4FEXA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor tyrphostin ag1478
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
NLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fexA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4fexA02
1ZOGA 2BZKB 5FRIA 4DBXA 4PQNA 1NY3A 2XYUA 3KCKA 2PUNA 3QLGA 4RT7A 3VUMA 4C37A 4EK4A 2NO3A 5FLFA 5G6VA 4ZY4A 4FIHA 3CSVA 4U8ZA 5JN2A 2XJ2A 3EN4A 4IB5A 3UPZA 4NFMA 5IA5A 4S30A 1H1QA 3TKUA 5B2MA 1BYGA 3PSBA 1WBPA 2FYSA 3E93A 3ERKA 5AIKA 5EW3A 5I9YA 5F20A 4GFMA 4QMXA 2ZYBA 2OXDA 3OT3A 4R5YA 2IO6A 2UZDA 5ANGA 4MCVA 3PVGA 2V22A 3QQJA 2G15A 4FV5A 4QQTA 3VS1A 1OIRA 4BY9E 3TJDA 4JBPA 4YSJA 4QPSA 1PMVA 4D0XA 3H30A 2RKUA 4S31A 5DA3A 1G8SA 5AP5A 3ZCLA 4FNYA 4KRCA 3F2RA 2PZPA 4F4PA 3FLNC 4IAFA 4DH7A 2HCKA 3HDMA 3P7CA 4BGGA 4ZJIA 4AQCA 4CMOA 3H0YA 2WMSA 2G9XA 2JKKA 3CD3A 4BCMA 2HELA 4YSMA 3D5WA 5ETIA 2XJ0A 5HI2A 1WBSA 3MVHA 4FUXA 4JRNA 3RAIA 5EI6A 3QHWA 1YDTE 4A9TA 3TYKA 3IDPA 5BVNA 3KGAA 4H1JA 2VX0A 1FOTA 2GQGA 1OKVA 1Z9XA 4WD5A 1OUKA 4EOQA 2EXMA 1TVOA 4FZ7A 2HZNA 4KIPA 4AF3A 4EH6A 4F7SA 5IH4A 3ENHA 3PWDA 1PXJA 4R3RA 2QU6A 4JT3A 4YLJA 5HX6A 5HCXA 4FKTA 4FZAB 3T9IA 5AWMA 4M15A 4PMPA 5J1WA 2H34A 4F7NA 5D11A 4D1SA 4EUTA 3C1XA 5A14A 4N70A 1ATPE 3N4UA 4OBQA 3NRMA 3IOPA 4FEXA 4J97A 3TZ9A 2WIPA 4CQEA 4M3QA 2QODA 3PSCA 4IZAA 1OBDA 2I1MA 1DI8A 1MQ4A 3DT1A 3BX5A 4PL5A 3R7EA 3QWJA 5D7VA 5HX8A 3QALE 3O96A 2VX1A 4FT5A 3UIBA 2G2IA 1BI7A 4IJ9A 3BBTB 4DEDA 3ID6C 4XS2A 4RQVA 4M0YA 2VRXA 4OTHA 2Y8OA 3S95A 3DKOA 1Y8GA 1SMHA 5GJGA 3ZM4A 5IA0A 2QLUA 5TT7A 5CTPA 3QKLA 2QNJA 3DNEA 2B9FA 2ZV7A 3NVMB 4MXZA 4FEUA 5I4NA 2JIIA 3NWWA 5AUWA 3IW7A 4WNMA 3R8VA 2Z8CA 2LGCA 2PY3A 3Q5ZA 3KL8A 4ZTQA 2W1DA 4KUJA 3ODYX 3ORPA 2WMAA 2I0YA 5HE1A 5KO1A 4IH8A 3AC4A 3RKBA 2UZVA 4ALVA 1Q97A 2O8YA 2YWPA 4RFMA 3G0FA 5T6KA 3UVQA 1YW2A 4PRJA 3ELJA 4AOJA 3NMUF 3ATTA 1OUYA 1VZOA 2WMRA 4MD7E 4O6LA 3NR9A 1WMKA 3OTVA 3I5NA 4JAJA 4C38A 1YXXA 5JKGA 3LM0A 3SXRA 5FGKA 3G90X 3FKOA 4Q9SA 1M7QA 5AAGA 5HU9A 1U4DA 5DT3A 4AE6A 2WEIA 1O6YA 3FXWA 4WNPA 5DGZA 3D14A 4J98A 1JWHA 4NIFB 4U5JA 2C47A 4ANLA 2C3KA 3RM6A 5IQEA 3DDPA 1PXMA 3Q32A 4KINA 2IW6A 4N0SA 3HV7A 4V04A 3R9HA 4CG8A 4F0IA 3SA0A 3UC4A 3O23A 5M44A 3W55A 5LVOA 1XKKA 2JDSA 4R77A 4E20A 3IK3A 4N6YA 2R3NA 4ITIA 3OS3A 2C0OA 3FJQE 3I81A 3PUPA 3HLLA 4USFA 1BUHA 3F2NA 5BYZA 3U55A 3JY9A 2X7OA 4I0SA 5ITAA 4C4IA 3QD4A 4TWNA 2CKPA 3OOMA 5LWMA 4RJ3A 3PXQA 2OIBA 3BHHA 3CY3A 3BIZA 4F0FA 2UZLA 4ACGA 3G15A 3I6UA 4ARKA 4FGBA 3Q5IA 5LARA 5LCJA 4I6BA 4I93A 3MFSA 3FYKX 3KQ7A 2YIXA 5HKMA 4A9UA 4QTEA 3JYAA 3C0HA 4PDOA 5H8EA 3W10A 4CFXA 3EYGA 4WO5A 2R64A 4AN9A 5IPJA 3RPVA 3UQGA 2VGPA 4YMJA 3DZQA 3H0ZA 4C4JA 5FTOA 4PDSA 1MQBA 4ANQA 4YURA 5CY3A 1S9JA 2VUWA 1SNXA 2V55A 4BDAA 5KBQA 2B54A 2VWZA 3H3CA 5K5XA 2B9HA 3EMGA 4PMMA 4RIWB 4BDEA 4JBQA 3ZM9A 4FL3A 5L2SA 4DG0E 2GS6A 2WMTA 5LXMA 1Q3WA 1MRUA 2OZAA 3OWJA 4KKHA 4E6QA 5AFVA 3DB6A 4L8MA 3U87A 3L9PA 5EOBA 3BGQA 2J50A 4FG9A 1J3HA 4B6LA 4WBBB 4WIHA 3PRIA 3R7VA 4A4OA 2XNOA 3FKLA 4M7IA 4DFNA 3QBNA 2XBAA 4Q9ZA 2QOKA 2GQRA 2I40A 3DA6A 5CI7A 1ND4A 4NUSA 4MXYA 1GIHA 5DEWA 1LP4A 4I24A 3QC4A 2YIWA 1KE6A 2CN5A 4F99A 4IWQA 4MHAA 3R9NA 1KSWA 4NM5A 4WNOA 5JFVA 4KNBA 4I5CA 3NCZA 4I23A 3V8SA 2GMXA 4LYNA 1YOJA 5M4FA 3CKWA 1YRPA 2X1NA 4HNIA 4LM5A 5D9HA 4Z7HA 2VTMA 5IDNA 5E7RA 3ATSA 5GHVA 4K0YA 3A8WA 3VS3A 4H1MA 3N4VA 3FYJX 2F49A 3AMBA 1Q5KA 2RFNA 2YCSA 4XG3A 5EM5A 5IQBA 3FXZA 5JSMA 3R1QA 1O9UA 3TIZA 4RX7A 3ROCA 5DHJA 3R04A 4F6WA 2BHEA 4J8MA 3NGAA 3EYHA 4IM0A 3S4QA 4RX9A 4BN1A 3PP0A 3CJFA 3P7BA 1DI9A 4AW5A 4FE2A 2J0JA 4FSRA 2VWIA 2OXYA 2JIUA 3ZO1A 1I09A 4BIDA 4MD9E 4O6EA 3GCQA 3PY1A 2R0UA 4FV4A 3E92A 3EFJA 3PDTA 4KIOA 3HNGA 4IWOA 4LOOA 3ZLXA 4UY9A 5ICPA 5KMNA 4EJNA 1ZMUA 1ZMVA 4ZMFA 3HL7A 1J1BA 2Z7QA 2Z02A 3DK7A 2ITWA 3LFEA 1BMKA 1FVTA 3QA0A 4YJPA 2YIQA 5FBOA 4B9DA 1YI4A 3F7WA 1H1SA 2BAQA 3GU7A 2FSOX 3PY3A 5EDQA 3R7YA 5HBEA 5KNJA 4GG7A 4FIFA 3V51A 4WKQA 1JVPP 4P7EA 4FC0A 2I6LA 4BCOA 4HVHA 4EEVA 3ZU7A 4RIWA 4UZDA 5M07A 4K77A 3SC1A 5J8IA 2BFYA 4E6CA 2Y9QA 2FVDA 4QNYA 4USDA 4PDPA 2C3IB 1IASA 3LCKA 1W83A 3NUYA 3QUPA 4K33A 4G5JA 4R78A 1RDQE 4IW0A 2CSNA 4WRSA 3ET7A 2HOGA 4WRGA 3E8DA 3UE4A 3BBWA 5GIPE 4DN5A 4FICA 2WOTA 4D58A 2BDJA 4L68A 3R2YA 4C3FA 4GYGA 2Y0AA 1M2QA 3HYHA 4FV9A 3CEKA 2IPXA 3IW5A 3PA3A 3KC3A 4IM2A 3TACA 5DFPA 3IQ7A 3I1AA 4FGRA 1WCCA 5AP4A 3GCUA 1BX6A 1APME 3F3UA 4EJ7A 4FIGA 4PNKA 2IW8A 3HVCA 1PY5A 2W7XA 2CKEA 4TWOA 3GC8A 4KABA 4X2JA 5FP5A 4WA9A 3SG8A 4O84A 3PA4A 1OL5A 2CGXA 5EYKA 5E1EA 5JH6A 4R1VA 2W06A 2YZLA 3W2QA 5CF5A 2UZEA 4QMTA 4WZYA 5HORA 2WQOA 4O7ZA 5LVLA 3ZZEA 1Q8ZA 1YHVA 3V5PA 2CCHA 5A46A 3CJGA 2GNHA 2Z2WA 3NNWA 1ZY4A 2GS2A 3SX9A 3OOGA 2PE0A 3O7LD 3UO5A 1QL6A 4FNZA 4AWIA 3OBJA 2Y4IB 2CKOA 3CKXA 3LXKA 4H39A 3ANRA 3FPMA 5A6OA 3ZFXA 3HMMA 3M11A 3OXZA 4HGLA 4R7IA 3SRVB 3EN5A 2P55A 3F6XA 2XM8A 4XEYA 4EZ5A 3IW4A 4D9UA 1KE5A 1JBPE 1YI3A 3PXFA 1SYKA 2WHBA 2ZM3A 4RWIA 5JRQA 3BU6A 2WXVA 5AP0A 1VYZA 1GOLA 4I4FA 1ZZ2A 3Q2JA 1U46A 2GHMA 2IJMA 1B39A 4YHJA 