4GKHA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor 1-na-pp1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
254
structure length
254
Chain Sequence
NLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
total genus 80
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gkhA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4gkhA02
4W4VA 1YHSA 2WMBA 3ZXTA 3UO5A 5CSHA 3Q9ZA 1ZLTA 4AT3A 4HW7A 4UV0A 4G34A 4M97A 3IK3A 2VWWA 5EOBA 3UIBA 3VHEA 3A99A 2ZB0A 3POOA 4UB7A 2WGJA 2ZJWA 2XIRA 3R63A 5BVEA 4FSMA 4F63A 5CSPA 4BHZA 4AT5A 2PVRA 2YCQA 4IAKA 2G01A 3NRMA 4DTBA 1RW8A 4FICA 5FTQA 3ZLWA 3SA0A 1M52A 3PVUA 5FTOA 1NT2A 2W5AA 3FLSA 3H9OA 1YKRA 2PULA 3VUGA 4B0GA 5C01A 4AGDA 3TUDA 3GGFA 5JGBA 1MRVA 4YJPA 5JQ5A 5KO1A 2HWOA 2QKWB 4FKRA 1QPDA 4G3EA 4FKWA 1KE5A 2KULA 4MWHA 5CYIA 3E88A 4DTAA 1YHWA 2Y9QA 4O6EA 4R7HA 4DCAA 2B9FA 3OD6X 3UDBA 3W0RA 2ESMA 3D15A 4GG7A 4N4SA 2LGCA 4LOPA 4L7SA 2VNWA 4B99A 4ZLZA 4PX6A 2XNPA 5BUEA 3MJ1A 1GOLA 3DPKA 3FL4A 3I4BA 4JRNA 4DT9A 2BKZA 1H1WA 4JL9A 5FM3A 2YM8A 4BYIA 3OT3A 3BYSA 3QHWA 2ZMCA 3VUMA 3BHVA 4A9TA 3OHTA 5JZNA 4NM3A 4DEBA 1FGKA 5FP6A 4EH7A 4FNYA 4FT5A 5CSWA 5I9WA 2QKRA 4YC6A 4CZTA 2EUFB 4ZLYA 4PDOA 4AACA 3EQCA 3F2RA 3KGAA 3P7BA 3G6GA 4G16A 3ROYA 3S95A 5BYYA 5AAGA 1AQ1A 5EDRA 3QTQA 3H4JA 5M44A 4K0YA 4O86A 3KK9A 5FD2A 4CVAA 3L9PA 3UBDA 4LYNA 3KXHA 2ZAZA 3C5UA 4FTUA 4LUEA 3H3CA 5EQPA 5CU3A 4UN0C 2C0TA 4WA9A 4MHAA 5FDPA 1YXUA 4FL3A 3KRXA 3E62A 4NTSA 3T3UA 3GU6A 1WZYA 3G9NA 1A06A 5C9CA 3MYGA 2QQ7A 3AMAA 4GJ2A 3WF6A 4ENXA 3KU2A 3Q52A 4TN6A 3GXLA 2C5VA 2HY81 3ULIA 1ZOEA 4F65A 1R1WA 3HV7A 2BHHA 2OK1A 3C4ZA 3P86A 4C59A 3LMIA 4OW8A 4Z55A 3DAKA 2PVHA 5CAPA 4E5BA 5A4QA 4AS0A 4F6SA 1RDQE 4IQ6A 3VN9A 2RG6A 2H34A 3FYJX 3F9NA 1Q4LA 3DK7A 5FEEA 4BDHA 4IH8A 5EM6A 2XZSA 5HNGA 3GVUA 1GIIA 2WB8A 4R5SA 4X3FA 3VVHA 5IH4A 4QMXA 3ZRKA 4DEEA 3OF0A 3V3VA 3DAJA 2BMCA 1W0XC 1WVYA 4E4XA 1JSVA 1R0PA 2X39A 4USDA 4J96A 4L3PA 3KKVA 4ZTLA 2GNLA 4H3BA 3KF4A 4RA5A 3DTWA 4FIGA 1M2RA 1XH7A 4RWLA 4A4XA 3WF8A 3LE6A 4ZSGA 1JKSA 2R3MA 2ZV2A 2VTHA 1QPCA 3R6XA 5L2SA 2OLCA 2R3LA 3QQLA 4S30A 4OBQA 3FLNC 4AZFA 3TIYA 3HP2A 2YM4A 3M1SA 4C35A 3HECA 2PZPA 5JKGA 2C5XA 3R04A 2W1DA 3POZA 2OF4A 3U55A 4CCBA 4F9YA 4QTBA 2IW6A 3GCQA 5L2IA 2RG5A 4BDKA 2BDJA 4S34A 1ZY5A 1IR3A 5T6KA 2EB2A 4U94A 1OKZA 2IZRA 4FEXA 5AJQA 4DH7A 5CEIA 3ZCLA 5HLPA 4XG6A 3O8PA 4RIWA 5GIOE 2PK9A 2WTCA 4FIJA 1BL7A 2X8DA 4QP4A 2I0VA 3ORZA 4JDKA 3VS2A 3PXZA 4KBAA 2YJRA 2OXXA 5TKDA 3G9LX 3RCDA 4IJ9A 2C3IB 3HV3A 5FUTA 4H1JA 4F7LA 4G5JA 1KWPA 1M2QA 4IIRA 5CF4A 1X8BA 4ZTRA 4YU2A 3L9NA 5DBXA 3R1YA 4R78A 3RHXA 3THBA 2BZKB 2PUIA 4EORA 2W0JA 2FSLX 1XH6A 2BZIB 4BRXA 2ETRA 2QOHA 3EN7A 1ZYSA 2BUJA 4NU1A 4PF4A 2V7AA 4MXXA 4ZOGA 4JQEA 5FTGA 4TL0A 1BI7A 5E1EA 4E93A 3PWYA 2XB7A 2GQGA 2WU6A 4A4OA 4I6FA 4IE9A 3II5A 4JBVA 5K5XA 2QG5A 1FOTA 4ZTNA 3QXPA 5CY3A 1W82A 1MQBA 2ZM4A 5CENA 5BMSA 4FVRA 4ORKA 3RNIA 4WNKA 4F64A 4Y85A 3HL7A 3BRBA 3ROCA 3UC3A 4ACGA 4AGCA 1YXTA 1WBVA 3KXZA 1H8FA 3QRJA 4NJ3A 4O82A 2WTKC 5BPYA 2WEIA 3I6UA 4BZDA 1CTPE 3EIDA 1FMKA 1GIHA 4U41A 2W4OA 2UZOA 4OR5A 4X2KA 4LV8A 4YZDA 1IRKA 3BHUA 3ZO3A 4FV8A 4ACHA 5BYZA 2ITPA 4GUBA 1GZ8A 5AUZA 5KBRA 5ETFA 4GU9A 4G1WA 1KOBA 3TJCA 4I5CA 4OGRA 3BU3A 1PMNA 1UU3A 3Q04A 3WZDA 5F20A 4BDFA 4AA0A 5IUGA 3Q32A 2O64A 3FXWA 1PKDA 4DT8A 5C26A 5M51A 4HGEA 2XK8A 3QRUA 4YSMA 3BQRA 4MCVA 2E9UA 3V5TA 4ZLOA 2VO0A 3PIXA 4O0RA 3UIUA 3FLQA 4U9AA 2UUEA 2YM5A 3GU8A 3FXXA 4MNFA 2Z7LA 3AC5A 3R7VA 4BCMA 4FT7A 2O3PA 2C0OA 4AWIA 5D1JA 2R64A 3BLRA 3KMMA 4J1RA 3RJCA 4PP7A 4QMSA 3PY0A 2CPKE 2GSFA 2IG7A 4M68A 3O71A 2BFXA 4FG8A 1WAKA 1JKKA 2ZDTA 5I0BA 4KIPA 4N6ZA 4WNOA 2FH9A 3NUNA 4ITHA 4O7WA 5KUPA 3W2OA 3K3IA 3N51A 4EQCA 5M53A 1LEWA 4J99A 4WOVA 4XCUA 3EN4A 4GMYA 3KC3A 5J87A 3VJOA 4PL5A 4QNAA 2VN9A 3LZBA 4U79A 4FT0A 2ITTA 4QQJA 2GNHA 4DAWA 4ZS0A 3IDPA 2WO6A 3C4FA 5EW8A 1JWHA 3L9LA 2XNMA 4AN3A 2PMNX 4Y83A 2JLDA 2C4GA 5IA1A 3OCTA 5CF5A 4DG3E 3ZOSA 4RBLA 4FG7A 4I6QA 4FSUA 3P4KA 2VZ6A 4ZZMA 3TNHA 4ZJJA 1TKIA 3MA6A 4CEGA 4O0TA 1XH4A 5BQ0A 2AUHA 1DM2A 2QG7A 2UZWE 3DKCA 3QQKA 4JR7A 3AQVA 2RGPA 1TQMA 4EH5A 4OBOA 1M17A 3KVWA 2BIYA 5K3YA 4CKRA 2Q0NA 3OP5A 4FKVA 5ACKA 4XOZA 3T8OA 3Q5IA 4E73A 4UYNA 4ZY4A 3R02A 3DV3A 2XM9A 5HCXA 3NAXA 3DA6A 5LQFA 5ITAA 4PTEA 1H07A 2BIKB 4DF3A 2NRYA 2IW8A 4PQNA 1PXIA 3VUDA 1JVPP 3CGFA 2OJJA 4HZRA 4I0RA 4QP3A 1CSNA 5CI7A 4FVQA 3UMWA 2OXYA 2QI8A 4CNHA 5CAVA 5L3AA 2XH5A 1SZMA 2IPXA 4DGMA 5CZIA 4HGTA 3QXOA 3TTJA 3W1FA 3FKNA 3FWQA 4M7IA 3FI8A 4PNIA 3EQFA 2YISA 4IW0A 4RVKA 5HIBA 3WOWA 4C2VA 5JK3A 5HBEA 3FMKA 4EK3A 5H3QA 3LM0A 4L01A 3MH2A 3ZO1A 3HX4A 4FTOA 4U6RA 3DGKA 4XHKB 5DR2A 4GUEA 3TZ9A 3FI2A 3A61A 4FZAB 4EC8A 5D7VA 1T46A 4GK2A 4EL9A 3HGKA 4FV9A 3QRTA 5IQGA 4C0TA 3OCGA 3OOGA 2VD5A 2VTTA 3GP0A 4RVLA 4TXCA 2W5BA 2HZ4A 4DGOA 4FX3A 3VQUA 1YDTE 3PJ2A 5M55A 4JR3A 3O96A 3R8VA 4MWIA 3DJ7A 4EQUA 4RX5A 3ZLYA 4U3YA 3NUPA 2GHGA 2OICA 2A27A 2XKCA 1FMOE 2A2AA 4IX6A 5I9ZA 5L8LA 2VTRA 4I41A 1ZY4A 1PJKA 2DQ7X 1PXPA 2WMXA 5HNBA 5LMKC 4QMOA 