4U81A 2X8IA 4UX9A 4P7EA 5LVNA 3R8ZA 5KMKA 2XJ2A 4XCUA 3C9WA 1Q24A 3OT3A 3ERKA 5K9IA 2JDOA 3L8XA 3HMNA 1H1WA 3FUPA 3PJ1A 4KSPA 2XNOA 3Q5ZA 3HX4A 2WKMA 3KGAA 5IA2A 4C4EA 2JLDA 3TI1A 4X3FA 4YHJA 3VC4A 3BE9A 1YQJA 3KK8A 4MYGA 3DTWA 3O8UA 3CPBA 1OMWA 1R0PA 2JFMA 2V7AA 4GK3A 3CKXA 4XMOA 1V0OA 3CR0A 5BYLA 3ZBFA 4BDJA 5DFPA 3RMFA 2WMVA 2UZNA 1AD5A 3TV4A 5D12A 3VJOA 4C35A 2HY81 1M7QA 5CVHA 5EDRA 3Q9XA 5EKOA 3TNPC 5F1ZA 5FP6A 4IVBA 2GMXA 3VRZA 5BVWA 4CCUA 4O6EA 5AA9A 1MRUA 3U8WA 4IAZA 2JDSA 3SW4A 5DRDA 4Z7HA 3FL4A 3HECA 2XMYA 4AN9A 4FIIA 5FQDC 3RCDA 4MHAA 5IQHA 4FSYA 5C8NA 3QCQA 4QQCA 5BVEA 2OJFE 2XIKA 3BHYA 3JR1A 3ULIA 4GFGA 4RFYA 3R9HA 4Y85A 4IFCA 3KY2A 3QXPA 4FTTA 3QRJA 3LFAA 2QLQA 1Y8GA 5AIRA 5HBJA 4NM5A 2R3MA 4X0MA 1ZYJA 3VUGA 2YDJA 4IM0A 3H0YA 3ZLXA 4PP7A 4LV5A 2AUHA 5L8JA 3QCXA 3B8RA 1SNXA 4QP9A 4ZTLA 4EZ7A 5ICPA 3UQFA 5DEWA 1YOLA 3KK9A 3ZEPA 3VNTA 3ANRA 3HV7A 5DYJA 2PULA 3COKA 3DBEA 4BBFA 1PRYA 3QYWA 4GEOA 4N6YA 4DAWA 5F95A 4RVKA 5H9BA 2HY0A 4FK6A 3UOLA 4DCEA 5ANJA 5EYKA 5J9LA 1DS5A 2BTRA 2YDIA 4TY1A 4YJTA 1QMZA 3CD3A 2V5QA 4F9WA 2ITZA 5DT0A 4F63A 4D5HA 4RJ6A 2QOOA 5E1EA 3EWHA 3BYOA 2UZLA 3QQFA 4YZBA 5ANKA 5B2MA 4FKIA 4C02A 2ITOA 2OJ9A 4WG4A 2W4JA 4GKIA 3VBQA 1URWA 3HMIA 4K6ZA 4BCJA 2B4SB 2BKZA 1WVWA 3TUDA 4ACHA 1UA2A 5CU2A 4KSQA 3RPOA 3U51A 5LMAA 2IO6A 2OXYA 5BVOA 3E7VA 3HRCA 3R30A 3ZXZA 4IB1A 2ZB1A 3MYGA 4GIIA 3R9OA 2WMAA 5L2IA 4RWLA 4A4LA 1PKDA 4O84A 4ACGA 3KREA 3JVRA 2XCHA 4O27B 3TV6A 2WFYA 3OC1A 5IQCA 2JITA 3BELA 3KCFA 2YIRA 5HKMA 5BMSA 3OCGA 4G17A 3WZJA 3W55A 4FICA 3TTJA 4KIQA 5A4LA 1UU3A 2PUNA 2VTRA 2WMBA 4C61A 2HZNA 2QD9A 4YBKA 4EOJA 3W2PA 4ALWA 1UU9A 3BYMA 3A7FA 3H10A 3KXHA 3HYHA 4GT3A 2OJIA 4BGGA 3ZM4A 2CJMA 3I7BA 5CF6A 3F2AA 4H1JA 1Q3WA 4BI0A 3AT3A 4BTFA 5A6OA 1KWPA 5I9YA 1J7UA 2W1HA 4ASXA 4HGTA 3Q04A 4FEWA 4YTFA 1DI9A 2WELA 3BGQA 2XH5A 3LFSA 4QP3A 4BDAA 4WD5A 4GJ2A 4DGNA 5A4EA 5EHLA 1OBDA 2ETRA 2FVDA 3E8CA 3ROCA 2BZIB 3CEKA 3FWQA 2B54A 4D58A 4QOXA 4D28A 4HJOA 3FKOA 3DY7A 4BIEA 3EZVA 2DS1A 2W1ZA 4FTUA 3CTHA 4YR8A 3MS9A 5HE2A 2CSNA 3VS6A 3ZZEA 4D55A 4IZ5A 4CFFA 1U5QA 1GIJA 3N51A 3F66A 4F99A 2PVFA 4FL2A 5JN2A 3KMUA 3JY9A 4H3QA 3HVCA 3I4BA 4RVMA 4YC3A 4JR7A 1ZOEA 2JBOA 1S9JA 3CQWA 1H28A 3NUSA 2BRNA 4G6OA 3PZHA 4W8DA 3W2OA 3LXNA 2REIA 2HWOA 2R5TA 1KE9A 1SVGA 2WQEA 4FTIA 4O0RA 2E9NA 4OBQA 5HZNA 2GNLA 2XBJA 4AW2A 3P23A 4QMOA 4B8LA 5HBEA 3VW6A 3C5IA 3DQXA 4PDSA 3DS6A 4QMQA 4O91A 5HIEA 5M53A 1OIRA 3LKMA 4RMZA 5E1SA 3KN5A 4PY1A 5M4FA 2VTIA 3Q96A 5H8BA 2X6DA 1SVHA 3M1SA 3QLFA 4FTAA 4NKSA 2WB8A 4H3PA 5JFWA 4FMQA 3TZ8A 3QTXA 4UWYA 5B0XA 4GFOA 3PP1A 2XZSA 2JIUA 1IRKA 3COMA 3MIAA 4G5JA 4YPSA 4CZUA 3WF9A 3EFLA 4U42A 4X6RA 5IUHA 2J5FA 4RA4A 3FJQE 3G9LX 4Q9SA 4BI2A 1AGWA 3EN4A 2QOQA 3GVUA 4K11A 4Y83A 2YZLA 3GP0A 3RK7A 3BEAA 3I6UA 3MB6A 3RPVA 2UZWE 3ZO1A 4F1OA 4F6SA 4IACA 4PWNA 3TZ9A 2R2PA 5AEPA 4FV7A 4E26A 2BILB 3CPCA 3QC9A 3F3UA 2B9JA 2F7ZE 2RFNA 4J1RA 1Q4LA 1FQ1B 3FLSA 1M52A 4FODA 4RZVA 4WO5A 5GJFA 3UBDA 3NNXA 3S95A 2W1FA 3ZLSA 5HU3A 5ETIA 3L8SA 4UWBA 5CU4A 3R1SA 3A7GA 1J1CA 1HOWA 3TN8A 3LCSA 4NTTA 1UKHA 2SRCA 5TKDA 4QQ5A 3A7IA 3OTUA 2GQRA 3C4WA 3D83A 4EL9A 3KMWA 3MBLA 4YTIA 3WBLA 4ALUA 2W1DA 4Z55A 4G1WA 3O50A 4IM2A 3GC0A 2HIWA 3TT0A 5M07A 3UIMA 4AOIA 2C6KA 4EQUA 3LFNA 3E92A 4CNHA 2BTSA 3GQLA 4D2SA 4FGRA 3THBA 4R78A 2ZMCA 3NW5A 4J99A 3HA8A 4DEHA 3ZC5A 4CZTA 1NT2A 2HXQA 2OJJA 4QP1A 4JIAA 4A07A 4UEUA 1ZWSA 4YPDA 5A6NA 1H24A 4RX8A 3ZO4A 1DAWA 4RFMA 1H27A 4FV2A 4RFZA 2W1GA 4HYSA 4XV3A 3E62A 1OI9A 4OTDA 2CNQA 4FTQA 5L3AA 3TWJA 3RPSA 3QHWA 5CT0A 3VBVA 1BYGA 2C5NA 2PTKA 3OEFX 3OG7A 4PMPA 2B9HA 1BKXA 4EH7A 4FSUA 4BRXA 4EQMA 5CAQA 2Y0AA 4MXOA 3BBTB 2WQNA 5C26A 3ODZX 4L43A 4NYEA 