4PMSA 3UTOA 1VEBA 4X3FB 1W98A 4XG7A 4GVJA 3FQEA 1LEZA 2YM3A 1Z5MA 4D1ZA 1ZOEA 1PXNA 3PP1A 3MY0A 1CMKE 3V5JA 3NZ0A 4ZSJA 2XS0A 4MX9A 4EHZA 4EUUA 5IQDA 3QLFA 5DYJA 3SLSA 1QPEA 3GGFA 5DLSA 4S2ZA 4Z7GA 2C6IA 4Y5HA 4FSUA 4IAYA 3RALA 1JQHA 3CC6A 5CF4A 4TKSA 3QZGA 4NK9A 3R1SA 4AZEA 4DH3A 3LQ5A 3VC4A 5E90A 3KY2A 2BAJA 3KRJA 5K4JA 3D2KA 3SW7A 3LM5A 3O0GA 2JKMA 2W5BA 4DFLA 3R7UA 1DM2A 4YZCA 5CSHA 1SZMA 2W1EA 5C01A 4QMZA 5CAUA 4WT6A 1YVJA 3O7LB 3G51A 2HWPA 4CFMA 3KXHA 3PLSA 4UWYA 4KAOA 3GU4A 3R1NA 2G2FA 3MY1A 4XX9A 4X3JA 2XNMA 4AW0A 4XNEA 2YCQA 4M67A 4YTIA 4IADA 5AAFA 3WZUA 4FNXA 2F7EE 3ZXZA 4IC8A 5IISA 2X9EA 4BBFA 5E9EA 5EI2A 5E8YA 4RIXA 3VHKA 1P5EA 4FKOA 3DLSA 1SVHA 2PL0A 5CWZA 3QTXA 5GNKA 5EW8A 2WTCA 4AGDA 3AT4A 4JDJA 2XIZA 2I0HA 2ITYA 3OEZA 1SNUA 4DYMA 3DY7A 4EHEA 4PMTA 1WBVA 3QRJA 5AUVA 5KZ0A 3VF8A 4HCUA 2ETRA 4FV3A 4O2PA 3IONA 3NVKI 4FK3A 3I7CA 3UMWA 3HX4A 4OUCA 4ORKA 4U45A 5C26A 1XJDA 3SAYA 5HBJA 4BIEA 2OICA 1U59A 4CEGA 4ZS4A 4RIYA 4R1YA 4D2SA 4HNFA 3SDJA 4AW2A 2OF2A 3V5LA 2GPHA 5IZFA 4WG4A 4EH5A 1NVSA 4CT2A 3D7TA 3R2BA 4O0TA 5IEXA 5CSXA 4EWQA 5M55A 2BR1A 3HDNA 4YNEA 4ASDA 1OGUA 2XNBA 2R7BA 3RPSA 3UNJA 1H1RA 4A7CA 4K6ZA 3MYGA 4G3CA 5TF9A 4LL0A 4EOLA 2QOCA 4KBAA 4I6HA 4FV7A 3SGCA 1A06A 2OZOA 2JDRA 5IMEA 3U8WA 3SOAA 4BB4A 2VTTA 1FQ1B 4BCKA 4FSQA 2YEXA 4DEHA 3T8OA 4NH1A 3AT3A 2JC6A 2XP2A 4IB1A 1V1KA 4ZJVA 2CCIA 5K5NA 1UVRA 5C9CA 4ZLYA 3JS2A 4I5PA 4CCBA 1ZMWA 2OJGA 1OL6A 2ITXA 2YCRA 2VWBA 4PL3A 5CQWA 5JT2A 1XBAA 3Q4UA 2XM9A 1M17A 3Q3BA 4CKIA 1CM8A 3ZUVA 2VWYA 3A62A 2O5KA 4QTAA 1GIJA 3Q4TA 4E5WA 2O2UA 1IAJA 4GJ3A 4MBIA 4EH8A 5AUUA 1JKKA 3Q4ZA 4BDDA 2R3QA 2PVFA 5HG9A 2J51A 4BI0A 1KE7A 2CNVA 4RC3A 4XP2A 5FXQA 4HVGA 4FOBA 4QMUA 3GB2A 5IA1A 1GZNA 3T9TA 4NJ3A 3W33A 4EORA 5TO8A 1H4LA 3ANQA 4CVAA 2VO6A 2ONLC 1BLXA 4HVDA 4D4YA 5A6NA 1BL6A 4DEIA 4OLIA 3QTSA 4XG4A 3U9CA 3W0NA 2CKQA 3MH1A 5CYIA 5DN3A 4BBEA 1XBCA 3O17A 3DFAA 5ANJA 1OPLA 3R71A 4HYUA 4BDIA 1CKPA 2JITA 4FSWA 2Y4PA 3C4FA 2BKKA 2YAAA 3QL8A 4MXXA 4FA2A 4K18A 2F7XE 3AMAA 3DPKA 2GHLA 2IZSA 5IQHA 3FZRA 3W2CA 3OCTA 2R3JA 3ZDIA 2WD1A 4XV1A 3DBCA 5DI1A 3F3VA 3ZFMA 2XIRA 3F61A 3UIUA 1L8TA 4NWMA 4I4EA 3HZTA 5E8TA 3WIKA 3LW0A 4IC7A 2XIKA 4UWCA 1MUOA 3PE1A 4CFWA 4HGEA 5JZNA 4EZ7A 4FUYA 2C68A 4QP2A 3ZXTA 4G17A 3FL4A 4W4YA 3TZ8A 3C51A 3BELA 3Q96A 2J5EA 4PY1A 3T3UA 4FKQA 1Q99A 3P78A 3P86A 3SVVA 3FMKA 2AC3A 5IQAA 3VBXA 5HTBA 5B2LA 3ODZX 4AZWA 3ZONA 3O71A 4FKSA 3W0MA 2WAJA 5KKRC 3CQEA 3KN6A 4XJ0A 2JIVA 4FVPA 1YDRE 3GCPA 3LFAA 4YBJA 3RP9A 3HECA 4AG8A 4CRSA 2X39A 4G16A 1UA2A 3P5KA 4DT9A 4M8TA 2ZB1A 3TT0A 4YHFA 1PYXA 4FKRA 1H01A 3W0OA 2W96B 2WIHA 3EFKA 3GNIB 3TDWA 3UODA 1FMKA 2QOBA 4JRVA 4OBPA 4BDCA 2XEZA 3KU2A 5JFSA 4MXAA 3CXWA 5HCYA 3TNIA 3FUPA 4ZLZA 4Y72A 5JGDA 3W32A 4AA0A 4E26A 3VRYA 4QQ5A 2BRGA 1IR3A 5CS6A 1GZ8A 2VV9A 4ZTNA 4IMYA 5H8BA 4A9SA 4W4WA 5G1XA 3SQQA 4IFCA 1KUTA 3R1YA 3MDYA 4Q5HA 4HZSA 3VWAA 4QP7A 4H05A 5LMKC 2C5NA 5CU2A 4EYJA 4U80A 4A06A 4M97A 3I79A 3NIZA 3DTWA 2XJ1A 3CTQA 1ZZLA 3RHXA 3AGLA 3DBQA 2UW8A 3THBA 2J5FA 3FMJA 5IA3A 3FV8A 3PWYA 3TV7A 4ZSAA 2OJJA 3CP9A 3ORLA 5CVFA 2QO2A 4LMNA 4OTIA 3R9RA 5LMAA 3E87A 4XG2A 5CXHA 3KRWA 3CIKA 4ZZMA 4I92A 2WQEA 4QYHA 5KMOA 2UW7A 3IKAA 1PF8A 2GHGA 4DFZE 3FXXA 2J0KA 3V04A 4ERWA 3NUNA 3UBDA 5HNIX 4FTTA 2YERA 3KMWA 4IVAA 2BROA 4DT8A 2OU7A 2VTQA 3FMLA 2XNNA 4FEVA 3F5XA 3MIAA 4HYSA 4NCTA 5A54A 3RMFA 3SXFA 4GT5A 4YO6A 4ZS0A 1YXTA 5K9IA 4ASZA 2OJFE 3CY2A 2W5AA 3FMDA 3V3VA 3FZTA 3PIXA 3WZJA 2YHVA 4EOIA 2R3MA 2PVHA 5J7HA 3F82A 5KMIA 2P3GX 4AFJA 4FSTA 5FM2A 3EN9A 2F9GA 3GU5A 2PZIA 4K8AA 2QURA 2Y6OA 1WAKA 2X8EA 3JVSA 3LZBA 3ORNA 5E8VA 2YITA 5M57A 4FIIA 4FTKA 3CGFA 2LAVA 4YC6A 4C62A 3D94A 3QCYA 3ETAA 4U3ZA 4EOKA 1EH4A 2XK8A 3I0OA 1SVEA 3PJ2A 4ALUA 4C7TA 5KKRB 3LJ2A 5J1VA 3WF7A 3QC9A 4FKIA 4QNAA 4JJRA 5HGIA 3OFMA 5H2UA 4AA4A 4F6SA 3WYXA 1GIIA 5JZJA 1Y6AA 3H10A 3TTJA 3MPMA 4U7ZA 1OPKA 3EQGA 2PTKA 3ZZWA 1J7LA 3R7IA 2OLCA 4FV0A 3DAJA 4C34A 3R7OA 5HG5A 3LCDA 4H58A 5LMBA 5LMKA 2VTJA 5A4QA 1REKA 3FDNA 2BHHA 1UKHA 5AMNA 5I9UA 3UZPA 4E6AA 4JX3A 4Q5EA 2GTMA 2V7AA 3DFCB 2X8IA 3L8PA 4X2KA 3EFWA 4O7VA 3LE6A 3NUUA 4GT3A 2P2HA 4AP7A 3OROA 1FBNA 2VGOA 5AP3A 5BYYA 3EN7A 4UYNA 4ZZOA 5FXRA 2WTDA 2ZMCA 4Y73A 4ID7A 4GS6A 5BVKA 4PP7A 3RK7A 3EB0A 2WMQA 5CT7A 3ZC5A 4I21A 3LFFA 4RJ8A 3KF7A 5HIBA 1UWJA 4L3LA 4C58A 1PKGA 5EH0A 3NPCA 4QYFA 2ERZE 4PTGA 4U3YA 5AV2A 3HMIA 5IQGA 4UYAA 2UW3A 3TIYA 3LAUA 2RFSA 3TDVA 4UALA 4BTKA 4C4GA 3RK9A 3UVRA 2R3RA 4H3PA 3Q53A 2ZM1A 3PVWA 3BGZA 4YJTA 2NRYA 4JQ8A 4W4XA 1TQIA 2RF9A 3JY0A 5AP2A 5EQYA 3KXNA 3PVBA 4FSMA 4K2RA 5HE2A 5EK7A 3DQXA 3VO3A 4O27B 2IZUA 4LOQA 5D1JA 4C0TA 3VNTA 4U6RA 3ZS5A 4JBOA 5A4EA 1RQQA 5E8UA 3V8WA 1URWA 5JEBA 4XUFA 3RK5A 4NKAA 3QF9A 2R7IA 4JR3A 2O3PA 3ACKA 3EKKA 4YJOA 4KA3A 4BHZA 4DA5A 2JFLA 3FHIA 1E1XA 5KMLA 2J90A 2W1FA 3UNZA 5CNNA 3FI2A 4F63A 2YABA 4DFXE 1OL2A 1PKDA 1Q8TA 4XCUA 3FZ1A 4B99A 3HP2A 5KE0A 3TN8A 3R21A 4OW8A 2ESMA 3G9NA 4YC8A 4GCJA 4O91A 4MTAA 5AP1A 1M7NA 5E4HA 2GS7A 5C27A 3B8QA 4RIYB 