3MPAA 4FIIA 2IZTA 2YN8A 2Y4PA 5KCVA 5DA3A 4FEWA 3OW4A 3S00A 5CT7A 2OBJA 2VTNA 3DB6A 3EN6A 4GS6A 4S32A 1YXXA 3R0TA 3QALE 4JIAA 4NFNA 3TACA 1BUHA 4OTFA 4XUFA 2CKEA 2UVYA 5HGIA 3SKCA 1OKVA 1VYZA 4YJVA 3ZUTA 3KRWA 3DQWA 4CMTA 1OL2A 4J53A 5ANJA 3U87A 3H0YA 3ANRA 4GJ3A 3UOLA 4F6WA 4BIDA 3AC2A 2JKQA 2JC6A 4EEVA 4C4GA 2QVSE 2QOLA 3WARA 1G5SA 4B6LA 2I0HA 3FY2A 3C4WA 3MJ2A 5BUIA 3ALNA 4FTCA 4MXZA 2PVKA 4HVSA 5AADA 5M06A 1FQ1B 4O0YA 3ZEWA 4PDYA 2XCHA 5HHWA 2ITZA 3RTPA 3U6HA 3WE4A 1YI4A 5CVFA 4CRLA 3COIA 2HZ0A 3IOKA 2PZRA 2C1AA 4O2PA 3W8LA 5J7HA 2UW5A 1V0PA 3NNWA 4RX9A 4TWNA 1G3NA 4KNBA 3WZEA 3DZQA 4W4YA 5IQHA 1P2AA 4L9IA 2BDFA 4H58A 3W2CA 4AF3A 3W0OA 2PZIA 3O7LD 3R7IA 5GINE 2GU8A 4FTLA 5H9BA 4LQMA 3TZ7A 3VUKA 3LMGA 2WQMA 4TT7A 5M56A 4YPDA 4HVGA 3VO3A 4BCKA 2ITOA 3I7CA 4OTGA 4AOTA 3I79A 2PZYA 2FGIA 5CEPA 2B54A 4XG8A 2W99B 3OVVA 1XHAA 2QURA 1YI6A 5AX9A 4R7IA 2X6EA 2I1MA 2VV9A 4RZVA 3PA4A 4FVPA 4AGUA 3A8XA 2YAKA 4BKJA 3UNZA 2QR7A 4BCNA 3UYTA 3QQUA 5KHWA 3LCTA 4LGHA 3AD4A 3WILA 3LHJA 4ZMEA 4B4LA 5IA3A 1UA2A 4ZK5A 4XYFA 3BYVA 1SVGA 4RA4A 4BTMA 4S2ZA 1QPJA 1B39A 3LW0A 4BICA 3ORXA 3E92A 2YDKA 5EQYA 4ZJVA 3R7EA 3LMHA 5E8UA 3HKOA 3FI3A 3W0MA 5HG5A 4RIOA 2RIOA 1YDSE 2G2FA 4IFGA 4OTHA 2QU6A 2BR1A 3FSFA 3LXLA 4I6HA 2O65A 1YWNA 2B7AA 3SW7A 5K4IA 2P4IA 2E9PA 4GFGA 4YJTA 4AZWA 3G2FA 3O51A 3NW6A 2XK3A 4FV1A 2J0IA 2B9HA 4JIKA 3UG1A 1IAHA 2X8IA 2Y6MA 3F69A 3MIAA 4G31A 5HE1A 2ZV9A 2IWIA 3UTOA 3D5WA 3VRYA 4E6QA 2Y8OA 3F66A 4FE2A 5CQUA 3ZC5A 4C33A 5DE2A 1KE6A 3OWKA 4BZNA 4FA2A 4IHPA 3LFSA 3TG1A 2F2UA 2PE2A 5EHLA 3ZUUA 5FBOA 3W0SA 2YCSA 5E91A 5DFPA 2WD1A 4FC0A 4PWNA 2YEXA 3E87A 3GU5A 4YTCA 4FTRA 3KCFA 4FEQA 5DOSA 4X7QA 3R8MA 3GB2A 4FNXA 3EFJA 4U43A 2GS6A 4KKGA 1UV5A 5A14A 2J4ZA 2XA4A 4M15A 3GU4A 1OPJA 4QMYA 3MBLA 4IM2A 5IQDA 2OKRA 4AXAA 4AGWA 5IF1A 3VBQA 5CAOA 3QQGA 5CEQA 4O96A 4RWKA 1AGWA 5AM6A 1YWRA 4NT4A 5DIAA 2GS7A 2QO9A 1WBTA 4R77A 5DT4A 4JG6A 4GL9A 2OZOA 1XO2B 4IWOA 5HG9A 3MV5A 3R8UA 3UVRA 4FYNA 2V55A 3FAAA 3Q96A 4G3FA 1PMUA 4J95A 2UW4A 4D1SA 3BHTA 3HMOA 3TCPA 2NPQA 4JAJA 3BEAA 5LMBA 2XKFA 4ZTMA 5HBJA 1PRYA 4BC6A 2VU3A 2QC6A 2JGZA 3VULA 1ZXEA 5CAQA 4MXYA 5AUYA 3UYSA 4DEGA 3DNEA 4EK8A 3TNQB 3AT4A 2PVNA 2V7OA 2YIQA 5AUUA 5HX6A 5DR6A 2XK4A 3LCKA 3QHRA 1AD5A 3LFNA 4ASDA 2GCDA 3IW6A 2F7ZE 3DZOA 4FTMA 1V0BA 2Z7RA 4P7EA 5HICA 1WBSA 5HKMA 2HXLA 3LQ8A 3OXTA 1ZOGA 4AFEA 5KMNA 2VWYA 1WMKA 4ITIA 3NNUA 4FZDB 2WIHA 4HYUA 3VS5A 3KMWA 3PWDA 3K2LA 1JPAA 2YIWA 4L44A 3HAVA 1YW2A 3P1AA 3BPRA 5DEYA 4DITA 5AMNA 1OBDA 3TEIA 4EJNA 2BAKA 4JI9A 4LRMA 5AV2A 3QD2B 2XK6A 2PPQA 4FKGA 5IZFA 2C5OA 3ATTA 5EDPA 4M13A 3F6XA 3CC6A 3EMGA 4QMQA 5LVPA 1FVRA 3V6SA 5DR9A 3L1SA 4ZIMA 1P14A 4D58A 4F7SA 4IDVA 4QYFA 3EWHA 4L00A 4W4WA 2C6EA 1ZMWA 4MD9E 4U3ZA 4EZ5A 5HCZA 2JAVA 4TRLA 4LOQA 3CXWA 5HD4A 3QD3A 3KULA 2C6TA 4EYMA 2O0UA 3HLLA 4UBAA 3UVQA 2UW6A 3JUHA 5F9EA 4QMNA 4LMUA 3QA0A 4EOPA 3VC4A 4C4FA 3UNJA 4D4YA 1I09A 5IEXA 2YZLA 4FZFB 1L8TA 4B8MA 5E7RA 5HVKA 5DH3A 2W4KA 1ZRZA 4X3JA 4GYGA 3QD0A 5L2WA 4AP7A 2YIYA 3VW8A 1NVQA 4L53A 4RIWB 4IANA 1ZMVA 4GT3A 3BI6A 3C0GA 5G1XA 3AT3A 4BGHA 2R3FA 3IPHA 3C7QA 2XBJA 4HVHA 2W96B 4RMZA 3NVMB 5TF9A 3PZEA 1J1BA 1R3CA 2XNGA 2GHMA 4FUYA 4KKHA 2OO8X 4C3FA 1KOAA 4G17A 5D11A 3EL8A 4MBIA 2W1ZA 1LPUA 3DOGA 1U59A 4AU8A 4AOJA 3GQIA 1UU7A 3R7UA 4PMPA 1K2PA 3VJNA 3JY0A 3WIKA 1J1CA 3F5XA 4QMMA 4EHGA 1YI3A 5LOHA 1FVVA 3ZTXA 1SVEA 3MGYA 2JITA 3FY0A 4M12A 5AUTA 1SNXA 2UW7A 4PNKA 2WTVA 3I60A 5ETCA 3KY2A 4FOBA 4IAYA 5CNNA 5IQCA 4OTRA 4YZBA 4M84A 5TR6A 2XNNA 3R71A 2YIRA 3V6RA 4L6QA 2EWAA 2YAAA 3O50A 2R9SA 4RRVA 3TDVA 5F1ZA 2NP8A 2VO6A 3E8DA 1BYGA 3VBVA 2IO6A 5J9YA 3ACKA 1JNKA 3W10A 5KZ0A 4KWPA 2Q0BA 4O81A 4EWQA 3IGGA 3LJ1A 1XR1A 2YWPA 5HBHA 2WOUA 4UEUA 4RFMA 2WMRA 5E4HA 3KQ7A 3NWWA 4GK4A 4KKEA 3R8LA 5M4FA 1T45A 5CSXA 3UP2A 1KE8A 1K3AA 3FYKX 3UQCA 3FKLA 3FMNA 3IONA 3VF9A 3V8TA 3QUEA 4BCGA 3HUCA 3MFSA 3VBTA 3UOHA 3GQLA 5EYMA 3PPKA 3SC1A 3DBCA 2PVYA 5H8GA 4YO4A 4TWCA 4EK4A 4NFMA 5IA5A 3G90X 4BCOA 2J9MA 3WZJA 2R3IA 3FBVA 4NM7A 4BCIA 3HUBA 4KRCA 4Z16A 3CPCA 5HTCA 4FT3A 4OTWA 4HNIA 3R7YA 4YC8A 1UNLA 4O7OA 3NGAA 1H08A 3BQCA 3P23A 4BN1A 2IVTA 4RC3A 2Z8CA 5EHOA 4DFUA 2VWUA 4BBEA 3I6WA 3RCJA 3PXRA 1XJDA 3LKMA 2QOCA 5HESA 4FOCA 4KA3A 4EUUA 2EU9A 2OIBA 1Q5KA 2PL0A 4L45A 3LVPA 3AT2A 3ZFXA 3PSDA 3PE1A 4MH7A 3MFUA 2HZIA 3V01A 5CVHA 3UQGA 2R3HA 4WRGA 4E6AA 3BHYA 3SDJA 2YHVA 2OH4A 4LI5A 1O9UA 4TPTA 2HW7A 2UZVA 2JFMA 4TZRA 5KZIA 3TZ8A 2W1GA 3HDMA 1M7NA 2KTYA 4APPA 4FK6A 3TT0A 2GTNA 5KNJA 3D2IA 3KXMA 2BRHA 2UZBA 1ZMUA 3HMMA 3SRVB 4UZHA 4LRJA 4OLIA 3PIYA 1V1KA 1PKGA 3E5AA 2FO0A 3O7LB 4YJOA 3ORNA 5FLFA 3RK9A 1ZWSA 2FUMA 3E8CA 3E93A 3FJQE 3I7BA 3H10A 4IWQA 2CLXA 4QMTA 4AG8A 3UIXA 5CF6A 5HTBA 3QGWA 4F9BA 3CPBA 2Z7SA 4GKIA 4D28A 4U98A 4XV3A 3HRFA 1J3HA 3DDQA 1F5QA 4GIIA 4H3PA 3NYNA 4OUCA 4YLJA 1PW2A 2Q83A 3GT8A 2RL5A 3NUSA 3LPBA 3FDNA 2PHKA 3P5KA 4AE9A 5J5SA 3DT1A 1K9AA 5C8MA 1FPUA 4WHZA 3CTJA 5IPJA 1M14A 3PXQA 4QP7A 4DGNA 4OTQA 3PY3A 4PP9A 3L8PA 4DEAA 2E9VA 4UYAA 4I20A 5D12A 3OCSA 