4JVGA 4DLIA 4IJ9A 4NW5A 4U94A 3FL5A 1M2PA 3MH3A 3R8VA 3R7YA 3SG8A 4KINA 5CNOA 2IVTA 5J1VA 4X21A 4XBRA 2Q0NA 3BEGA 1P2AA 4RWJA 3AC8A 4RC4A 3WE4A 4FYNA 3WZUA 4ZY5A 3UQCA 1APME 1H1SA 5CQUA 5HIDA 5L6PA 3R1YA 3TTIA 3FI4A 4FZ7A 3VULA 3ENMA 5IMXA 4PX6A 3TNWA 3HMMA 4BVUA 2VWUA 4K77A 4YP8A 4EBVA 4KS7A 4OW8A 4FIJA 4FZAB 3TG1A 5EW9A 3ULZA 4NW6A 1XWSA 4BGHA 3DV3A 5FXRA 2P4IA 4M0YA 4E6DA 1TQIA 4RPVA 4U44A 2UZBA 2W06A 1G5SA 3VBTA 2IJMA 1BMKA 3R9NA 3D9VA 5TT7A 3A8XA 1UWJA 4JLCA 3TM0A 2OFVA 3EQCA 1IASA 4PUZA 4E6CA 4AW1A 4IC8A 4DH5A 3IDPA 1OL2A 3FZOA 3L9NA 5AUVA 4AFEA 4TRLA 2C47A 1U5RA 5HLPA 3RALA 2CGUA 4QYFA 3QRUA 4FIFA 1QL6A 2C68A 4BI1A 3V8WA 5FDPA 1PXIA 4WUNA 3RAIA 4DG0E 4G2FA 5AAGA 4IADA 3P79A 4FIHA 2P55A 3ZO3A 2BR1A 3QKMA 3G2FA 5AM7A 2IPXA 4YMJA 5LOHA 3QAME 2IG7A 1IAJA 3TV7A 3LIJA 4EK8A 4AW0A 1LPUA 4IB0A 4AZWA 3O51A 1NVRA 4GU6A 2BDFA 2YIQA 4O38A 2C0TA 4CKIA 5BUEA 3MVJA 4DE4A 2OJGA 4ID7A 2QKRA 2JKQA 2EUFB 3C51A 3BKBA 4HGLA 4I6FA 3D2IA 4MXZA 4QMTA 3V5WA 1OKVA 2Y4IB 5IQIA 4EBWA 3MWUA 2OBJA 3NUNA 4DINA 4LGHA 2ITVA 3OBJA 3ZO2A 4RVLA 4B8MA 4HYUA 3LFEA 1TVOA 4ASZA 2C5YA 4C38A 4GCJA 3UNKA 2P3GX 1LUFA 2CGWA 3F3WA 1OITA 5CI7A 4C7TA 1V1KA 4O0UA 2CMWA 1XKKA 2QODA 4HVGA 1UV5A 5HIBA 4AZSA 3ZRMA 3ORTA 1ZMVA 1OL7A 2VNWA 4CKRA 2OKRA 3DU8A 1NVSA 2YCFA 4JXFA 2AYPA 2XVDA 4TYHB 5ETAA 3SX9A 3PUPA 4FSMA 3T9TA 3W1FA 1LEWA 4O7TA 4YTCA 2OF2A 4I92A 5CASA 1W98A 3D4QA 3UPZA 4OR5A 3MFUA 3F88A 5DR2A 3UOJA 3L9PA 4FSTA 3LMIA 2E9OA 4MWIA 3PIZA 3PXZA 4ZY6A 4DGMA 3R1NA 5ANEA 3WOWA 3K5VA 5AUUA 2LAVA 4CMTA 3SC1A 4NWMA 1TKIA 1CTPE 1XH4A 5KUPA 4ZTNA 1OIYA 1JNKA 3PIYA 5HE1A 4RX5A 3UQGA 5E8SA 3FHIA 4P5ZA 2JKMA 4D1ZA 4A9YA 3GU8A 3ZU7A 3B2TA 4J71A 3H9RA 4L8MA 2C3LA 3Q60A 4ASDA 1BUHA 4IWQA 4KUJA 3VS2A 1UNLA 3MY5A 3ZH8A 1YWVA 3H9FA 1PXKA 5K5XA 3LHJA 1KE7A 2O8YA 5CVFA 4R5YA 3WZKA 4WNMA 4A7CA 5KBRA 3ZSIA 2BRGA 5JRSA 1OGUA 3MY0A 3ALNA 4EH5A 5L8KA 4A4XA 4KBKA 4ANSA 4X3FC 3FKLA 3EN6A 4C59A 2XK9A 2JFLA 3CY3A 1OIUA 4FX3A 3T3UA 4I94A 3OOGA 4LRKA 4UZHA 5M44A 3F7WA 3FI8A 2ITUA 3R8LA 4MBIA 3DK6A 4FIEA 4IC7A 1E1VA 3AD5A 1Y57A 4IVDA 5EK7A 2WTKB 2C69A 4U79A 4TT7A 3NUUA 3PVBA 1RQQA 1NW1A 2UW7A 4UWCA 1W8CA 1YWNA 1Q97A 4ZTMA 5AP4A 2ZV7A 3GU6A 3JXWA 3C4FA 3SXSA 3IS5A 3FY2A 3QUEA 3OHTA 4RC2A 2PMOX 3AC3A 3EFWA 3NAXA 4EH8A 2O63A 3MVLA 1YW2A 2O64A 3EB0A 3COIA 3O71A 3VHKA 3NAYA 2JGZA 5IH5A 2JAVA 3PE1A 4L67A 3ORNA 3TNQB 2VTMA 4HYIA 4EOPA 3ZDIA 3LM0A 4C33A 2YM6A 1HCKA 3QTWA 3VS3A 4IAIA 3I5NA 2HXLA 1GAGA 3ZSGA 1XBBA 4I5PA 4WZYA 1OKZA 2A2AA 3VHEA 4DTBA 3OFMA 4PRJA 3LMHA 3R83A 4ZS0A 4AS0A 4GRBA 1PYEA 2J5EA 3E93A 3BQRA 4BCPA 3HA6A 3HKOA 2R3LA 4L3LA 4WT6A 2R7IA 3D0EA 3R21A 5JEBA 3LXKA 5ANDA 4LGGA 4IWOA 4AU8A 5T3QA 4ANMA 3LFQA 2WEVA 4P2KA 4ZOGA 3AMYA 3R8PA 2BIKB 1NY3A 3U9CA 5H8GA 3DPKA 1YHVA 3KULA 3SKCA 4A9UA 4LRMA 3K3IA 3O0GA 5CSWA 3EYHA 1PMEA 2X2LA 2NPQA 4D0XA 4ZZNA 5FBOA 5LMKA 1W83A 4MX9A 5HHWA 4E6QA 4EI4A 3NIZA 4FVPA 4CVAA 5DBXA 3CS9A 3QTUA 3I0OA 2ITTA 4M7IA 1YI6A 1AQ1A 3OXIA 4JBOA 2YITA 3D5XA 3U54A 2J0IA 5FG8A 2WTDA 3IGOA 2V62A 2XRUA 4QP4A 4D4VA 3QRTA 4HPTE 2BMCA 2V22A 3NLBA 4MF1A 3WF6A 1JQHA 2H6DA 2RL5A 1STCE 2PZPA 4XP0A 2GHGA 4XV2A 3KF4A 3W2CA 3FYKX 3MFSA 2CN8A 5L6OA 1FMKA 3HAVA 4UY9A 3SAYA 4G9CA 4IZYA 1KV1A 2XK3A 2XB7A 1PF8A 5AP3A 2C6IA 2BRBA 4KIOA 2IVSA 3O7LD 2VWYA 3A7HA 2XNPA 3PXFA 4FTKA 2PVYA 1XH9A 3KXXA 3RK5A 3FDNA 1H8FA 2PVNA 4CXAA 4DG3E 3L1SA 5CF5A 4Z9LA 5FEQA 2FSLX 3VRYA 1UU7A 2VZ6A 4B4LA 1NXKA 5M56A 3FXWA 5IQAA 2G2FA 2QURA 2WMUA 2E9PA 2EB3A 5EQEA 5LJJA 3KXZA 2GNIA 4NH1A 3ZS5A 3EL7A 3N4UA 3GCPA 3R22A 4GSBA 4TNDA 2W1CA 1OUKA 4M15A 4EH4A 3BHHA 4QT1A 3Q2MA 4AFJA 4FIGA 5I9ZA 3BIZA 2X6EA 2C6MA 1B39A 4AAAA 2OICA 2YM7A 3UC3A 4DT8A 4FT5A 1WVXA 