5D12A 2BZJA 4QTDA 4G6OA 2EUFB 2PK9A 3VRZA 1L3RE 2R3KA 2E9PA 4HGTA 3V8TA 3ZRMA 4UX9A 2GNIA 3TV4A 5BPYA 3TL8A 1HCLA 2HXLA 3OP5A 4AUAA 3HV3A 2XCKA 4LRKA 3EQPA 3D5UA 2C6LA 4U97A 3VUIA 4LG4A 3OW4A 4J71A 3QTRA 3E62A 4JDHA 4O7NA 5IQIA 4XV9A 2IN6A 4I0RA 2BALA 2XKEA 3MFTA 5GJFA 1WBTA 4I94A 2XNGA 3UQFA 2R3LA 4K11A 4GIIA 4A07A 2WMVA 3ZLWA 5LJJA 1JSVA 3LIJA 2Z7SA 5AEPA 1NA7A 4AU8A 3ZUUA 3GVUA 5HIDA 4DITA 1QCFA 4Z16A 1PMNA 4X3FA 3HMNA 3Q04A 2XIXA 4RQKA 2R9SA 5KCVA 1FGKA 2BZIB 3W2PA 1WBWA 4RMZA 4IHPA 2HWOA 4CKRA 3QU0A 4DBNA 4UBAA 3NNUA 3RJCA 1XH9A 3NNVA 5HU3A 2YM4A 4YZDA 3S1HA 4MNFA 3DDQA 4AAAA 1ZOHA 2PE2A 4TN6A 3MN3A 1ZYJA 1W0XC 3PTGA 2JEDA 3MW1A 2QLQA 2RFEA 1WZYA 3E63A 5EYCA 2REIA 5M4CA 5BX0A 5L2WA 1I44A 2GFSA 4I5HA 5HCZA 5CSPA 4DAWA 3U6IA 2YAKA 3R02A 5LVPA 5M53A 1R0EA 4TPTA 2PZRA 3QCXA 2V62A 3K5VA 3NYVA 4ALWA 1YWNA 4FEQA 4O38A 3QX2A 4GFGA 4XP0A 1H07A 4IBMA 3NDMA 4ONAA 4BTJA 4YUQA 2AUHA 3DJ6A 1FGIA 5L3AA 2Z60A 2WMWA 3LQ3A 5EYMA 4O7TA 3P23A 4QMYA 5AX9A 4BYJA 2F4JA 4O7SA 4QP8A 4O7RA 4D5HA 5HTCA 1G8AA 3CR0A 1SVGA 3P7AA 4BC6A 3GP0A 4CFUA 2VWVA 4S32A 2HW7A 2CPKE 5DIAA 3AC1A 4H36A 5DPVA 2UW4A 2VTAA 2C3LA 2C5XA 2W1HA 2F2CB 3LFBA 4TW9A 4NM0A 2ETKA 1REJA 3DXQA 3JUHA 3ORKA 5ANDA 1PMUA 2JD5A 3NW7A 5AADA 4HGSA 2BTRA 4YHTA 3DZOA 1H0VA 2C1BA 4NYEA 5JMSA 3ZSHA 1ZLTA 3UO6A 3FSFA 3RCDA 3LJ1A 2XUUA 4UB7A 5I9XA 4ITJA 2UW0A 5AV0A 2DWBA 4L7FA 2YM7A 1Q8UA 5CSWA 3WF6A 4F6UA 4QMNA 3WBLA 1W7HA 4FBXA 4RX8A 4V01A 5JQ5A 5LVMA 4BCHA 3E3PA 4YO4A 1FVVA 3QTZA 4I6FA 5ANOA 3NS9A 3K3JA 3D15A 2XZSA 5AV4A 4HYIA 3Q9YA 2VNYA 4FI1A 3ZUTA 4K9YA 4YZBA 1QMZA 3UMXA 5FDXA 5IH6A 4EK5A 3PXKA 3TV6A 1Z57A 4YBKA 2P0CA 4U0IA 3RPYA 4EKLA 2UVZA 4GL9A 4EK8A 4EQUA 1OI9A 2CMWA 1OKZA 3GOKA 4FKPA 1CKJA 2A2AA 3QCSA 3N51A 3R9OA 2WTIA 5CEQA 3A7FA 1YI6A 4PTEA 4IQ6A 5ACKA 3POZA 3TZMA 4CXAA 4G2FA 4LGHA 2UZUE 2UVYA 3RAWA 5HESA 5D10A 2PMIA 1H26A 4FZDB 2J7TA 2RG5A 4KD1A 4YC3A 3R8MA 2GQSA 2R3HA 2Y7JA 5FEQA 4RVKA 2XKDA 4FL1A 5CEIA 2A27A 3QUDA 3CPCA 4RGJA 3SW4A 1H08A 3P1AA 2WMUA 2X0GA 3EL7A 2X81A 4DG3E 4EC9A 5IEYA 5BUEA 3UQCA 2UUEA 4QOXA 3A4OX 3F66A 4EC8A 3ZLYA 5K3YA 3UZRA 4JBVA 4IVBA 3OZ6A 4X6RA 5DOSA 3DKFA 3IW8A 5HLPA 4B8MA 5L6PA 4D5KA 5EDRA 3TG1A 3QGYA 3RAKA 2C6DA 3ZRLA 2YISA 4DGLC 5IA2A 5AP7A 3F7ZA 1KV2A 3VW8A 1TQPA 4L45A 5L8JA 2E9VA 4OTGA 3VVHA 3M1SA 1PMEA 1BI8A 3VUGA 4J7BA 3WOWA 5HEZA 3PZHA 1KV1A 1JKLA 3V6SA 3PFQA 3KULA 4YJNA 2HY81 4AFEA 2WOUA 1WFCA 3QQUA 4JG7A 4TTHB 4LFIA 2J4ZA 3WZEA 3Q9XA 4E4LA 5DH3A 4F9YA 3W0QA 3BU5A 4N6ZA 2C4GA 2BVAA 1OVEA 3MA3A 3TUDA 3DJ7A 3SOCA 5C1QB 3A7IA 3BHTA 1M14A 2W4KA 5DRBA 1U5RA 1Q8WA 4BYIA 4RC2A 2OH0E 3OWPA 4L43A 4AS0A 4DH1A 3GQIA 5C4LA 4I22A 4M0ZA 5J9YA 5L2IA 4QP1A 4RZVA 5BQ0A 4FG8A 4RIOA 4O0XA 5HE0A 2GFCA 3DAKA 2QR7A 4AZSA 1U54B 2OO8X 5JGAA 1BKXA 4JIAA 4F70A 3LLTA 4L6QA 4FTOA 5HVJA 2OF4A 5CEMA 4QYEA 4BR3A 3FAAA 3Q4CA 2I0VA 2QOQA 3UVPA 1JAMA 2JKOA 4U94A 3HUBA 1R39A 3CCNA 4F0GA 2B4SB 4QYGA 4QO9A 4BTMA 4YNOA 4E6DA 2HW6A 4LOPA 4UXQA 3LCSA 4O0VA 3CTJA 3BV2A 2Q0BA 2QOHA 2W1ZA 3DBEA 3CQWA 4CTCA 4GU9A 2UVXA 3L9MA 3KVXA 2UV2A 1J7UA 4D55A 2PVKA 4EYMA 1NVRA 1H0WA 4DCEA 5AUZA 5IQCA 1DAWA 2OG8A 5DRDA 5L6WL 2R3OA 3QWKA 5KX8A 3QD3A 3VULA 2YDKA 3KFAA 2V5QA 3JXWA 4MWHA 2X4ZA 4FTQA 2BAKA 4AGCA 5L2TA 2WU7A 4RWKA 2VO3A 3AC8A 1OMWA 2VN9A 3NUPA 5CLPA 3BEAA 3FLQA 2VTHA 2X7FA 3UO4A 4BHNA 3CGOA 1ZAOA 5C4KA 3ITZA 2J2IB 2EB3A 4ZAUA 3OG7A 3D7TB 2P2IA 1T45A 3R73A 1XH4A 5LWNA 4GW8A 3RI1A 2BCJA 3UIMA 5I9ZA 3B2WA 5FEEA 3RHKA 5JGBA 3IW6A 3OUKA 3R9DA 4MXCA 1DAYA 1ZARA 1CSNA 2PVMA 3EOCA 4WUNA 3UYSA 4IAIA 4L3PA 2VWUA 2VTSA 3FI8A 4ZTHA 3KREA 3EH9A 4R6VA 4XRJA 3V01A 2C6OA 5E8XA 5M4UA 4FTUA 1R3CA 5ANKA 3D4QA 2SRCA 3EZRA 3NNXA 4MVFA 4I6QA 4C59A 4D9TA 3QQFA 3LMGA 4X21A 4XOYA 5DR6A 4AN3A 2B1PA 1WVWA 3UOJA 2ZAZA 4L3JA 4UEUA 5CSVA 3RINA 3KXXA 2DYLA 3BHVA 3KB7A 4QMSA 3HAVA 5E8ZA 2X7GA 3BWFA 5A4TA 2C6MA 2OI4X 3RAHA 4ANMA 5CF8A 4XG6A 4NFNA 2KULA 4TYHB 1H25A 1UNHA 2PSQA 3QXOA 2VAGA 3GU6A 1UV5A 2OZAB 3FE3A 3GUBA 5HICA 4YJRA 2X6DA 2FSLX 2PVNA 4XH6A 4QQJA 2J0LA 3KXGA 4W8DA 4D4SA 3M2WA 3LCOA 1H28A 4FVRA 4QT1A 4A9RA 4NTTA 5CI6A 2G1TA 4ZZNA 4QMLA 3EL8A 3P4KA 3F5UA 4KKEA 3ZFYA 4O7WA 4CMUA 4P5QA 5M09A 1OKWA 1Q4LA 3HMOA 4FK6A 4IAZA 4CG9A 1LUFA 2FA2A 3RGFA 4JDKA 4FKGA 2A4LA 1O6LA 5AM7A 2OFUA 3EQDA 4TT7A 5I0BA 2E2BA 3GI3A 3EIDA 5CF6A 4XBUA 4RSSA 3RCJA 3Q6WA 2VO0A 1ZY5A 1OZ1A 3IS5A 1Y57A 5HG7A 5HVYA 2BRNA 4I41A 4HJOA 3FLYA 4ZTLA 5EKOA 1K2PA 1XBBA 3TUCA 1R78A 1JSTA 4BDBA 1DS5A 2OK1A 4YTHA 2RGPA 1W82A 2WU6A 4F08A 4O7LA 3P79A 2PE1A 3HMPA 3OW3A 4KS8A 3NYXA 4XOZA 1NT2A 4O0SA 3RNIA 4EZ3A 2OGVA 1OL1A 5CENA 4NW6A 5CAVA 3N4TA 5CU0A 4IFGA 3A2CA 4XLVA 3DGKA 4EOOA 5F1ZA 3MH2A 5CVGA 2WTVA 3ZSGA 3VS6A 3MTLA 2XK3A 4RVTA 3R0TA 3EQHA 4I1ZA 3QTWA 2HXQA 4DEEA 3FMNA 4BCNA 4YPSA 2XK7A 1GZKA 3QQLA 2PULA 4HOKA 3MGYA 3V5TA 3MFUA 4R7BA 4Y83A 1H00A 5CQUA 4ZSEA 4AT4A 2I7QA 2X2LA 3TKHA 4OT5A 4DHFA 2G01A 2QC6A 4OTDA 3FY2A 2FH9A 3I7BA 5IA4A 1Y8YA 1V0OA 2YIYA 2HY0A 3OCBA 4TZRA 5AV1A 3TNHA 3F3ZA 3TEIA 3AG9A 5JRSA 1NVQA 