5M4IA 2ITQA 3KRRA 4YP8A 4BCJA 2BILB 4JDHA 2UZDA 2VTIA 2J0MB 3E8EA 3D14A 4D0XA 1KSWA 3NYXA 4L43A 3CBLA 4MVFA 3ENMA 4EH6A 4FV4A 1OUKA 4AUAA 4ZMFA 3EHAA 4KABA 4LV5A 4XG4A 4ACDA 4CRSA 4BI0A 3PRFA 2OFUA 4IZ7A 3A7HA 2C69A 3C50A 3KRLA 5CI6A 3VRZA 1WBNA 3R9HA 2JDTA 2C6DA 4AQCA 3R00A 5B7VA 2JEDA 2OJIA 4F70A 5GIPE 4Q5EA 4BCHA 5FP5A 3FKOA 3MVHA 2X2MA 1H0WA 2JFLA 4AZTA 3VS0A 5L2TA 3CD8A 4F4PA 1WCCA 4BDGA 2PWLA 2ERKA 5HU9A 4I0TA 3UZRA 4KUJA 4B8LA 3CE3A 3MFTA 3PSBA 4WUAA 4Q9ZA 2YACA 2JDVA 3MWUA 5C8NA 2C6OA 1OIQA 3SVVA 4PDPA 4Y72A 4AZSA 2E9OA 3GCPA 5CT0A 4BDCA 5A4TA 5KMMA 4Z7HA 1H1RA 1Q3DA 1KE7A 5FBNC 1WVWA 3FMJA 2W05A 3O8UA 4I94A 3CY2A 4X2JA 3LFDA 4FTAA 3V04A 2QNJA 3HVCA 1I44A 4YZ9A 1PMEA 2VAGA 4ANMA 1HCKA 5I4NA 3ACJA 3ZDIA 5A4EA 4QYYA 1YDRE 5AWMA 2ITNA 3BIZA 4RJ8A 3NIEA 4DCEA 3QGYA 3OMVA 3RPVA 2I6LA 3AOXA 3PYYA 3WYYA 3BYMA 1ZYJA 2XEYA 5T3QA 2JDSA 3QD4A 3KF7A 3N4UA 3P08A 3G6HA 3ORIA 4FSRA 3R9DA 3GC7A 4BBFA 1MRUA 3Q2JA 2CGWA 2BFYA 4RIXB 4A4LA 3P78A 4I4EA 3KFAA 4LGGA 4HGLA 3GC8A 5T68A 3SOCA 1P4FA 2QO7A 4NJDA 4NTTA 4X0MA 3ZZEA 2W1HA 3F2NA 1UU9A 4A7CA 1YOJA 5TO8A 2WTIA 3F5UA 1Q8UA 4KRDA 4QYHA 2CLQA 1KE9A 3GI3A 4AT4A 4QP2A 2CMWA 1UKIA 2CN8A 5J8IA 5KHXA 4MXCA 5L6WL 1A9UA 3UJGA 3ZBXA 3RMFA 4EOKA 3KXNA 3PXFA 4IAFA 4EOSA 5I9YA 1BLXA 3VBXA 3FC2A 4M3QA 4KS8A 4UWBA 2X9FA 3U4UA 4C36A 5HI2A 4ITJA 2PSQA 3PA3A 3R28A 4BGGA 4N57A 3T9TA 4EZ3A 5BVNA 5EKNA 1S9JA 1LEZA 4MYGA 1L3RE 1NVRA 2XCKA 4GYIA 2ZM3A 4WT6A 4TY1A 4EOMA 4XH6A 5DLSA 2QOOA 2UZTA 2GMXA 3OUNB 4DFZE 4WG3A 1NVSA 4K9YA 4EHZA 2VUWA 3ERKA 1XH9A 3PTGA 3V5LA 4X6RA 4CD0A 4EH3A 2HK5A 1YXSA 4FIFA 3QTRA 5B2MA 4HPUE 2IZSA 3E8NA 4XRJA 3D5VA 1F3MC 3UP7A 2IVSA 2LAVA 4IAAA 4CV8A 4XEYA 4FBXA 5IDNA 4XS2A 3GUBA 4BR3A 2C1BA 2XRUA 5EYDA 4Q9SA 3F61A 1H28A 1IASA 5CU4A 4XV1A 3AGMA 4W8EA 4YTHA 3VS6A 3MVJA 2GQRA 4ZAUA 4JXFA 3W0PA 1U54A 4B9DA 4IADA 4DE4A 3ZLSA 2WMUA 1YQJA 3GCVA 2XVDA 1FINA 3EFWA 4F7NA 3HP5A 2B1PA 2I7QA 4MF1A 2WTDA 4I5HA 3QBNA 3CQWA 4R3RA 4BF2A 4F9WA 1H00A 3OEFX 4QNYA 1XBBA 4I0SA 5CEKA 4IZ5A 5J9LA 4FTKA 2YM3A 3T3VA 4HOKA 2BCJA 5AA8A 4O0SA 5E8YA 2R3KA 5JZJA 3D7ZA 4G3GA 3SXFA 2G9XA 3QCYA 3DBQA 3O23A 1QPEA 3W0QA 3ZEPA 4RJ7A 4BDIA 2XIKA 4JBOA 5AP7A 3QC4A 4NK9A 4PTCA 4RQKA 3SXSA 3RALA 5E92A 2JBPA 4BGQA 4JX3A 3QUDA 3F5GA 4GK3A 2PVFA 1OZ1A 1JAMA 3OBJA 4J7BA 5LWNA 5E8ZA 3D5XA 3QQFA 5J1VA 2WQBA 4J52A 3DU8A 5E90A 4II5A 3RPRA 3M2WA 4XV9A 3C9WA 4XG3A 2OF2A 2JKKA 3MIYA 5C8KA 5M09A 3A7JA 3K54A 1XBCA 2Y0AA 3ZRLA 2PVMA 4H39A 4C02A 4MXOA 4AW1A 2VTSA 2B53A 2OGVA 4PRJA 3JPVA 4TWPA 4ARKA 5HO8A 3PPZA 4D0WA 2W9FB 3U6JA 3QQHA 2HYYA 3BLQA 4WBOA 5F94A 5AV3A 3NAYA 5KMOA 3ZH8A 3DFCB 4ZSJA 5KMKA 4O21A 5HLWA 1P5EA 3C0IA 1TQPA 2G1TA 3PA5A 5HG7A 4WUNA 3Q60A 2WTKB 5K5NA 4HZSA 5IDPA 3MH0A 5BVKA 3PJ3A 2GHLA 4RQVA 5AV4A 5FRIA 3FXZA 4MNEB 3R83A 4IEBA 4GIHA 3SXRA 4L52A 1Q97A 2QU5A 2ITYA 4IX3A 3MVLA 2UV2A 4PV0A 3UVPA 5JT2A 5IH5A 3MTFA 4KSPA 2B4SB 3V5WA 3R2BA 4UWYA 3C4CA 4K33A 4N6YA 2PU8A 3CTHA 3RM7A 2X7FA 3OTUA 4FSYA 3ZBFA 5EH0A 4I5MA 3UZTA 1GIJA 1U4DA 3PG1A 5EFQA 5HG8A 3BYOA 3VS7A 2YERA 3BV3A 3E63A 3FHIA 3HV5A 3KN5A 4RPVA 3LLAA 3P0MA 1H1SA 2XKEA 3NW5A 4FKTA 4DGGA 3SX9A 5IH6A 4DH5A 4HYIA 4WBBB 4XBUA 3IW4A 1MQ4A 2BKKA 3F3ZA 3DQXA 3TNWA 5JSMA 2BTRA 2CN5A 2R0IA 2GNFA 3UGCA 4O7VA 1H4LA 2X6DA 3QC9A 3LQ3A 4U97A 5F4NA 5I9UA 4GKHA 4FIHA 1LUFA 2PVLA 2WNTA 1EH4A 5FQDC 3LFEA 4IDTA 4TKSA 3W2QA 4UXQA 3W2PA 2R3PA 2ETKA 4QMLA 5FGKA 3C4EA 3R9RA 1VZOA 5EI6A 1GY3A 4ZTSA 5G6VA 2QD9A 3AG9A 3Q2MA 4O7PA 4MNEA 5LVMA 2ZOQA 3NX8A 4KAOA 3IECA 3RHKA 3AC8A 2YDIA 3DBFA 4JVGA 4RJ6A 2XNEA 3HRCA 5EI2A 3RK5A 4PMTA 3AD6A 3DB8A 3FLZA 2ITWA 4CFWA 4RX7A 5IEYA 2W5HA 3V51A 3OFMA 5I5ZA 3JYAA 1SVHA 3WZUA 2ONLC 4FT9A 2ITXA 4FKJA 3SG9A 3H9RA 5HIDA 4CFVA 4EH4A 3B2WA 4XP2A 3RP9A 4R6VA 2Z7QA 3I1AA 4IWPA 3KEXA 4IX4A 3MW1A 3EKNA 1G8AA 2BRMA 2GNJA 3DY7A 3QTZA 4YJQA 1XKKA 5LCKA 3HV6A 4O0VA 3A2CA 5F95A 3U8WA 4JQ8A 3BBWA 4N70A 2FVDA 2WU7A 5H8BA 2XK7A 4BVUA 3ZS5A 3KCKA 3TZMA 2P2HA 3MY0A 3Q4TA 5JGAA 3UNKA 3FV8A 3I5NA 2UVZA 3PVWA 4YJNA 4EBWA 1GNGA 1JOWB 3NPCA 4KS7A 4X3FC 3FLYA 4ASXA 4EOIA 3A8WA 2AC5A 4C37A 3OS3A 4WD5A 3QA8A 1J7UA 1W84A 3ORTA 4GG5A 3ZRMA 3PZHA 3PDTA 4FIEA 3TTIA 3QWKA 1W83A 3MVMA 4Y5QA 3QUPA 1UNGA 4GSBA 3NW7A 3GFEA 4YURA 3IOPA 4HCUA 3U9NA 4DHFA 4BYJA 4DFLA 1YHVA 1P4OA 2ZB1A 1S9IA 2G2HA 2XKDA 3IQ7A 3FQHA 4JLCA 4QQCA 3TN8A 3TV6A 5JFXA 4FKQA 2ETMA 3VNTA 3VUHA 1SMHA 2C6IA 4U80A 3SW4A 3TDWA 5LCJA 4NWMA 2E2BA 4U0IA 1Z9XA 1OI9A 4KIQA 4EWHA 3QTXA 4I93A 4R3CA 4GVAA 3QZFA 3DJ5A 4FKIA 3RVGA 1U54B 3ZMMA 2HIWA 2E9NA 3EFLA 3C4XA 3TIZA 2QOBA 1XBAA 2R7BA 3HV4A 3EYGA 3Q5ZA 4V01A 3P79A 4YZCA 3ETAA 5K9IA 2OJGA 2X4FA 3EKKA 4FTTA 4JG8A 4QPSA 3NYOA 5E9EA 3UIMA 1H01A 1VEBA 3I0OA 3KVXA 4Z7GA 4M8TA 3FQEA 5J1WA 3KXXA 4Z9LA 1JSTA 5B2KA 5EW9A 3UC4A 4CFXA 5LJJA 4BI2A 4DG0E 3WF7A 3S0OA 4JX7A 2UW9A 4C61A 4YO6A 2X2KA 4ZY6A 4F99A 1O6KA 3E3BX 3I0QA 4ZTQA 4ANBA 2V62A 3LCSA 3V5PA 3TV7A 2JKMA 5DYJA 2EXMA 4GU6A 4DG2E 2BAJA 3IGOA 4AW5A 4AE6A 4JJRA 1PMVA 4I92A 4HPTE 5CNOA 4EOQA 3TYKA 5L8KA 2CDZA 