3ZC6A 2QHNA 3IW5A 4XEYA 3EOCA 4AG8A 2JDVA 4V01A 2XM8A 2JBPA 4TTHB 3GCUA 4NM0A 4C4HA 3AT4A 4U8ZA 4TYHA 1GZ8A 4FL3A 3NUYA 2BRMA 4JX3A 4KD1A 4OUCA 5G6VA 2BRHA 2P2IA 2R4BA 4I5MA 3RVGA 5LQFA 2YACA 5E8UA 2XS0A 3NYNA 4C3FA 3EKKA 3EKNA 4FTMA 4RT7A 4UB7A 1YOMA 4YUQA 5BVDA 3OMVA 4D9UA 2JIVA 1ZZ2A 3DB6A 3FBVA 5H8EA 1WAKA 1CDKA 2WIHA 5EFQA 4FUYA 3WIKA 2C5VA 4O2PA 2VWZA 4XLVA 4G34A 4EHZA 3NPCA 1XR1A 2WHBA 4XHKB 1E1XA 3AC4A 4AWIA 2QKWB 5E8TA 3PJ2A 4APCA 3FMHA 3KRJA 3PY3A 2W17A 2XIRA 2Y6OA 2W7XA 3MA3A 4O7WA 3V3VA 3PXQA 3TUCA 5ACBC 2WTCA 2WXVA 4QTAA 3ROYA 5DH3A 3U55A 2YABA 4CMOA 3W2QA 3MGYA 4BDBA 4MK0A 3E3PA 4IDTA 4I0TA 2XEYA 4ZJVA 3QGYA 5CEKA 4FG9A 4QMUA 2HW7A 3KKVA 4MAOA 4F9BA 5EM6A 3GC8A 1G8AA 2CKOA 2JAMA 4NKAA 4JBPA 1ZY4A 4DN5A 3GB2A 5A3XA 3W18A 5EYDA 4FEXA 4IM3A 2Z7QA 3SW7A 4LUEA 3MSSA 2VU3A 4EOSA 4KA3A 1PXPA 4X7QA 4B7TA 4ANQA 3V01A 3R6XA 3R8MA 1YXTA 2XKCA 4WKQA 5A4CA 2UW0A 5KMNA 3UZTA 2ITQA 2BUJA 2WMXA 2G1TA 3RPRA 3G15A 3L9MA 2V7OA 4QYEA 4RVTA 4KRDA 4AF3A 5C1QB 4EKLA 2WMTA 2OH0E 5BX0A 4MXYA 5HBHA 4BHNA 5E90A 5IISA 4U7ZA 5E9EA 2X81A 2ZDUA 4X2FA 5DN3A 4J97A 4DTAA 2GNJA 3DTCA 4E73A 3QLGA 3II5A 2UW6A 2PUUA 2VNYA 5AM6A 2FYSA 4PL4A 2FSOX 5M4IA 2Z7SA 4S31A 5KNJA 3FI3A 2XK4A 4EK4A 3A7JA 5EM5A 4DFUA 2WTJA 1ZMUA 2ITPA 3BYSA 4F6UA 5HVKA 3OY1A 4I6BA 2PY3A 3V5TA 4D1SA 2C1AA 2PE2A 1U4DA 2XK8A 4QMMA 4YZMA 4K18A 4EUTA 2HELA 4GV1A 2PU8A 4DH8A 1YDSE 5AP5A 5D1JA 4M68A 4F0IA 2E2BA 3FXZA 5AP0A 3MESA 3C4CA 1A06A 4AZEA 3DXNA 4FOCA 3ZEWA 1XJDA 5C9CA 4QMZA 5DOSA 4C4JA 4I41A 4EOIA 5JZJA 3DKOA 4HZRA 5DVRA 5J9YA 4O7OA 2GQSA 4AN3A 2WOUA 3Q53A 3VF8A 4LV8A 4PMSA 1YRPA 5IQEA 4FI1A 3BBWA 1YVJA 4F08A 3V5PA 4WNKA 4CRLA 5IEYA 2J51A 2PE0A 3KRLA 5E8YA 5A46A 5AAEA 3R2BA 4L6QA 2BPMA 4FKPA 3OF0A 5AIKA 3NX8A 2PMNX 5D41A 3GBZA 5HNIX 4GG5A 5LVMA 3ZXTA 3QC4A 2BKKA 4YZCA 1VZOA 5DWRA 3RWQA 4FT3A 4TW9A 3RAKA 4E5AX 3TUBA 1XBCA 2WIPA 3RKBA 4YJUA 2IW6A 2OK1A 3LQ5A 3DBFA 4FKOA 4FTNA 5JGBA 3C50A 4FNXA 3W33A 1E9HA 1WMKA 2PZIA 3Q9ZA 3H0ZA 3QRIA 4E7WA 5I9UA 3WZDA 2XKDA 4NM7A 1B38A 1JSUA 2V55A 3HZTA 3PVWA 4R7IA 2WOTA 3F5GA 2YIXA 4F9YA 2C6LA 3UIBA 3BWFA 1CKPA 2BAKA 1XH6A 5EW3A 2R7BA 5HG5A 4BY9E 2Y9QA 3LXPA 4DEDA 3LLTA 3Q4TA 2OZOA 5CS6A 3U6JA 2UW4A 3V6SA 3GT8A 4HGEA 3PSDA 3WIGA 1GJOA 2F2UA 4YJRA 5IQBA 1J3HA 1P4FA 4APPA 2F7EE 4GT5A 3MJ1A 1G3NA 4AE6A 3VN9A 2PVHA 2F7XE 2HENA 3ZCLA 4C3RA 2BFYA 5DE2A 5BVNA 4H05A 4ASEA 5B2LA 5GINE 1PKGA 3GEQA 3W0NA 5J7HA 2Z8CA 4NK9A 3ZDUA 4MVFA 5C4LA 4B9DA 3DJ5A 5CXZA 4HOKA 1F5QA 2WQMA 3CQEA 4QP8A 3QGWA 4ZMFA 3PVGA 3TEIA 3UOHA 1CKJA 4ZSLA 4G16A 3ZUTA 3MVHA 2OI4X 3PSCA 3Q9WA 4L9IA 2IWIA 3ZRLA 1JKKA 2HAKA 3CP9A 3CY2A 4O0TA 3EQBA 4WNOA 3HLLA 5AP2A 4YJOA 4O7SA 4GU9A 3COHA 4RJ5A 4BC6A 2J50A 3F3ZA 4O7LA 3C4ZA 3HRBA 3ORIA 4FZFB 2QOKA 1GOLA 3MPAA 4PNIA 4FTJA 1P5EA 1RDQE 5KKRB 3S0OA 4ZZOA 1ZAOA 4L45A 4D4SA 4O0SA 3WYXA 4UYNA 2J9MA 3UVQA 4NIFB 4BCGA 4LM5A 4DEBA 5CAUA 4RJ4A 2ZM1A 4R7BA 4EOMA 4F65A 3PPJA 4RLLA 2IN6A 2UVXA 2OGVA 4TXCA 1H25A 2H96A 4I20A 3I79A 3BWJA 3F5PA 4QMNA 4BDEA 4X2JA 4DYMA 5KMOA 4M84A 4F4PA 3UYTA 4MD8E 3L8PA 1NA7A 4RJ3A 3VVHA 4C36A 4R77A 4C3PA 1URCA 4V05A 5EH0A 4E4MA 3GUBA 3R00A 4X6QC 2VX1A 2Y4PA 4EWQA 1XO2B 2HYYA 1YDTE 2VWBA 3NYOA 3R9DA 3SDJA 4MH7A 3H3CA 2XUUA 3F61A 4F09A 2W5AA 2X7FA 2HZ0A 4BCHA 4FV0A 4H3BA 4BKJA 1P14A 5AV1A 2VO7A 4F9AA 2WU7A 1R1WA 4LL0A 3QTZA 4G6LA 4AZVA 4E5WA 1TQPA 5HU9A 4GYIA 2WAJA 1B6CB 2PUIA 3D2KA 2VAGA 2EVAA 2XIZA 1YI3A 4WIHA 4C34A 4CFXA 2HOGA 1SM2A 3HV5A 3DXPA 5JH6A 3MB7A 4PTCA 4I6HA 5D10A 2H8HA 2UW3A 2QVSE 3R7IA 1UWHA 2ERKA 2ZJWA 3VS1A 3ZFXA 4YO6A 3V5QA 4GL9A 4YGAA 1FGIA 2OLCA 3W2SA 2X9FA 3VQHA 3VBXA 3UODA 2VO3A 4FE2A 3AMBA 2WPAA 4QMXA 2GNFA 3NSZA 2QG7A 3U9NA 2UW5A 5AV3A 