3BPRA 2B0QA 3A7JA 2QHMA 2O64A 4FSZA 4AE9A 5LCKA 4FTMA 2HZIA 1HCKA 3A61A 3QUEA 3F69A 1PXIA 4DTKA 4JR7A 3GENA 4CV9A 3WF8A 4D1XA 4WSYA 3UDBA 1OL7A 4LGGA 1OB3A 2OFVA 4DCAA 3D5VA 2WTWA 3NUXA 5CANA 4N57A 4AN2A 1E1VA 4ZOGA 2W0JA 3Q2MA 4QTBA 2GU8A 2CLQA 4ANBA 4F9AA 3MPTA 3IOKA 4KS7A 4O7YA 3UYTA 4USEA 3SD0A 3QTQA 3C4CA 4R3PA 4DTAA 4WBOA 3ZMMA 4YTFA 4NT4A 3Q9ZA 3QRUA 4PDYA 4XRLA 1RW8A 3VN9A 2YWVA 3AOXA 5EM6A 1TQMA 3V5QA 4FKWA 4AW1A 1YXSA 2GDOA 5HD7A 4RVMA 5AM6A 2KTYA 3F3TA 3AC5A 3UIXA 4RRVA 4RWLA 3TI1A 3BGPA 2EXCX 3KXZA 4JS8A 2R3GA 2XKFA 2YA9A 5BVWA 2BDFA 3CTHA 2UW5A 3QQGA 3TXOA 3W2OA 2XK9A 1FMOE 1H1PA 3W8LA 5HLWA 3BHUA 4EH4A 1NXKA 2WQMA 4GFOA 5FDPA 1CTPE 4Y95A 2QO9A 3P0MA 5AJQA 2UZNA 4X6QC 3O8PA 4F9WA 4U79A 1YKRA 3OEFX 4KSQA 3AD5A 1YHSA 4E4XA 3VQUA 3E5AA 3HRBA 2IVSA 3JR1A 4IZ5A 4TRLA 3RM7A 4FV1A 4E7WA 3QD0A 4CFVA 3W16A 1XR1A 5M4IA 5J87A 3C5IA 4F09A 4GUBA 3CLYA 4MNEB 2OIDA 4BCIA 4EK6A 2Q83A 3FWQA 4EOMA 4F9BA 1H8FA 3NUSA 4O83A 4FT0A 5CU4A 3H4JA 3E88A 3U51A 2VTIA 3OHTA 2CNQA 5AX3A 4EL9A 4FYNA 3WILA 4FOCA 4V0GA 2R3FA 1OIUA 1YWVA 2HENA 2VWXA 3MV5A 3D9VA 4GKHA 2FO0A 3NAXA 4QMVA 4CKJA 4CSVA 2Y6MA 5TKDA 4BZNA 4QP3A 3FI4A 3S00A 2G2HA 1KOBA 3FMEA 1T46A 3LXLA 3PPKA 4ASEA 2UW9A 5KZIA 3RPRA 1TKIA 4IEBA 5KHWA 2C3JA 3FLWA 3DOGA 3EQIA 1PXLA 2GCDA 2HIWA 2XVDA 5TOZA 2VD5A 5KUPA 4GYIA 3VS2A 5M08A 4ZXTA 4NM7A 3FMMA 1M52A 5CU3A 3GT8A 3W0PA 2ITZA 3VS4A 4FNWA 2B9IA 5J9ZA 3MS9A 4AZFA 4JNWA 2Q0NA 1JSUA 3WARA 4ASXA 5IH5A 4BDFA 2A1AB 5IU2A 2CDZA 2JBPA 2YDIA 3F9NA 4O86A 1UU7A 3R6XA 5I5ZA 5HD4A 5HO7A 3E3BX 2UZTA 3CD8A 2PUPA 4ZLOA 5IEVA 2ITVA 4U43A 5IMXA 3TZ7A 3OT8A 2R2PA 2B52A 3Q52A 5K4IA 3H9RA 3W0RA 3BYUA 3QZHA 2W9FB 3EJ1A 3QRKA 3VS0A 4AXAA 3SXSA 2JFMA 1OIQA 4XG9A 3C50A 3I5ZA 2OSCA 3NEWA 2OIQA 3DAEA 3QRIA 3U4UA 4KBCA 2R4BA 4E5BA 3C4WA 1PJKA 4MBLA 5BNJA 5FG8A 2XMYA 4MD8E 4YZMA 2BRHA 1XWSA 2E9OA 1XHAA 2VZ6A 2W1IA 3HKOA 5CZIA 5C8NA 3DK3A 3UOLA 3PPZA 4KIQA 5EW9A 5JK3A 3HV4A 3FZOA 4DE4A 1WVXA 3D83A 3DQWA 4AX8A 4O0RA 3LFSA 3LFDA 4U98A 3F5GA 2QKWB 3V6RA 3WI6A 4CLJA 5HIEA 2QOIA 4QTCA 1JOWB 4RZWA 1M2PA 3MB7A 4U40A 5KMJA 4IM3A 4R3CA 4TNBA 3ALNA 4AOTA 4KWPA 2BRBA 4IACA 4F65A 5EYDA 3F88A 3LXPA 3ZRKA 1GAGA 1P4OA 3RWPA 4ACCA 4FEWA 2X2KA 4IX5A 4TWCA 1UU9A 1YWRA 2BIYA 2C0TA 1XH8A 3IPHA 4W8EA 3UJGA 5B2KA 1OECA 3ZTXA 3GEQA 3DNDA 2DQ7X 1PW2A 3PXYA 3R83A 2NP8A 4EHVA 3ZC6A 4CZTA 2XH5A 2IW9A 4EH9A 5A4CA 2JAMA 4KBKA 4PUZA 3DU8A 4C3PA 4I5MA 4BI2A 3TWJA 4A4XA 4U44A 4D0WA 2PVJA 1V0BA 3ORZA 2ZDTA 2HYYA 4JDIA 4BZOA 3GU8A 2B53A 3VUKA 3LFCA 4BDHA 3C7QA 1R1WA 5CU6A 4GK2A 3D2IA 3UG1A 2CN8A 3Q6UA 4JIKA 5CEKA 2XK4A 3IG7A 3DXPA 3H9OA 3VUDA 4EBWA 3F3WA 2PZ5A 2CNUA 5E8WA 4EH2A 4RG0A 3SV0A 4QMQA 3S3IA 2YCFA 2NPQA 4BKJA 5T3QA 1F0QA 1FINA 4ZMEA 1OIYA 3DLZA 4C4EA 3MB6A 2PPQA 3PRFA 3R8ZA 2BKZA 2ERKA 3KXMA 4V0GB 4YPDA 3ULIA 3ENMA 3ORMA 3BE9A 4FR4A 4L44A 4FV8A 3KK8A 3EQFA 2BPMA 4YGAA 3BKBA 5KHXA 3FL5A 4O81A 4ZY5A 2ETMA 3LFNA 1ZRZA 4U81A 3H9FA 3E7VA 3C5UA 5CASA 4UN0C 4FX3A 4IZYA 4JQEA 3ZHPC 2PMOX 3FC1X 4E73A 4IX3A 4C02A 5J9LA 2GTNA 4HZRA 1JPAA 2YIRA 3DXNA 3TM0A 2BILB 2EU9A 4ITHA 4RJ6A 4RX5A 4IVCA 1IA9A 3FBVA 4FTLA 4IVDA 3LMIA 2GNJA 2VTRA 4BCGA 1VYWA 2QU5A 2F7ZE 4YJQA 4ZSGA 2E9NA 4CD0A 3FPQA 2OW3A 1K9AA 3FQSA 2VNWA 3MVLA 4BCJA 4JX7A 4FTIA 4MAOA 4QP4A 2AC5A 4X2NA 4IB3A 3COIA 3P08A 1XH7A 4IE9A 5F94A 3FI3A 3KF4A 4F7LA 2CGWA 4ZTMA 3A60A 3OY1A 3EFLA 4H3BA 3U9NA 4FMQA 1G3NA 4L46A 5GJDA 4RJ4A 4HW7A 2VWWA 2JKQA 4FZ6A 4APPA 1Q62A 2OKRA 1OM1A 1PRYA 3KMMA 4RFYA 1U54A 5AV3A 2O63A 3VBVA 3SRVA 3VF9A 4UXLA 4YTCA 2XK6A 3ZBFA 4EH7A 3U6HA 2PHKA 4LV8A 2J9MA 3L8SA 4TWPA 2YJSA 4L67A 4XHKB 4DG2E 1F3MC 4G1WA 4E1ZA 5DT4A 1BL7A 4H3QA 3BI6A 5B0XA 3A7GA 1U5QA 3BQCA 3DBFA 3NLBA 3NCGA 4JL9A 4FV6A 3ZO2A 4MXOA 3ORXA 1JKSA 4TYHA 3IECA 5CEPA 3VAPA 2QQ7A 3W18A 3LLAA 3IDCA 4DGMA 2P4IA 4G9CA 3TCPA 5BUJA 3P9JA 4G5PA 2VTNA 2PVYA 4UWBA 3QGWA 4C36A 3UZTA 5EG3A 3ZH8A 5GINE 4BDGA 2H8HA 4EK3A 1R0PA 5J5SA 4TNDA 3HRCA 5BMMA 1QPJA 1W8CA 3LJ0A 4C3RA 5BVOA 2QHNA 3L8VA 4XP3A 2RG6A 4B4LA 2C5OA 2FSMX 3C4EA 3Q60A 4FIEA 2YZAA 2ZB0A 2OH4A 3KCFA 4G9RA 4QMMA 4C2WA 3EQCA 2RFDA 2HAKA 3WF9A 2WB8A 2V7OA 4FT9A 4U9AA 4C35A 4IDTA 4X3FC 4AOIA 3REPA 4E93A 1YXVA 3DK6A 5DE2A 3LFQA 2X2MA 4PV0A 4QMOA 4DLIA 4U42A 1X8BA 5FD2A 2WMBA 4DFYA 4TYIA 3PVUA 4J52A 1A48A 2YM6A 4LMUA 3R8UA 3MPAA 5H9BA 3RVGA 3AGMA 5DG5A 4EI4A 3BRBA 1LR4A 3QKMA 1KOAA 3ROYA 3FY0A 4ZJJA 5FXSA 4CZUA 4O7OA 3COKA 4IANA 4EOPA 4JI9A 4MYGA 5IDPA 1ZYSA 2QONA 4MF1A 1XO2B 2PZYA 4XV2A 3Q9WA 3PJCA 3NX8A 1A9UA 1Y91A 5T68A 3PG1A 3ZEWA 3ACJA 2ZDUA 5HBHA 2HK5A 3KVWA 4YR8A 3C4XA 4L00A 5AAEA 2W1CA 2JBOA 2WGJA 4M12A 4BCQA 2ZM4A 5C8KA 2O65A 2CLXA 1GZOA 4IIRA 5ANEA 4HPUE 3G6HA 3UC3A 5IF1A 4BF2A 1UNLA 3MH0A 2EWAA 2QI8A 2XB7A 4X2FA 4FG7A 4EBVA 4B0GA 4L7SA 3F2AA 3UOHA 3R8LA 3ZO3A 2XA4A 1PXPA 4M84A 1RE8A 2C30A 3ULZA 1QPCA 4QRCA 3AD4A 3G6GA 4GV1A 3BCEA 3M42A 1JNKA 4PWNA 5H8GA 4D4RA 3C13A 3TJCA 1XH6A 3ZSIA 5F9EA 4DTBA 4MKCA 5E8SA 1AGWA 3ORIA 4N4SA 2YM5A 3KULB 2ZMDA 3S2PA 4LL5A 2X6EA 4PP9A 3WZKA 