5AP5A 2A0CX 3PVGA 4FK3A 4ZY5A 2CNUA 4E6DA 2GDOA 3LIJA 3TNPC 5BX0A 4NM0A 4P2KA 5JRQA 3MPMA 3BGQA 3CLYA 3QRIA 3D0EA 3JVSA 4J98A 4ZP5A 4QQ5A 3WZKA 5EM8A 3DFAA 5CXHA 1UVRA 2OG8A 4MK0A 4CT2A 4NKSA 1JQHA 5DPVA 5CEMA 5HD7A 1E9HA 3FI4A 4J71A 2R0UA 3PJCA 4FSNA 4BDEA 4TYJA 2XJ1A 3BU6A 4USEA 3UOJA 2RF9A 1BMKA 2C6KA 2YWVA 3SD0A 4F0IA 3AXWA 4ID7A 2BROA 3REPA 3PUPA 1OUYA 4WNPA 4KIOA 2ZYBA 4XP0A 4XJ0A 2BTSA 3QCXA 3DJ6A 4I24A 3V8WA 3KRJA 3QKLA 2ITUA 4EOOA 5D41A 2Z2WA 2XJ2A 2HOGA 2HY0A 2WQOA 4AW0A 3KN6A 3GOKA 3Q4ZA 4EK6A 4JG7A 4P5QA 3GENA 3PRIA 2OU7A 4ZEGA 4O83A 1PYEA 2J7TA 3ID6C 2BVAA 2QONA 4CLIA 3IW7A 3CTQA 4FR4A 4CQEA 4ONAA 3UO4A 4D5KA 2JAMA 2J5FA 2WELA 3HMIA 4Y46A 5E8VA 3BHHA 5JFVA 3U9CA 2OH0E 3Q9WA 3OZ6A 3VWAA 4FYOA 2C3LA 3QTIA 3WF5A 5L6OA 2WMSA 2WTWA 4M67A 4HCVA 3H9FA 3IO7A 5AP3A 5KMLA 5LMAA 2I0EA 4S31A 1RE8A 2CSNA 4U40A 3OCBA 4DFYA 4DLIA 4O7RA 1CMKE 3ELJA 4IWDA 4OT6A 4TYGA 4LOOA 3OWLA 4OTDA 5FM2A 2UZUE 2J51A 4YJSA 5GNKA 3UZPA 4E4LA 3F5PA 5EKOA 4EKKA 2PYWA 3D7TB 4ACMA 1Q3WA 3W2RA 4P4CA 4UX9A 5DRDA 4F7JA 3TXOA 4ANSA 1BX6A 4DEDA 2PMIA 1XQZA 4JDJA 2BRBA 5D7AA 4CFFA 4KSQA 4NZWB 5IG1A 1DI9A 1VYWA 4ZZNA 2VX0A 2XMYA 4O7ZA 2Y7JA 2CKQA 1NY3A 3TI1A 5EYKA 2CKPA 5DNRA 4AN9A 4MXAA 1PXOA 3CQUA 1TQIA 4QTCA 2OIQA 4W8DA 4O0WA 2WXVA 5IUIA 4DFXE 2VTLA 1FVTA 3R73A 1J7IA 2A4LA 3LM5A 5CF8A 3TNIA 1OVEA 3OG7A 4G3DA 4AX8A 2FSOX 5CU0A 4V0GA 3D94A 3P9JA 5FG8A 2X81A 1ZYCA 1BL6A 4PL3A 1A48A 2G15A 3VS4A 3DK6A 1YXVA 2C5NA 3R9OA 3MY5A 1CDKA 1IA8A 3PE2A 4FI1A 3QX4A 4FODA 4C62A 4DGLC 3Q53A 3SLSA 4I1ZA 4TYHA 4YZMA 2GFSA 1UU8A 2WKMA 2REIA 4QPAA 4QYGA 3GU7A 5JEBA 2PUPA 3PJ8A 4DFNA 4EH9A 4ALWA 3TJDA 4M69B 3SRVA 5IQIA 2QR8A 3GCUA 4E26A 1UKHA 4BCFA 4ZSAA 3AMYA 1FGIA 1UNHA 4RSSA 3JXWA 3I5ZA 4A07A 3D83A 2YDJA 4D4RA 2XEZA 5A3XA 2W9ZB 2X2LA 3IDBA 4PY1A 5BNJA 4CLJA 5IA4A 1WFCA 5DVRA 5HO7A 4C4HA 2PUNA 4FV5A 4RLLA 4RFZA 4Y95A 5FXQA 4BBMA 1Q62A 5CVGA 1SM2A 4FSQA 2WZJA 5LXMA 1LP4A 5M07A 4JS8A 4J97A 2YM6A 4FL1A 2P33A 2WQNA 5AP4A 1ZOHA 4GFMA 3S2PA 4ASZA 4NIFB 1O6YA 3QU0A 3PLAE 5JFWA 3CSVA 3TWJA 3ZHPC 3FMDA 3DKFA 4HNFA 4MEDA 3NUXA 3ZDUA 4RGJA 2VTPA 4JAIA 3TKIA 5IQFA 1Q8TA 3N4TA 2UZEA 2ZV7A 1Q61A 3HZTA 5EK7A 3B8QA 1Q41A 3W33A 2UZLA 2XBAA 3EQPA 1YOLA 1GJOA 4YPSA 4MX9A 3QCSA 5FEQA 2F4JA 2R3RA 1M7QA 2FB8A 5BVOA 3FL5A 3TUCA 4WZYA 3MDYA 3RI1A 4DFBA 4M14A 4U81A 4C3RA 4ZS4A 4RIYA 2IJMA 3WYXA 2C68A 4LL5A 3FZOA 2OJFE 2WMQA 2F7EE 3EZRA 1OIRA 5IU2A 5DN3A 4KBCA 2OZAB 4IC7A 2ERZE 2X4ZA 4GFOA 3ZXZA 2QLQA 2GQSA 3OROA 5HCYA 3TL8A 2OWBA 1DAYA 1SNUA 5CSVA 4CCUA 3PXYA 2XNBA 3U4WA 5IQEA 2DUVA 1MUOA 5KMJA 3RAKA 3QTWA 2VTJA 3B8RA 3NUYA 2WHBA 3D2KA 3IS5A 2PY3A 4I5PA 4MTAA 3R9NA 3CEKA 3F3WA 4XP3A 2WQEA 4WO5A 2WMAA 5J95A 2WFYA 4DLJA 4RC2A 4EI4A 5EYCA 1OM1A 2ZDUA 3KL8A 3DLZA 4WG4A 2R3JA 4AZEA 4B7TA 5CAUA 4ZZOA 4UALA 2W1CA 3UPZA 4NYEA 3OXIA 3MH3A 4U5JA 2IW9A 3MI9A 1CKPA 2B9IA 3KXGA 2P3GX 5E1SA 5HE0A 3NCGA 3EQDA 4IB0A 3WF9A 3G15A 2QO2A 4U7ZA 3WI6A 3GOPA 5D10A 4E1ZA 1OL6A 2IZUA 3FZTA 2WMTA 4CZUA 2WTJA 2UVXA 4D2RA 4N0SA 3EQRA 3SOAA 4QTDA 3ZUVA 2R3OA 3A7FA 3HRBA 3PXKA 5IMXA 4TNBA 2J0JA 3KA0A 3QTSA 2WMVA 3FHRA 3TM0A 2QOFA 5HVJA 2XNOA 3Q4UA 4Y5HA 3LFCA 5HLNA 5B0XA 4O84A 3R30A 4LMNA 1M2PA 5CXZA 1HCLA 2WPAA 4D9UA 4G2FA 3CIKA 2X1NA 3R1SA 3ZM9A 2XM8A 1OKYA 4E8AA 4E7WA 1PXJA 2BRGA 4P90A 1GZKA 2EXCX 3ET7A 4WKQA 3KULB 4BCQA 3UPXA 4LM5A 4YUQA 1CKIA 3MB6A 3QYZA 5H8EA 5KE0A 3U6IA 4FKOA 3AD5A 5AAEA 2R4BA 2IVVA 5EW3A 1JLUE 5HE3A 5C27A 2XIZA 4XMOA 2V0DA 3RM6A 4L7FA 4BTJA 1UWJA 2OZAA 1XWSA 4F6UA 2CKOA 4WG5A 4FV2A 3SV0A 4FZ7A 1WBOA 4DH1A 4M0ZA 5AA9A 3FZ1A 1GAGA 3QF9A 4O7TA 4NW5A 4FUXA 2C3KA 4C38A 2H6DA 1OMWA 4RIYB 4UXLA 1H0VA 5A9UA 2RFNA 5LMKA 2OW3A 3VW6A 5HZNA 3SAYA 4L67A 1FBNA 4R1VA 3R22A 3C51A 5LVLA 3FZRA 2A1AB 5C4LA 2HW6A 3ZSGA 5CEOA 3LJ2A 3BGZA 4QT1A 3ODYX 3PSCA 3VBWA 4C7TA 1QL6A 2RFSA 5C4KA 4CFUA 4CMUA 3FC1X 5LVOA 4ANLA 3DXPA 3R8PA 4GVJA 3UOKA 2XP2A 4F9CA 4YHJA 4FV0A 3HA6A 4QYEA 4YBJA 3COMA 4H1MA 3DAEA 3LXPA 3ANQA 1WVXA 3MA3A 5HEZA 4CTBA 2PMOX 4A9RA 2SRCA 4IAIA 4BTFA 5A4LA 3FUPA 2NO3A 3IG7A 4FTNA 2YZAA 1WBWA 2C6LA 3FPQA 4YZNA 4NH1A 4EHVA 4OT5A 4AZVA 1UWHA 3QWJA 3FE3A 4JDIA 2OXDA 3V5JA 3RAHA 4ALVA 3D5UA 4IVCA 2EB3A 2I40A 4QMUA 4A9UA 3O8TA 4CKIA 2WAJA 5DGZA 4DH3A 4HVIA 3DKOA 5BUJA 3SHEA 1TVOA 3AC4A 1OL7A 4MQ1A 3QQJA 5JN2A 5JGDA 1R0EA 3HMNA 4FSTA 4QP9A 5B2LA 4HJOA 2JDRA 3LJ0A 2BZJA 4PUZA 3NYVA 3DTCA 3EZVA 3FZSA 3LFBA 3BCEA 2JD5A 2UW8A 4UZDA 3VAPA 4AN2A 2X7OA 3LFFA 3GNIB 2PTKA 3QCQA 4K1BA 1Q8ZA 2G2IA 2W7XA 3ORMA 4XLVA 5HE2A 3CKWA 4TYHB 2C5YA 5EHYA 2FA2A 3DBEA 1PY5A 2PUUA 2OSCA 3GEQA 4L3JA 2C47A 2O5KA 3FMMA 5TT7A 3ULZA 3BELA 3BWJA 5AV1A 5DWRA 4BB4A 5DI1A 5BVDA 3NUAA 5HORA 2ZM1A 3NDMA 2R3QA 3FSKA 3VIDA 3A4OX 5AUXA 2OI4X 4V0GB 4ZSLA 5GJDA 4EH8A 5AAFA 1OGUA 1H27A 4AOIA 4XX9A 4CFNA 1RJBA 5LARA 2XIYA 2R5TA 3LAUA 1WBPA 3Q6UA 2O8YA 2BRNA 2VGOA 3QAME 2FSTX 2CNVA 2PVJA 3BV2A 3K5UA 1ERKA 4HGSA 5CASA 2AC3A 4CFMA 3LCDA 4FEUA 2C30A 4DBNA 5HQ0A 4IM3A 3HA8A 4WRSA 2QODA 4L46A 4LRKA 3LOKA 3ENHA 5CLPA 4E5AX 4FSWA 2ZV8A 5CU6A 