4GKHA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor 1-na-pp1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
254
structure length
254
Chain Sequence
NLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 80
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gkhA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4gkhA02
2W1GA 3DJ6A 2BZKB 4NJ3A 3GT8A 4FT0A 5HBJA 3TZ8A 4A4OA 1Y6AA 1J7IA 3II5A 3QKLA 5EHOA 4ZJIA 1FVRA 3UIUA 3E64A 3QTUA 3VO3A 2PPQA 2QOHA 3FZOA 3GCVA 3NW5A 3GEQA 1FQ1B 2ZJWA 4DG2E 3HLLA 4WA9A 5JFVA 5IUHA 2BFXA 4AWIA 2JDVA 1LEZA 2UZLA 2E9PA 2EB2A 5KBRA 3H3CA 3PE1A 2VGOA 5L8KA 3MIAA 4K77A 2ERKA 2UW8A 2VNWA 4NCTA 1IA9A 1Q4LA 4RVMA 3S4QA 4WZYA 2PWLA 3OUNB 4GCJA 4H58A 5B2KA 3HVCA 2OJIA 3BYOA 5BVFA 4QP1A 1YRPA 2YWVA 3ODYX 4J97A 4JXFA 4X2GA 4DYMA 1PXLA 4JQ8A 5IA3A 3BV3A 2VO3A 2F7XE 4KWPA 4FKPA 4QP3A 3W1FA 4KIPA 1Q97A 3WARA 5AUWA 4HVDA 4UV0A 3HKOA 2FGIA 2UZVA 3FEGA 4JAJA 4ZK5A 5B7VA 5IA0A 3UYTA 2GQGA 4N57A 4RQVA 3I1AA 4O0VA 3W33A 3ATTA 3VJOA 3R00A 4GIHA 4Q5HA 2C1AA 3U4UA 5JFSA 3OP5A 4P5ZA 4I24A 5J9YA 3VBXA 4FZFB 1XH5A 4B8MA 5D9HA 1U54B 1URWA 1FVTA 1XJDA 4YZ9A 4Q2AA 5CU3A 3SAYA 2VTQA 4USEA 5CVGA 4KBAA 5AV3A 4J98A 1CKIA 4UBAA 3RALA 5KKRB 3TNWA 2C68A 5IISA 4CV9A 3T8OA 2O64A 4YTHA 5E8TA 4EI4A 2GS2A 4MHAA 5AP5A 1KOAA 3EFWA 4FTJA 3PUPA 2HY0A 2OH4A 4PMTA 2AYPA 4Y8DA 1WVWA 4O7VA 1BL6A 3JY0A 4FV8A 4F09A 4IAIA 1Q61A 2AC3A 2PVFA 3KXNA 4AAAA 5AAGA 5EG3A 4ANSA 5BNJA 3KCFA 4C4FA 4GT4A 3ANQA 4NK9A 4O96A 4AT3A 3A7HA 5B0XA 5IMXA 3F3VA 4FT7A 5BUJA 5ETAA 2V62A 5IQHA 3QRJA 1MRYA 5ANDA 3HP5A 3TNPC 3DBFA 4QP2A 4FZ7A 3VF9A 2DYLA 2CGUA 4BTKA 5FDXA 4ZMFA 3V6SA 5C4LA 4FIJA 4GK2A 3S0OA 1W82A 4MQ1A 4O0YA 4BN1A 4XRJA 5JFXA 4ANBA 4E20A 2UZNA 2OFUA 2CSNA 4YLKA 1MUOA 3POOA 4FSTA 4DITA 4CFUA 2VTIA 4ZJVA 1GZKA 3QZGA 2YZLA 3D5WA 4H1MA 1PJKA 1Y8YA 3LXLA 4LUDA 4TWCA 3CCNA 4XP2A 4AP7A 3DDQA 3OS3A 4RLKA 3Q04A 1YHSA 4LV8A 4FKLA 4RC4A 2QO9A 3PLSA 2V7OA 4D1ZA 2W4KA 5M51A 2WXVA 3WF9A 4D9UA 2JKOA 4A9UA 1YWVA 4JBQA 4MD8E 1AGWA 2F2UA 3V5TA 3AT2A 5CYIA 3PJCA 3PVBA 5FM2A 3IECA 2H8HA 2WU7A 3UVQA 4YTCA 3FYJX 3QYWA 3VS6A 3PSBA 3KXXA 3CY2A 4W4WA 2CCIA 4C4IA 4QRCA 2XK4A 5BYZA 5CSWA 4ZAUA 4OBQA 2IO6A 3BHUA 4RX7A 2I0VA 3R9HA 1PXMA 3LVPA 3Q9YA 3DFAA 3FLZA 4PTCA 4YGAA 4CMOA 3ZBXA 3VRYA 4CZTA 3OTUA 1J7LA 4U80A 4YZNA 3BGZA 4DBNA 3F61A 2QONA 3DBDA 3R7OA 4MBIA 4F99A 1XBAA 3PXQA 5LXMA 3FKOA 4IWPA 2W1ZA 5F20A 5CF4A 3OWJA 5A54A 4GYIA 4MXCA 4FMQA 4IB1A 3LCTA 1V1KA 3IW7A 2YIYA 5CEQA 3ZO2A 2ITVA 4IJPA 4O0XA 2HWPA 2YAKA 4D58A 3U9CA 4Z7HA 4CCBA 4TZRA 4CT2A 2YDKA 3O50A 1CTPE 1LP4A 3EQCA 3O7LD 5EW8A 1UU3A 2XS0A 4I0TA 4HYUA 4TL0A 5FDPA 3VBQA 1OI9A 3G9LX 3D9VA 2PE1A 4F0IA 4Y46A 3R8VA 3I5ZA 3P5KA 2A4LA 4S2ZA 5CU4A 5FTQA 3EH9A 4DH5A 1OIRA 3M2WA 5CXZA 1B39A 4EZ5A 4QP9A 3W18A 4QMNA 3DAEA 1IA8A 4YJUA 4TYGA 4EQCA 4L46A 4TXCA 2JD5A 3V3VA 2ZOQA 4TYEA 2XEZA 3F82A 4ORKA 2OH0E 1QL6A 5HBHA 3TZ7A 1JKTA 3OOMA 2J0IA 4Y95A 5TR6A 2XF0A 4EYJA 2YFXA 2PUUA 2SRCA 3ORXA 4PDOA 5I0BA 5EYCA 4EONA 5HG9A 4R77A 4F08A 1ZY5A 2Q0NA 3ET7A 4ZSLA 3ELJA 4DA5A 4YSJA 3CSVA 1PW2A 2CCHA 4NM0A 4PUZA 5HLPA 5LVNA 2R0UA 4FG7A 4IEBA 4G3DA 2QR8A 5C8MA 4CRLA 3FXZA 2IZRA 2UW9A 2QOBA 2VWUA 4EOJA 3LZBA 5HICA 5CAPA 1TQIA 4E93A 5AUZA 5DEYA 4IVCA 3HV7A 4E4NA 4MWHA 3LOKA 4ZTRA 3E8CA 4N4SA 4O2PA 2EB3A 4CSVA 3OROA 5ICPA 2YM8A 1XH8A 4J53A 3VUMA 3QQLA 5KHWA 3F3UA 4BBMA 3QXOA 3CKWA 2VTJA 5D11A 2YM6A 3TV7A 5HNGA 5J5SA 5AUYA 4IAFA 1QPJA 4IZAA 3GOPA 5EOLA 4BIEA 2OFVA 3EFJA 4UWYA 2R3RA 4GUBA 5ANKA 3T9IA 4BVUA 2UW6A 3R7YA 5A4EA 4LOOA 2Y6MA 4BZDA 3HAVA 3D2IA 4IAZA 4C3PA 4ZJJA 2BAKA 3IQ7A 3SRVA 4FKTA 1S9JA 1GIJA 4ENYA 4AGCA 4FI1A 1YDTE 3CKXA 4FKOA 1GNGA 2CPKE 2IG7A 3TIYA 2YZAA 3HRFA 4PDPA 3FSFA 5JK3A 2J4ZA 2XM9A 2RF9A 4RWJA 4MKCA 3A4PA 4ARKA 4E6DA 1YQJA 5E8YA 2C5OA 1OL6A 4PMPA 2XYNA 4M13A 4PMSA 5FEDA 3U4WA 4ZIMA 2VO0A 5HE2A 3I0OA 5I9XA 3PA4A 4MXZA 4O0SA 4L43A 3MYGA 3QTRA 4O0TA 3NNVA 4MXYA 2ZDTA 2HZNA 3UP7A 4FUYA 1HCLA 5DNRA 5DN3A 3V51A 3LFEA 4TYJA 4F0FA 4LFIA 4FKGA 4I5CA 3FDNA 3F88A 3NPCA 4OUCA 4BZNA 3ZLWA 3KXZA 4I0RA 3TG1A 1BYGA 2GNIA 2ZYBA 2XKEA 4H3BA 5HLWA 3F2AA 4G6LA 1GZ8A 1BX6A 4MXXA 5DWRA 3S1HA 2J0KA 3COKA 5GHVA 3FXXA 3NNUA 2OWBA 1H8FA 3SHEA 3L8VA 1FBNA 1YXVA 3WF7A 4YNEA 4ZTSA 3MH2A 2C6EA 4NM5A 2YEXA 1ZWSA 4NFMA 4UY9A 3PWYA 3FHIA 3P9JA 3CE3A 3W0MA 1JKKA 3WZUA 2VD5A 3ZC6A 2GQRA 3FZRA 2C3IB 3GGFA 2P55A 2QOQA 4I94A 3OW4A 4MNEA 4RVKA 3FUPA 4BGHA 4U98A 4U5JA 3V8WA 1ZMVA 2R3IA 2VWYA 2XK3A 5CVHA 4AN9A 3FY2A 4FV0A 4QQJA 5KMNA 3F3ZA 3UOKA 2W1HA 4IIRA 1U4DA 3TUDA 2WB8A 3JUHA 4IVDA 1UU9A 2C5XA 1JKSA 4ZEGA 3OT3A 3S95A 5HGIA 4EK3A 2X8DA 4D4SA 2J6MA 4WG5A 3F7WA 1E1VA 1TQPA 2CJMA 4PTEA 2JFLA 1UA2A 3U9NA 4AX8A 3BV2A 3DGKA 4EHGA 2OU7A 1Z57A 3GU5A 3CD3A 4Q9ZA 3O51A 2YCSA 2IVTA 3SXSA 3DBEA 4GJ3A 4IDVA 4J95A 4K18A 4QMXA 4ZLYA 1UU8A 3JR1A 3QC9A 4OTFA 4FSUA 4L9IA 4XYFA 5IEYA 4C4GA 1Z5MA 3IGOA 2I0YA 3S3IA 3MY1A 2GHLA 4FODA 4M15A 3ZUTA 3LMHA 2GPHA 2R9SA 4DH1A 4BDKA 3DKGA 5CAQA 4AN2A 2IN6A 3ZLXA 2BKKA 4WUAA 3QGYA 4BR3A 4DT9A 3SVVA 