4G3DA 1P2AA 4FYOA 2W4OA 2XF0A 4I0TA 4O22A 5FTGA 3SHEA 1ZWSA 3TTIA 3BE2A 3ZLSA 4EH3A 3EWHA 2W05A 4QP9A 3LXNA 3OY3A 3HV6A 3L9LA 4BGQA 5CEOA 4FTRA 3CQUA 4D4VA 5LVNA 3NW6A 4IB0A 2ZV9A 4ACMA 2H6DA 5HE3A 4FIJA 4RLKA 4KSPA 4XG8A 1ERKA 4F64A 2QOLA 1GJOA 1YQJA 2YM8A 5M06A 5DBXA 4MBJA 4GRBA 3GCVA 4AACA 4FT3A 3L8XA 3B2TA 3MVJA 2IG7A 3PZEA 2VO7A 3EHAA 3UGCA 4CGAA 1STCE 2DUVA 5FTQA 5ETCA 4C33A 2GNLA 3UG2A 2YDJA 3O50A 3JVRA 3MTFA 4BZDA 3QZIA 3MJ1A 4YJSA 5EHYA 2ITTA 4RVLA 3D0EA 3C4ZA 3NAYA 3CPBA 3FC2A 4RFZA 4L52A 3WF5A 4DFBA 4FKJA 2QG7A 4OBOA 2PVRA 3OUNB 2PUIA 4CV8A 2ZV2A 2IVUA 2Z7LA 4Y46A 4Z9LA 4GH2A 4D2RA 3MI9A 4YZ9A 3WYYA 4EQCA 5L8KA 4WG3A 4F1TA 3W1FA 2B9JA 3GXLA 4JG6A 4MQ1A 4LUDA 4XV3A 5I9VA 5FEDA 5JFXA 5HNGA 1YDSE 2A0CX 1PXKA 3VW6A 3OCSA 4FL2A 3TKIA 4AT5A 2PVLA 3I4BA 4CNHA 3BHYA 4FT7A 3PSDA 1YOMA 4FV2A 4WHZA 4P90A 3WIGA 3KKVA 2WZJA 3PYYA 4IJPA 5D7AA 4M14A 4AZTA 2QOOA 2C5VA 1J1CA 1UKIA 2IWIA 2ZV8A 3NIEA 2C6KA 3FLSA 3OCGA 4QQCA 4DC2A 3B8RA 4DINA 1YHWA 2R0IA 2ITPA 3COMA 4FZFB 4GSBA 1LPUA 1IEPA 1FVRA 4GUEA 5FM3A 3TNQB 4JLCA 5L8LA 4EOSA 2BIKB 1JLUE 4WUAA 3HA6A 4YLKA 4PX6A 3GBZA 4IDVA 3PXZA 5CX9A 4HCTA 3DS6A 4OTQA 4L9IA 3W2RA 4JAIA 4QYYA 3VJNA 3ZEPA 3BEGA 4G34A 2QKRA 5F95A 3A7HA 1H1WA 2OBJA 2X8DA 2PU8A 3KN5A 4C4FA 3POOA 2W9ZB 5A3XA 3NW5A 2YN8A 1UNGA 4FSNA 4MEDA 3MA6A 4M68A 3VJOA 3V5WA 4F1OA 5ETFA 5FQDC 2YJRA 3K2LA 4GEOA 4HCVA 2GSFA 4GK4A 1FPUA 3SG9A 3VS5A 4OR5A 4X2GA 2WTKB 3O51A 2VU3A 2A19B 3UP7A 2QR8A 1WBOA 5FBNC 4TL0A 3UP2A 1HOWA 3OMVA 4YZNA 5CT0A 3BLRA 4WOVA 5EFQA 4EKKA 3TUBA 1UU8A 3QTUA 4FODA 3PJ1A 3OVVA 1QPDA 2E9UA 2R5TA 3LVPA 3U4WA 4EWHA 1URCA 5IUGA 2CGUA 4Q2AA 3FEGA 4GK3A 5D41A 2GNGA 1OBGA 2ITNA 2PMNX 2VTPA 5CNOA 2CGVA 4I3ZA 1JKTA 1VR2A 4ZP5A 3S0OA 3PJ8A 3HP5A 4DEAA 1F5QA 4TY1A 3W8QA 4ZEGA 4X7QA 3I60A 4GT4A 4NTSA 3NSZA 4CTBA 3BLQA 1RJBA 2BTSA 3QXPA 4EHGA 3FLZA 4PF4A 4OGRA 3II5A 2JDOA 3EKNA 3E8CA 1G5SA 5BVFA 3BQRA 3U6JA 2QD9A 4DF3A 5CZHA 4DGNA 2BFXA 4L01A 3UOKA 2J0MB 3HUCA 4YJUA 3RZBA 4GU6A 3VS7A 1OITA 4F1MA 5FUTA 2C6EA 3GOPA 4A9YA 1ZXEA 3DKCA 3KRLA 5HO8A 5ACBC 3EN6A 1AD5A 3CS9A 3L1SA 4ZSLA 5C03A 4NCTC 1UWHA 2H96A 3O8UA 3D5XA 3AMYA 3K3IA 4J53A 2CJMA 3DKGA 2WQNA 3LHJA 3T3VA 5DR2A 5DEYA 2W4JA 4UV0A 1Q41A 4IAAA 2XBJA 5EM7A 4JVGA 2WTJA 2EB2A 5EOLA 3G5DA 2ZOQA 3MH3A 4PL4A 2NRUA 2QOFA 4BI1A 3OXIA 4E5AX 2J6MA 3EQBA 5CAOA 4BTFA 1ZYCA 3QYZA 3QZFA 3FKNA 5I9WA 3PJ3A 2BMCA 2BRMA 4ENXA 2FSTX 3HV5A 4V05A 5DVRA 4W4VA 4JXFA 1P14A 2OXXA 3OBGA 4BCFA 2W5HA 3RWQA 2XIYA 3BLHA 3QD2B 3CE3A 4JOAA 4OTWA 4P2KA 1XH5A 3A4PA 4TYGA 4LV5A 2Y4IC 4ZK5A 3E64A 2GNFA 2IVTA 4LUEA 4E8AA 3GQLA 3VBQA 4GMYA 3MFRA 4Y85A 2BDWA 3QA8A 2JDVA 2W1GA 4YJVA 5EHLA 3OF0A 5CVHA 2VTLA 5JQ8A 1M2RA 3CBLA 4MQ2A 4AGWA 2QO7A 5M51A 3MJ2A 4L42A 4O2ZA 1J7IA 1E9HA 3ALOA 2WQBA 3QKKA 4R7HA 3PPJA 4RIXB 4D28A 3R28A 4BRXA 4NL0A 3DTCA 2PYWA 2WKMA 3DB8A 4YU2A 3LOKA 3E8EA 2ITOA 3A8XA 3QRTA 5F4NA 1Y6BA 5CALA 3HRFA 3PXRA 2RIOA 2FUMA 3E8NA 2WPAA 3QHRA 2PUUA 2W99B 4Z3VA 2ACXA 4DH8A 4DEGA 3MSSA 3C0IA 5DR9A 4YLLA 1CDKA 5FP6A 2WO6A 5BVEA 3U54A 4RLLA 1B6CB 3LPBA 3N9XA 4RC4A 5CAPA 3OWKA 4C61A 5J95A 2WFYA 3ZBXA 2ITUA 2JLDA 3BV3A 4G6LA 5H3QA 1OKYA 4B7TA 4XLIA 5HVKA 2BZHB 2WTKC 2WELA 2XYNA 2UW6A 4G6NA 3R8PA 4QMPA 3FZPA 3AD6A 2UZWE 4YP8A 4P4CA 4MWIA 3VBWA 3COHA 4BGHA 2CHLA 5DWRA 4J96A 3QYWA 2XCHA 4IZ7A 3VHEA 4JQ7A 4UZHA 5IUIA 3UNKA 4LI5A 3WE4A 5A4LA 3VBTA 3EQRA 4AGUA 4BVUA 1PYEA 3ORTA 4J1RA 4GVAA 4FKLA 4B8LA 4NZWB 2OJIA 3IGGA 3DBDA 4IX6A 4O21A 3QAME 4EQMA 5M56A 2RL5A 4J95A 5BVDA 5LOHA 2IVVA 3D7ZA 3MY5A 4LRJA 4APCA 1YOLA 5DT0A 3OXTA 3R01A 2XRUA 4HYHA 4PTCA 4ZY6A 4QPAA 3IGOA 3R30A 1KE8A 4DH5A 4JG8A 4NSTA 3VUHA 4O0UA 4IWPA 3ZDUA 2YFXA 2X9FA 2R3IA 4NKSA 3FSKA 1ZYDA 2IZRA 4QMWA 4FKUA 3BYOA 5CXZA 3WE8A 3BYVA 4J8NA 4GKIA 1WBNA 1IAHA 4M13A 3MIYA 2XRWA 4A4LA 4TYEA 3VQHA 2J0IA 4GIHA 4O0YA 3UPXA 3W2SA 3K5UA 3TNWA 4CFNA 4OTRA 4G3GA 3GCSA 4OT6A 5EI8A 4EONA 5HLNA 2FGIA 3O8TA 5BMSA 3MWUA 3MBLA 2BUJA 4DFUA 4WNKA 5EQEA 2Z7RA 4EOJA 5AA8A 2W17A 2H9VA 1H24A 1SM2A 3BWJA 3BZ3A 3KK9A 4M69B 5EDPA 4E4NA 4TYJA 2ZVAA 4PNIA 2YACA 3JPVA 4BBMA 1V0PA 3LMHA 1VJYA 3BYSA 3FQHA 4ZTSA 2HZ0A 4FTCA 2WNTA 4GG5A 4NM3A 5AUTA 3KRXA 3G33A 1MRVA 3OTUA 4J99A 3TNPC 3F5PA 4K1BA 3PIZA 4O7PA 1GNGA 1WVYA 3ZYAA 4IWDA 1Q24A 4NJDA 4CFFA 4HVSA 2PWLA 2PMLX 4ACHA 5KMKA 3FZSA 3PY0A 3LKMA 5AIRA 5LQFA 5DNRA 3VIDA 1GY3A 4FTAA 4CCUA 2WMXA 4XMOA 2JDTA 4WG5A 4KB8A 3RTPA 3SKCA 4U41A 4GJ2A 1P4FA 3DV3A 4DEBA 3QQHA 2EVAA 4XYFA 1PXOA 1J91A 3PG3A 2WEVA 2JGZA 4RWJA 3FHRA 1YXUA 1KE9A 2I0EA 4RA4A 4MK0A 2C5YA 4P5ZA 3GC0A 4X0MA 3RPOA 2DS1A 2B55A 3O2MA 4C4HA 1O6KA 2C0IA 4II5A 4F7JA 5EKNA 3E7OA 5HG8A 4KRDA 3NUAA 4RA5A 2X4FA 4CMTA 3AC2A 1S9IA 3I6WA 4MH7A 4QP6A 2VX3A 4Y8DA 2XNPA 5IQFA 3R22A 3QFVA 4TXCA 3AT2A 4C2VA 3G9LX 4HVIA 4FTNA 4AT3A 3HA8A 4NW5A 4NU1A 5KMMA 1MP8A 4FVQA 3MVMA 5BYLA 1H27A 5HHWA 2C1AA 4BICA 2JAVA 4BDKA 1LEWA 4E4MA 2FB8A 4XBRA 4OTFA 3ZOSA 3VBYA 2ZJWA 4LQMA 2ONLA 4BIBA 4DGOA 2AYPA 4L53A 4RJ7A 3BU3A 5C8MA 4ZIMA 5A9UA 3AC3A 5B7VA 2XEYA 3G0EA 