2W9ZB 3GU4A 1BI8A 4YZDA 5TR6A 3D7TA 2FB8A 4Q2AA 4R7HA 4EJ7A 4YNEA 2YWVA 4EYMA 2WMWA 3CCNA 3IW6A 3O8TA 1Q5KA 2UZVA 4KBCA 2C30A 5I9WA 3MV5A 3CTJA 4PQNA 3NVMB 4N4SA 3MPMA 4M3QA 2ITYA 3R7EA 5FEDA 4AA0A 3EN7A 1KSWA 5CSVA 3ZUVA 3PYYA 1O6YA 4XRJA 1R39A 3QQUA 1PJKA 2BZJA 2Z2WA 3ODYX 4BDHA 1Z5MA 4AA5A 1H00A 5KBQA 4BF2A 4C0TA 2XKFA 2X7OA 3UP7A 3GCVA 4DFLA 4AT5A 5IA1A 3G9NA 3DAKA 2XKEA 3P4KA 5CQWA 1M7NA 3DK3A 4QNYA 5HO7A 4PNKA 3R9RA 1XH8A 2F4JA 2PVRA 4K9YA 4AT3A 2OZAB 5L2TA 2O65A 3GGFA 4MD9E 4CRSA 4FA2A 4FV3A 1H07A 4PL3A 4MXAA 2IVVA 4J52A 1VYZA 4X2KA 3RP9A 4C62A 1W84A 4E5BA 2GU8A 1SZMA 1XH7A 2CKPA 3KVXA 4JAIA 4WBBB 5K3YA 3UDBA 5BUJA 1H01A 4XG4A 2F57A 2GTMA 2UZTA 4Y5HA 1IG1A 5ETCA 5BYYA 1VJYA 4G3EA 4KAOA 5F20A 4IZ7A 4JQEA 1OL5A 1Z57A 4QYHA 4TWNA 4AN2A 2VTJA 3EQGA 5HLWA 3E8EA 2O5KA 3BGZA 4QRCA 2XNBA 3Q9YA 4G9RA 1A48A 2UV2A 2RGPA 3MN3A 1UNGA 2ONLA 3QQLA 2XA4A 4WG5A 3ORXA 4YJPA 4N6ZA 5EM7A 3C13A 5AP7A 4LOPA 3OTVA 4AE9A 5TOZA 4BGQA 3M42A 2UW8A 5EDQA 4U43A 4RSSA 5FLFA 4YURA 4BDKA 3CJFA 2F9GA 4EKKA 2G2HA 3EFJA 5E8XA 1WZYA 3CGOA 4X2NA 1J91A 2EWAA 4L3JA 2B55A 5M4UA 5GNKA 4GKHA 1O6KA 4JIKA 4X2GA 5AJQA 4FL1A 3OP5A 5TF9A 5BVFA 3BE2A 3FMDA 3ACJA 3EQIA 3LJ2A 4RZWA 4ZXTA 2UZDA 1CSNA 3ZMMA 2FGIA 2WGJA 2OXDA 3DNDA 3E3BX 4JQ8A 4C58A 3PG1A 4HGSA 4DFBA 1PY5A 3EYGA 4Z7GA 2FUMA 4BN1A 3QD3A 4CTCA 1OECA 5FD2A 2J4ZA 4NFMA 4W4YA 3HP5A 2UZOA 5A14A 3A4OX 2W9FB 4BCQA 4JAJA 4XG7A 4UYAA 2VWVA 3BQCA 2A0CX 2G9XA 3ZYAA 5BPYA 3HL7A 2B52A 4KB8A 2X4ZA 4EJNA 3UG1A 3SVVA 3QKLA 5HX8A 2NP8A 2OH4A 3UOKA 4XG6A 3LFBA 1PXOA 5CAVA 1Q8UA 3JUHA 1IA9A 3IECA 5EQPA 2J6MA 3SQQA 4C4FA 2R3PA 5LWNA 4R1VA 1M17A 1UNHA 3ET7A 3U6IA 2VRXA 3CKWA 3ELJA 3E7OA 4RRVA 3LMGA 4L00A 3A99A 3MH1A 5CX9A 1FVRA 4NFNA 3W0QA 5CY3A 5TO8A 5CF4A 2BIYA 1ZY5A 1Q99A 4FEQA 1GZNA 4BCKA 3KULB 3FMMA 1GZKA 2H9VA 3F9NA 3IQ7A 4G6NA 4O22A 2CKQA 2XK7A 5E91A 2Y4IC 4CSVA 3NEWA 1QPCA 4JI9A 2QR8A 5AAFA 2C4GA 4L68A 5AUXA 4R5SA 4E4LA 5IQGA 1OPKA 3SRVB 3C0IA 4J95A 3GOKA 2X9EA 2A19B 2W4OA 5DIAA 2P0CA 1MUOA 3LQ3A 4ZTHA 1R78A 4K2RA 3DA6A 3V04A 4YLKA 3LW0A 5C4KA 3NDMA 1JLUE 3UPXA 2YAKA 3VUMA 3LLAA 3R2YA 3UIUA 4TWCA 1WBVA 2WU6A 4MEDA 2C3KA 2AC3A 4O0XA 3QD4A 1XHAA 4DH3A 1QPDA 3UJGA 3AC2A 2R3QA 4GIHA 4MNFA 3BLQA 3MVMA 3E8NA 1GIIA 3OUKA 4KKHA 3FLNC 4QP6A 1Y8YA 4DEGA 1KUTA 4I4EA 2HW6A 4YHTA 4AGCA 3QTSA 2ZM3A 4S2ZA 3QZIA 3VO3A 4P90A 5AUWA 5A4QA 4O7RA 2G2IA 2Z7LA 3HV3A 3UNJA 3LQ8A 3LJ0A 1JVPP 5HG7A 2R3IA 3E87A 3IKAA 3HP2A 1QPEA 5J87A 2QQ7A 3GXLA 4F9CA 4BYIA 4J8NA 4U0IA 1BLXA 4QMLA 5T6KA 1OKWA 2WTWA 5C8KA 1F0QA 1Q3DA 4G31A 5L6WL 4FZDB 5HICA 3W32A 5JMSA 4K1BA 5EI2A 2XIXA 3PPKA 3IOPA 1Y6AA 4U3YA 5CLPA 5DRBA 4ZTSA 4RJ7A 4E20A 1K3AA 4FV5A 2RIOA 3MJ2A 3OZ6A 2HCKA 4QQJA 3PXKA 1M2QA 2B9IA 2QU6A 3OWKA 2OZAA 2WTKC 3HRFA 3FC2A 3A4PA 3UO4A 1OL1A 1WFCA 3CJGA 3FZTA 2RFSA 4IFGA 5A9UA 3PIXA 4IE9A 4RG0A 2OO8X 4DFNA 4ZSGA 2AC5A 1RJBA 4BBEA 3WF7A 3BYVA 4J96A 5DPVA 4YC6A 3PLAE 3A2CA 4AQCA 4FT7A 3UP2A 3QX4A 4FK3A 2B7AA 5LMBA 3A60A 5FDXA 3U87A 1IA8A 1V0PA 1BI7A 1W7HA 2I6LA 3FZ1A 4JX7A 2R3KA 3S4QA 4C2VA 2ITWA 3DBQA 5E7RA 1GZOA 3DGKA 3NW6A 4LMUA 3VS0A 4BICA 2X0GA 4G3DA 3N4VA 3UIXA 4MXCA 4UBAA 5DA3A 4O81A 5A54A 3G6GA 3AC5A 3LFFA 5KZIA 4FTCA 4AZFA 3EQDA 4B6LA 3PRIA 4FNYA 4O0WA 4XRLA 3VS7A 2DQ7X 5F94A 5LARA 2ACXA 5CENA 4OTFA 5HCYA 2CNVA 2QC6A 4B0GA 3UNZA 5HD4A 1G8SA 4BZOA 3BU3A 3CC6A 1BL7A 2YJRA 5EDPA 5AV2A 2OIBA 4HCUA 4DITA 2QOFA 4CLJA 2ZV8A 2Z7RA 3W0SA 2CNUA 2GS7A 3VS4A 1WBPA 4ZLOA 2OXXA 2XCKA 5JSMA 4FSNA 4GK4A 3FXXA 5IEXA 3UTOA 4ZZMA 4IX6A 5JGDA 3HEGA 1OB3A 1RW8A 1JBPE 1Q41A 3NGAA 4K0YA 1YI4A 1GY3A 4WUAA 2GHMA 3I81A 3IK3A 4YHFA 4AX8A 3ZFYA 1ZYDA 4PF4A 1OUYA 4NZWB 4ZLZA 1ZLTA 3T3VA 4ITHA 4JG6A 2BAJA 3BCEA 