3KRJA 4FTLA 3PZHA 4V0GB 4DLJA 3IPHA 3FYKX 2R3PA 5AADA 2YA9A 3UNKA 1Q3WA 2ZM4A 5IQDA 5LMKC 5ANIA 4WHZA 4RC3A 4DFYA 1BI8A 3VUIA 1H1QA 4DFUA 3LJ2A 2PULA 5M4FA 1VJYA 2PVRA 4M14A 4YZCA 2WTCA 2OK1A 2PMOX 3QLGA 5AP7A 4XEYA 4Y83A 5LCKA 2QHMA 3IW8A 4ONAA 1ZARA 3BE2A 2PVHA 5CF8A 3CGFA 5IH5A 4IANA 2VTNA 3LFSA 3QBNA 4KA3A 2FVDA 2GTMA 3V8SA 3VHEA 4YMJA 2W1IA 4CTBA 3R71A 3RI1A 3HL7A 3O96A 4NTTA 3VF8A 5AUVA 4DE4A 2YIRA 3CJGA 3F9NA 4H3PA 5F1ZA 2QLQA 2JAMA 3EKNA 2VTRA 3LHJA 5HHWA 4E4LA 4TN6A 1Y57A 3WIKA 3ZO4A 4D5KA 5L8JA 4RIXA 4C36A 3G6HA 3FXWA 1OIUA 3VQHA 4DEEA 4ITHA 2X4FA 3VS2A 2OJ9A 2WMVA 3UIBA 2BDFA 1XKKA 4BDBA 3IS5A 3OEFX 3PWDA 3TXOA 5HIBA 4BHZA 3UVPA 2QU5A 2VTOA 3OCBA 5HE1A 4BRXA 2PMLX 3HEGA 4IWOA 1OB3A 3MH1A 3OG7A 2ZV7A 3NYXA 4QQTA 5IA1A 4FTQA 3GC9A 4MX9A 3H4JA 4HVIA 5KKRC 2DWBA 2Y6OA 4F7SA 2WMTA 4F9BA 5C8NA 4LRKA 4IDTA 3C4XA 4J71A 4I4FA 3W2SA 3QRUA 3VWAA 5A14A 2BAJA 3B2TA 1SNUA 1U59A 3ZDUA 3E63A 2UZEA 4ZTQA 4BDDA 2ITXA 3Q4TA 3KRLA 4IQ6A 5CQUA 2VX3A 3NZ0A 5ACBC 4QQ5A 2WQEA 3P4KA 4FYOA 2P2HA 4G9CA 3BHTA 4K0YA 4RX8A 4TNDA 3T3VA 4EOPA 3AXWA 2X4ZA 4QMTA 4U0IA 2QOOA 3I6UA 1FOTA 3LXPA 3RHXA 4DEDA 5M55A 2UZUE 3UGCA 5LWMA 2C6TA 3MA3A 3GU6A 4G17A 4DHFA 3G15A 4L68A 1H0VA 2WPAA 3GCQA 3LCKA 4H1JA 4FSZA 4R3CA 1H26A 3HDNA 3Q4CA 2P2IA 5LMKA 2FSMX 3EL8A 1YKRA 1OZ1A 5I9YA 3OXTA 1U5RA 2IPXA 4L01A 1SNXA 3MB7A 4IZ7A 1YOLA 2J5FA 2Z7RA 4FGBA 5F94A 3GVUA 2O2UA 4QP6A 5AV1A 3D83A 5ETIA 4EL9A 5FQDC 4EK5A 3H9OA 2ETMA 3COHA 1DI8A 1URCA 4I4EA 3Q5ZA 4YJQA 5IG1A 4QPSA 3ZLSA 3ZSHA 3DZQA 4X6RA 4E4MA 2XZSA 4M7IA 4F9WA 3OMVA 4BCQA 2BVAA 5E1SA 3EQDA 1QPEA 3ZFYA 4DEBA 2KULA 3PZEA 1Q8YA 3AG9A 2FO0A 2UZWE 3AGLA 2XNBA 3G0EA 4M97A 3MS9A 3E7VA 3UPXA 2NRUA 2QURA 2R3MA 4ACDA 4L7FA 4MD7E 3L8PA 1PXIA 1CKJA 3AD4A 1YVJA 1YXTA 3MPTA 4L3JA 4QTCA 4IZ5A 1M7NA 4UB7A 5CEKA 3HV4A 2JIVA 2VTAA 3RHKA 2CKEA 3BU3A 3UQFA 2BHHA 4F0GA 4O7TA 4NFNA 4KKEA 4EHVA 4KRDA 2ITNA 4FZDB 1R1WA 3IG7A 4YHJA 5J9ZA 2HZ0A 3GU7A 4EOSA 3H10A 3M11A 4LI5A 4CCUA 3ATSA 3EN6A 2XCHA 3LAUA 5CS6A 4O0RA 1WZYA 3BEGA 3H9FA 2XIKA 1Q3DA 4GKHA 2C4GA 1JSTA 3BYMA 3NUPA 2R3NA 4JS8A 5DR2A 3VULA 1XWSA 3BYUA 2RFSA 3PYYA 3V04A 4XP0A 4HGSA 2QCSA 2WQOA 4I6QA 3RK5A 2B53A 4IWDA 3PXRA 5EH0A 5EDRA 3FE3A 2HXLA 1V0BA 2YJRA 1WBPA 2CKPA 3I79A 4FV9A 4NWMA 4QYHA 1Y91A 3UO6A 3KRRA 4O38A 4MXAA 3QTWA 3BLQA 4JDIA 5AV2A 4KNBA 1LUFA 4BI2A 5CF5A 5H8EA 3QTZA 2R3GA 3WE8A 2YM7A 3PXKA 3TJCA 1H00A 4WD5A 3TZ9A 2FUMA 2ONLC 3I7BA 3PXFA 3QD3A 4J8NA 2PZIA 2VTLA 3LM5A 3W2CA 4CG8A 4ASXA 3W0NA 4UYAA 4ACMA 5JRQA 3DKCA 2A27A 1BKXA 3DXQA 1WCCA 4X2FA 4LRMA 3EMGA 5I4NA 2B54A 1OGUA 3TTJA 2GS6A 2OO8X 5EDQA 2IW8A 3QZIA 2QOFA 3Q4ZA 4JAIA 3UOLA 4C02A 3KA0A 4GRBA 3COMA 1UVRA 4EOOA 3UYSA 5KCVA 4CQEA 4WRGA 3ZRMA 3C0HA 4NT4A 4XG9A 4DG3E 3DCVA 4ZY6A 4MEDA 3QTIA 3DAJA 3F2RA 3QTXA 4TRLA 5BVDA 5IQCA 4C2WA 4P90A 3U6JA 4GK3A 4L8MA 3UZRA 3LQ5A 3GB2A 3GOKA 3LQ3A 4N0SA 4ERKA 5L8LA 2OXDA 3P08A 4FC0A 3R1SA 3E62A 4RJ8A 3LFDA 5CEPA 3NCGA 5LJJA 5E8ZA 3RAHA 4LGGA 4RLLA 1CM8A 2PUNA 4MNFA 4BDFA 4RJ7A 1YDSE 3MY5A 3QHRA 4PL4A 2PVNA 2CLQA 2QG5A 4O81A 5DE2A 4F6UA 5FTGA 4IX3A 4HNFA 3FLWA 4JBPA 4LYNA 4MK0A 4HYIA 4IACA 2R3KA 2X0GA 2IW6A 2XH5A 5CU2A 4XV9A 3TNIA 2IZSA 3PIYA 5CF6A 2IVUA 2C6MA 2XMYA 3GFEA 3TI1A 2R7BA 3D94A 4E4XA 2FSTX 3LMIA 3GCSA 3PPKA 4YZBA 3MVMA 1BLXA 4O83A 2J0JA 2CHLA 5EFQA 4MF1A 4EK8A 3QGWA 4XG2A 3MFUA 4L67A 4A9TA 5JN2A 3NEWA 3QLFA 3WBLA 5CNOA 3LXNA 3G33A 3U51A 3ZBFA 2Z8CA 4BCMA 4RVTA 5E9EA 4RVLA 3I60A 3WIGA 1BI7A 3UE4A 3HECA 4DAWA 3P7AA 3UG2A 4CXAA 1R3CA 4DFNA 3E3PA 4E26A 3FLYA 4JLCA 4K11A 4CTCA 3QRIA 5EI6A 3SA0A 2ONLA 4WO5A 3KK9A 4H36A 5DG5A 5AV0A 4AG8A 2VWXA 4D55A 5A4CA 1FGKA 4B4LA 1H1PA 3D15A 4AS0A 3QD0A 3ZSIA 4DEHA 3L9LA 4QYYA 4GK4A 4IM0A 3IONA 3AD6A 4ZTNA 5H9BA 3VS5A 4HPUE 3D4QA 2XKCA 4P4CA 4OTGA 4UWCA 2XA4A 3DTWA 4NYEA 4HVSA 4BCOA 2GSFA 5CANA 4AZWA 5DT3A 3TT0A 2W96B 3FMMA 3LCSA 4A4XA 2ZMCA 2C0TA 3W16A 1PXOA 5IEVA 2F4JA 5A46A 2WIHA 2W17A 4JDHA 4EWHA 2CGVA 4C2VA 4FYNA 4X3FB 3ACKA 2ZV2A 3DDPA 5H3QA 4CV8A 3OBJA 4P2KA 4FTNA 4JDJA 4LUEA 3ULZA 4O7NA 4FL3A 4EHZA 2OJGA 2B9JA 2RFDA 1UU7A 1P4FA 1ATPE 2F7ZE 3HX4A 4NIFB 4F7LA 2BRNA 5A6NA 3ALNA 4XNEA 3U8WA 4CT1A 3TNHA 4QT1A 3R1QA 2HAKA 3A60A 3O17A 3VS0A 3FZTA 4O7SA 4BCGA 3Q53A 5D7AA 3HMNA 4FE2A 2XIXA 4FA2A 1KWPA 1NA7A 4U6RA 3UTOA 1H1RA 2CNUA 4X3JA 3EQHA 5EKOA 1RJBA 5HCXA 2XNPA 4XOYA 3QRTA 3KN6A 3R9DA 3RPOA 2XNMA 4BCKA 4BYIA 3HUBA 3QZHA 4FTMA 3RAKA 3HA8A 4H3QA 2J7TA 4U42A 1KE7A 1M2QA 3DXNA 4KKHA 5EDPA 5HEZA 1L3RE 1OKZA 2RKUA 3JVRA 1WBNA 3VAPA 3U6IA 3ORTA 1G3NA 1ZYSA 3REPA 4OR5A 4BHNA 2XYUA 1UKHA 4Q5EA 1OITA 4G3FA 4RFMA 3ZXTA 5AUXA 4ERWA 3HZTA 4HOKA 4ZTMA 3HGKA 3LJ1A 3MVJA 2QO7A 2R3HA 5F4NA 3PA3A 3WOWA 4AA4A 4HYHA 3MJ1A 3RZBA 2QQ7A 3C1XA 3O23A 3RMFA 4ZSAA 3UIXA 3OCTA 4ACCA 5T3QA 3W8LA 4CFFA 2HIWA 3Q6WA 2R4BA 5CSPA 4EH3A 4QYFA 3IW5A 4QPAA 5HESA 3M42A 3R01A 4QNYA 4F9CA 3SLSA 3RM7A 4CFMA 5LVPA 3OZ6A 5J95A 5F95A 4K33A 5HIDA 3NUNA 4UALA 2JDOA 3PLAE 3THBA 5IDNA 3ZLYA 1P2AA 4FEQA 2XM8A 5EYDA 2UV2A 4JX7A 3NR9A 4HZSA 4RJ5A 3RJCA 