3O0GA 4AA5A 1H1QA 3QYWA 4O7YA 3D7TA 1R78A 2UW0A 3NCZA 4O2ZA 4V04A 1RQQA 2F2CB 5AIRA 3F88A 3JS2A 2QHMA 5EQEA 3NZ0A 4R5YA 5AUVA 4F09A 5IEVA 4C4JA 4FV6A 3R1NA 1BI8A 4IVBA 3QRKA 4F9AA 5HNIX 1HOWA 5LWMA 5IUHA 2JKOA 2J50A 3BLHA 5IMEA 4U8ZA 3NLBA 3PVBA 4NL0A 3CJGA 2J2IB 4O27B 1H1PA 4PTGA 1Z5MA 3VBYA 4X2GA 4D2SA 3CGOA 2AYPA 4F1MA 3GC9A 3M42A 3SQQA 4HYSA 1CM8A 4L42A 3QFVA 5DT3A 4BTKA 1J91A 4EQMA 2A19B 2WMWA 4CSVA 2QHNA 2BZHB 3K3JA 3O2MA 4UY9A 4ERKA 4QQTA 2JIUA 5AM7A 2XF0A 4E20A 2O63A 3A7GA 4MD7E 1Q8YA 3K5VA 3N4VA 5I9XA 5M08A 2VTOA 3ODZX 5CZHA 2JDOA 2NNWB 3KK8A 2IVUA 2X7GA 3CKXA 3MN3A 4CXAA 4LFIA 4X2FA 3BE2A 3D9VA 5JH6A 2H96A 3LXKA 5FDXA 3VS3A 4FGRA 4Y8DA 4CMOA 1V0OA 4FTJA 2VWIA 2XK9A 3F7ZA 4IBMA 3RGFA 4YHFA 1GZOA 1PXKA 3C13A 4KBKA 3TKHA 4C58A 4NSTA 2C6MA 4F0GA 4GEOA 1DI8A 3GC0A 4EONA 3MTLA 4RJ4A 4YTIA 2OFVA 4IAZA 3ZZWA 4DYMA 4FTQA 1ATPE 1IEPA 4QP8A 4RZWA 4FNZA 1DS5A 3BEGA 4D1ZA 3ZC6A 3HMPA 2W1FA 4DBXA 1URCA 4ASEA 4YBKA 3EN9A 4DN5A 3DBDA 3W32A 3F3TA 3ZONA 4FMQA 1PXLA 2OJ9A 5A6NA 4K18A 4QOXA 5AV0A 4CV9A 2VTQA 4E4NA 2QOIA 1KUTA 4IFCA 5C03A 3W0NA 4H3QA 4JBPA 1F0QA 3L8SA 2Y4IC 4G6OA 3EB0A 5L6PA 5ANGA 4J8MA 3C5IA 2HWPA 4IJPA 3SGCA 1Q8WA 3QTUA 5E8XA 3Q3BA 4G9CA 3JR1A 1W98A 4I23A 3ZM4A 2VO3A 1GZNA 3AC3A 2DYLA 4D9TA 3TKUA 3E7OA 2W1EA 3G0EA 3ORLA 3G33A 3OC1A 3BWFA 2VO7A 4JNWA 4BCPA 3EFKA 3DNDA 3JY9A 4WNMA 1H25A 3EQHA 1YRPA 3S4QA 4RWJA 1Y57A 4O0UA 4AFJA 1IA9A 1Y8YA 4DTKA 4C3PA 5M4UA 1Y8GA 3BGPA 5A6OA 3OW3A 4KINA 3G0FA 4FEVA 4FV7A 4FKUA 3PG3A 1SYKA 4QTAA 5CANA 4JOAA 4DEIA 3FQSA 2B55A 4FG9A 4JRVA 5DRBA 5ETAA 2CJMA 2C3JA 3S3IA 2PMLX 3LLTA 3F2AA 3KMUA 4BDBA 1NW1A 3ZSIA 3RZBA 5ANOA 4DA5A 5KX8A 4D1XA 3IKAA 1OITA 4RFYA 4I3ZA 3NSZA 2GNIA 2YIXA 3NNVA 4RWIA 3W55A 2F9GA 2XS0A 5AFVA 4MD8E 4MKCA 3RINA 5LVNA 1YWVA 3FMLA 5FEDA 4ANQA 2GPHA 3ZLXA 3FPMA 4PMMA 3A60A 5IA0A 1Y6AA 3AC1A 5BVFA 4Y73A 4QTEA 2GS2A 2X0GA 4I22A 3OOMA 2YA9A 4G5PA 1O6LA 4BIBA 3P7CA 2H9VA 3IW5A 4EHEA 5E8TA 2B9JA 1JKTA 4PL4A 1PYXA 4ZSEA 1B6CB 4ENYA 3RK7A 2CGXA 5GHVA 4QO9A 4ERWA 3FZPA 4F1OA 3DXNA 5AUWA 4D5HA 3PIZA 4K6ZA 2FYSA 5BVWA 2R3GA 3ZFYA 4U44A 4QMPA 4QP6A 5KBQA 2O2UA 3G5DA 5CWZA 3H30A 4E6CA 4DC2A 3EQIA 3CR0A 2YM7A 3EOCA 4CT1A 2DS1A 4APCA 1U46A 3QL8A 2CCHA 3RWPA 2HELA 4K11A 2P2IA 2BDWA 1ZARA 4U42A 4AAAA 1OB3A 2BPMA 4H36A 3MH1A 4EKLA 2WOTA 3M11A 2GFCA 4RT7A 3L8VA 5AP0A 4WIHA 5I9VA 4M0YA 2GNGA 5AP1A 2Z60A 3NR9A 4W4XA 3ZFMA 3MS9A 1APME 3RWQA 5CU2A 4GW8A 4I21A 5DEWA 3Q6WA 4YGAA 4BIEA 3CP9A 3R7OA 4OBPA 3NUUA 4PMSA 2VX3A 2F57A 5AIKA 3MSSA 4FKSA 4LG4A 1JKLA 5JFSA 2F7XE 3EJ1A 2W1IA 4TYIA 3PFQA 3BX5A 4O22A 4YNEA 2J6MA 2Z02A 5ICPA 3W2SA 4YMJA 3D4QA 3UQFA 5JQ8A 2BAQA 2J0KA 3HAMA 3O17A 3BE9A 1QCFA 4GH2A 1Y91A 1ZAOA 3PLSA 4MBJA 1YVJA 2HAKA 1OKWA 4H05A 4L3LA 4IVAA 1PF8A 2Y4IB 2VTMA 3DLSA 4K77A 4MBLA 4Q2AA 3LFAA 4RVTA 5AP2A 3CS9A 4CG8A 2HENA 2YCFA 4X2NA 2YJSA 4WSYA 4HYHA 2EVAA 1XH5A 3ZU7A 4E5WA 4F1TA 3Q4CA 4D4SA 1KV1A 4XG7A 3V8SA 5ANIA 2ZVAA 2VGPA 4RLKA 4S33A 3VQHA 3H0ZA 2XJ0A 2R7IA 3OEZA 5BMMA 4Q5HA 2VNYA 4CKJA 3AMBA 3W8QA 4FZ6A 5IA2A 3QX2A 4I4FA 3FMEA 4O38A 5AP6A 3A7IA 4EBVA 4XRLA 4V05A 4PDSA 4FTIA 3A62A 4GT4A 2XRWA 4I6BA 4AW2A 4BZOA 2QOQA 5IISA 1U5QA 4YTFA 4K8AA 1W7HA 4KB8A 4CGAA 3ALOA 3RAIA 5K4JA 5ANDA 4IB1A 3UE4A 3TUBA 3KB7A 4A9SA 2CCIA 4CG9A 2R3NA 3EH9A 3ORPA 1H24A 3LQ5A 5DT0A 5EM7A 4AA4A 4YNOA 4EK5A 1ZZ2A 1H26A 3G51A 2XYNA 1JSUA 3E64A 3LCOA 3P7AA 3CD3A 4GV1A 1NXKA 5ANKA 3RKBA 4FV3A 4BDDA 5HU3A 4LUDA 3OTVA 3V5QA 2P55A 1OIYA 2ACXA 4IZYA 5A54A 1OBGA 3DXQA 3COKA 3R21A 3R2YA 5KMIA 2RKUA 4L8MA 2BALA 1W8CA 2J5EA 1KV2A 2QLUA 4NUSA 4RJ3A 3NNXA 1Q24A 1NA7A 3TV4A 4EH2A 1ZYDA 4C4IA 1QMZA 3BKBA 4GT5A 5M4CA 3EL7A 4X6QC 1Z57A 3EQBA 3QZIA 5HVYA 4BI1A 1E1VA 2V22A 2XYUA 4TTHB 4DEHA 3HDNA 2BHEA 2VTAA 2VWBA 3C1XA 3NEWA 4O7SA 3WIGA 5A46A 3R1QA 3VHKA 3OY3A 3F3UA 4BDJA 3OT8A 3QLFA 3OWPA 3BBTB 3GCSA 4R3PA 4EOJA 4Z3VA 2XIXA 4IB3A 1PXNA 1YOMA 3EQGA 3PPJA 5HX8A 2Y6OA 2ONLA 3Q9YA 4G6LA 3OY1A 4NCTA 3DKGA 3IDCA 5CQWA 4L68A 2PE1A 4MQ2A 4YHTA 3CY3A 1BKXA 3ZYAA 2HZNA 3ORKA 4UWCA 1Q99A 3UO6A 2YCRA 2JBOA 4YSJA 4EOLA 3W18A 4NM5A 1B38A 4O0XA 3OWJA 4QMWA 5A4CA 4IB5A 4BHNA 2DWBA 2RFDA 4JBQA 4X3FB 5EOLA 2H8HA 2HCKA 3OUKA 2P0CA 3AGLA 1PHKA 5IQAA 4BDAA 3DS6A 1LR4A 3NIZA 1OIUA 4E4MA 1DAWA 4EUTA 2VRXA 4CTCA 3L9MA 4G3CA 4EJ7A 1VJYA 3HEGA 4X21A 2VX1A 5ACBC 3BZ3A 5AEPA 3Q9XA 1REJA 4YJRA 3RPYA 5E8SA 4TW9A 2J0LA 4YLLA 1URWA 4A9YA 3DDPA 4XBRA 5CALA 4NCTC 5H2UA 3PY1A 2W17A 3VUIA 1U5RA 3DCVA 4GCJA 3WE8A 3FLWA 4RX8A 5FXRA 4J8NA 3A4PA 4YR8A 2F49A 3R8ZA 3MPTA 1PXMA 4FGBA 5E8WA 2W4JA 4FSZA 1OPLA 4QP1A 4YJUA 3LFQA 5AX3A 3UODA 1VR2A 3U51A 1G8SA 5JMSA 4ZJIA 1CKJA 2X8EA 4GRBA 3UG2A 4EYJA 5DHJA 2PE0A 3QKKA 4DH8A 2NRUA 4R1YA 2FSMX 3QLGA 4XV2A 5HIEA 3SG8A 1E1XA 3RPOA 3HYHA 2VWVA 1ZZLA 4R7BA 1Y6BA 2JIIA 4G9RA 5L8JA 3RPSA 4A06A 4EZ7A 4XNEA 3CJFA 2UW3A 2WIPA 3CQEA 4JT3A 4NW6A 3CCNA 4ACCA 4YLKA 3EN5A 3MESA 3R01A 3QZGA 5TOZA 4IM0A 4QMZA 4IC8A 2X9EA 4IX5A 4O7LA 1OL5A 2V5QA 4RVMA 3GFWA 1IAJA 5FXSA 2YITA 4P5ZA 2VWZA 1XH8A 3PP1A 3ZO2A 3F7WA 