2FA2A 3VUIA 1YDRE 3JS2A 2WMSA 4YNOA 2QO2A 3POOA 2J90A 4RWKA 4YJQA 3NUAA 4RA5A 3CE3A 2JD5A 4XV9A 1XH5A 4HCVA 4CV8A 4DFXE 3BLRA 1KOAA 2X1NA 1H0WA 4LQMA 3FZPA 4U9AA 5B2KA 4Y8DA 3C0HA 4OT6A 5CI6A 3ZTXA 4U45A 5IA0A 3ORZA 3BZ3A 3KRWA 5EI8A 3QD0A 3SD0A 4AW5A 3PDTA 2PMIA 2C5XA 3AMAA 5CT7A 4DT9A 2XF0A 3D5UA 3DFCB 4IANA 4N70A 1QPJA 4WA9A 5C01A 4AXAA 5CNNA 1H1PA 2J7TA 3UGCA 4EH3A 5HORA 5HTBA 1L8TA 5LCJA 4FT0A 3IW4A 4HW7A 4BTJA 1TQMA 2FO0A 2WTVA 5CU0A 5ANOA 3ORKA 4IWDA 4U97A 4F70A 4EUUA 5M08A 1REJA 4EOKA 3U6HA 4J7BA 4U98A 2YA9A 4CMUA 4XYFA 5AV0A 4O7YA 4IWPA 2PL0A 2HWPA 4OTGA 3SRVA 4PTEA 4ALVA 3SA0A 4N0SA 2BDJA 1ERKA 3Q6WA 4DEAA 3SOCA 2UZEA 2B53A 2OG8A 2Y8OA 3AOXA 4GFMA 3V8TA 4JNWA 3OCBA 4RX9A 4ACDA
chains in the Genus database with same CATH superfamily
3QCYA 1H4LA 4TNBA 4AT4A 4FT9A 3FQEA 2QOLA 2BZHB 4KWPA 4EH9A 5M06A 1CKIA 4EK3A 3KA0A 3U4UA 5I4NA 4AUAA 3FSKA 3MA6A 3CSVA 3QBNA 3QZFA 3DZOA 4RX7A 4RC3A 2WEIA 4QMSA 5JT2A 1WBOA 4IQ6A 3E88A 2CGXA 3LCDA 3G6HA 3PA4A 5HVJA 3T9IA 3W8QA 1Q8YA 4ZY4A 1FMOE 2I40A 3OOMA 4HNFA 5IQFA 3HV4A 4E6AA 3OXTA 4QP7A 3K2LA 3QTRA 3LAUA 4MQ1A 2GQGA 3N9XA 2XYNA 5EHYA 3QX2A 5AFVA 4QP2A 3RNIA 2B1PA 3DK7A 1H0VA 4GMYA 1SMHA 4QTEA 4QTBA 2YZAA 3QQJA 3QRKA 1F3MC 2R64A 2YHVA 3C5UA 4GK2A 1TFFA 4ZTQA 2PE1A 4DEEA 5CAPA 3W10A 5AA8A 1T46A 4R1YA 3F69A 3DFAA 3NR9A 2KTYA 4F7LA 2W4KA 5HO8A 3D14A 4QTCA 3RJCA 4XG2A 2VWIA 4U5JA 3HV6A 3GCQA 5CTPA 4MBJA 3TDVA 4ITIA 4FNWA 4M67A 1KE5A 4AXEA 1H08A 3IW7A 4ZJJA 1PXMA 4AA4A 2W05A 3RZBA 1WCCA 4ANBA 4BZDA 3HGKA 5HGIA 5AMNA 5ETFA 3IO7A 3EHAA 3NYVA 5C8MA 5B7VA 3EQPA 5FRIA 4ENXA 2QR7A 2R9SA 4MQ2A 5GIOE 3FLZA 3PXYA 4WSYA 2W5HA 2C6TA 4IVCA 2BDWA 5DEYA 4ZSJA 2R0IA 1MP8A 4AOJA 5IUGA 1W0XC 3NRMA 2JC6A 5LVOA 3QZGA 4IW0A 3DZQA 3JYAA 1UKIA 2X8DA 4U80A 1JWHA 3DLSA 3ML1A 2VTAA 3NZ0A 3L8VA 4PMTA 4FYOA 3FMNA 4DFYA 3DCVA 2DUVA 5I9XA 4EWHA 4KKGA 4I21A 2OIQA 2ZV2A 3FKNA 4FC0A 1UVRA 1OPJA 2BAQA 3UG2A 3JPVA 3GI3A 2W0JA 4EK5A 4PDYA 5DI1A 5KMMA 3FLQA 3WZEA 2JKOA 1GNGA 2R3OA 2YWPA 3WYYA 4G3CA 4I93A 3I6WA 3U4WA 4ACMA 5IEVA 3KXGA 4FSRA 4ZSEA 4CG9A 4JDJA 5IDNA 1PMVA 4ZTRA 3FLYA 4JG8A 5JFXA 4A9RA 1ATPE 3AGMA 5AP6A 5HQ0A 1YXVA 4YTHA 1WBWA 5ANIA 3GC9A 3DT1A 3VUHA 4CFNA 4B99A 2FH9A 4USFA 3FLWA 4Y73A 3MY1A 5LVPA 5HI2A 3AG9A 3EFKA 2WD1A 2X4FA 2XRWA 3LFDA 3D15A 3AXWA 4LV7A 3TJDA 2C6OA 3FSFA 1YXUA 4WRGA 2VTOA 2VV9A 4QNAA 3RM6A 3W8LA 5KX8A 4TZRA 4QQTA 4DHIB 2EU9A 2YIYA 3P78A 5CZHA 3D7TB 3O2MA 4OTHA 5F9EA 1OKYA 4AXDA 4S30A 2DWBA 5EW8A 3TXOA 3ANQA 2ZVAA 3LJ1A 2ZB0A 2F2CB 2WNTA 2XYUA 4TYGA 1ZMWA 3WI6A 4DGLC 2NO3A 3HUCA 4EEVA 3S00A 3BPRA 4LI5A 4IX5A 2ETKA 5DNRA 5HTCA 5KMLA 2A27A 3PZEA 4MTAA 3VF9A 2WQOA 1JAMA 3QA0A 4YBJA 1J1BA 1VR2A 2DYLA 3F5XA 4L52A 4YU2A 2ONLC 4IHPA 1W82A 2VTQA 3P08A 3C4EA 1RE8A 5CVGA 3KF7A 4EH2A 4HVHA 3ZOSA 4O0VA 1I09A 4N57A 4U40A 2C6EA 4I0SA 2C5OA 4FKJA 1IEPA 3BHTA 1REKA 4I3ZA 5T68A 4BR3A 2VTLA 5HESA 1H1RA 3C7QA 3P7AA 3IOKA 1CM8A 2QCSA 4NCTA 4NJDA 5IH6A 3LXLA 5AADA 1J7IA 5M51A 5I9VA 3ZRKA 5CU6A 3MTFA 4F7NA 5BVKA 4EOOA 3O23A 2XP2A 3AD4A 5JFSA 3TYKA 3P0MA 4TYEA 5IPJA 3BLHA 3EZRA 1Q62A 3BGPA 3G0EA 2EXCX 4GW8A 4R6VA 1V0BA 3QF9A 3BLAA 4RIOA 2W1IA 4DHFA 1L3RE 4USDA 4QEBA 4OTRA 3JVSA 5E92A 4FSWA 3RM7A 1OIQA 5HNGA 3H9OA 3SXFA 5HG9A 4HZSA 1EH4A 3NFGB 2QLUA 2VX3A 4TWOA 3QU0A 3VIDA 2I0YA 3NCGA 1XBAA 3DAJA 5JQ5A 2VGOA 3O7LB 4RWIA 5AUZA 5KKRC 3TZMA 2ITNA 3Q4ZA 4JBQA 4O2ZA 4IB5A 3Q32A 4RIYB 4FBXA 1JKSA 4IJPA 1J7LA 3BV3A 4Y46A 3OWLA 4RLKA 5C27A 3QKKA 4XG9A 3P5KA 3H4JA 4D5KA 3ID6C 4C37A 4ERKA 3RK9A 1DM2A 4FV9A 5CAOA 4BTKA 2XK6A 5M57A 5EKNA 4LOQA 3SXRA 4WOVA 3UO5A 3NUPA 2PVKA 4WRSA 4AGDA 5KHWA 4J8MA 2J0MB 3P7CA 4QO9A 3BI6A 3RHKA 4M13A 3PTGA 4LMNA 3NNUA 4XX9A 5KO1A 3Q4CA 