2XK7A 4FKUA 4BIDA 3FKNA 2R3JA 4DH8A 1AQ1A 2JFMA 3FJQE 3RWPA 4ZOGA 4D9TA 3QU0A 4PL3A 3RCJA 3NW6A 5AP0A 3DT1A 5TOZA 3PIXA 2WTWA 4IX4A 5D10A 3ENHA 3PP0A 3IO7A 1VZOA 2REIA 1W84A 4FKJA 3QCXA 5FTOA 5CT0A 3NLBA 4FIIA 2QC6A 3FI2A 4OTQA 5DBXA 1YHWA 2JDTA 1B6CB 5HQ0A 5IQAA 1JPAA 5JEBA 3G6GA 3FAAA 3NUXA 4MAOA 4U7ZA 4QMZA 5EI2A 3QHWA 4GS6A 1J1CA 1WBSA 2X2MA 3AD5A 3P1AA 4IFCA 4II5A 4U45A 5DVRA 4I3ZA 3Q32A 1OL5A 4WUNA 3V01A 2R3FA 4ITIA 3PTGA 1R0EA 1ZAOA 2R3OA 2CLXA 4MD9E 4WIHA 2Z7SA 4XG6A 4EQMA 5LVMA 1XBBA 2GS7A 3UBDA 5M57A 2YERA 2B4SB 4AQCA 2E2BA 3LFNA 4KABA 4NSTA 4V01A 3R8LA 2B9FA 3HV5A 4M8TA 2BUJA 4ANLA 4X21A 4EKLA 3DB8A 2G15A 3WF5A 3R73A 4J96A 2R0IA 1YWRA 3I7CA 1APME 4FNYA 4FV6A 4TKSA 2XNNA 5CT7A 3TM0A 3PG1A 5FGKA 3NVMB 3UQCA 4OT6A 3RK9A 4ZLOA 4OLIA 2EU9A 2PE2A 4BDIA 3DK3A 3ZS5A 4DFZE 4G2FA 1CSNA 1TVOA 2ACXA 3DY7A 3R8PA 2BCJA 1LPUA 1VYZA 2UVZA 2QNJA 1QPDA 5E8UA 2C3JA 2OGVA 3FY0A 2UW7A 4TT7A 4KSQA 4YU2A 2CGWA 5M4CA 4O7YA 3A2CA 1H1SA 1RDQE 2W0JA 3C4ZA 4I23A 2WMRA 3OWLA 4DT8A 4R78A 4QO9A 4ASZA 4LL0A 1OKYA 4Y73A 5IZFA 1O6YA 2ESMA 2Y7JA 2X1NA 4RRVA 5CY3A 5JFWA 1FPUA 2BZJA 2WMXA 4DGMA 2GHMA 4XG3A 2V0DA 3GUBA 3RVGA 3NYOA 4U41A 4GYGA 3VS3A 1JLUE 2YACA 4GT3A 5T6KA 3UG1A 4JVGA 3OW3A 4XH6A 3AMBA 2I1MA 5D41A 5BVWA 4YJPA 5HO7A 4YURA 4LV5A 4YJSA 4D2RA 4YO4A 1PHKA 2J50A 2JITA 2XJ2A 3ANRA 4FKVA 4YJOA 1AD5A 5D7VA 3VBWA 3BI6A 3R21A 4V0GA 2XIZA 5LMAA 2FSOX 4IC8A 2DQ7X 3NVKI 4FIHA 2OW3A 4FZ6A 4TTHB 1H08A 2WGJA 1Q8ZA 4FKIA 3LIJA 3ZU7A 2NPQA 2NP8A 4DLIA 3M1SA 1IASA 4XBUA 4LGHA 4TPTA 3TZMA 5FD2A 4FL1A 3D0EA 5HG8A 5A9UA 4IB0A 3K54A 4BCPA 3DKFA 4FVRA 2XKDA 3QUDA 4BI1A 2PUPA 4C3RA 1NVSA 2OZAB 2VWWA 2YITA 4KSPA 5BQ0A 5H8BA 1JSUA 4R1VA 4FTRA 3EKKA 4FK3A 3IW6A 5EQEA 1OPLA 3VJNA 2JEDA 4NH1A 4EJNA 3MJ2A 2QI8A 3HRBA 3A99A 4C4HA 1QMZA 4PP7A 3PVWA 3D5XA 4NU1A 3AC4A 5FUTA 2CGXA 5HVJA 4UZHA 1RW8A 4YBKA 1ZLTA 3UVRA 4GMYA 2PVYA 4QOXA 5AX9A 3V5JA 5AV4A 1NXKA 3DJ5A 4GFMA 3QTQA 2W1EA 4WSYA 4JG6A 3FZ1A 3MDYA 4KIQA 3MI9A 4ACHA 3P79A 4F9YA 4G1WA 3BQRA 2O65A 4FT9A 2WKMA 4LG4A 3RNIA 4A06A 5HIEA 4R7IA 3A7IA 2FSLX 3QKMA 5CLPA 4I0SA 3ZFXA 2RL5A 3RPSA 4U8ZA 3QQGA 4PF4A 5GIOE 2OXXA 3LM0A 4RIWA 3PJ8A 4GG5A 3IW4A 3ENMA 4K2RA 5ACKA 4YTFA 2OICA 1ND4A 3MN3A 4S32A 2PHKA 3OUKA 4NKAA 4DCAA 5CX9A 4I5PA 3WYYA 3VUDA 1PYXA 1IAHA 3DV3A 2X9FA 4JBVA 1B38A 3ORPA 3Q52A 5FXQA 1NVQA 4G3GA 3DK7A 4D0WA 4S31A 4YR8A 4FEUA 5CAUA 3QUEA 4E6AA 2F7EE 2P3GX 4CKRA 2QLUA 3R8ZA 1ZZLA 3LFAA 3NAYA 3UC4A 3O7LB 3BWFA 5E7RA 1W0XC 3QQJA 1BUHA 4AA0A 2R3QA 5IDPA 3FI8A 3HUCA 5KBQA 2C6DA 4ID7A 1GAGA 2C5VA 4XV2A 2BIYA 2XJ0A 3FMEA 4N6ZA 5BVKA 3FLSA 4FK6A 1G8AA 2WEIA 3AC3A 4EH8A 4L3LA 5LMBA 4IAYA 2XJ1A 2DUVA 1DI9A 4R3PA 2O8YA 3QALE 3RINA 3ULIA 3V8TA 5DEWA 1I09A 4IX6A 4O6LA 4UZDA 1Q62A 2QOIA 1RQQA 3SOAA 1VYWA 2WMBA 3CPBA 3KRWA 1UNLA 3ZTXA 1T46A 4JJRA 3PG3A 5IA5A 3E8DA 3DBCA 1OL7A 2W4OA 4WKQA 1SVGA 3CP9A 4XHKB 4OT5A 4EUUA 4HJOA 2XBAA 3VBVA 4A9YA 3VS1A 4QMYA 4W8DA 5AJQA 4DTKA 2QVSE 5DPVA 4MQ2A 4OTIA 4DBXA 2X81A 3OTVA 1DAWA 5KZ0A 3MY0A 4DINA 2VNYA 1M2RA 4NJDA 4TWNA 4YSMA 2HW6A 5AP3A 4EOKA 3GU4A 4AXAA 5C4KA 4RJ6A 5ETFA 2XRUA 5K5XA 3R22A 1NW1A 2HZIA 3PRIA 3NSZA 1PMNA 3Q9ZA 3CTJA 3MFTA 4GIIA 4KKGA 4Y72A 3VW8A 4EK6A 4FT3A 5E8VA 2EUFB 3CQWA 5C26A 5HBEA 3UDBA 2WTKB 3EFKA 4IWQA 4PMMA 4WG4A 3ZEWA 4AW5A 4W4XA 4BDAA 3ID6C 2X39A 1P4OA 3RM6A 3SC1A 3W2OA 2VV9A 2W7XA 3KCKA 3L8XA 2YM4A 4FSRA 3GQIA 1Q8TA 4LOQA 5FBOA 5IUGA 4BGGA 4V05A 5AFVA 2JIIA 5M07A 3N51A 1MP8A 5E92A 4EORA 4NW6A 1MRVA 3UPZA 4RZWA 3CXWA 4O7RA 3W8QA 5CU0A 1JVPP 3U55A 3VW6A 3BX5A 4LL5A 4O7LA 5G1XA 3MBLA 4GVAA 4RG0A 1UKIA 4PNKA 3C4EA 4XG8A 2X6EA 5HU3A 2AC5A 5CEIA 3DKOA 1KOBA 1YW2A 4I6FA 2PL0A 1T45A 1G8SA 2JDSA 4IW0A 3A7GA 4YZDA 3IDCA 5IQGA 2GCDA 2WO6A 4E7WA 2CN5A 4PP9A 5I9WA 3F69A 1ZOEA 3PJ1A 4JG7A 5CQWA 2UZDA 2IZTA 3P23A 4EUTA 4FTOA 5L6WL 2PMIA 3JVSA 3KEXA 3AGMA 4TYIA 4FVPA 5FBNC 4DN5A 1NT2A 2O3PA 3OY3A 4EC8A 3QCQA 5KX8A 3DQXA 5D1JA 5EW3A 3MH0A 1IEPA 1Q24A 2FYSA 5FM3A 4X3FC 3VBYA 4G31A 2BRGA 2R5TA 3DNDA 4BYJA 5KMLA 2BILB 3W0QA 3VRZA 1OIQA 3T9TA 1WMKA 4DTBA 4CMTA 4IE9A 5M06A 1F3MC 4WNPA 2BPMA 3RAIA 2QO2A 4D4RA 4C0TA 4FTIA 1H07A 1VR2A 3QL8A 4RX9A 4O7PA 2V5QA 3ZZEA 2V22A 3A7FA 4MCVA 5JZJA 2FA2A 5L6PA 4GSBA 4GV1A 2GFSA 4D0XA 5C27A 3ROCA 3CY3A 3NCZA 2C6KA 4NTSA 5GNKA 4JX3A 4RC2A 3ZDIA 4AFJA 1DS5A 1ERKA 5J87A 5K3YA 4AA5A 3H0ZA 3R2YA 3NNXA 5L2SA 3FLNC 4FVQA 3BCEA 2X2KA 1GZNA 3NWWA 5HI2A 5K4JA 3U87A 4YP8A 4X0MA 3PJ3A 5GJGA 3C7QA 3NUYA 5BVOA 3KFAA 4RMZA 2XNEA 1L8TA 1PXNA 3I0QA 5EHLA 5K5NA 4E5WA 5KNJA 5JSMA 4D5HA 1I44A 3HRCA 3DFCB 4CLIA 5AP2A 5EM6A 3GCUA 5JZNA 3NAXA 3ZHPC 4R6VA 4YJNA 5H8GA 4BICA 4RIOA 1KE9A 5C9CA 1H4LA 2B52A 2GU8A 3F66A 2XEYA 5AA8A 2H96A 3UQGA 2YM3A 3R04A 2QG7A 2QODA 2YWPA 2X7OA 2KTYA 2VX0A 1W83A 3Q9WA 3A62A 1SYKA 4WT6A 3U6HA 5AM6A 3MFSA 3LKMA 5LCJA 2WOUA 3RTPA 4APPA 4PDSA 3C5UA 5KMOA 4D4YA 2BIKB 1HOWA 3TV6A 5J7HA 2C3KA 5EM8A 3B2WA 4BTMA 4TW9A 4KS8A 4JI9A 4AW0A 4KS7A 4LOPA 3C0GA 3OWKA 3VUGA 4RIYB 1ZMUA 3QX2A 1E1XA 4WBOA 4RIWB 4FSQA 2Q83A 3JYAA 1JBPE 