3IO7A 2XKCA 2HZ4A 3OWLA 5GIOE 4R5SA 2R3PA 3NYNA 5EM8A 4BCPA 3C9WA 5AP6A 2C6TA 2QVSE 5EQPA 3G2FA 2F2UA 3NYOA 1CKIA 4FSYA 4HPTE 4ERKA 1IA8A 5E91A 4Z55A 3ZO4A 4LRMA 4FTJA 2UZOA 4CT1A 4MNEA 3GFEA 3AXWA 5HNBA 4DGGA 5HZNA 4Y5QA 3PA5A 3W0SA 2ITQA 1AQ1A 1XQZA 3R63A 5EHOA 5E92A 2B7AA 4RPVA 2P33A 1KWPA 2XNEA 5CAQA 3GFWA 4IAKA 3QQKA 3K54A 1IG1A 3AQVA 2UZBA 3KRRA 1OPJA 2QCSA 3QTIA 4O96A 5BUIA 5HQ0A 3DCVA 4G3FA 3QX4A 4KKGA 2O0UA 3KA0A 1K3AA 3HEGA 4ACDA 2IZTA 4AZVA 2V0DA 5AA9A 3I0QA 3GC7A 3LCTA 1Q3DA 3QCQA 5AUYA 3KEXA 1Q8YA 3OC1A 3PE2A 1PHKA 4G31A 1B38A 5ETAA 4ENYA 3C0GA 4BDJA 4IX4A 3MESA 4ZTRA 3LQ8A 3FMHA 1Q61A 3HGKA 5JFWA 5AUXA 1NW1A 4AA5A 2OJ9A 2OWBA 2C69A 2VTOA 2F57A 4CRLA 4F9CA 5IUHA 4G3EA 4I20A 4ANSA 3PLAE 3OD6X 4O0WA 3PIYA 3DJ5A 5KBRA 2QG5A 5TR6A 3EZVA 4RBLA 1W84A 4RJ5A 5E1SA 4FKVA 1MRYA 1UU3A 4S34A 3BYMA 3A99A 2NNWB 3GC9A 5L6OA 3KMUA 3HAMA 4O82A 1IRKA 3R00A 4CLIA 4S33A 5IG1A 3L9NA 3WZDA 3IDBA 4DLJA 5ANIA
chains in the Genus database with same CATH superfamily
1ZOGA 2BZKB 5FRIA 4DBXA 4PQNA 1NY3A 2XYUA 3KCKA 2PUNA 3QLGA 4RT7A 3VUMA 4C37A 4EK4A 2NO3A 5FLFA 5G6VA 4ZY4A 4FIHA 3CSVA 4U8ZA 5JN2A 2XJ2A 3EN4A 4IB5A 3UPZA 4NFMA 5IA5A 4S30A 1H1QA 3TKUA 5B2MA 1BYGA 3PSBA 1WBPA 2FYSA 3E93A 3ERKA 5AIKA 5EW3A 5I9YA 5F20A 4GFMA 4QMXA 2ZYBA 2OXDA 3OT3A 4R5YA 2IO6A 2UZDA 5ANGA 4MCVA 3PVGA 2V22A 3QQJA 2G15A 4FV5A 4QQTA 3VS1A 1OIRA 4BY9E 3TJDA 4JBPA 4YSJA 4QPSA 1PMVA 4D0XA 3H30A 2RKUA 4S31A 5DA3A 1G8SA 5AP5A 3ZCLA 4FNYA 4KRCA 3F2RA 2PZPA 4F4PA 3FLNC 4IAFA 4DH7A 2HCKA 3HDMA 3P7CA 4BGGA 4ZJIA 4AQCA 4CMOA 3H0YA 2WMSA 2G9XA 2JKKA 3CD3A 4BCMA 2HELA 4YSMA 3D5WA 5ETIA 2XJ0A 5HI2A 1WBSA 3MVHA 4FUXA 4JRNA 3RAIA 5EI6A 3QHWA 1YDTE 3TYKA 4A9TA 3IDPA 5BVNA 3KGAA 4H1JA 2VX0A 1FOTA 2GQGA 1OKVA 1Z9XA 4WD5A 1OUKA 4EOQA 2EXMA 1TVOA 4FZ7A 2HZNA 4KIPA 4AF3A 4EH6A 4F7SA 5IH4A 3ENHA 3PWDA 1PXJA 4R3RA 2QU6A 4JT3A 4YLJA 5HX6A 5HCXA 4FKTA 4FZAB 3T9IA 5AWMA 4M15A 4PMPA 5J1WA 2H34A 4F7NA 5D11A 4D1SA 4EUTA 3C1XA 5A14A 4N70A 1ATPE 3N4UA 4OBQA 3NRMA 3IOPA 4FEXA 4J97A 3TZ9A 2WIPA 4CQEA 4M3QA 2QODA 3PSCA 4IZAA 1OBDA 2I1MA 1DI8A 1MQ4A 3DT1A 3BX5A 4PL5A 3R7EA 3QWJA 5D7VA 5HX8A 3QALE 3O96A 2VX1A 4FT5A 3UIBA 2G2IA 1BI7A 4IJ9A 3BBTB 4DEDA 3ID6C 4XS2A 4RQVA 4M0YA 2VRXA 4OTHA 2Y8OA 3S95A 3DKOA 1Y8GA 1SMHA 5GJGA 3ZM4A 5IA0A 2QLUA 5TT7A 5CTPA 3QKLA 3UDTA 2QNJA 3DNEA 2B9FA 2ZV7A 3NVMB 4MXZA 4FEUA 5I4NA 2JIIA 3NWWA 5AUWA 3IW7A 4WNMA 3R8VA 2Z8CA 2LGCA 2PY3A 3Q5ZA 3KL8A 4ZTQA 2W1DA 4KUJA 3ODYX 3ORPA 2WMAA 2I0YA 5HE1A 5KO1A 4IH8A 3AC4A 3RKBA 2UZVA 4ALVA 1Q97A 2O8YA 2YWPA 4RFMA 3G0FA 5T6KA 3UVQA 1YW2A 4PRJA 2AEGA 3ELJA 4AOJA 3ATTA 3NMUF 1OUYA 1VZOA 2WMRA 4MD7E 4O6LA 3NR9A 1WMKA 3OTVA 3I5NA 4JAJA 4C38A 1YXXA 5JKGA 3LM0A 3SXRA 5FGKA 3G90X 3FKOA 4Q9SA 1M7QA 5AAGA 5HU9A 1U4DA 5DT3A 4AE6A 2WEIA 1O6YA 3FXWA 4WNPA 5DGZA 3D14A 4J98A 1JWHA 4NIFB 4U5JA 2C47A 4ANLA 2C3KA 3RM6A 5IQEA 3DDPA 1PXMA 3Q32A 4KINA 2IW6A 4N0SA 3HV7A 4V04A 3R9HA 4CG8A 4F0IA 3SA0A 3UC4A 3O23A 5M44A 3W55A 5LVOA 1XKKA 2JDSA 4R77A 4E20A 3IK3A 4N6YA 2R3NA 4ITIA 3OS3A 2C0OA 3FJQE 3I81A 3PUPA 3HLLA 4USFA 1BUHA 3F2NA 3NFGB 5BYZA 3U55A 3JY9A 2X7OA 4I0SA 5ITAA 4C4IA 3QD4A 4TWNA 2CKPA 3OOMA 5LWMA 4RJ3A 3PXQA 2OIBA 3BHHA 3CY3A 3BIZA 4F0FA 2UZLA 4ACGA 3G15A 3I6UA 4ARKA 4FGBA 3Q5IA 5LARA 4DDGA 5LCJA 4I6BA 4I93A 3MFSA 3FYKX 3KQ7A 2YIXA 5HKMA 4A9UA 4QTEA 3JYAA 3C0HA 4PDOA 5H8EA 3W10A 4CFXA 3EYGA 4WO5A 2R64A 4AN9A 5IPJA 3RPVA 3UQGA 2VGPA 4YMJA 3DZQA 3H0ZA 4C4JA 5FTOA 4PDSA 1MQBA 4ANQA 4YURA 5CY3A 1S9JA 2VUWA 1SNXA 2V55A 4BDAA 5KBQA 2B54A 2VWZA 3H3CA 5K5XA 2B9HA 3EMGA 4PMMA 4RIWB 4BDEA 4JBQA 3ZM9A 4FL3A 5L2SA 4LV7A 4DG0E 2GS6A 2WMTA 5LXMA 1Q3WA 1MRUA 2OZAA 3OWJA 4KKHA 4E6QA 5AFVA 3DB6A 4L8MA 3U87A 3L9PA 5EOBA 3BGQA 2J50A 4FG9A 1J3HA 4B6LA 4WBBB 4WIHA 3PRIA 3R7VA 4A4OA 2XNOA 3FKLA 4M7IA 4DFNA 3QBNA 2XBAA 4Q9ZA 2QOKA 2GQRA 2I40A 3DA6A 5CI7A 1ND4A 4NUSA 4MXYA 1GIHA 5DEWA 1LP4A 3O5AA 4I24A 3QC4A 2YIWA 1KE6A 2CN5A 4F99A 4IWQA 4MHAA 3R9NA 1KSWA 4NM5A 4WNOA 5JFVA 4KNBA 4I5CA 3NCZA 4I23A 3V8SA 2GMXA 4LYNA 1YOJA 5M4FA 3CKWA 1YRPA 2X1NA 4HNIA 4LM5A 5D9HA 4Z7HA 2VTMA 5IDNA 5E7RA 3ATSA 5GHVA 4K0YA 3A8WA 3VS3A 4H1MA 3N4VA 3FYJX 2F49A 3AMBA 1Q5KA 2RFNA 2YCSA 4XG3A 5EM5A 5IQBA 3FXZA 5JSMA 3R1QA 1O9UA 3TIZA 4RX7A 3ROCA 5DHJA 3R04A 4F6WA 2BHEA 4J8MA 3NGAA 3EYHA 4IM0A 3S4QA 4RX9A 4BN1A 3PP0A 3CJFA 3P7BA 1DI9A 4AW5A 4FE2A 2J0JA 4FSRA 2VWIA 2OXYA 2JIUA 3ZO1A 1I09A 4BIDA 4MD9E 4O6EA 3GCQA 3PY1A 2R0UA 4FV4A 3E92A 3EFJA 3PDTA 4KIOA 3HNGA 4IWOA 4LOOA 3ZLXA 4UY9A 5ICPA 5KMNA 4EJNA 1ZMUA 1ZMVA 4ZMFA 3HL7A 1J1BA 2Z7QA 2Z02A 3DK7A 2ITWA 3LFEA 1BMKA 1FVTA 3QA0A 4YJPA 2YIQA 5FBOA 4B9DA 1YI4A 3F7WA 1H1SA 2BAQA 3GU7A 2FSOX 3PY3A 5EDQA 3R7YA 5HBEA 5KNJA 4GG7A 4FIFA 3V51A 4WKQA 1JVPP 4P7EA 4FC0A 2I6LA 4BCOA 4HVHA 4EEVA 3ZU7A 4RIWA 4UZDA 5M07A 4K77A 3SC1A 5J8IA 2BFYA 4E6CA 2Y9QA 2FVDA 4QNYA 4USDA 4PDPA 2C3IB 1IASA 3LCKA 3BL7A 1W83A 3NUYA 3QUPA 4K33A 4G5JA 4R78A 1RDQE 4IW0A 2CSNA 4WRSA 3ET7A 2HOGA 4WRGA 3E8DA 3UE4A 3BBWA 5GIPE 4DN5A 4FICA 2WOTA 4D58A 