2I0HA 3FEGA 2I0EA 2BHHA 3R8UA 4E1ZA 3T8OA 4QTDA 3H30A 4QMYA 4DEIA 4IDVA 4I23A 4LFIA 3GENA 4OTIA 4R3PA 4XUFA 2OU7A 2UVYA 3F2NA 3M11A 4RGJA 5CYIA 3TMOA 5IG1A 4JDKA 2NNWB 4I5CA 3TNHA 4F78A 4ZJIA 1FVVA 3QUPA 4KABA 4CT1A 3RCJA 3MW1A 2PUPA 4L3PA 4QMWA 1BX6A 5HEZA 3P86A 5BYZA 5IH4A 3TCPA 1OVEA 1FINA 2J0KA 3DDQA 4BDIA 4EOLA 5E8WA 3HAMA 3HMPA 2PK9A 2RG6A 5EG3A 1SNUA 1XQZA 4KRCA 4QYYA 4FKTA 4M14A 1LEZA 2PSQA 3O96A 4I0RA 3I5ZA 3PWDA 2CLXA 3FPMA 2YCRA 1Q61A 3V6RA 3V5JA 1KE6A 2Z60A 3F82A 4H36A 5DT3A 4FV1A 3SOAA 3ACKA 1OL6A 3RPYA 3ZLWA 5AUTA 2BROA 4QMVA 3DOGA 4YO4A 1YWRA 3IGGA 4WG3A 1U54A 4FKUA 2IZUA 3RHXA 3FE3A 4JMQA 4F7JA 4O86A 2WMQA 5IDPA 4DGOA 2C0IA 3QD2B 3PXRA 5FGKA 2ERZE 3R63A 5F4NA 3HUBA 3CXWA 5IA3A 2VWWA 3A62A 2E9VA 1WBSA 4W4XA 5E4HA 2ZM4A 2LGCA 2JIIA 4ENYA 4II5A 3FPQA 2GTNA 4U6RA 3NNWA 4S32A 1SVEA 5CSPA 4I24A 3QQKA 5HVYA 5HCXA 3LOKA 1PHKA 3E5AA 1WVYA 4W4VA 2YFXA 4YZ9A 1I44A 2VO0A 4MD7E 1YHWA 2VGPA 4LL5A 2QU5A 3F5UA 4NT4A 4PDOA 5E8VA 2YJSA 4AGUA 3C1XA 4FGBA 3UZPA 3DBDA 3D94A 3GU5A 4MCVA 3UMWA 3UYSA 3E63A 2W99B 3MH2A 4YSJA 3GCSA 4ZAUA 3B2WA 5AUYA 4O7ZA 3R7VA 2CKEA 2YCQA 3QTIA 5AX9A 5JFVA 5FXQA 1WBNA 2YN8A 3ORLA 3OUNB 4DH1A 3SGCA 1DI8A 2HZIA 3QQGA 4FVRA 4WHZA 4F64A 3F3TA 4EYJA 5GIPE 5J8IA 3GC7A 3MFRA 3AC1A 1KE8A 3R01A 2ETMA 3MIYA 4IAYA 4FR4A 4E8AA 4YJVA 3OCSA 4BCOA 3UDTA 3DLZA 2W1EA 2WZJA 3OW3A 3W0MA 5DR6A 3R7OA 4M97A 2YM4A 5BNJA 2XAMA 3R28A 3W16A 4GYGA 4YZNA 4G5PA 3PSBA 3BRBA 2YIWA 4DA5A 3I60A 4DG2E 3FHRA 4ZMEA 3OW4A 5K4JA 4FKGA 4MWHA 2JDRA 4F0FA 4HVDA 2Q83A 1FGKA 4FTRA 4BCFA 3VWAA 4K33A 5GHVA 3G5DA 4BTMA 2C0OA 2R3JA 4ACCA 4CTBA 2O3PA 4D4RA 3NVKI 4JOAA 4XS2A 2XALA 2QNJA 2VTHA 5DR9A 4OTWA 3TKIA 2IZSA 5G1XA 3UE4A 3WARA 3EL8A 3GU7A 4BDGA 5FTGA 3ZBXA 2VX0A 4KKEA 4LG4A 4IVAA 3EMGA 3FY0A 3EIDA 2PWLA 3CLYA 4WNPA 4NM3A 2RKUA 3Q4UA 4L7FA 2VTTA 4CQEA 2WO6A 4FG7A 5DHJA 3S1HA 2RFEA 5EHOA 4XBUA 4Z3VA 3IONA 3OCTA 2P33A 5HD7A 3NUXA 1ZYLA 3VQUA 3LCKA 3ZM9A 2BZKB 4BB4A 3DBCA 3FQHA 4M69B 1SYKA 2QO7A 3KN6A 2QHMA 5FP5A 3EQFA 4D9TA 4FKRA 5L8LA 1M2RA 4DFZE 5KMIA 4QPSA 2QOIA 3TIZA 4RIYA 3NW7A 3IDBA 3REPA 4RJ8A 3GNIB 4O96A 4O7VA 3DDPA 1JKLA 4V0GB 4CD0A 3R1QA 3ORMA 2WMRA 4A06A 3EJ1A 2JKKA 4L42A 1NVQA 1U46A 2B9FA 2PZYA 4BIDA 4IAAA 3OEZA 5LMKC 3LVPA 4EZ3A 3BHUA 5CALA 2ZDTA 3F3VA 4ORKA 4EC8A 5HE3A 1GIHA 3JY0A 3FAAA 5FTOA 4FKWA 1FVTA 5DT4A 2A4LA 4AZTA 4PP9A 1Q8WA 2J2IB 1OZ1A 3PLSA 4IEBA 3TJCA 2XNMA 3W0OA 2Z02A 4FKSA 1KOBA 2ITXA 4M12A 4OGRA 5CEPA 2X2MA 2PZRA 5JK3A 3IDCA 2R3FA 4GH2A 4JDIA 3UC4A 2X39A 3DXQA 3TKUA 4ZK5A 2BVAA 4JL9A 5EYMA 3ATSA 1JKTA 4GJ3A 5J5SA 5IMEA 2KULA 2ZOQA 4YJSA 4U3ZA 2GCDA 3DKFA 3GOPA 4BDCA 2ZFYA 4L46A 1R3CA 4LOOA 3DKGA 2YM3A 2QG5A 3PY1A 3FMEA 2YEXA 4UXLA 4GT4A 1ZARA 4J98A 4HYHA 4EC9A 4Y72A 4D1XA 3BYUA 3FC1X 3S3IA 3K3JA 5ITAA 2CCHA 3QUDA 3O8PA 4MXXA 5AP1A 3PG3A 2G15A 2H34A 4NSTA 5J9ZA 3NWWA 2XNEA 1MRYA 2X2KA 3VJNA 2GSFA 4FKLA 4GVAA 4KBAA 2V0DA 4CFUA 3SG9A 4JG7A 2Y7JA 3EN5A 5JZNA 5ANGA 3BU6A 4DF3A 1MQ4A 4EQCA 4Q5HA 5AWMA 2OW3A 2X7GA 5CSXA 1KV2A 4QPAA 4GUBA 5EQYA 5M4CA 4CT2A 4DLJA 4EONA 1PMUA 2XM9A 3ZZWA 3EQRA 4OT5A 2CDZA 4MNEB 4ZS4A 3UVRA 3PUFC 4FTLA 3MI9A 5C03A 2WQBA 3ATTA 3FZSA 4G3FA 3ZHPC 4IB3A 5A4TA 4TYIA 2QOHA 3L9LA 1JSVA 1YKRA 3R71A 3DJ7A 4ARKA 2UW9A 1OGYA 4W4WA 5I5ZA 3DJ6A 3G33A 4A9SA 4PTGA 1VYWA 5FM3A 3PY0A 5BMMA 2NRYA 5H2UA 3PFQA 4C4GA 4L7SA 2CPKE 1YHSA 4BIBA 2RG5A 4PMMA 2PYWA 3FMLA 3CGFA 4XV1A 4TPTA 3D5VA 2C1BA 2XEZA 3MTLA 3LM5A 3OY3A 2R3RA 4QYGA 5J95A 5FM2A 4RQKA 2GS2A 5FEEA 3W0PA 4O7PA 3CBLA 3QTQA 4I4FA 3RAHA 3TNIA 4CCBA 4NU1A 3MH0A 3OVVA 5FUTA 5LXMA 2GFSA 3C4XA 3G51A 5D11A 5KMJA 3ZFMA 4CLIA 4E93A 4FEVA 4MBLA 2R3NA 3DNEA 2GDOA 1R0EA 4IAKA 2YM5A 4YLJA 4CFVA 4FKVA 5D7AA 