1PMEA 3NX8A 4MYGA 3ZO3A 2VO7A 5IQEA 5CALA 3OXZA 3F5GA 4X3FA 1OKVA 3PRFA 4QP4A 3TIZA 3QFVA 4L6QA 3E93A 5CEOA 4QTAA 3PVUA 3W32A 1JWHA 5CZHA 3C4FA 5E8XA 2W06A 3VS4A 2BZHB 4ALUA 4O86A 3WZDA 4QMQA 3W0RA 1DM2A 1GJOA 4OBOA 3EN9A 4AOJA 5A3XA 1H0WA 3DZOA 4WNMA 2GDOA 2E9UA 5K9IA 3ZZWA 3A8WA 4R3RA 3GU8A 4N70A 4NUSA 5FRIA 1H28A 5C01A 4USFA 3R1NA 1A48A 3KVXA 4X2KA 2ZM1A 4AZFA 2V55A 3RAWA 4EWQA 4F70A 3EHAA 4JIKA 4RZVA 4D1XA 4W8EA 2OLCA 4DFXE 4HVHA 5LVLA 5HVKA 5CWZA 5DGZA 5TKDA 4EOIA 3AC5A 4B0GA 2VGPA 3FI3A 2W5HA 4I6BA 4DFLA 3AT3A 4ITJA 4FEXA 5EM7A 1W98A 4M84A 4XLIA 1X8BA 5AIKA 3BYSA 2B9HA 3CR0A 5HG7A 3PXZA 4DGGA 4BDEA 2WAJA 4TWOA 3LMGA 3SDJA 2NO3A 1GIHA 4EZ3A 4ZMEA 2B9IA 1OECA 2O0UA 2UUEA 4PNIA 4FR4A 5L3AA 2J0LA 2PE0A 3F5XA 3W0OA 3AOXA 4I5MA 3DLZA 4FGRA 2XIYA 2F2CB 5HNIX 1J91A 5DR9A 4ASDA 3UZTA 4DCEA 5E4HA 4FNXA 2W1CA 3BHVA 4AFEA 5EW9A 4BTJA 3S00A 5AWMA 1PMUA 4F7NA 1SVEA 4FTUA 4DGLC 4X7QA 4XRLA 3ZEPA 3UP2A 2XIRA 4AE6A 3PJ2A 3MV5A 5CI6A 3KF4A 5AMNA 4EH6A 1OVEA 3EIDA 1KE6A 3EB0A 2ZV8A 1WBWA 3KL8A 2H6DA 4FKQA 1CMKE 5CAOA 4F63A 3EOCA 3WILA 5E91A 4PTGA 4BZOA 4C33A 5DH3A 3AC1A 5BMMA 3UO4A 5BVNA 1A06A 1CKPA 2CN8A 2HOGA 5HCZA 2VU3A 1HCKA 3PY1A 5JGDA 1J7UA 1GY3A 3ACJA 4IADA 1J1BA 1ZZ2A 4FKRA 3W2QA 5CXHA 4Y85A 1QCFA 1TQMA 3ZRKA 4L45A 4OW8A 2BDJA 4BDGA 5CEMA 3UZPA 1OL2A 1YDRE 3ORNA 4IH8A 4MWIA 2NNWB 3DU8A 3I5NA 5CTPA 4FNZA 1XH6A 4G9RA 4TY1A 3MGYA 2VTHA 2QOCA 3W2RA 3BU6A 4AE9A 4V04A 3OD6X 5KO1A 4Q9SA 4BTFA 4DFBA 3C9WA 3EQGA 1R0PA 2BRMA 2BRHA 2QU6A 3F5PA 3T3UA 5LWNA 3IOPA 1OUKA 4HNIA 4O84A 3UMXA 4D28A 4F6WA 1Q99A 4IX5A 5KZIA 4CKJA 4FUXA 1FVVA 4FEWA 2YDIA 2YCRA 4AGDA 3EWHA 2VUWA 4YLLA 2BTSA 2XNGA 4JG8A 3RCDA 1Y8GA 2WOTA 3VUHA 4EJ7A 2UVXA 4XCUA 1SVHA 5KMMA 3NS9A 3R7EA 4BF2A 2GNJA 3MTFA 4FIFA 4AW2A 3QQHA 3MSSA 4Z16A 3SXRA 2JLDA 4BDJA 3E87A 3SX9A 4RWKA 3QC4A 1M17A 3NGAA 1Q8WA 3ZO1A 3MH3A 2ZV9A 3DBQA 3GENA 3BPRA 2GMXA 3R63A 4FT5A 4A9RA 5EQYA 1UNHA 4RFYA 3VBTA 1ZOHA 3TL8A 3LE6A 4QMPA 3NIZA 3R9OA 3PVGA 5AM7A 4C3FA 1YI4A 4J52A 5D12A 2HWOA 4HCUA 4L3PA 1SZMA 3E88A 1M14A 4FTAA 5DRBA 2C47A 3KC3A 3OFMA 3PA5A 3CGOA 3GBZA 4AZVA 3P78A 4IB5A 3TACA 4LM5A 3L9PA 4BCIA 3KULB 4QMWA 4WG3A 3KF7A 3WYXA 4HVGA 2BALA 1PKDA 4I5HA 2WMQA 2FB8A 4I1ZA 4MBJA 4AW1A 4ENXA 4O0UA 4FOCA 2X8EA 1GOLA 4C35A 3CBLA 3W0SA 4OTDA 1ZY4A 4G3EA 2Z60A 4EQUA 2OKRA 2W5BA 3CPCA 4D2SA 2RGPA 1OPJA 4DGOA 4I20A 3QCSA 2CNVA 5FP6A 4JIAA 5B2MA 2P33A 2X8IA 1DAYA 3BHHA 1H27A 4MTAA 3CJFA 4F65A 4X2JA 1RE8A 3FQEA 3W55A 3NMUF 4L44A 3AQVA 1W7HA 3G2FA 4M3QA 4O82A 5DOSA 2OZAA 4UXLA 2JGZA 5DI1A 1YI6A 5HCYA 4JOAA 3V5QA 4CGAA 4AU8A 5DLSA 3SV0A 2QHNA 3D7TB 2CMWA 5K4IA 1K3AA 3KMWA 4YC6A 4G34A 4AOTA 2QOLA 4C38A 3GXLA 2IZUA 3GI3A 3LLAA 3C50A 2LGCA 1XHAA 2ITUA 2WQNA 3LFFA 3LXKA 3QKKA 5DFPA 4ANQA 1JKLA 4M68A 4C58A 4E5BA 4BB4A 2UZOA 2YN8A 5GIPE 2ETRA 3H0YA 3UODA 3L9NA 4H05A 3AC2A 1K9AA 4XG7A 4AZEA 2WTKC 3DK6A 4A07A 1Q8UA 1TKIA 2WTJA 1YHVA 2ETKA 3K3JA 4IZYA 3G0FA 4XBRA 3EL7A 5L2WA 2WTDA 4E5AX 2IVSA 2R2PA 3QRKA 3QTSA 3LQ8A 4BC6A 2EXCX 4G3CA 2C30A 1LEWA 2VTMA 2HW7A 4JR3A 4PL5A 4UYNA 3V5LA 1CDKA 3E8EA 4GUEA 4IB3A 1ZYDA 4PDYA 2P4IA 5J1WA 2Y9QA 4C37A 4BDCA 1WBVA 4CG9A 1UWJA 3FMJA 2W1DA 3N4VA 3PP1A 3O8PA 2IWIA 4O0WA 4USDA 4DGNA 3WZJA 3TKUA 5LARA 4RX5A 3KVWA 4EC9A 3WZKA 4FV7A 2CKQA 5DHJA 3NNWA 4I6HA 4UXQA 4YO6A 1YXXA 3VQUA 4CFWA 3IDBA 5EHYA 4ALVA 1SMHA 3FHRA 4RBLA 2BRBA 4EH5A 2BDWA 4FV4A 1OUYA 3ITZA 1KUTA 4OTHA 2I0HA 3NUSA 3UC3A 3PSCA 4WNKA 3TDWA 4DTAA 3TKIA 5EOBA 5FXSA 3SKCA 4B99A 2EXMA 4IJ9A 2BAQA 2PZPA 1M2PA 4TNBA 2WQMA 3PIZA 2OF2A 2UW4A 1G5SA 4PY1A 3TN8A 3KK8A 4QMMA 4K8AA 4S30A 3BQCA 3KKVA 4NL0A 1Q41A 3DOGA 2JKQA 5GINE 1M7QA 2HK5A 4GH2A 5IQIA 5C03A 4FKSA 2O63A 2Y0AA 4R7HA 3A61A 4RGJA 2PVLA 2PMNX 3BE9A 3LCOA 4K6ZA 4OGRA 4XS2A 3CQUA 3L8SA 3PPZA 4QMVA 4AGUA 1QPCA 4FICA 4C59A 3UNJA 5AP1A 1J3HA 3I4BA 5HZNA 5IMEA 3FKLA 4HGLA 4GKIA 4I22A 2JDRA 3LFBA 2G2IA 5TO8A 5BUIA 2X2LA 3ORMA 2PY3A 4U94A 4I92A 1YOMA 4MXOA 5A4LA 4R7BA 4U3ZA 4XV1A 1WFCA 3IDPA 2XB7A 3FMDA 3DQWA 4L42A 4C4JA 2XRWA 4BCHA 2QKWB 3AT4A 3DXPA 1XO2B 3EYHA 2WELA 3SG9A 1PY5A 3NDMA 4EZ7A 5F9EA 2UVYA 5I9VA 2BROA 3CTQA 1NY3A 3NIEA 4B6LA 3IKAA 1SM2A 2OF4A 3N9XA 4S33A 4BI0A 2OI4X 5IA2A 3EN5A 3BBWA 3HA6A 4DEGA 4ZS0A 3OT8A 3NYNA 2Y4PA 2BR1A 1OKWA 3P7BA 3PY0A 3GP0A 3ZUUA 4XLVA 2RG5A 2PK9A 3SQQA 2O5KA 4IVAA 5FEEA 2C6OA 4M12A 3HMIA 3TWJA 4FZAB 4YJTA 3VC4A 3H9RA 1KSWA 3RPYA 3D14A 4EOLA 3UMWA 3C0IA 4YPDA 5JMSA 1IAJA 3SW7A 5KMKA 4FSWA 4LMUA 4EYMA 5M4UA 2W1FA 2RG6A 4D4VA 3BHYA 2PZ5A 3D5UA 3IOKA 3NUAA 4ZSEA 2FH9A 3COIA 2G01A 5C8KA 1KV1A 3CS9A 4ZZMA 3TUCA 3VNTA 3O71A 1YXSA 4NKSA 3KREA 2C0OA 3OWPA 5EYKA 4YTIA 1OPKA 4WOVA 1WVXA 5ITAA 2ITYA 2WNTA 5CZIA 3R8MA 1ZXEA 3HP2A 2G2HA 5KUPA 1ZYCA 2H34A 3V5WA 2ERZE 5CI7A 1O6KA 4YLJA 4RFZA 3ZSGA 2BMCA 2G9XA 3ORZA 3FC1X 3A4OX 1ZMWA 2G1TA 5CNNA 2J5EA 3EZVA 3FQSA 5AX3A 3FLQA 3NYVA 1JNKA 1BMKA 1P5EA 3ZUVA 1W8CA 3FC2A 4J1RA 4BDHA 3DPKA 4P5QA 4ASEA 3DTCA 4U40A 3HNGA 2OJFE 4FTKA 1OL1A 4IMYA 4KRCA 4O91A 2C6LA 3VIDA 1OBGA 4QYGA 3Q5IA 3EQPA 2B1PA 