2YABA 4DINA 5GJFA 1J7LA 5ANEA 1R39A 1JBPE 2ZMDA 2PZ5A 1OECA 4RIXA 5M57A 4F08A 4TWOA 3E3PA 4BY9E 4HCTA 5ETIA 5EM5A 3RAWA 2CNQA 2HXQA 3N9XA 3QKMA 5EI8A 4YC3A 5EG3A 4OTIA 4EC9A 3ZO4A 5IQBA 2RFEA 3B2TA 3DK3A 3FEGA 4TYEA 3ZSHA 2R2PA 1OPKA 2CHLA 2WEVA 3OXZA 4ZTHA 3MB7A 4C34A 5CX9A 4D4VA 3BU5A 4ZXTA 2B0QA 1IG1A 3NVKI 2VWXA 2QCSA 3KREA 5J9ZA 5C1QB 3PJ1A 2ITVA 3EYHA 1OL1A 3COHA 5EDQA 2XUUA 2I0YA 4FNWA 3T9IA 4FL2A 5CTPA 5KKRC 5DG5A 3F3VA 3W16A 4QRCA 3F82A 3QZHA 3PP0A 4XLIA 3IW8A 2OIDA 5CS6A 3FMHA 4D55A 5KKRB 4O7NA 4HVDA 4MAOA 2W06A 3U54A 3I81A 4LL0A 2CGVA 3C0HA 3WBLA 4IZAA 4USFA 2C0IA 4IMYA 3BYUA 4TNDA 3ATSA 2B52A 3E7VA 3GBZA 3ITZA 3MFRA 4NKAA 4K2RA 4U45A 4XG2A 3JVRA 5D9HA 2QOKA 1ND4A 3MY1A 1MP8A 4RG0A 3VF8A 4RC4A 4O6LA 4ALUA 3UMXA 2IN6A 3L8XA 2YFXA 4FKLA 4O91A 2UZNA 5JRSA 5GJGA 1REKA 1MRYA 3NS9A 2GTMA 5BYLA 4F0FA 3NMUF 3HNGA 4FKPA 4QMVA 3OBGA 3VS1A 1STCE 4C2WA 4C4EA 4XOYA 2J90A 2JIVA 2CGUA 4G6NA 4IACA 4RJ5A 3S1HA 4XG9A 4JQ7A 3LXNA 4IVDA 4KD1A
chains in the Genus database with same CATH superfamily
4W4VA 1YHSA 2WMBA 3ZXTA 3UO5A 5CSHA 3Q9ZA 1ZLTA 4AT3A 4HW7A 4UV0A 4G34A 4M97A 3IK3A 2VWWA 5EOBA 3UIBA 3VHEA 3A99A 2ZB0A 3POOA 4UB7A 2WGJA 2ZJWA 2XIRA 3R63A 5BVEA 4FSMA 4F63A 5CSPA 4BHZA 4AT5A 2PVRA 2YCQA 4IAKA 2G01A 3NRMA 4DTBA 1RW8A 4FICA 5FTQA 3ZLWA 3SA0A 1M52A 3PVUA 5FTOA 1NT2A 2W5AA 3FLSA 3H9OA 1YKRA 2PULA 3VUGA 4B0GA 5C01A 4AGDA 3TUDA 3GGFA 5JGBA 1MRVA 4YJPA 5JQ5A 5KO1A 2HWOA 2QKWB 4FKRA 1QPDA 4G3EA 4FKWA 1KE5A 2KULA 4MWHA 5CYIA 3E88A 4DTAA 1YHWA 2Y9QA 4O6EA 4R7HA 3ML1A 2B9FA 3OD6X 3UDBA 4DCAA 3W0RA 2ESMA 3D15A 4GG7A 4N4SA 2LGCA 4LOPA 4L7SA 2VNWA 4B99A 4ZLZA 4PX6A 2XNPA 5BUEA 3MJ1A 1GOLA 3DPKA 3FL4A 3I4BA 4JRNA 4DT9A 2BKZA 1H1WA 4JL9A 5FM3A 2YM8A 4BYIA 4AAYA 3OT3A 3BYSA 3QHWA 2ZMCA 3VUMA 3BHVA 4A9TA 3OHTA 1ST4A 5JZNA 4NM3A 4DEBA 1FGKA 1G8KA 5FP6A 4EH7A 4FNYA 4FT5A 5CSWA 5I9WA 2QKRA 4YC6A 4CZTA 2EUFB 4ZLYA 4PDOA 4AACA 3EQCA 3F2RA 3KGAA 3P7BA 3G6GA 4G16A 3ROYA 3S95A 5BYYA 5AAGA 1AQ1A 5EDRA 3QTQA 3H4JA 5M44A 4K0YA 4O86A 3KK9A 5FD2A 4CVAA 3L9PA 3UBDA 4LYNA 3KXHA 2ZAZA 3C5UA 4FTUA 4LUEA 3H3CA 5EQPA 5CU3A 4AXEA 2C0TA 4UN0C 4WA9A 4MHAA 5FDPA 1YXUA 4FL3A 3KRXA 3E62A 4NTSA 3T3UA 3GU6A 1WZYA 3G9NA 1A06A 5C9CA 3MYGA 2QQ7A 3AMAA 4GJ2A 3WF6A 4ENXA 3KU2A 3Q52A 4TN6A 3GXLA 2C5VA 2HY81 3ULIA 1ZOEA 4F65A 1R1WA 3HV7A 2BHHA 2OK1A 3C4ZA 3P86A 4C59A 3LMIA 4OW8A 4Z55A 3DAKA 2PVHA 3AKJA 5CAPA 4E5BA 5A4QA 4AS0A 4F6SA 1RDQE 4IQ6A 3VN9A 2RG6A 2H34A 3FYJX 3F9NA 1Q4LA 3DK7A 5FEEA 4BDHA 4IH8A 5EM6A 2XZSA 5HNGA 3GVUA 1GIIA 2WB8A 4R5SA 4X3FA 3VVHA 5IH4A 4QMXA 3ZRKA 4DEEA 3OF0A 3V3VA 3DAJA 2BMCA 1W0XC 1WVYA 4E4XA 1JSVA 1R0PA 2X39A 4USDA 4J96A 3P5JC 3KKVA 4L3PA 4ZTLA 2GNLA 4H3BA 3KF4A 4RA5A 3DTWA 4FIGA 1M2RA 1XH7A 4RWLA 4A4XA 3WF8A 3LE6A 4ZSGA 1JKSA 2R3MA 2ZV2A 2VTHA 1QPCA 3R6XA 5L2SA 2OLCA 2R3LA 3QQLA 4S30A 4OBQA 3FLNC 4AZFA 3TIYA 3HP2A 2YM4A 3M1SA 4C35A 3HECA 2PZPA 5JKGA 2C5XA 3R04A 2W1DA 3POZA 2OF4A 3U55A 4CCBA 4F9YA 4QTBA 2IW6A 3GCQA 5L2IA 2RG5A 4BDKA 2BDJA 4S34A 1ZY5A 1IR3A 5T6KA 2EB2A 4U94A 1OKZA 2IZRA 4FEXA 5AJQA 4DH7A 5CEIA 3ZCLA 5HLPA 4XG6A 3O8PA 4RIWA 5GIOE 2PK9A 2WTCA 4FIJA 1BL7A 2X8DA 4QP4A 2I0VA 3ORZA 4JDKA 3VS2A 3PXZA 4KBAA 2YJRA 2OXXA 5TKDA 3G9LX 3RCDA 4IJ9A 2C3IB 3HV3A 5FUTA 4H1JA 4F7LA 4G5JA 1KWPA 1M2QA 4IIRA 5CF4A 1X8BA 4ZTRA 4YU2A 3L9NA 5DBXA 3R1YA 4R78A 3RHXA 3THBA 2BZKB 2PUIA 4EORA 2W0JA 2FSLX 1XH6A 2BZIB 4BRXA 2ETRA 2QOHA 3EN7A 1ZYSA 2BUJA 4NU1A 4PF4A 2V7AA 4MXXA 4ZOGA 4JQEA 5FTGA 4TL0A 1BI7A 5E1EA 4E93A 3PWYA 2XB7A 2GQGA 2WU6A 4A4OA 4I6FA 4IE9A 3II5A 4JBVA 5K5XA 2QG5A 1FOTA 4ZTNA 3QXPA 5CY3A 1W82A 1MQBA 2ZM4A 5CENA 5BMSA 4FVRA 4ORKA 3RNIA 4WNKA 4F64A 4Y85A 3HL7A 3BRBA 3ROCA 3UC3A 4ACGA 4AGCA 1YXTA 1WBVA 3KXZA 1H8FA 3QRJA 2AEGA 4NJ3A 2WTKC 4O82A 5BPYA 2WEIA 3I6UA 4BZDA 1CTPE 3EIDA 1FMKA 1GIHA 4DDGA 4U41A 2W4OA 2UZOA 4OR5A 4X2KA 4LV8A 4YZDA 3UDSA 1IRKA 3BHUA 3ZO3A 4FV8A 4ACHA 5BYZA 2ITPA 4GUBA 1GZ8A 5AUZA 5KBRA 5ETFA 4GU9A 4G1WA 1KOBA 3TJCA 4I5CA 4OGRA 3BU3A 1PMNA 1UU3A 3Q04A 3WZDA 5F20A 4BDFA 4AA0A 5IUGA 3Q32A 2O64A 3FXWA 1PKDA 4DT8A 5C26A 5M51A 4HGEA 2XK8A 3QRUA 4YSMA 3BQRA 4MCVA 2E9UA 3V5TA 4ZLOA 2VO0A 3PIXA 4O0RA 3UIUA 3FLQA 4U9AA 2UUEA 2YM5A 3GU8A 3FXXA 4MNFA 2Z7LA 3AC5A 3R7VA 4BCMA 4FT7A 2O3PA 2C0OA 4AWIA 5D1JA 2R64A 3BLRA 3KMMA 4J1RA 3RJCA 4PP7A 4QMSA 3PY0A 2CPKE 2GSFA 2IG7A 4M68A 3O71A 2BFXA 4FG8A 1WAKA 1JKKA 2ZDTA 5I0BA 4KIPA 4N6ZA 4WNOA 2FH9A 3NUNA 4ITHA 4O7WA 5KUPA 3W2OA 3K3IA 3N51A 4EQCA 5M53A 1LEWA 4J99A 4WOVA 4XCUA 3UDTA 3EN4A 4GMYA 3KC3A 5J87A 3VJOA 4PL5A 4QNAA 2VN9A 3LZBA 4U79A 4FT0A 2ITTA 4QQJA 2GNHA 4DAWA 4ZS0A 3IDPA 2WO6A 3C4FA 5EW8A 1JWHA 3L9LA 2XNMA 4AN3A 2PMNX 4Y83A 2JLDA 2C4GA 5IA1A 3OCTA 5CF5A 4DG3E 3ZOSA 4RBLA 4FG7A 4I6QA 4FSUA 3P4KA 2VZ6A 4ZZMA 3TNHA 4ZJJA 1TKIA 3MA6A 4CEGA 4O0TA 1XH4A 5BQ0A 2AUHA 1DM2A 2QG7A 2UZWE 3DKCA 3QQKA 4JR7A 3AQVA 2RGPA 1TQMA 5BV3A 3PFYA 1VLRA 4EH5A 4OBOA 1M17A 3KVWA 2BIYA 5K3YA 4CKRA 2Q0NA 3OP5A 4FKVA 5ACKA 4XOZA 3T8OA 3Q5IA 4E73A 4UYNA 4ZY4A 3R02A 3DV3A 2XM9A 5HCXA 3NAXA 