5DG5A 2J0LA 3AQVA 4ANLA 3TDWA 4KNBA 4RIXB 2VUWA 4S33A 3NMUF 4TL0A 4XP3A 5EYCA 1WBTA 5CWZA 4H58A 2A1AB 4S34A 4Q9ZA 4BZNA 4FUXA 4YLLA 3KRXA 2FSTX 3BU5A 4XOZA 3F7ZA 4CFMA 4M8TA 4LYNA 3IG7A 3Q6UA 5ACKA 4H39A 4USEA 2IW8A 4O6LA 3P7BA 4XJ0A 3VW8A 3PJCA 5CEMA 4EHEA 3RTPA 2XJ0A 3FV8A 3Q52A 2ZMDA 2GS6A 2CGVA 3NNVA 2R3HA 4J53A 4NJ3A 4PL5A 5L2SA 3OXZA 4DCAA 3HDMA 3CD8A 2VTPA 2PHKA 2IW9A 2PVJA 4V04A 4WBOA 5K5NA 4E4XA 2QOCA 3ZSHA 2XIYA 4HPUE 5FXSA 4P5QA 5CZIA 4FTOA 1M14A 5CU3A 4BDDA 2RF9A 4Y5QA 1A9UA 1ZZLA 4FSQA 3VBYA 3VS5A 3R02A 5KE0A 4D0WA 2UUEA 3ALOA 1Q8TA 3I7CA 3KVWA 3CQUA 2FSMX 1ZOGA 3E8DA 3I1AA 3NYXA 2OWBA 4L01A 3NCZA 1Y91A 4CG8A 4BCIA 3EN9A 4JBVA 2VWXA 5M09A 3LCTA 3PE2A 5LCKA 3UVPA 3DAEA 2C6DA 4X3JA 1U59A 5FBNC 1ND4A 4FNZA 2XBAA 3KB7A 4YC8A 2VTSA 5JGAA 5K4IA 3EH9A 5GJDA 3R0TA 4AP7A 3UZRA 3QYZA 4HCTA 5BQ0A 2C3JA 4OBOA 4F1MA 2NRUA 3RI1A 4ZP5A 4KS8A 1T45A 5EM8A 2YCSA 2W5BA 4FSZA 4XLIA 3BV2A 4JT3A 4RQVA 5IF1A 3C0GA 3DQWA 4FZ6A 4RIWB 1ZRZA 3P1AA 4V0GA 5DGZA 3VAPA 3HDNA 4XG3A 2YISA 4GVJA 3QHRA 5IUIA 3ZUUA 2O2UA 3QQHA 3A8WA 3UMXA 2F49A 2HZ4A 1P4OA 3TACA 3IW8A 2I0VA 3G90X 2O0UA 4DBXA 2CN5A 4JR3A 2ZYBA 3LFCA 4IX4A 4EK6A 3HMOA 4FKQA 1QCFA 2EB2A 3D7ZA 4FV6A 3WF8A 2QO9A 2YM8A 2XJ1A 3KC3A 4FVQA 5EOBA 2YAAA 4BYJA 3DKCA 4JQ7A 1IAHA 3ETAA 4E4NA 3LCOA 4C2WA 4DC2A 5IZFA 3ZONA 4O82A 1YXXA 3QWJA 3KCKA 4NCTC 4TN6A 5EOLA 3TZ7A 5IA4A 5IU2A 3KQ7A 4GUEA 1UU8A 2B0QA 4IAFA 4XG8A 4YSMA 4OTQA 3QCSA 1PXJA 4BCNA 4O0YA 3SV0A 1S9IA 2IZTA 2JEDA 4BBMA 1PXLA 2I1MA 3OS3A 5CEQA 1OM1A 3NS9A 3SHEA 3I0QA 4DDGA 4K8AA 3KMMA 4UALA 3UDSA 3LPBA 4IMYA 4ITJA 4JDHA 4X3FB 3WILA 2PZ5A 4ZEGA 5EI6A 4GG7A 2E9UA 1H26A 3VUDA 3PPZA 4JRNA 4TWPA 5CF8A 2I7QA 3GQIA 1JOWB 4LUDA 4YJNA 5KZ0A 3KRRA 1ZYSA 2GHLA 5KHXA 2XAOA 4C4IA 1LP4A 1YOJA 1LR4A 3FYJX 2G01A 1Z9XA 4FOBA 4L44A 2ZAZA 4O21A 5AX3A 5KCVA 1OBGA 3QZHA 1ST0A 3TKHA 1BL6A 4IZAA 5AV4A 2OF4A 1K2PA 3BX5A 3N4TA 3PWYA 1PYXA 2CHLA 3VBWA 4MNEA 4DH7A 4ERWA 3PRFA 3QWKA 5L2WA 3E64A 1ZOHA 4JRVA 3EQHA 4IIRA 3CTQA 3O17A 2P2HA 4FG8A 3QFVA 3KXMA 4R3RA 2JDTA 4DTKA 3KU2A 4XP2A 4KIPA 4Y95A 5HG8A 3PJ3A 2HK5A 2RFDA 5HNBA 3RAWA 3RWPA 2BCJA 4I6QA 3D5WA 4IBMA 5D7VA 4GS6A 3UDZA 2CLQA 2XNGA 4I6LA 3WE8A 4BDFA 3PJ8A 4DGGA 4F1TA 1PXNA 2IZRA 5CEIA 2ESMA 5IA5A 3Q2JA 4OBPA 5HLNA 1MRVA 2PPQA 2W96B 4MKCA 3K5UA 2WTIA 2GPHA 3F2RA 3FZRA 1O9UA 3WF5A 4XOYA 4BCMA 2YERA 3QA8A 4OLIA 5CXHA 3M2WA 3V8SA 4CV9A 3OT8A 2Y6MA 1YXSA 3FQSA 3VONA 1DAYA 3QXOA 3W2RA 4FEUA 4U41A 1X8BA 3P9JA 4I5HA 4Z16A 3LZBA 4D4YA 5BUIA 3OBGA 1FPUA 5M55A 4AACA 4LRJA 4IH8A 3B8QA 4RIXA 3GFWA 3S2PA 2VN9A 3KL8A 3IPHA 3CIKA 1XMMA 2CCIA 3HNGA 5LWMA 1JPAA 2BALA 3Q3BA 3A61A 2Q0BA 3NIEA 5IQDA 3TL8A 1VEBA 3R04A 3MPTA 4JJRA 3OD6X 2XANA 3QALE 3KEXA 3AT2A 5JQ8A 3ORPA 3PA5A 2VTNA 5HE0A 1ZYCA 3QL8A 3OWPA 3V5LA 5CANA 4EH6A 2BFXA 5CEOA 3K54A 2VO6A 4Q5EA 4AOTA 4HVIA 4EOQA 4EORA 3R73A 3AD6A 3PVUA 4IX3A 3UO6A 4H1MA 4UV0A 2GFCA 5I0BA 3BHVA 4XH6A 4CEGA 4UN0C 4ZLYA 1MQBA 4ONAA 2PMLX 3ENHA 2EXMA 2C3IB 1CMKE 5JKGA 1FOTA 4R3CA 5CSHA 5H3QA 3RGFA 3VUKA 4HNIA 5LVLA 3SLSA 2ZV9A 4EHVA 3FMJA 1JSTA 3V51A 4HVSA 1O6LA 1Q8ZA 2OSCA 3TIYA 2BHEA 3OWJA 3F6XA 3W0RA 4CGAA 2GNGA 4UZDA 2PVLA 4M0ZA 2VD5A 4DBNA 2UZUE 1PMNA 3R7UA 5HCZA 1H1QA 1HCLA 4CKJA 1IR3A 2X8EA 4O83A 4BHZA 2XNNA 4EZ5A 5HX6A 5DLSA 3PA3A 1ZXEA 3RINA 1OPLA 2OIDA 4TYJA 3OROA 1Y6BA 3FMKA 1U54B 3ZLYA 4L53A 4ZSAA 3G0FA 3DB8A 4O7NA 3FI2A 4PDPA 2R3GA 3Q5IA 2OFUA 4W8EA 2YDKA 4RIWA 4P4CA 4FV8A 4TKSA 3MFTA 4UXQA 4JS8A 3GFEA 2PVMA 4I1ZA 4PV0A 2R0UA 4D2RA 1PW2A 4AGWA 3PP0A 4XNEA 4CFWA 4F6WA 4F0GA 5GJGA 2IVUA 2GNHA 3KFAA 4A9TA 4NTSA 4RBLA 4NUSA 5FTQA 3LE6A 4A4OA 3O5AA 5D9HA 4DHJA 4EHGA 4G3GA 1FBNA 2QI8A 4I22A 4QMPA 2QOBA 4NL0A 4F7SA 2J0JA 