4BGQA 3QD2B 2J2IB 1REKA 5HKMA 2W9ZB 4PRJA 5JKGA 4GU6A 2Y4IB 5EK7A 4K9YA 3C4WA 4RWIA 4ZTLA 3S2PA 3W0PA 3D7ZA 1KV2A 3TJDA 4QNAA 5B2LA 3WZEA 4TYHB 1H01A 2E9OA 4JRVA 5CSVA 5IUIA 3ZH8A 5HTBA 2ITTA 3K2LA 4IVBA 4Z7GA 1U46A 3BLHA 3QUPA 4AACA 2VWVA 4ZY4A 5J1VA 2BZIB 3Q3BA 3HMMA 1PKGA 2QKRA 5DIAA 3KQ7A 1R39A 2CDZA 2ZMDA 1MQBA 3BRBA 4G16A 4O6EA 4QTBA 3R9NA 2PU8A 3ZOSA 5HLNA 2YISA 2VRXA 3R2BA 5AA9A 2HYYA 4BBEA 2C5YA 2YABA 3G9NA 3OVVA 2X7GA 3TYKA 4O7WA 2ITQA 2OXYA 3P86A 3QAME 1UWHA 1IRKA 2JKMA 4CRSA 2GNHA 4RIYA 4IM2A 1MQ4A 3FPMA 4KIOA 2YIQA 5DA3A 3MIYA 3QX4A 4EOMA 1BL7A 5JRSA 3MB6A 3CC6A 4GFOA 4GU9A 3FMNA 3R7VA 2J9MA 3DS6A 4EK4A 2UW3A 2JBPA 4YJRA 3RGFA 4IHPA 3MTLA 2E9NA 1XH7A 5M44A 3V5PA 4C7TA 1XBCA 3LCDA 4KD1A 2F49A 4EEVA 3SD0A 5IH4A 3L9MA 4GVJA 5FG8A 2XK9A 5DYJA 5FP5A 5AEPA 4XV3A 2XVDA 4U43A 4YHTA 4YJVA 4CKIA 3HV3A 1PMVA 4A7CA 4F1TA 4XG4A 3ETAA 5AUUA 3FZSA 3ORIA 3TKHA 2LAVA 3TUBA 2I40A 5IU2A 3GNIB 3LW0A 4FBXA 5A4TA 3SG8A 2YM5A 4GJ2A 2RIOA 1WBTA 4E8AA 2Z2WA 2BFYA 4EHEA 5BPYA 4CD0A 4OTWA 2PVJA 4PV0A 4GG7A 4L7SA 2C0IA 2WMSA 3N4UA 4K1BA 5CENA 3MVHA 1FGIA 4BBFA 3FBVA 4YUQA 3LJ0A 5JH6A 2ITPA 2VTTA 1F0QA 2W9FB 4U79A 4M69B 2RFEA 3O8TA 1V0OA 4Y5QA 4A9SA 5CU6A 3R28A 1XH9A 5IEXA 4FV5A 4P7EA 5E8SA 2XP2A 4HGTA 1XR1A 2C5NA 2HZ4A 4TWPA 3RPRA 3NRMA 3R30A 5HU9A 2OSCA 4YZMA 4JQ7A 3F7ZA 1H25A 4FG9A 2C3LA 3RK7A 3KU2A 2HENA 3ZM9A 5JGBA 2PZRA 4I21A 3OY1A 4ZS4A 4PX6A 5C1QB 5LQFA 2YJSA 4GL9A 2YHVA 4CZUA 2B0QA 4RA4A 5IH6A 4HPTE 1YI3A 4O2ZA 4Z3VA 1PRYA 5EM5A 5FLFA 3ZXZA 4QMOA 1K2PA 3ALOA 3QZFA 3C5IA 3VHKA 4NM3A 1F5QA 4FEVA 4APCA 2VO6A 3RWQA 4B7TA 4UX9A 3QQFA 5GJFA 2WQBA 5E90A 5M56A 2B7AA 4U97A 1O9UA 4J99A 1A9UA 1OMWA 2I0EA 3BKBA 3OOGA 3MVLA 3DNEA 4JBOA 5J9LA 1UV5A 3A8XA 3C4CA 3DAKA 5JQ8A 4RT7A 2GNGA 3FMHA 3OC1A 3I81A 2Q0BA 2B55A 4LRJA 4X6QC 3UO5A 3A7JA 3FL5A 2WTIA 2GTNA 3TV4A 1XH4A 4ALWA 4DF3A 1E9HA 3G90X 3ERKA 3Q4UA 1UNGA 3MFRA 2W99B 4FIGA 2YIWA 4EH2A 4GT5A 2OBJA 4ZZOA 4PWNA 4ZSGA 4EH9A 3FMKA 5HTCA 5IF1A 1FMOE 4IC7A 4AGWA 4GW8A 3C51A 3JXWA 3ZMMA 4XX9A 4YC3A 2WMWA 3OF0A 3EFLA 5ANOA 5G6VA 4FSNA 1ZOGA 2Y8OA 3E3BX 2OZOA 2ZM3A 4UEUA 4NM7A 5EKNA 3EQFA 3AMYA 3FZPA 3HDMA 3LFCA 4HZRA 5CSHA 3OHTA 5TF9A 4CEGA 4Z55A 4G5JA 5CASA 4QMSA 1FMKA 2PSQA 4QMUA 1EH4A 1P14A 3K5VA 2IJMA 5LOHA 2WMAA 5HO8A 5IPJA 2ITOA 3OBGA 2F9GA 3EN4A 4IBMA 4OBPA 3BU5A 1R78A 2UW0A 4QP8A 3KMUA 4BCFA 3PFQA 1PYEA 2A2AA 3GFWA 4HYSA 4C62A 2JBOA 4IAAA 4GFGA 2XK8A 2UW5A 4AT5A 1V0PA 4AUAA 3TDVA 4XOZA 3PE2A 5LVOA 5L6OA 3EQIA 2WU6A 4FV1A 4RQKA 2JKKA 3CEKA 5DRDA 3MA6A 3R83A 4ZZNA 4IFGA 2ZAZA 2QOKA 3KULA 4FX3A 4ZY5A 1ZYJA 5KE0A 3DLSA 5BVEA 1H24A 1REJA 3WF8A 1VEBA 4EH4A 3HAMA 3Q2MA 2PYWA 3MPAA 2GHGA 4JDKA 3ZCLA 2YIXA 4C34A 3CD8A 2QD9A 3O8UA 4M67A 4AT4A 4L53A 5IA4A 3R7IA 3RP9A 4F4PA 5DR6A 4BIBA 4LMNA 2AUHA 2JIUA 4S34A 3BGPA 4KUJA 4F64A 5BX0A 2XUUA 5H2UA 2YAAA 2Z7LA 3OEZA 3UOJA 2W5AA 3BZ3A 5JT2A 4PQNA 4O7OA 3Q96A 3NW7A 4I41A 3QCYA 1S9IA 4F1MA 4YPSA 5I9UA 4JRNA 3R6XA 5TT7A 4WRSA 3ZC5A 5M08A 1H1WA 3POZA 1WBOA 2X6DA 3FPQA 1NVRA 4RSSA 2ITZA 4U3YA 4DC2A 3W2PA 3QWKA 3R7UA 3RKBA 2V7AA 3D7TA 1M52A 3KB7A 3FSKA 2UZTA 4FTTA 5I5ZA 5M53A 2E9VA 2F57A 4EBVA 2JAVA 3KXHA 3OCSA 3F3WA 3R02A 4O7ZA 4F7JA 4B8LA 2QR7A 3WF6A 1GIIA 3DJ7A 5FXRA 5L2IA 1PXPA 4O21A 4H39A 3BEAA 3KY2A 3BWJA 3MWUA 4DG0E 2A1AB 3GC0A 4HCVA 4OTRA 4RWLA 1JAMA 3MPMA 2C6IA 4CFXA 4YBJA 2WHBA 3CIKA 3K5UA 3Q2JA 5AIRA 3EQBA 4DEAA 2OG8A 2WFYA 4FOBA 2YDJA 4MH7A 4WBBB 2WMUA 3VS7A 2JC6A 4E6CA 1JSVA 4N6YA 4RJ3A 4KINA 5KMJA 3ORLA 2DS1A 3JY9A 3EJ1A 4QYEA 4KB8A 4J7BA 2XBJA 4QTDA 2J0MB 3V6RA 4CMUA 2C69A 3HV6A 2YCFA 2X7FA 4JNWA 2VTSA 2WIPA 4NZWB 5HVYA 4U44A 4FV2A 2WD1A 3KN5A 2RFNA 4BCJA 5HD4A 4Z9LA 2R3LA 3QD4A 5L2TA 3QWJA 3SRVB 3F2NA 3FMLA 4HCTA 5HX6A 2VAGA 1PF8A 2CNQA 3FWQA 3ZRLA 3E7OA 3QXPA 5AP6A 2XNOA 3SOCA 2Z02A 3ROYA 5AAFA 4ACGA 4CLJA 4MVFA 3BBTB 3EYGA 5HD7A 2A19B 4Y5HA 3DA6A 2R7IA 3GC8A 3P0MA 3DB6A 3R1YA 4FTCA 5FEQA 2XCKA 4QQCA 2HXQA 3C13A 3QQKA 4JL9A 3O0GA 4FG8A 2GNLA 3CLYA 4M0YA 3JS2A 3BIZA 5BYYA 5HX8A 1STCE 4G5PA 3QYZA 3E8NA 1YOJA 3VVHA 1KE5A 2G2FA 2OIDA 4J8MA 5EI8A 3WE4A 4BKJA 5AUTA 1LR4A 2BKZA 3F6XA 4A4LA 4EKKA 1Z9XA 2BTRA 4IAKA 3WI6A 3Q60A 5JQ5A 4QP7A 4LQMA 4FKWA 3SGCA 3PPJA 4CVAA 3I6WA 1U54A 1IG1A 4DH3A 3MW1A 4HGEA 4RJ4A 3TTIA 3ZFMA 4RPVA 2R64A 3KGAA 4XJ0A 3LPBA 4FL2A 3KXGA 4EH7A 1FINA 5HE0A 5HNBA 3HYHA 3NUUA 1KE8A 5KMIA 5T68A 4G6OA 3OXIA 3SW4A 3BLRA 4FSYA 4XMOA 3BGQA 3D2KA 3P7CA 4QTEA 5AP4A 5A6OA 1OIYA 3O2MA 5E1EA 3LLTA 1OBDA 2I6LA 1WAKA 3FL4A 3FQHA 2EVAA 2XKFA 2VWBA 2C1BA 3F5UA 4MNEB 4XUFA 3TNQB 2VWIA 4CNHA 4E6QA 4RA5A 3PSDA 4O27B 1Y6BA 3KMMA 4D1SA 5BMSA 2H9VA 3OCGA 3GQLA 4KAOA 4FV3A 3Q6UA 2GFCA 3RPVA 4AZTA 2Y4IC 4EBWA 2J51A 5M09A 3K3IA 1OM1A 2ZDUA 4E1ZA 2VWZA 4W4VA 4XP3A 5CVFA 3UJGA 5IQBA 2VTPA 2VZ6A 3PXYA 5J8IA 2ZB1A 4ZLZA 2WEVA 2W4JA 5ANEA 3B8QA 3VN9A 5I9ZA 3LFQA 3U54A 2WTVA 4FSMA 4O22A 4WNOA 4U9AA 5ANJA 2VX1A 2OIBA 2PZYA 2X9EA 2WZJA 3CQEA 3FI4A 3IK3A 5DT0A 2IW9A 4DH7A 3EN7A 4C4EA 1O6LA 2OIQA 5ANGA 5BUEA 5CSXA 4F6SA 2W05A 3JPVA 4UWBA 4JR7A 