3DA6A 5LQFA 5ITAA 4PTEA 1H07A 2BIKB 4DF3A 2NRYA 2IW8A 4PQNA 1PXIA 3VUDA 1JVPP 3CGFA 2OJJA 4HZRA 4I0RA 4QP3A 1CSNA 5CI7A 4FVQA 3UMWA 2OXYA 2QI8A 4CNHA 5CAVA 5L3AA 2XH5A 1SZMA 2IPXA 4DGMA 5CZIA 4HGTA 3QXOA 3TTJA 3W1FA 3FKNA 3FWQA 4M7IA 3FI8A 4PNIA 3EQFA 2YISA 4IW0A 4RVKA 5HIBA 3WOWA 4C2VA 5JK3A 5HBEA 3FMKA 4EK3A 5H3QA 3LM0A 4L01A 3MH2A 3ZO1A 3HX4A 4FTOA 4QEBA 3DGKA 4U6RA 4XHKB 4GUEA 1TFFA 3FI2A 5DR2A 3A61A 4FZAB 3TZ9A 5D7VA 1T46A 4GK2A 4EC8A 4EL9A 3HGKA 4FV9A 3QRTA 5IQGA 4C0TA 3OCGA 3OOGA 2VD5A 2VTTA 3GP0A 1ST0A 4RVLA 4TXCA 4QDEA 2W5BA 2HZ4A 4DGOA 4FX3A 3VQUA 1YDTE 3PJ2A 5M55A 4JR3A 3O96A 3R8VA 4MWIA 3DJ7A 4EQUA 4RX5A 3ZLYA 4U3YA 3NUPA 2GHGA 2OICA 2A27A 2XKCA 1FMOE 2A2AA 4IX6A 5I9ZA 5L8LA 2VTRA 4I41A 1ZY4A 1PJKA 2DQ7X 1PXPA 2WMXA 5HNBA 5LMKC 4QMOA 3MPAA 4FIIA 2IZTA 2YN8A 2Y4PA 5KCVA 5DA3A 4FEWA 3OW4A 3S00A 5CT7A 2OBJA 2VTNA 3DB6A 3EN6A 4GS6A 4S32A 1YXXA 3R0TA 3QALE 4JIAA 4NFNA 3TACA 1BUHA 4OTFA 4XUFA 2CKEA 2UVYA 5HGIA 3SKCA 1OKVA 1VYZA 4YJVA 3ZUTA 3KRWA 3DQWA 4CMTA 1OL2A 4J53A 5ANJA 3U87A 3H0YA 3ANRA 4GJ3A 3UOLA 4F6WA 4BIDA 3AC2A 2JKQA 2JC6A 4EEVA 4C4GA 2QVSE 2QOLA 3WARA 1G5SA 4B6LA 2I0HA 3BL7A 3C4WA 3FY2A 3MJ2A 5BUIA 3ALNA 4FTCA 4MXZA 2PVKA 4HVSA 5AADA 5M06A 1FQ1B 4O0YA 3ZEWA 4PDYA 2XCHA 5HHWA 2ITZA 3RTPA 3U6HA 3WE4A 1YI4A 5CVFA 4CRLA 3COIA 2HZ0A 3IOKA 2PZRA 2C1AA 4O2PA 3W8LA 5J7HA 2UW5A 1V0PA 3NNWA 4RX9A 4TWNA 1G3NA 4KNBA 3WZEA 3DZQA 4W4YA 3W0OA 1P2AA 4L9IA 2BDFA 4H58A 3W2CA 4AF3A 5IQHA 2PZIA 3O7LD 3R7IA 5GINE 2GU8A 4FTLA 5H9BA 4LQMA 3TZ7A 3VUKA 3LMGA 2WQMA 4TT7A 5M56A 4YPDA 4JMQA 4HVGA 3VO3A 4BCKA 2ITOA 3I7CA 4OTGA 4AOTA 3I79A 2PZYA 2FGIA 5CEPA 2B54A 4XG8A 2W99B 3OVVA 1XHAA 2QURA 1YI6A 5AX9A 4R7IA 2X6EA 2I1MA 2VV9A 4RZVA 3PA4A 4FVPA 4AGUA 3A8XA 2YAKA 4BKJA 3UNZA 2QR7A 4BCNA 3UYTA 3QQUA 5KHWA 3LCTA 4LGHA 3AD4A 3WILA 3LHJA 4ZMEA 4B4LA 5IA3A 1UA2A 4ZK5A 4XYFA 3BYVA 1SVGA 4RA4A 4BTMA 4S2ZA 1QPJA 1B39A 3LW0A 4BICA 3ORXA 3E92A 2YDKA 5EQYA 4ZJVA 3R7EA 3LMHA 5E8UA 4DDIA 3HKOA 3FI3A 3W0MA 5HG5A 4RIOA 2RIOA 1YDSE 2G2FA 4IFGA 4OTHA 2QU6A 2BR1A 3FSFA 3LXLA 4I6HA 2O65A 1YWNA 2B7AA 3SW7A 5K4IA 2P4IA 2E9PA 4GFGA 4YJTA 4AZWA 3G2FA 3O51A 3NW6A 2XK3A 4FV1A 2J0IA 2B9HA 4JIKA 3UG1A 1IAHA 2X8IA 2Y6MA 3F69A 3MIAA 4G31A 5HE1A 2ZV9A 2IWIA 3UTOA 3D5WA 3VRYA 4E6QA 2Y8OA 3F66A 2XANA 4FE2A 5CQUA 3ZC5A 4C33A 5DE2A 1KE6A 3OWKA 4BZNA 4FA2A 4IHPA 3LFSA 3TG1A 2F2UA 2PE2A 5EHLA 3W0SA 5FBOA 3ZUUA 2YCSA 1XMLA 5DFPA 2WD1A 4FC0A 4PWNA 5E91A 2YEXA 3E87A 3GU5A 4YTCA 4FTRA 3KCFA 4FEQA 5DOSA 4X7QA 3R8MA 3GB2A 4FNXA 3EFJA 4U43A 2GS6A 4KKGA 1UV5A 5A14A 2J4ZA 2XA4A 4M15A 3GU4A 1OPJA 4QMYA 3MBLA 4IM2A 5IQDA 2OKRA 4AXAA 4AGWA 5IF1A 3VBQA 5CAOA 3QQGA 5CEQA 4O96A 4RWKA 1AGWA 5AM6A 1YWRA 3O5AA 4NT4A 5DIAA 2GS7A 2QO9A 1WBTA 4R77A 5DT4A 4JG6A 4GL9A 2OZOA 1XO2B 4IWOA 5HG9A 3MV5A 3R8UA 3UVRA 4FYNA 2V55A 3FAAA 3Q96A 4G3FA 1PMUA 4J95A 2UW4A 3NFFB 4D1SA 3BHTA 3HMOA 3TCPA 2NPQA 4JAJA 3BEAA 5LMBA 2XKFA 4ZTMA 5HBJA 1PRYA 4BC6A 2VU3A 2QC6A 2JGZA 3VULA 1ZXEA 5CAQA 4MXYA 5AUYA 3UYSA 4DEGA 3DNEA 4EK8A 3TNQB 3AT4A 2PVNA 2V7OA 2YIQA 5AUUA 5HX6A 5DR6A 2XK4A 3LCKA 3QHRA 1AD5A 3LFNA 4ASDA 2GCDA 3IW6A 2F7ZE 3DZOA 4FTMA 1V0BA 2Z7RA 4P7EA 5HICA 1WBSA 5HKMA 2HXLA 3LQ8A 3OXTA 1ZOGA 4AFEA 5KMNA 2VWYA 1WMKA 4ITIA 3NNUA 4FZDB 2WIHA 4HYUA 3VS5A 3KMWA 3PWDA 3K2LA 1JPAA 2YIWA 4L44A 3HAVA 1YW2A 3P1AA 3BPRA 5DEYA 4DITA 5AMNA 1OBDA 3TEIA 4EJNA 2BAKA 4JI9A 4LRMA 5AV2A 3QD2B 2XK6A 2PPQA 4FKGA 5IZFA 2C5OA 3ATTA 5EDPA 4AXFA 4M13A 3F6XA 3CC6A 3EMGA 4QMQA 5LVPA 1FVRA 3V6SA 5DR9A 3L1SA 4ZIMA 1P14A 4D58A 4F7SA 4IDVA 4QYFA 3EWHA 4L00A 4W4WA 2C6EA 1ZMWA 4MD9E 4U3ZA 4EZ5A 5HCZA 2JAVA 4TRLA 4LOQA 3CXWA 5HD4A 3QD3A 3KULA 2C6TA 4EYMA 2O0UA 3HLLA 4UBAA 3UVQA 2UW6A 3JUHA 5F9EA 4QMNA 4LMUA 3QA0A 4EOPA 3VC4A 4C4FA 3UNJA 4D4YA 1I09A 5IEXA 2YZLA 4FZFB 1L8TA 4B8MA 5E7RA 5HVKA 5DH3A 2W4KA 1ZRZA 4X3JA 4GYGA 3QD0A 5L2WA 4AP7A 2YIYA 3VW8A 1NVQA 4L53A 4RIWB 4IANA 1ZMVA 4GT3A 3BI6A 3C0GA 5G1XA 3AT3A 4BGHA 2R3FA 3IPHA 3C7QA 2XBJA 4HVHA 2W96B 4RMZA 3NVMB 5TF9A 3PZEA 1J1BA 1R3CA 2XNGA 2GHMA 4FUYA 4KKHA 2OO8X 4C3FA 1KOAA 4G17A 5D11A 3EL8A 4MBIA 2W1ZA 1LPUA 3DOGA 1U59A 4AU8A 4AOJA 3GQIA 1UU7A 3R7UA 4PMPA 1K2PA 3VJNA 3JY0A 3WIKA 1J1CA 3F5XA 4QMMA 4EHGA 1YI3A 5LOHA 1FVVA 3ZTXA 1SVEA 3MGYA 2JITA 3FY0A 4M12A 5AUTA 1SNXA 2UW7A 4PNKA 2WTVA 3I60A 5ETCA 3KY2A 4FOBA 4IAYA 5CNNA 5IQCA 4OTRA 4YZBA 4M84A 5TR6A 2XNNA 3R71A 2YIRA 3V6RA 4L6QA 2EWAA 2YAAA 3O50A 2R9SA 4RRVA 3TDVA 5F1ZA 2NP8A 2VO6A 3E8DA 1BYGA 3VBVA 4F78A 2IO6A 5J9YA 3ACKA 1JNKA 3W10A 5KZ0A 4KWPA 2Q0BA 4O81A 4EWQA 3IGGA 3LJ1A 1XR1A 2YWPA 5HBHA 2WOUA 4UEUA 4RFMA 2WMRA 5E4HA 3KQ7A 3NWWA 4GK4A 4KKEA 3R8LA 5M4FA 1T45A 5CSXA 3UP2A 1KE8A 1K3AA 3FYKX 3UQCA 3FKLA 3FMNA 3IONA 3VF9A 3V8TA 3QUEA 4BCGA 3HUCA 3MFSA 3VBTA 3UOHA 3GQLA 5EYMA 3PPKA 3SC1A 3DBCA 2PVYA 5H8GA 4YO4A 4TWCA 4EK4A 4NFMA 5IA5A 3G90X 4BCOA 2J9MA 3WZJA 2R3IA 3FBVA 4NM7A 4BCIA 3HUBA 4KRCA 4Z16A 3CPCA 5HTCA 4FT3A 4OTWA 4HNIA 3R7YA 4YC8A 1UNLA 4O7OA 3NGAA 1H08A 3BQCA 3P23A 4BN1A 2IVTA 4RC3A 2Z8CA 5EHOA 4DFUA 