3MDYA 4FV4A 3AGLA 3ITZA 1ST4A 1K9AA 2QONA 2UVZA 3KXNA 3POZA 5E8ZA 4ZIMA 5JRQA 4U81A 2X8IA 5J1WA 4P7EA 5LVNA 3R8ZA 5KMKA 4UX9A 2XJ2A 4XCUA 3C9WA 1Q24A 3OT3A 3ERKA 5K9IA 2JDOA 3L8XA 3HMNA 1H1WA 3FUPA 3PJ1A 4KSPA 2XNOA 3Q5ZA 3HX4A 2WKMA 3KGAA 5IA2A 4C4EA 2JLDA 3TI1A 4X3FA 4YHJA 3VC4A 3BE9A 1YQJA 3KK8A 4MYGA 3DTWA 3O8UA 3CPBA 1OMWA 1R0PA 2JFMA 2V7AA 4GK3A 3CKXA 4XMOA 1V0OA 3CR0A 5BYLA 3ZBFA 4BDJA 5DFPA 3RMFA 2WMVA 2UZNA 1AD5A 3TV4A 5D12A 3VJOA 4C35A 2HY81 1M7QA 5CVHA 5EDRA 3Q9XA 5EKOA 3TNPC 5F1ZA 5FP6A 4IVBA 2GMXA 3VRZA 5BVWA 4CCUA 4O6EA 5AA9A 1MRUA 3U8WA 4IAZA 2JDSA 3SW4A 5DRDA 4Z7HA 3FL4A 3HECA 2XMYA 4AN9A 4FIIA 5FQDC 3RCDA 4MHAA 5IQHA 4FSYA 5C8NA 3QCQA 4QQCA 5BVEA 2OJFE 2XIKA 3BHYA 3JR1A 3ULIA 4GFGA 4RFYA 3R9HA 4Y85A 4IFCA 3KY2A 3QXPA 4FTTA 3QRJA 3LFAA 2QLQA 1Y8GA 5AIRA 5HBJA 4NM5A 2R3MA 4X0MA 1ZYJA 3VUGA 2YDJA 4IM0A 3H0YA 3ZLXA 4PP7A 4LV5A 2AUHA 5L8JA 3QCXA 3B8RA 1SNXA 4QP9A 4ZTLA 4EZ7A 5ICPA 3UQFA 5DEWA 1YOLA 3KK9A 3ZEPA 3VNTA 3ANRA 3HV7A 5DYJA 2PULA 3COKA 3DBEA 4BBFA 1PRYA 3QYWA 4GEOA 4N6YA 4DAWA 5F95A 4RVKA 5H9BA 2HY0A 4FK6A 3UOLA 4DCEA 5ANJA 5EYKA 5J9LA 1DS5A 2BTRA 2YDIA 4TY1A 4YJTA 1QMZA 3CD3A 2V5QA 4F9WA 2ITZA 5DT0A 4F63A 4D5HA 4RJ6A 2QOOA 5E1EA 3EWHA 3BYOA 2UZLA 3QQFA 4YZBA 5ANKA 5B2MA 4FKIA 4C02A 2ITOA 4AXFA 2OJ9A 4WG4A 2W4JA 4GKIA 3VBQA 1URWA 3HMIA 4K6ZA 4BCJA 2B4SB 2BKZA 1WVWA 3TUDA 4ACHA 1UA2A 5CU2A 4KSQA 3RPOA 3U51A 5LMAA 2IO6A 2OXYA 5BVOA 3E7VA 3HRCA 3R30A 3ZXZA 4IB1A 2ZB1A 3MYGA 4GIIA 3R9OA 2WMAA 5L2IA 4RWLA 4A4LA 1PKDA 4O84A 4ACGA 3KREA 3JVRA 2XCHA 4O27B 3TV6A 2WFYA 3OC1A 5IQCA 2JITA 3BELA 3KCFA 2YIRA 5HKMA 5BMSA 3OCGA 4G17A 3WZJA 3W55A 4FICA 3TTJA 4KIQA 5A4LA 1UU3A 2PUNA 2VTRA 2WMBA 4C61A 2HZNA 2QD9A 4YBKA 4EOJA 3W2PA 4ALWA 1UU9A 3BYMA 3A7FA 3H10A 3KXHA 3HYHA 4GT3A 2OJIA 4BGGA 3KIOC 3ZM4A 2CJMA 3I7BA 5CF6A 3F2AA 4H1JA 1Q3WA 5BV3A 4BI0A 3AT3A 4BTFA 5A6OA 1KWPA 5I9YA 1J7UA 2W1HA 4ASXA 4HGTA 3Q04A 4FEWA 4YTFA 1DI9A 2WELA 3BGQA 2XH5A 3LFSA 4QP3A 4BDAA 4WD5A 4GJ2A 4DGNA 5A4EA 5EHLA 1OBDA 2ETRA 2FVDA 3E8CA 3ROCA 2BZIB 4BJJA 3CEKA 3FWQA 2B54A 4D58A 4QOXA 4D28A 4HJOA 3FKOA 3DY7A 4BIEA 3EZVA 2DS1A 2W1ZA 4FTUA 3CTHA 4YR8A 2NYAA 3MS9A 5HE2A 2CSNA 3VS6A 3ZZEA 4D55A 4IZ5A 4CFFA 1U5QA 1GIJA 3N51A 3F66A 4F99A 2PVFA 4FL2A 5JN2A 3KMUA 3JY9A 4H3QA 3HVCA 3I4BA 4RVMA 4YC3A 4JR7A 1ZOEA 2JBOA 1S9JA 3CQWA 1H28A 3NUSA 2BRNA 4G6OA 3PZHA 4W8DA 3W2OA 3LXNA 2REIA 2HWOA 2R5TA 1KE9A 1SVGA 2WQEA 4FTIA 3AKJA 4O0RA 2E9NA 4OBQA 5HZNA 2GNLA 2XBJA 4AW2A 3P23A 4QMOA 4B8LA 5HBEA 3VW6A 3C5IA 3DQXA 4PDSA 3DS6A 4QMQA 4O91A 5HIEA 5M53A 1OIRA 3LKMA 4RMZA 5E1SA 3KN5A 4PY1A 5M4FA 2VTIA 3Q96A 5H8BA 2X6DA 1SVHA 3M1SA 3QLFA 4FTAA 4NKSA 2WB8A 4H3PA 5JFWA 4FMQA 3TZ8A 3QTXA 4UWYA 5B0XA 4GFOA 3PP1A 2XZSA 2JIUA 1IRKA 3COMA 3MIAA 4G5JA 4YPSA 4AAYA 3WF9A 4CZUA 3EFLA 4U42A 4X6RA 5IUHA 2J5FA 4RA4A 3FJQE 3G9LX 4Q9SA 4BI2A 1AGWA 3EN4A 2QOQA 3GVUA 4K11A 4Y83A 2YZLA 3AKKA 3GP0A 3BEAA 3I6UA 3MB6A 3RK7A 2UZWE 3RPVA 3ZO1A 4F1OA 4IACA 4PWNA 3TZ9A 2R2PA 4F6SA 5AEPA 4FV7A 4E26A 2BILB 3CPCA 3QC9A 3F3UA 2B9JA 2F7ZE 2RFNA 4J1RA 1Q4LA 1FQ1B 3FLSA 1M52A 4FODA 4RZVA 4WO5A 5GJFA 3UBDA 3NNXA 3S95A 2W1FA 3ZLSA 5HU3A 5ETIA 3L8SA 4UWBA 5CU4A 3R1SA 3A7GA 1J1CA 1HOWA 3TN8A 3LCSA 4NTTA 1UKHA 2SRCA 5TKDA 4QQ5A 3A7IA 3OTUA 2GQRA 3C4WA 3D83A 4EL9A 3KMWA 3MBLA 4YTIA 3WBLA 4ALUA 2W1DA 4Z55A 4G1WA 3O50A 4IM2A 3GC0A 2HIWA 3TT0A 5M07A 3UIMA 4AOIA 2C6KA 4EQUA 3LFNA 3E92A 4CNHA 2BTSA 3GQLA 4D2SA 4FGRA 3THBA 4R78A 2ZMCA 3NW5A 4J99A 3HA8A 4DEHA 3ZC5A 4CZTA 1NT2A 2HXQA 2OJJA 4QP1A 4JIAA 4A07A 4UEUA 1ZWSA 4YPDA 5A6NA 1H24A 4RX8A 3ZO4A 1DAWA 4RFMA 1H27A 4FV2A 4RFZA 2W1GA 4HYSA 4XV3A 3E62A 1OI9A 4OTDA 2CNQA 4FTQA 5L3AA 3TWJA 3RPSA 3QHWA 5CT0A