2ZVAA 5HG5A 5EQPA 5IQFA 3ZM4A 4UN0C 4YC8A 4ZTHA 1YWNA 4QMLA 2YCQA 3R0TA 3KXMA 2I7QA 1JQHA 2ZB0A 3QA0A 3TEIA 4R5SA 4BY9E 1PXJA 2VN9A 5EYMA 4EOQA 5JGAA 3N4TA 4M0ZA 3UNZA 2XK6A 4YHFA 4FIEA 2NRYA 4AZSA 4GEOA 4CFVA 4ZP5A 4ZXTA 4ZSJA 2HY81 4KBCA 2P0CA 3UIMA 4MBLA 5E8WA 4DEIA 5A4QA 2UZBA 1MRUA 1YXUA 4NCTC 3PY3A 4KBKA 3R8UA 4NW5A 1XQZA 3EZRA 2BHEA 4YNOA 2PUIA 3E5AA 3HMPA 2EWAA 4C61A 4HW7A 2Z7QA 5GJDA 5CAVA 3MESA 2OJJA 4G6NA 3AC8A 3TCPA 4I93A 3QA8A 2J90A 1Q5KA 3CTHA 3BYVA 2HCKA 3EQRA 4BCNA 4L52A 4R5YA 2IVVA 3ODZX 1JOWB 2PVMA 2CKOA 3AMAA 4ANMA 5KHXA 4E73A 3QF9A 4AN3A 2GNFA 4B9DA 3R9RA 4U81A 3W10A 4F1OA 3QQUA 3H30A 3HMOA 3KRXA 1IR3A 4AF3A 4JQEA 3FV8A 3ZONA 2A0CX 3B8RA 3G51A 4RIXB 1U5QA 4L00A 3D5VA 1PXKA 4F9AA 5ETCA 4CFNA 4JT3A 2ITWA 3L1SA 3GC7A 4FNWA 5HORA 3PDTA 3IGGA 3ZYAA 4R1YA 3G5DA 4TYHA 2GQSA 5BYLA 2PTKA 3F3TA 2PVKA 4X2NA 3SXFA 1ZRZA 3BELA 1GZOA 5HE3A 3Q9XA 2HELA 4IM3A 5M4IA 3ORKA 4W4YA 1WVYA 5DT4A 3UOHA 3E92A 3GCPA 5AAEA 4AOIA 3VUKA
chains in the Genus database with same CATH superfamily
2W1GA 3DJ6A 3AKKA 2BZKB 4NJ3A 3GT8A 4FT0A 5HBJA 3TZ8A 4A4OA 1Y6AA 1J7IA 3II5A 3QKLA 5EHOA 4ZJIA 1FVRA 3UIUA 3E64A 3QTUA 3VO3A 2PPQA 2QOHA 3FZOA 3GCVA 3NW5A 3GEQA 1FQ1B 2ZJWA 4DG2E 3HLLA 4WA9A 4BJJA 5JFVA 5IUHA 2BFXA 4AWIA 2JDVA 1LEZA 2UZLA 2E9PA 2EB2A 5KBRA 3H3CA 3PE1A 2VGOA 5L8KA 2ZFYA 3MIAA 4K77A 2ERKA 2UW8A 2VNWA 4NCTA 1IA9A 1Q4LA 4QDVA 4RVMA 3S4QA 4WZYA 2PWLA 3OUNB 4GCJA 4H58A 5B2KA 3HVCA 2OJIA 3BYOA 5BVFA 4QP1A 1YRPA 2YWVA 3ODYX 4J97A 4JXFA 4X2GA 4DYMA 1PXLA 4JQ8A 5IA3A 3BV3A 2VO3A 2F7XE 4KWPA 4FKPA 4QP3A 3W1FA 4KIPA 1Q97A 3WARA 3BL7A 5AUWA 4HVDA 4UV0A 3HKOA 2FGIA 2UZVA 3FEGA 4JAJA 4ZK5A 5B7VA 5IA0A 3UYTA 2GQGA 4N57A 4RQVA 3I1AA 4O0VA 3W33A 3ATTA 3VJOA 4LV7A 3R00A 4GIHA 4Q5HA 2C1AA 3U4UA 5JFSA 3OP5A 4P5ZA 4I24A 5J9YA 3VBXA 4FZFB 1XH5A 4B8MA 5D9HA 1U54B 1URWA 1FVTA 1XJDA 4YZ9A 4Q2AA 5CU3A 3SAYA 2VTQA 4USEA 5CVGA 4KBAA 5AV3A 4J98A 1CKIA 4UBAA 3RALA 5KKRB 3TNWA 2C68A 5IISA 4CV9A 3T8OA 2O64A 4YTHA 5E8TA 4EI4A 2GS2A 4MHAA 5AP5A 1KOAA 3EFWA 4FTJA 3PUPA 2HY0A 2OH4A 4PMTA 2AYPA 4Y8DA 1WVWA 4O7VA 1BL6A 3JY0A 4FV8A 4F09A 4IAIA 1Q61A 2AC3A 2PVFA 3KXNA 4AAAA 5AAGA 5EG3A 4ANSA 5BNJA 3KCFA 4C4FA 4GT4A 3ANQA 4NK9A 4O96A 4AT3A 2XAOA 3A7HA 5B0XA 5IMXA 3F3VA 4FT7A 5BUJA 5ETAA 2V62A 5IQHA 3QRJA 1MRYA 5ANDA 3HP5A 3TNPC 3DBFA 4QP2A 4FZ7A 3VF9A 2DYLA 2CGUA 4BTKA 5FDXA 4ZMFA 3V6SA 5C4LA 4FIJA 4GK2A 3S0OA 1W82A 4MQ1A 4O0YA 4BN1A 4XRJA 5JFXA 4ANBA 4E20A 2UZNA 2OFUA 2CSNA 4YLKA 1MUOA 3POOA 4FSTA 4DITA 4CFUA 2VTIA 4ZJVA 1GZKA 3QZGA 2YZLA 3D5WA 4H1MA 1PJKA 1Y8YA 3LXLA 3ML1A 4LUDA 4TWCA 3CCNA 4XP2A 4AP7A 3DDQA 3OS3A 4RLKA 3Q04A 1YHSA 4LV8A 4FKLA 4RC4A 2QO9A 3PLSA 2V7OA 4D1ZA 2W4KA 5M51A 2WXVA 3WF9A 4D9UA 2JKOA 4A9UA 1YWVA 4JBQA 4MD8E 1AGWA 2F2UA 3V5TA 3AT2A 5CYIA 3PJCA 3PVBA 5FM2A 3IECA 2H8HA 2WU7A 3UVQA 4YTCA 3FYJX 3QYWA 3VS6A 3PSBA 3KXXA 3CY2A 4W4WA 2CCIA 3UDSA 4C4IA 4QRCA 2XK4A 5BYZA 5CSWA 4ZAUA 4OBQA 2IO6A 3BHUA 4RX7A 2I0VA 3R9HA 1PXMA 3LVPA 3Q9YA 3DFAA 3FLZA 4PTCA 4YGAA 4CMOA 3ZBXA 3VRYA 4CZTA 3OTUA 1J7LA 4U80A 4YZNA 3BGZA 4DBNA 3F61A 2QONA 3DBDA 3R7OA 4MBIA 4F99A 1XBAA 3PXQA 5LXMA 3FKOA 4IWPA 2W1ZA 5F20A 5CF4A 3OWJA 5A54A 4GYIA 4MXCA 4FMQA 4IB1A 3LCTA 1V1KA 3IW7A 2YIYA 5CEQA 3ZO2A 2ITVA 4IJPA 4O0XA 2HWPA 2YAKA 4D58A 3U9CA 4Z7HA 4CCBA 4TZRA 4JMQA 2YDKA 4CT2A 3O50A 1CTPE 1LP4A 3EQCA 3O7LD 5EW8A 1UU3A 2XS0A 4I0TA 4HYUA 4TL0A 5FDPA 3VBQA 1OI9A 3G9LX 3D9VA 2PE1A 4F0IA 4Y46A 3R8VA 3I5ZA 3P5KA 2A4LA 4S2ZA 5CU4A 5FTQA 3EH9A 4DH5A 1OIRA 3M2WA 5CXZA 1B39A 4EZ5A 4QP9A 3W18A 4QMNA 3DAEA 1IA8A 4YJUA 4TYGA 4EQCA 4L46A 4TXCA 2JD5A 3V3VA 2ZOQA 4TYEA 2XEZA 3F82A 4ORKA 2OH0E 1QL6A 5HBHA 3TZ7A 1JKTA 3OOMA 2J0IA 4Y95A 5TR6A 2XF0A 4EYJA 2YFXA 2PUUA 2SRCA 3ORXA 4PDOA 5I0BA 5EYCA 4EONA 5HG9A 4R77A 4F08A 1ZY5A 2Q0NA 3ET7A 4ZSLA 3ELJA 4DA5A 4YSJA 3CSVA 1PW2A 2CCHA 4NM0A 4PUZA 5HLPA 5LVNA 2R0UA 4FG7A 4IEBA 4G3DA 2QR8A 5C8MA 4CRLA 3FXZA 2IZRA 2UW9A 2QOBA 2VWUA 4EOJA 3LZBA 5HICA 5CAPA 1TQIA 4E93A 5AUZA 5DEYA 4IVCA 3HV7A 4E4NA 4MWHA 3LOKA 4ZTRA 3E8CA 4N4SA 4O2PA 2EB3A 4CSVA 3OROA 5ICPA 2YM8A 1XH8A 4J53A 3VUMA 3QQLA 5KHWA 3F3UA 4BBMA 3QXOA 3CKWA 2VTJA 5D11A 2YM6A 3TV7A 5HNGA 5J5SA 5AUYA 4IAFA 1QPJA 4IZAA 3GOPA 5EOLA 4BIEA 2OFVA 3EFJA 4UWYA 2R3RA 4GUBA 5ANKA 3T9IA 4BVUA 2UW6A 3R7YA 5A4EA 4LOOA 2Y6MA 4BZDA 3HAVA 3D2IA 4IAZA 4C3PA 4ZJJA 2BAKA 3IQ7A 3SRVA 4FKTA 1S9JA 1GIJA 4ENYA 4AGCA 4FI1A 1YDTE 3CKXA 4FKOA 1GNGA 2CPKE 2IG7A 3TIYA 2YZAA 3HRFA 4PDPA 3FSFA 5JK3A 2J4ZA 2XM9A 2RF9A 4RWJA 4MKCA 3A4PA 4ARKA 4E6DA 1YQJA 5E8YA 2C5OA 1OL6A 4PMPA 2XYNA 4M13A 4PMSA 5FEDA 3U4WA 4ZIMA 2VO0A 5HE2A 3I0OA 5I9XA 3PA4A 4MXZA 4O0SA 4L43A 3MYGA 3QTRA 4O0TA 3NNVA 4MXYA 2ZDTA 2HZNA 3UP7A 4FUYA 1HCLA 5DNRA 5DN3A 3V51A 3LFEA 4TYJA 4AXCA 4LFIA 4F0FA 4FKGA 4I5CA 3FDNA 3F88A 3NPCA 4OUCA 4BZNA 3ZLWA 3KXZA 4I0RA 3TG1A 1BYGA 2GNIA 2ZYBA 2XKEA 4H3BA 3RNYA 3F2AA 4G6LA 1GZ8A 1BX6A 4MXXA 5DWRA 3S1HA 2J0KA 3COKA 5GHVA 3FXXA 3NNUA 2OWBA 1H8FA 3SHEA 3L8VA 1FBNA 1YXVA 3WF7A 4YNEA 4ZTSA 3MH2A 2C6EA 4NM5A 