2BDJA 4L68A 3R2YA 4C3FA 4GYGA 2Y0AA 1M2QA 3HYHA 4FV9A 3CEKA 2IPXA 3IW5A 3PA3A 3KC3A 4IM2A 3TACA 5DFPA 3IQ7A 3I1AA 3P5JC 4FGRA 1WCCA 5AP4A 3GCUA 1BX6A 1APME 3F3UA 4EJ7A 4FIGA 4PNKA 2IW8A 3HVCA 1PY5A 2W7XA 2CKEA 4TWOA 3GC8A 4KABA 4X2JA 5FP5A 4WA9A 3SG8A 4O84A 3PA4A 1OL5A 2CGXA 5EYKA 5E1EA 5JH6A 4R1VA 2W06A 2YZLA 3W2QA 5CF5A 2UZEA 4QMTA 4WZYA 5HORA 2WQOA 4O7ZA 5LVLA 3ZZEA 1Q8ZA 1YHVA 3V5PA 2CCHA 5A46A 3CJGA 2GNHA 2Z2WA 3NNWA 1ZY4A 2GS2A 3SX9A 3OOGA 3RNYA 2PE0A 3O7LD 3UO5A 1QL6A 4FNZA 4AWIA 3OBJA 2Y4IB 2CKOA 3CKXA 3LXKA 4H39A 3ANRA 3FPMA 5A6OA 3ZFXA 3HMMA 3M11A 3OXZA 4HGLA 4R7IA 3SRVB 3EN5A 2P55A 3F6XA 2XM8A 4XEYA 4EZ5A 3IW4A 4D9UA 1KE5A 1JBPE 1YI3A 3PXFA 1SYKA 2WHBA 2ZM3A 4RWIA 5JRQA 3BU6A 2WXVA 5AP0A 1VYZA 1GOLA 4I4FA 1ZZ2A 3Q2JA 1U46A 2GHMA 2IJMA 1B39A 4YHJA 4PMSA 3UTOA 1VEBA 4X3FB 1W98A 4XG7A 4GVJA 3FQEA 1LEZA 2YM3A 1Z5MA 4D1ZA 1ZOEA 1PXNA 3UDSA 3PP1A 3MY0A 1CMKE 3V5JA 3NZ0A 4ZSJA 2XS0A 4MX9A 4EHZA 4EUUA 5IQDA 3QLFA 5DYJA 3SLSA 1QPEA 3GGFA 5DLSA 4S2ZA 4Z7GA 2C6IA 4Y5HA 4FSUA 4IAYA 3RALA 1JQHA 3CC6A 5CF4A 4TKSA 3QZGA 4NK9A 3R1SA 4AZEA 4DH3A 3LQ5A 3VC4A 5E90A 3KY2A 2BAJA 3KRJA 5K4JA 3D2KA 3SW7A 3LM5A 3O0GA 2JKMA 2W5BA 4DFLA 3R7UA 1DM2A 4YZCA 5CSHA 1SZMA 2W1EA 5C01A 4QMZA 5CAUA 4WT6A 1YVJA 3O7LB 3G51A 2HWPA 4CFMA 3KXHA 3PLSA 4UWYA 4KAOA 3GU4A 3R1NA 2G2FA 3MY1A 4XX9A 4X3JA 2XNMA 4AW0A 4XNEA 2YCQA 4M67A 4YTIA 4IADA 5AAFA 3WZUA 4FNXA 2F7EE 3ZXZA 4IC8A 5IISA 2X9EA 4BBFA 5E9EA 5EI2A 5E8YA 4RIXA 3VHKA 1P5EA 4FKOA 3DLSA 1SVHA 2PL0A 5CWZA 3QTXA 5GNKA 5EW8A 2WTCA 4AGDA 3AT4A 4JDJA 2XIZA 2I0HA 2ITYA 3OEZA 1SNUA 4DYMA 3DY7A 4EHEA 4PMTA 1WBVA 3QRJA 5AUVA 5KZ0A 3VF8A 4HCUA 2ETRA 4FV3A 4O2PA 3IONA 3NVKI 4FK3A 3I7CA 3UMWA 3HX4A 4OUCA 4ORKA 4U45A 5C26A 1XJDA 3SAYA 5HBJA 4BIEA 2OICA 1U59A 4CEGA 4ZS4A 4RIYA 4R1YA 4D2SA 4HNFA 3SDJA 4AW2A 2OF2A 3V5LA 2GPHA 5IZFA 4WG4A 4EH5A 1NVSA 4CT2A 3D7TA 3R2BA 4O0TA 5IEXA 5CSXA 4EWQA 5M55A 2BR1A 3HDNA 4YNEA 4ASDA 1OGUA 4FJVA 2XNBA 2R7BA 3RPSA 3UNJA 1H1RA 4A7CA 4K6ZA 3MYGA 4G3CA 5TF9A 4LL0A 4EOLA 2QOCA 4KBAA 4I6HA 4FV7A 3SGCA 1A06A 2OZOA 2JDRA 5IMEA 3U8WA 3SOAA 4BB4A 2VTTA 1FQ1B 4BCKA 4FSQA 2YEXA 4DEHA 3T8OA 4NH1A 3AT3A 2JC6A 2XP2A 4IB1A 1V1KA 4ZJVA 2CCIA 5K5NA 1UVRA 5C9CA 4ZLYA 3JS2A 4I5PA 4CCBA 1ZMWA 2OJGA 1OL6A 2ITXA 2YCRA 2VWBA 4PL3A 5CQWA 5JT2A 1XBAA 3Q4UA 2XM9A 1M17A 3Q3BA 4CKIA 1CM8A 3ZUVA 2VWYA 3A62A 2O5KA 4QTAA 1GIJA 3Q4TA 4E5WA 2O2UA 1IAJA 4GJ3A 4MBIA 4EH8A 5AUUA 1JKKA 3Q4ZA 4BDDA 2R3QA 2PVFA 5HG9A 2J51A 4BI0A 1KE7A 2CNVA 4RC3A 4XP2A 5FXQA 4HVGA 4FOBA 4QMUA 3GB2A 5IA1A 1GZNA 3T9TA 4NJ3A 3W33A 4EORA 5TO8A 1H4LA 3ANQA 4CVAA 2VO6A 2ONLC 1BLXA 4HVDA 4D4YA 5A6NA 1BL6A 4DEIA 4OLIA 3QTSA 4XG4A 3U9CA 3W0NA 2CKQA 3MH1A 5CYIA 5DN3A 4BBEA 1XBCA 3O17A 3DFAA 5ANJA 1OPLA 3R71A 4HYUA 4BDIA 1CKPA 2JITA 4FSWA 2Y4PA 3C4FA 2BKKA 2YAAA 3QL8A 4MXXA 4FA2A 4K18A 2F7XE 3AMAA 3DPKA 2GHLA 2IZSA 5IQHA 3FZRA 3W2CA 3OCTA 2R3JA 3ZDIA 2WD1A 3ML1A 4XV1A 3DBCA 5DI1A 3F3VA 3ZFMA 2XIRA 3F61A 3UIUA 1L8TA 4NWMA 4I4EA 3HZTA 5E8TA 3WIKA 3LW0A 4IC7A 2XIKA 4UWCA 1MUOA 3PE1A 4CFWA 4HGEA 5JZNA 4EZ7A 4FUYA 2C68A 4QP2A 3ZXTA 4G17A 3FL4A 4W4YA 3TZ8A 3C51A 3BELA 3Q96A 2J5EA 4PY1A 3T3UA 4FKQA 1Q99A 3P78A 3P86A 3SVVA 3FMKA 2AC3A 5IQAA 3VBXA 5HTBA 5B2LA 3ODZX 4AZWA 3ZONA 3O71A 4FKSA 3W0MA 2WAJA 5KKRC 3CQEA 3KN6A 4XJ0A 2JIVA 4FVPA 1YDRE 3GCPA 3LFAA 4YBJA 3RP9A 3HECA 4AG8A 4CRSA 2X39A 4G16A 1UA2A 3P5KA 4DT9A 4M8TA 2ZB1A 2XALA 3TT0A 4YHFA 1PYXA 4FKRA 1H01A 3W0OA 2W96B 2WIHA 3EFKA 3GNIB 3TDWA 3UODA 1FMKA 2QOBA 4JRVA 4OBPA 4BDCA 2XEZA 3KU2A 5JFSA 4MXAA 3CXWA 5HCYA 3TNIA 3FUPA 4ZLZA 4Y72A 5JGDA 3W32A 4AA0A 4E26A 3VRYA 4QQ5A 2BRGA 1IR3A 5CS6A 1GZ8A 2VV9A 4ZTNA 4IMYA 4QEBA 5H8BA 4A9SA 4W4WA 5G1XA 3SQQA 4IFCA 1KUTA 3R1YA 3MDYA 4Q5HA 4HZSA 3VWAA 4QP7A 4H05A 5LMKC 2C5NA 5CU2A 4EYJA 4U80A 4A06A 4M97A 3I79A 3NIZA 3DTWA 2XJ1A 3CTQA 1ZZLA 3RHXA 3AGLA 3DBQA 2UW8A 3THBA 2J5FA 3FMJA 5IA3A 3FV8A 3PWYA 4AAYA 3TV7A 4ZSAA 2OJJA 3CP9A 3ORLA 5CVFA 2QO2A 4LMNA 4OTIA 3R9RA 5LMAA 3E87A 4XG2A 5CXHA 3KRWA 3CIKA 4ZZMA 4I92A 2WQEA 4QYHA 5KMOA 2UW7A 3IKAA 1PF8A 2GHGA 4DFZE 3FXXA 2J0KA 3V04A 4ERWA 3NUNA 3UBDA 5HNIX 4FTTA 2YERA 3KMWA 4IVAA 2BROA 4LDTA 4DT8A 2OU7A 2VTQA 3FMLA 2XNNA 4FEVA 3F5XA 3MIAA 4HYSA 4NCTA 3VONA 5A54A 3RMFA 3SXFA 4GT5A 4YO6A 4ZS0A 1YXTA 5K9IA 4ASZA 2OJFE 3CY2A 2W5AA 3FMDA 3V3VA 3FZTA 3PIXA 3WZJA 2YHVA 1TFFA 2R3MA 4EOIA 2PVHA 5J7HA 3F82A 5KMIA 2P3GX 4AFJA 4FSTA 5FM2A 3EN9A 2F9GA 3GU5A 1OGYA 2PZIA 4K8AA 2QURA 2Y6OA 1WAKA 2X8EA 3JVSA 3LZBA 3ORNA 5E8VA 2YITA 5M57A 4FIIA 4FTKA 3CGFA 2LAVA 4YC6A 4C62A 3D94A 3QCYA 5BV3A 3ETAA 4U3ZA 4EOKA 1EH4A 2XK8A 3I0OA 1SVEA 3PJ2A 4ALUA 4C7TA 5KKRB 3LJ2A 5J1VA 3WF7A 3QC9A 4FKIA 4QNAA 4JJRA 5HGIA 3OFMA 5H2UA 4AA4A 4F6SA 3WYXA 1GIIA 5JZJA 1Y6AA 3H10A 3TTJA 3MPMA 4U7ZA 1OPKA 3EQGA 2PTKA 3ZZWA 1J7LA 3R7IA 2OLCA 4FV0A 3DAJA 4C34A 3R7OA 5HG5A 3LCDA 4H58A 5LMBA 5LMKA 2VTJA 5A4QA 1REKA 3FDNA 2BHHA 1UKHA 5AMNA 5I9UA 3UZPA 4E6AA 4JX3A 4Q5EA 2GTMA 2V7AA 3DFCB 2X8IA 3L8PA 4X2KA 3EFWA 4O7VA 3LE6A 3NUUA 4GT3A 