2VWUA 4BBEA 3I6WA 3RCJA 3PXRA 1XJDA 3LKMA 2QOCA 5HESA 4FOCA 4KA3A 4EUUA 2EU9A 2OIBA 1Q5KA 2PL0A 4L45A 3LVPA 3AT2A 3ZFXA 3PSDA 3PE1A 4MH7A 3MFUA 2HZIA 3V01A 5CVHA 3UQGA 2R3HA 4WRGA 4E6AA 3BHYA 3SDJA 2YHVA 2OH4A 4LI5A 1O9UA 4TPTA 2HW7A 2UZVA 2JFMA 4TZRA 5KZIA 3TZ8A 2W1GA 3HDMA 1M7NA 2KTYA 4APPA 4FK6A 3TT0A 2GTNA 5KNJA 3D2IA 3KXMA 4AXDA 2BRHA 2UZBA 1ZMUA 3HMMA 3SRVB 4UZHA 4LRJA 4OLIA 3PIYA 1V1KA 1PKGA 3E5AA 2FO0A 3O7LB 4YJOA 3ORNA 5FLFA 3RK9A 1ZWSA 2FUMA 3E8CA 3E93A 3FJQE 3I7BA 3H10A 4IWQA 2CLXA 4QMTA 4AG8A 3UIXA 5CF6A 5HTBA 3QGWA 4F9BA 3CPBA 2Z7SA 4GKIA 4D28A 4U98A 4XV3A 3HRFA 1J3HA 3DDQA 1F5QA 4GIIA 4H3PA 3NYNA 4OUCA 4YLJA 1PW2A 2Q83A 3GT8A 2RL5A 3NUSA 3LPBA 3FDNA 2PHKA 3P5KA 4AE9A 5J5SA 3DT1A 1K9AA 5C8MA 1FPUA 4WHZA 3CTJA 5IPJA 1M14A 3PXQA 4QP7A 4DGNA 4OTQA 3PY3A 4PP9A 3L8PA 4DEAA 2E9VA 4UYAA 4I20A 5D12A 3OCSA 5M4IA 2ITQA 3KRRA 4YP8A 4BCJA 2BILB 4JDHA 2UZDA 2VTIA 2J0MB 3E8EA 3D14A 4D0XA 1KSWA 3NYXA 4L43A 3CBLA 4MVFA 3ENMA 4EH6A 4FV4A 1OUKA 4AUAA 4ZMFA 3EHAA 4KABA 4LV5A 4XG4A 4ACDA 4CRSA 4BI0A 3PRFA 2OFUA 4IZ7A 3A7HA 2C69A 3C50A 3KRLA 5CI6A 3VRZA 1WBNA 3R9HA 2JDTA 2C6DA 4AQCA 3R00A 5B7VA 2JEDA 2OJIA 4F70A 5GIPE 4Q5EA 4BCHA 5FP5A 3FKOA 3MVHA 2X2MA 1H0WA 2JFLA 4AZTA 3VS0A 5L2TA 3CD8A 4F4PA 1WCCA 4BDGA 2PWLA 2ERKA 5HU9A 4I0TA 3UZRA 4KUJA 4B8LA 3CE3A 3MFTA 3PSBA 4WUAA 4Q9ZA 2YACA 2JDVA 3MWUA 5C8NA 2C6OA 1OIQA 3SVVA 4PDPA 4Y72A 4AZSA 2E9OA 3GCPA 5CT0A 3PUFC 4BDCA 5A4TA 5KMMA 4Z7HA 1H1RA 1Q3DA 1KE7A 5FBNC 1WVWA 3FMJA 2W05A 3O8UA 4I94A 3CY2A 4X2JA 3LFDA 4FTAA 3V04A 2QNJA 3HVCA 1I44A 4YZ9A 1PMEA 2VAGA 4ANMA 1HCKA 5I4NA 3ACJA 3ZDIA 5A4EA 4QYYA 1YDRE 5AWMA 2ITNA 3BIZA 4RJ8A 3NIEA 4DCEA 3QGYA 3OMVA 3RPVA 2I6LA 3AOXA 3PYYA 3WYYA 3BYMA 1ZYJA 2XEYA 5T3QA 2JDSA 3QD4A 3KF7A 3N4UA 3P08A 3G6HA 3ORIA 4FSRA 3R9DA 3GC7A 4BBFA 1MRUA 3Q2JA 2CGWA 2BFYA 4RIXB 4A4LA 3P78A 4I4EA 3KFAA 4LGGA 4HGLA 3GC8A 5T68A 3SOCA 1P4FA 2QO7A 4NJDA 4NTTA 4X0MA 3ZZEA 2W1HA 3F2NA 1UU9A 4A7CA 1YOJA 5TO8A 2WTIA 3F5UA 1Q8UA 4KRDA 4QYHA 2CLQA 1KE9A 3GI3A 4AT4A 4QP2A 2CMWA 1UKIA 2CN8A 5J8IA 5KHXA 4MXCA 5L6WL 1A9UA 3UJGA 3ZBXA 3RMFA 4EOKA 3KXNA 3PXFA 4IAFA 4EOSA 5I9YA 1BLXA 3VBXA 3FC2A 4M3QA 4KS8A 4UWBA 2X9FA 3U4UA 4C36A 5HI2A 4ITJA 2PSQA 3PA3A 3R28A 4BGGA 4N57A 3T9TA 4EZ3A 5BVNA 5EKNA 1S9JA 1LEZA 4MYGA 1L3RE 1NVRA 2XCKA 4GYIA 2ZM3A 4WT6A 4TY1A 4EOMA 4XH6A 5DLSA 2QOOA 2UZTA 2GMXA 3OUNB 4DFZE 4WG3A 1NVSA 4K9YA 4EHZA 2VUWA 3ERKA 1XH9A 3PTGA 3V5LA 4X6RA 4CD0A 4EH3A 2HK5A 1YXSA 4FIFA 3QTRA 5B2MA 4HPUE 2IZSA 3E8NA 4XRJA 3D5VA 1F3MC 3UP7A 2IVSA 2LAVA 4IAAA 4CV8A 4XEYA 4FBXA 5IDNA 4XS2A 3GUBA 4BR3A 2C1BA 2XRUA 5EYDA 4Q9SA 3F61A 1H28A 1IASA 5CU4A 4XV1A 3AGMA 4W8EA 4YTHA 3VS6A 3MVJA 2GQRA 3W0PA 4JXFA 4ZAUA 1U54A 4B9DA 4IADA 4DE4A 3ZLSA 2WMUA 1YQJA 3GCVA 2XVDA 1FINA 3EFWA 4F7NA 3HP5A 2B1PA 2I7QA 4MF1A 2WTDA 4I5HA 3QBNA 3CQWA 4R3RA 4AXCA 4BF2A 4F9WA 1H00A 3OEFX 4QNYA 1XBBA 4I0SA 5CEKA 4IZ5A 5J9LA 4FTKA 2YM3A 3T3VA 4HOKA 2BCJA 5AA8A 4O0SA 5E8YA 2R3KA 5JZJA 3D7ZA 4G3GA 3SXFA 2G9XA 3QCYA 3DBQA 3O23A 1QPEA 3W0QA 3ZEPA 4RJ7A 4MUQA 4BDIA 2XIKA 4JBOA 5AP7A 3QC4A 4NK9A 4PTCA 4RQKA 3SXSA 3RALA 5E92A 2JBPA 4BGQA 4JX3A 3QUDA 3UDZA 3F5GA 4GK3A 2PVFA 1OZ1A 1JAMA 3KIOC 3OBJA 4J7BA 5E8ZA 3D5XA 3QQFA 4DHIB 5J1VA 2WQBA 4J52A 3DU8A 5E90A 4II5A 3RNYA 3RPRA 3M2WA 4XV9A 3C9WA 4XG3A 2OF2A 2JKKA 3MIYA 5C8KA 5M09A 3A7JA 3K54A 1XBCA 2Y0AA 3ZRLA 2PVMA 4H39A 4C02A 4MXOA 4AW1A 2VTSA 2B53A 2OGVA 4PRJA 3JPVA 4TWPA 4ARKA 5HO8A 3PPZA 4D0WA 2W9FB 3U6JA 3QQHA 2HYYA 3BLQA 4WBOA 5F94A 5AV3A 3NAYA 5KMOA 3ZH8A 3DFCB 4ZSJA 5KMKA 4O21A 5HLWA 1P5EA 3C0IA 1TQPA 2G1TA 3PA5A 5HG7A 4WUNA 3Q60A 2WTKB 5K5NA 4HZSA 5IDPA 3MH0A 5BVKA 3PJ3A 2GHLA 4RQVA 5AV4A 5FRIA 3FXZA 4MNEB 3R83A 4IEBA 4GIHA 3SXRA 4L52A 1Q97A 2QU5A 2ITYA 4IX3A 3MVLA 2UV2A 4PV0A 3UVPA 5JT2A 5IH5A 3MTFA 4KSPA 2B4SB 3V5WA 3R2BA 4UWYA 3C4CA 4K33A 4N6YA 2PU8A 3CTHA 3RM7A 2X7FA 3OTUA 4FSYA 3ZBFA 5EH0A 4I5MA 3UZTA 1GIJA 3VONA 1U4DA 3PG1A 5EFQA 5HG8A 3BYOA 3VS7A 2YERA 3BV3A 3E63A 3FHIA 3HV5A 3KN5A 4RPVA 3LLAA 3P0MA 1H1SA 2XKEA 3NW5A 4FKTA 4DGGA 3SX9A 5IH6A 4DH5A 4HYIA 4WBBB 4XBUA 3IW4A 1MQ4A 2BKKA 3F3ZA 3DQXA 3TNWA 5JSMA 2BTRA 2CN5A 2R0IA 2GNFA 3UGCA 4O7VA 1H4LA 2X6DA 3QC9A 3LQ3A 4U97A 5F4NA 5I9UA 4GKHA 4FIHA 1LUFA 2PVLA 2WNTA 1EH4A 5FQDC 3LFEA 4IDTA 4TKSA 3W2QA 4UXQA 3W2PA 2R3PA 2ETKA 4QMLA 5FGKA 3C4EA 3R9RA 1VZOA 5EI6A 1GY3A 4ZTSA 5G6VA 2QD9A 3AG9A 3Q2MA 4O7PA 4MNEA 5LVMA 1OGYA 2ZOQA 3NX8A 4KAOA 3IECA 3RHKA 3AC8A 2YDIA 3DBFA 4JVGA 4RJ6A 2XNEA 3HRCA 5EI2A 3RK5A 4PMTA 3AD6A 3DB8A 3FLZA 2ITWA 4CFWA 4RX7A 5IEYA 2W5HA 3V51A 3OFMA 5I5ZA 3JYAA 1SVHA 3WZUA 2ONLC 4FT9A 2ITXA 4FKJA 3SG9A 3H9RA 5HIDA 4CFVA 4EH4A 3B2WA 4XP2A 3RP9A 4R6VA 2Z7QA 3I1AA 4IWPA 3KEXA 4IX4A 3MW1A 3EKNA 1G8AA 2BRMA 2GNJA 3DY7A 3QTZA 4YJQA 1XKKA 5LCKA 3HV6A 4O0VA 3A2CA 5F95A 3U8WA 4JQ8A 3BBWA 4N70A 2FVDA 2WU7A 5H8BA 2XK7A 4BVUA 3ZS5A 3KCKA 3TZMA 2P2HA 3MY0A 3Q4TA 5JGAA 3UNKA 3FV8A 3I5NA 2UVZA 3PVWA 4YJNA 4EBWA 1GNGA 1JOWB 3NPCA 4KS7A 4X3FC 3FLYA 4ASXA 4EOIA 3A8WA 2AC5A 4C37A 3OS3A 4WD5A