2YEXA 1ZWSA 4NFMA 4UY9A 3PWYA 3FHIA 3P9JA 3CE3A 3W0MA 1JKKA 3WZUA 2VD5A 3ZC6A 2GQRA 3FZRA 2C3IB 3GGFA 2P55A 2QOQA 4I94A 3OW4A 4MNEA 4RVKA 3FUPA 4BGHA 4U98A 4U5JA 3V8WA 1ZMVA 2R3IA 2VWYA 2XK3A 5CVHA 4AN9A 3FY2A 4FV0A 4QQJA 5KMNA 3F3ZA 3UOKA 2W1HA 4IIRA 1U4DA 3TUDA 2WB8A 3JUHA 4IVDA 1UU9A 2C5XA 1JKSA 4ZEGA 3OT3A 3S95A 5HGIA 4EK3A 2X8DA 4D4SA 2J6MA 4WG5A 3F7WA 1E1VA 1TQPA 2CJMA 4PTEA 2JFLA 1UA2A 3U9NA 4AX8A 3BV2A 3DGKA 4EHGA 2OU7A 1Z57A 3GU5A 3CD3A 4Q9ZA 3O51A 2YCSA 2IVTA 3SXSA 3DBEA 4GJ3A 4IDVA 4J95A 4K18A 4QMXA 4ZLYA 1UU8A 3JR1A 4F78A 3QC9A 4OTFA 4FSUA 4L9IA 4XYFA 5IEYA 4C4GA 1Z5MA 3IGOA 2I0YA 3S3IA 3MY1A 2GHLA 4FODA 4M15A 3ZUTA 3LMHA 2GPHA 2R9SA 4DH1A 4BDKA 3DKGA 5CAQA 4AN2A 1XMLA 2IN6A 3ZLXA 2BKKA 4WUAA 3QGYA 4BR3A 4DT9A 3SVVA 3KRJA 4FTLA 3PZHA 4V0GB 4DLJA 3IPHA 3FYKX 2R3PA 5AADA 2YA9A 3UNKA 1Q3WA 2ZM4A 5IQDA 5LMKC 5ANIA 4WHZA 4RC3A 4DFYA 1BI8A 3VUIA 1H1QA 4DFUA 4DHZA 3LJ2A 2PULA 5M4FA 1VJYA 2PVRA 4M14A 4YZCA 2WTCA 2OK1A 2PMOX 3QLGA 5AP7A 4XEYA 4Y83A 5LCKA 2QHMA 3IW8A 4ONAA 1ZARA 3BE2A 2PVHA 5CF8A 3CGFA 5IH5A 4IANA 2VTNA 3LFSA 3QBNA 4KA3A 2FVDA 2GTMA 3V8SA 3VHEA 4YMJA 2W1IA 4CTBA 3R71A 3RI1A 3HL7A 3O96A 4NTTA 3VF8A 5AUVA 4DE4A 2YIRA 3CJGA 3F9NA 4H3PA 5F1ZA 1TFFA 2QLQA 2JAMA 3EKNA 2VTRA 3LHJA 5HHWA 4E4LA 4TN6A 1Y57A 3WIKA 3ZO4A 4D5KA 5L8JA 4RIXA 4C36A 3G6HA 3FXWA 1OIUA 3VQHA 4DEEA 4ITHA 2X4FA 3VS2A 2OJ9A 2WMVA 3UIBA 2BDFA 1XKKA 4BDBA 3IS5A 3OEFX 3PWDA 3TXOA 5HIBA 4BHZA 3UVPA 2QU5A 2VTOA 3OCBA 5HE1A 4BRXA 1XMMA 2PMLX 3HEGA 4IWOA 1OB3A 3MH1A 3OG7A 2ZV7A 3NYXA 4QQTA 5IA1A 4FTQA 3GC9A 4MX9A 3H4JA 4HVIA 5KKRC 2DWBA 2Y6OA 4F7SA 2WMTA 4F9BA 5C8NA 4LRKA 4IDTA 3C4XA 4J71A 4I4FA 3W2SA 3QRUA 3VWAA 5A14A 2BAJA 3B2TA 1SNUA 1U59A 3ZDUA 3E63A 2UZEA 4ZTQA 4BDDA 2ITXA 3Q4TA 3KRLA 4IQ6A 5CQUA 2VX3A 3NZ0A 4LDTA 5ACBC 4QQ5A 2WQEA 3P4KA 4FYOA 2P2HA 4G9CA 3BHTA 4K0YA 4RX8A 4TNDA 3T3VA 4EOPA 3AXWA 2X4ZA 4QMTA 4U0IA 2QOOA 3I6UA 1FOTA 3LXPA 3RHXA 4DEDA 5M55A 2UZUE 3UGCA 5LWMA 2C6TA 3MA3A 3GU6A 4G17A 4DHFA 3G15A 4L68A 1H0VA 2WPAA 3GCQA 2XAMA 3LCKA 4H1JA 4FSZA 4R3CA 1H26A 3HDNA 3Q4CA 2P2IA 5LMKA 2FSMX 3EL8A 1YKRA 1OZ1A 5I9YA 3OXTA 1U5RA 2IPXA 4L01A 1SNXA 3MB7A 4IZ7A 1YOLA 2J5FA 2Z7RA 4FGBA 5F94A 3GVUA 2O2UA 4QP6A 5AV1A 3D83A 5ETIA 4EL9A 5FQDC 4EK5A 3H9OA 2ETMA 3COHA 1DI8A 1URCA 4I4EA 3Q5ZA 4YJQA 5IG1A 4QPSA 3ZLSA 3ZSHA 3DZQA 4X6RA 4E4MA 2XZSA 4M7IA 4F9WA 3OMVA 4BCQA 2BVAA 5E1SA 3EQDA 1QPEA 3ZFYA 4DEBA 2KULA 3PZEA 1Q8YA 3AG9A 2FO0A 2UZWE 3AGLA 2XNBA 3G0EA 4M97A 3MS9A 3E7VA 3UPXA 2NRUA 2QURA 2R3MA 4ACDA 4L7FA 4MD7E 3L8PA 1PXIA 1CKJA 3AD4A 1YVJA 1YXTA 3MPTA 4L3JA 4QTCA 4IZ5A 1M7NA 4UB7A 5CEKA 3HV4A 2JIVA 4QDEA 2VTAA 3RHKA 2CKEA 3BU3A 3UQFA 2BHHA 4F0GA 4O7TA 1G8JA 4NFNA 4KKEA 4EHVA 4KRDA 2ITNA 4FZDB 1R1WA 3IG7A 4YHJA 5J9ZA 2HZ0A 1ST0A 3GU7A 4EOSA 3H10A 3M11A 4LI5A 4CCUA 3ATSA 3EN6A 2XCHA 3LAUA 5CS6A 4O0RA 1WZYA 3BEGA 3H9FA 2XIKA 1Q3DA 4GKHA 2C4GA 1JSTA 3BYMA 3NUPA 2R3NA 4JS8A 5DR2A 3VULA 1XWSA 3BYUA 2RFSA 3PYYA 3V04A 4XP0A 4HGSA 2QCSA 2WQOA 4I6QA 3RK5A 2B53A 4IWDA 3PXRA 5EH0A 5EDRA 3FE3A 2HXLA 1V0BA 2YJRA 1WBPA 2CKPA 3I79A 4FV9A 4NWMA 4QYHA 1Y91A 3UO6A 3KRRA 4O38A 4MXAA 3QTWA 3BLQA 4JDIA 5AV2A 4KNBA 1LUFA 4BI2A 5CF5A 5H8EA 3QTZA 2R3GA 3WE8A 2YM7A 3PXKA 3TJCA 1H00A 4WD5A 3TZ9A 2FUMA 2ONLC 3I7BA 3PXFA 3QD3A 4J8NA 2PZIA 2VTLA 3LM5A 3W0NA 3W2CA 4ASXA 4CG8A 4UYAA 4ACMA 5JRQA 3DKCA 2A27A 1BKXA 3DXQA 1WCCA 4X2FA 4LRMA 3EMGA 5I4NA 2B54A 1OGUA 3TTJA 2GS6A 2OO8X 5EDQA 2IW8A 3QZIA 2QOFA 3Q4ZA 4JAIA 3UOLA 4C02A 3KA0A 4GRBA 3COMA 1UVRA 4EOOA 3UYSA 5KCVA 4CQEA 4WRGA 3ZRMA 3C0HA 4NT4A 4XG9A 4DG3E 3DCVA 4ZY6A 4MEDA 3QTIA 3DAJA 3F2RA 3QTXA 4TRLA 5BVDA 5IQCA 4C2WA 4P90A 3U6JA 4GK3A 4L8MA 3UZRA 3LQ5A 3GB2A 3GOKA 2AEGA 3LQ3A 4N0SA 4ERKA 2OXDA 3P08A 4FC0A 3R1SA 3E62A 4RJ8A 3LFDA 5CEPA 3NCGA 5LJJA 5E8ZA 3RAHA 4LGGA 4RLLA 1CM8A 2PUNA 4MNFA 4BDFA 4RJ7A 1YDSE 3MY5A 3QHRA 4PL4A 2PVNA 2CLQA 2QG5A 4O81A 4QEBA 5DE2A 4F6UA 5FTGA 4IX3A 4HNFA 3FLWA 4JBPA 4LYNA 4MK0A 4HYIA 4IACA 2R3KA 2X0GA 2IW6A 2XH5A 5CU2A 4XV9A 3TNIA 2IZSA 3PIYA 5CF6A 2IVUA 2C6MA 2XMYA 3GFEA 3TI1A 2R7BA 3D94A 4E4XA 2FSTX 3LMIA 3GCSA 3PPKA 4YZBA 3MVMA 1BLXA 4O83A 2J0JA 2CHLA 5EFQA 4MF1A 4EK8A 3QGWA 4XG2A 3MFUA 4L67A 4A9TA 5JN2A 3NEWA 3QLFA 3WBLA 5CNOA 3LXNA 3G33A 3U51A 3ZBFA 2Z8CA 4BCMA 4RVTA 5E9EA 4RVLA 3I60A 3WIGA 1BI7A 3UE4A 3HECA 4DAWA 3P7AA 3UG2A 4CXAA 1R3CA 4DFNA 3E3PA 4E26A 3FLYA 4JLCA 4K11A 4CTCA 3QRIA 5EI6A 3SA0A 2ONLA 4WO5A 3KK9A 4H36A 5DG5A 5AV0A 4AG8A 2VWXA 4D55A 5A4CA 1FGKA 4B4LA 1H1PA 3D15A 4AS0A 3QD0A 3ZSIA 4DEHA 3L9LA 4QYYA 4GK4A 4IM0A 3IONA 3AD6A 4ZTNA 5H9BA 3VS5A 4HPUE 3D4QA 2XKCA 4P4CA 4OTGA 4UWCA 2XA4A 3DTWA 4NYEA 4HVSA 4BCOA 2GSFA 5CANA 4AZWA 5DT3A 3TT0A 2W96B 3FMMA 3LCSA 4A4XA 2ZMCA 2C0TA 3W16A 1PXOA 5IEVA 2F4JA 5A46A 2WIHA 2W17A 4JDHA 4EWHA 2CGVA 4C2VA 4FYNA 4X3FB 3ACKA 2ZV2A 3DDPA 5H3QA 4CV8A 3OBJA 4P2KA 4FTNA 4JDJA 4LUEA 3ULZA 4O7NA 4FL3A 4EHZA 2OJGA 2B9JA 2RFDA 1UU7A 1P4FA 1ATPE 2F7ZE 3HX4A 4NIFB 4F7LA 2BRNA 5A6NA 3ALNA 4XNEA 3U8WA 4CT1A 3TNHA 4QT1A 3R1QA 2HAKA 3A60A 