2P2HA 4AP7A 3OROA 1FBNA 2VGOA 5AP3A 5BYYA 3EN7A 4UYNA 4ZZOA 5FXRA 2WTDA 2ZMCA 4Y73A 4ID7A 4GS6A 5BVKA 4PP7A 1G8KA 1ST4A 3EB0A 3RK7A 2WMQA 5CT7A 3NFFB 4I21A 3ZC5A 3LFFA 4RJ8A 2XANA 3KF7A 5HIBA 1UWJA 4L3LA 4AXDA 1PKGA 5EH0A 3NPCA 4C58A 4QYFA 2ERZE 4PTGA 4AXFA 4U3YA 5AV2A 3HMIA 5IQGA 4UYAA 2UW3A 3TIYA 3LAUA 2RFSA 3TDVA 4UALA 4BTKA 4C4GA 3RK9A 3UVRA 2R3RA 4H3PA 3Q53A 2ZM1A 3PVWA 3BGZA 4YJTA 2NRYA 4JQ8A 4W4XA 1TQIA 2RF9A 3JY0A 5AP2A 5EQYA 3KXNA 3PVBA 4FSMA 4K2RA 5HE2A 5EK7A 3DQXA 3VO3A 4O27B 2IZUA 4LOQA 5D1JA 4C0TA 3VNTA 4U6RA 3ZS5A 4JBOA 5A4EA 1RQQA 5E8UA 3V8WA 1URWA 5JEBA 4XUFA 3RK5A 4NKAA 3QF9A 2R7IA 4JR3A 2O3PA 3ACKA 3EKKA 4YJOA 4KA3A 4BHZA 4DA5A 2JFLA 3FHIA 1E1XA 5KMLA 2J90A 2W1FA 3UNZA 5CNNA 3FI2A 4F63A 2YABA 4DFXE 1OL2A 1PKDA 1Q8TA 4XCUA 3FZ1A 4B99A 3HP2A 5KE0A 3TN8A 3R21A 4OW8A 2ESMA 3G9NA 4YC8A 4GCJA 4O91A 4MTAA 5AP1A 1M7NA 5E4HA 2GS7A 5C27A 3B8QA 3BLAA 4RIYB 5D12A 2BZJA 4QTDA 4G6OA 2EUFB 2PK9A 3VRZA 1L3RE 2R3KA 2E9PA 4HGTA 3V8TA 3ZRMA 4UX9A 2GNIA 3TV4A 5BPYA 3TL8A 1HCLA 2HXLA 3OP5A 4AUAA 3HV3A 2XCKA 4LRKA 3EQPA 3D5UA 2C6LA 4U97A 3VUIA 4LG4A 3OW4A 4J71A 3QTRA 3E62A 4JDHA 4O7NA 5IQIA 4XV9A 2IN6A 4I0RA 2BALA 2XKEA 3MFTA 5GJFA 1WBTA 4I94A 2XNGA 3UQFA 2R3LA 4K11A 4GIIA 4A07A 2WMVA 3ZLWA 5LJJA 1JSVA 3LIJA 2Z7SA 5AEPA 1NA7A 4AU8A 3ZUUA 3GVUA 5HIDA 4DITA 1QCFA 4Z16A 1PMNA 4X3FA 3HMNA 3Q04A 2XIXA 4RQKA 2R9SA 5KCVA 1FGKA 2BZIB 3W2PA 1WBWA 4RMZA 4IHPA 2HWOA 4CKRA 3QU0A 4DBNA 4UBAA 3NNUA 3RJCA 1XH9A 3NNVA 5HU3A 2YM4A 4YZDA 3S1HA 4MNFA 3DDQA 4AAAA 1ZOHA 2PE2A 4TN6A 3MN3A 1ZYJA 1W0XC 3PTGA 2JEDA 3MW1A 2QLQA 2RFEA 1WZYA 3E63A 5EYCA 2REIA 5M4CA 5BX0A 5L2WA 1I44A 2GFSA 4I5HA 5HCZA 5CSPA 4DAWA 3U6IA 2YAKA 4F78A 3R02A 5LVPA 5M53A 1R0EA 4TPTA 2PZRA 3QCXA 2V62A 3K5VA 3NYVA 4ALWA 1YWNA 4FEQA 4O38A 3QX2A 4GFGA 4XP0A 1H07A 4IBMA 3NDMA 4AQKA 4ONAA 4BTJA 4YUQA 2AUHA 3DJ6A 1FGIA 5L3AA 2Z60A 2WMWA 3LQ3A 5EYMA 4O7TA 3P23A 4QMYA 5AX9A 4BYJA 2F4JA 4O7SA 4QP8A 4O7RA 4D5HA 5HTCA 1G8AA 3CR0A 1SVGA 3P7AA 4BC6A 3GP0A 4CFUA 2VWVA 4S32A 2HW7A 2CPKE 5DIAA 3AC1A 4H36A 5DPVA 2UW4A 2VTAA 2C3LA 2C5XA 2W1HA 2F2CB 3LFBA 4TW9A 4NM0A 2ETKA 1REJA 3DXQA 3JUHA 3ORKA 5ANDA 1PMUA 2JD5A 3NW7A 5AADA 4HGSA 2BTRA 4YHTA 3DZOA 1H0VA 2C1BA 4NYEA 5JMSA 3ZSHA 1ZLTA 3UO6A 3FSFA 3RCDA 3LJ1A 2XUUA 4UB7A 5I9XA 4ITJA 2UW0A 5AV0A 2DWBA 4L7FA 2YM7A 1Q8UA 5CSWA 3WF6A 4F6UA 4QMNA 3WBLA 1W7HA 4FBXA 4RX8A 4V01A 5JQ5A 5LVMA 4BCHA 3E3PA 4YO4A 1FVVA 3QTZA 4I6FA 5ANOA 3NS9A 3K3JA 3D15A 2XZSA 5AV4A 4HYIA 3Q9YA 2VNYA 4FI1A 3ZUTA 4K9YA 4YZBA 1QMZA 3UMXA 5FDXA 5IH6A 4EK5A 3PXKA 3TV6A 1Z57A 4YBKA 2P0CA 4U0IA 3RPYA 4EKLA 2UVZA 4GL9A 4EK8A 4EQUA 1OI9A 2CMWA 1OKZA 3GOKA 4FKPA 1CKJA 2A2AA 3QCSA 3N51A 3R9OA 2WTIA 5CEQA 3A7FA 1YI6A 4PTEA 4IQ6A 5ACKA 3POZA 3TZMA 4CXAA 4G2FA 4LGHA 2UZUE 2UVYA 3RAWA 5HESA 5D10A 2PMIA 1H26A 4FZDB 2J7TA 2RG5A 4KD1A 4YC3A 3R8MA 2GQSA 2R3HA 2Y7JA 5FEQA 4RVKA 2XKDA 4FL1A 5CEIA 2A27A 3QUDA 3CPCA 4RGJA 3SW4A 3UDZA 1H08A 3P1AA 2WMUA 2X0GA 3EL7A 2X81A 4DG3E 4EC9A 5IEYA 5BUEA 3UQCA 2UUEA 4QOXA 3A4OX 3F66A 4EC8A 3ZLYA 5K3YA 3UZRA 4JBVA 4IVBA 3OZ6A 4X6RA 5DOSA 3DKFA 3IW8A 5HLPA 4B8MA 5L6PA 4D5KA 5EDRA 3TG1A 3QGYA 3RAKA 2C6DA 3ZRLA 2YISA 4DGLC 5IA2A 5AP7A 3F7ZA 1KV2A 3VW8A 1TQPA 4L45A 5L8JA 2E9VA 4OTGA 3VVHA 3M1SA 1PMEA 1BI8A 3VUGA 4J7BA 3WOWA 5HEZA 3PZHA 1KV1A 1JKLA 3V6SA 3PFQA 3KULA 4YJNA 2HY81 4AFEA 2WOUA 1WFCA 3QQUA 4JG7A 4TTHB 4LFIA 2J4ZA 3WZEA 3Q9XA 4E4LA 5DH3A 3W0QA 4F9YA 3BU5A 4N6ZA 2C4GA 2BVAA 1OVEA 3MA3A 3TUDA 3DJ7A 3SOCA 5C1QB 3A7IA 3BHTA 1M14A 2W4KA 5DRBA 1U5RA 1Q8WA 4BYIA 4RC2A 2OH0E 3OWPA 4L43A 4AS0A 4DH1A 3GQIA 5C4LA 4I22A 4M0ZA 5J9YA 5L2IA 4QP1A 4RZVA 5BQ0A 4FG8A 4RIOA 4O0XA 5HE0A 2GFCA 3DAKA 2QR7A 4AZSA 1U54B 2OO8X 5JGAA 1BKXA 4JIAA 4F70A 3LLTA 4L6QA 4FTOA 5HVJA 2OF4A 5CEMA 4QYEA 4BR3A 3FAAA 3Q4CA 2I0VA 2QOQA 3UVPA 1JAMA 2JKOA 4U94A 3HUBA 1R39A 3CCNA 4F0GA 2B4SB 4QYGA 4QO9A 4BTMA 4QDEA 4YNOA 4E6DA 2HW6A 4LOPA 4UXQA 3LCSA 4O0VA 3CTJA 3BV2A 2Q0BA 2QOHA 2W1ZA 3DBEA 3CQWA 4CTCA 4GU9A 2UVXA 3L9MA 3KVXA 2UV2A 1J7UA 4D55A 2PVKA 4EYMA 1NVRA 1H0WA 4DCEA 5AUZA 5IQCA 1DAWA 2OG8A 5DRDA 5L6WL 2R3OA 3QWKA 5KX8A 3QD3A 3VULA 2YDKA 3KFAA 2V5QA 3JXWA 4MWHA 2X4ZA 4FTQA 1VLRA 2BAKA 4AGCA 5L2TA 2WU7A 4RWKA 2VO3A 3AC8A 1OMWA 2VN9A 3NUPA 5CLPA 3BEAA 3FLQA 2VTHA 2X7FA 3UO4A 4BHNA 3CGOA 1ZAOA 5C4KA 3ITZA 2J2IB 2EB3A 4ZAUA 3OG7A 3D7TB 2P2IA 1T45A 3R73A 1XH4A 5LWNA 4GW8A 3RI1A 2BCJA 3UIMA 5I9ZA 3B2WA 5FEEA 3RHKA 5JGBA 3IW6A 3OUKA 3R9DA 4MXCA 1DAYA 1ZARA 1CSNA 2PVMA 3EOCA 4WUNA 3UYSA 4IAIA 4L3PA 2VWUA 2VTSA 3FI8A 4ZTHA 3KREA 3EH9A 4R6VA 4MUQA 4XRJA 3V01A 2C6OA 5E8XA 5M4UA 4FTUA 1R3CA 5ANKA 3D4QA 2SRCA 3EZRA 3NNXA 4MVFA 4I6QA 4C59A 4D9TA 3QQFA 3LMGA 4X21A 4XOYA 5DR6A 4AN3A 2B1PA 1WVWA 3UOJA 2ZAZA 4L3JA 4UEUA 5CSVA 3RINA 3KXXA 2DYLA 3BHVA 3KB7A 4QMSA 3HAVA 5E8ZA 2X7GA 3BWFA 5A4TA 2C6MA 2OI4X 3RAHA 4ANMA 5CF8A 4XG6A 4NFNA 2KULA 4TYHB 1H25A 1UNHA 2PSQA 3QXOA 2VAGA 3GU6A 1UV5A 2OZAB 3FE3A 3GUBA 5HICA 4YJRA 2X6DA 2FSLX 2PVNA 4XH6A 4QQJA 2J0LA 3KXGA 4W8DA 4D4SA 3M2WA