3O17A 3VS0A 3FZTA 4O7SA 4BCGA 3Q53A 5D7AA 3HMNA 4FE2A 2XIXA 4FA2A 1KWPA 1NA7A 4U6RA 3UTOA 1H1RA 2CNUA 4X3JA 3EQHA 5EKOA 1RJBA 5HCXA 2XNPA 4XOYA 3QRTA 3KN6A 3R9DA 3RPOA 2XNMA 4BCKA 4BYIA 3HUBA 3QZHA 4FTMA 3RAKA 3HA8A 4H3QA 2J7TA 4U42A 1KE7A 1M2QA 3DXNA 4KKHA 5EDPA 5HEZA 1L3RE 1OKZA 2RKUA 3JVRA 1WBNA 3VAPA 3U6IA 3ORTA 1G3NA 1ZYSA 3REPA 4OR5A 4BHNA 2XYUA 1UKHA 4Q5EA 1OITA 4G3FA 4RFMA 3ZXTA 5AUXA 4ERWA 3HZTA 4HOKA 4ZTMA 3HGKA 3LJ1A 3MVJA 2QO7A 2R3HA 5F4NA 3PA3A 3WOWA 4AA4A 4HYHA 3MJ1A 3RZBA 2QQ7A 3C1XA 3O23A 3RMFA 4ZSAA 3UIXA 3OCTA 4ACCA 5T3QA 3W8LA 4CFFA 2HIWA 3Q6WA 2R4BA 5CSPA 4EH3A 4QYFA 3IW5A 4QPAA 5HESA 3M42A 3R01A 4QNYA 4F9CA 3SLSA 3RM7A 4CFMA 5LVPA 3VONA 3OZ6A 5J95A 5F95A 4K33A 5HIDA 3NUNA 4UALA 2JDOA 3PLAE 3THBA 5IDNA 3ZLYA 1P2AA 4FEQA 2XM8A 5EYDA 2UV2A 4JX7A 3NR9A 4HZSA 4RJ5A 3RJCA 2XK7A 4FKUA 4BIDA 3FKNA 2R3JA 4DH8A 1AQ1A 2JFMA 3FJQE 3RWPA 4ZOGA 4D9TA 3QU0A 4PL3A 3RCJA 3NW6A 5AP0A 3DT1A 5TOZA 3PIXA 2WTWA 4IX4A 5D10A 3ENHA 3PP0A 3IO7A 1VZOA 2REIA 1W84A 4FKJA 3QCXA 5FTOA 5CT0A 3NLBA 4FIIA 2QC6A 3FI2A 4OTQA 5DBXA 1YHWA 2JDTA 1B6CB 2XALA 5HQ0A 5IQAA 1JPAA 5JEBA 3G6GA 3FAAA 3NUXA 4MAOA 4U7ZA 4QMZA 5EI2A 3QHWA 4GS6A 1J1CA 1WBSA 2X2MA 3AD5A 3P1AA 4IFCA 4II5A 4U45A 5DVRA 4I3ZA 3Q32A 1OL5A 4WUNA 3V01A 2R3FA 4ITIA 3PTGA 1R0EA 1ZAOA 2R3OA 2CLXA 4MD9E 4WIHA 2Z7SA 4XG6A 4EQMA 5LVMA 1XBBA 2GS7A 3UBDA 5M57A 2YERA 2B4SB 4AQCA 2E2BA 3LFNA 4KABA 4NSTA 4V01A 3R8LA 2B9FA 3HV5A 4M8TA 2BUJA 4ANLA 4X21A 4EKLA 3DB8A 2G15A 3WF5A 3R73A 4J96A 2R0IA 1YWRA 3I7CA 1APME 4FNYA 4FV6A 4TKSA 2XNNA 5CT7A 3TM0A 3PG1A 5FGKA 3NVMB 3UQCA 4OT6A 3RK9A 4ZLOA 4OLIA 2EU9A 2PE2A 4BDIA 3DK3A 3ZS5A 4DFZE 4G2FA 1CSNA 1TVOA 2ACXA 3DY7A 3R8PA 2BCJA 1LPUA 1VYZA 2UVZA 2QNJA 1QPDA 5E8UA 2C3JA 2OGVA 3FY0A 2UW7A 4TT7A 4KSQA 4YU2A 2CGWA 5M4CA 4O7YA 3A2CA 1H1SA 1RDQE 2W0JA 3C4ZA 3PUFC 4I23A 2WMRA 3OWLA 4DT8A 4R78A 4QO9A 4ASZA 4LL0A 1OKYA 4Y73A 5IZFA 1O6YA 2ESMA 2Y7JA 2X1NA 4RRVA 5CY3A 5JFWA 1FPUA 2BZJA 2WMXA 4DGMA 2GHMA 4XG3A 2V0DA 3GUBA 3RVGA 3NYOA 4U41A 4GYGA 3VS3A 1JLUE 2YACA 4GT3A 5T6KA 3UG1A 4JVGA 3OW3A 4XH6A 3AMBA 2I1MA 5D41A 5BVWA 4YJPA 5HO7A 4YURA 4LV5A 4YJSA 4D2RA 4YO4A 1PHKA 2J50A 2JITA 2XJ2A 3ANRA 4FKVA 4MUQA 1AD5A 4YJOA 5D7VA 3VBWA 3BI6A 3R21A 4V0GA 2XIZA 5LMAA 2FSOX 4IC8A 2DQ7X 3NVKI 4FIHA 2OW3A 4FZ6A 4TTHB 1H08A 3UDTA 2WGJA 1Q8ZA 4FKIA 3LIJA 3ZU7A 2NPQA 2NP8A 4DLIA 3M1SA 1IASA 4XBUA 4LGHA 4TPTA 3TZMA 5FD2A 4FL1A 3D0EA 5HG8A 5A9UA 4IB0A 3K54A 4BCPA 3DKFA 4FVRA 2XKDA 3QUDA 4BI1A 2PUPA 4C3RA 1NVSA 2OZAB 2VWWA 2YITA 4KSPA 5BQ0A 5H8BA 1JSUA 4R1VA 4FTRA 3EKKA 4FK3A 3IW6A 5EQEA 1OPLA 3VJNA 2JEDA 4NH1A 4EJNA 3MJ2A 2QI8A 3HRBA 3A99A 4C4HA 1QMZA 4PP7A 3PVWA 3D5XA 4NU1A 3AC4A 5FUTA 2CGXA 5HVJA 4UZHA 1RW8A 4YBKA 1ZLTA 3UVRA 4GMYA 2PVYA 4QOXA 5AX9A 3V5JA 5AV4A 1NXKA 3DJ5A 4GFMA 3QTQA 2W1EA 4WSYA 4JG6A 3FZ1A 3MDYA 4KIQA 3MI9A 4ACHA 3P79A 4F9YA 4G1WA 3BQRA 2O65A 4FT9A 2WKMA 4LG4A 3RNIA 4A06A 5HIEA 4R7IA 3A7IA 2FSLX 3QKMA 5CLPA 4I0SA 3ZFXA 2RL5A 3RPSA 4U8ZA 3QQGA 4PF4A 5GIOE 1OGYA 2OXXA 3LM0A 4RIWA 3PJ8A 4GG5A 3IW4A 3ENMA 4K2RA 5ACKA 4YTFA 2OICA 1ND4A 3MN3A 4S32A 2PHKA 3OUKA 4NKAA 4DCAA 5CX9A 4I5PA 3WYYA 3VUDA 1PYXA 1IAHA 3DV3A 2X9FA 4JBVA 1B38A 3ORPA 3Q52A 5FXQA 1NVQA 4G3GA 3DK7A 4D0WA 4S31A 4YR8A 4FEUA 5CAUA 3QUEA 4E6AA 2F7EE 2P3GX 4CKRA 2QLUA 3R8ZA 1ZZLA 3LFAA 3NAYA 3UC4A 3O7LB 3BWFA 5E7RA 1W0XC 3QQJA 1BUHA 4AA0A 2R3QA 5IDPA 3FI8A 3HUCA 5KBQA 2C6DA 4ID7A 4AXFA 1GAGA 4DDGA 2C5VA 4XV2A 2BIYA 2XJ0A 3FMEA 4N6ZA 5BVKA 3FLSA 4FK6A 1G8AA 2WEIA 3AC3A 4EH8A 4L3LA 5LMBA 4IAYA 2XJ1A 2DUVA 1DI9A 4R3PA 2O8YA 3QALE 3RINA 3ULIA 3V8TA 5DEWA 1I09A 4IX6A 4O6LA 4UZDA 1Q62A 2QOIA 1RQQA 3SOAA 1VYWA 2WMBA 3CPBA 3KRWA 1UNLA 3ZTXA 1T46A 4JJRA 3PG3A 5IA5A 3E8DA 3DBCA 1OL7A 2W4OA 4WKQA 1SVGA 3CP9A 4XHKB 4OT5A 4EUUA 4HJOA 2XBAA 3VBVA 4A9YA 3VS1A 4QMYA 4W8DA 5AJQA 4DTKA 2QVSE 5DPVA 4MQ2A 4OTIA 4DBXA 2X81A 3OTVA 1DAWA 5KZ0A 3MY0A 4DINA 2VNYA 1M2RA 4NJDA 4TWNA 4YSMA 2HW6A 5AP3A 4EOKA 3GU4A 4AXAA 5C4KA 4RJ6A 5ETFA 2XRUA 5K5XA 3R22A 1NW1A 2HZIA 3PRIA 3NSZA 1PMNA 3Q9ZA 3CTJA 3MFTA 4GIIA 4KKGA 4Y72A 3VW8A 4EK6A 4FT3A 5E8VA 2EUFB 3CQWA 5C26A 5HBEA 3UDBA 2WTKB 3EFKA 4IWQA 4PMMA 4WG4A 3ZEWA 4AW5A 4W4XA 4BDAA 3ID6C 2X39A 1P4OA 3RM6A 3SC1A 3W2OA 2VV9A 2W7XA 3KCKA 3L8XA 2YM4A 4FSRA 3GQIA 1Q8TA 4LOQA 5FBOA 5IUGA 4BGGA 4V05A 5AFVA 2JIIA 5M07A 3N51A 1MP8A 5E92A 4EORA 4NW6A 1MRVA 3UPZA 4RZWA 3CXWA 4O7RA 3W8QA 5CU0A 1JVPP 3U55A 3VW6A 3BX5A 4LL5A 4O7LA 5G1XA 3MBLA 4GVAA 4RG0A 1UKIA 4PNKA 3C4EA 4XG8A 2X6EA 5HU3A 2AC5A 5CEIA 3DKOA 1KOBA 1YW2A 4I6FA 2PL0A 1T45A 1G8SA 2JDSA 4IW0A 3A7GA 4YZDA 3IDCA 5IQGA 2GCDA 2WO6A 4E7WA 2CN5A 4PP9A 5I9WA 3F69A 1ZOEA 3PJ1A 4JG7A 5CQWA 2UZDA 2IZTA 3P23A 4EUTA 4FTOA 5L6WL 2PMIA 3JVSA 3KEXA 3AGMA 4TYIA 4FVPA 5FBNC 3AKLA 4DN5A 1NT2A 2O3PA 3OY3A 4EC8A 3QCQA 5KX8A 3DQXA 5D1JA 5EW3A 3MH0A 1IEPA 1Q24A 2FYSA 5FM3A 4X3FC 3VBYA 4G31A 2BRGA 2R5TA 3DNDA 4BYJA 5KMLA 2BILB 3W0QA 3VRZA 1OIQA 3T9TA 1WMKA 4DTBA 4CMTA 4IE9A 5M06A 1F3MC 4WNPA 2BPMA 3RAIA 2QO2A 4D4RA 4C0TA 4FTIA 1H07A