4FEXA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor tyrphostin ag1478
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
NLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fexA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4fexA02
5BVNA 2ZYBA 2DUVA 1Z57A 1U46A 2BHEA 2GNIA 2NP8A 3OXTA 1YOJA 3R73A 5CU3A 2CN8A 5CVFA 4E93A 3V8SA 3ZYAA 4L45A 3IW7A 4HYSA 4ID7A 4Z9LA 2R5TA 4WUNA 3RJCA 2R3MA 1V0OA 3QC4A 3AC2A 4ZSJA 3VNTA 4BCNA 1LPUA 1M14A 3KGAA 3LXPA 2VTNA 1YI3A 4BCIA 2XM9A 1IR3A 4CXAA 4ASZA 2YIRA 4M14A 3MY1A 1CMKE 1OL6A 2KULA 5CALA 3ACKA 5A4LA 4FNWA 2HXQA 2W0JA 3FY2A 4KNBA 4RJ8A 3PXZA 4ANBA 3BHUA 2FSTX 2B9JA 4FV9A 3N4VA 4F0GA 3GOKA 3PFQA 2YITA 4EWHA 2ZDTA 4X2NA 3FSFA 4S34A 5D1JA 4RT7A 2XF0A 2WMQA 5B0XA 3WF7A 3O7LD 3IQ7A 4QPSA 4WG3A 1G3NA 2CNUA 2QOOA 2W06A 4MNEA 1AGWA 4C3FA 3I5NA 3C0HA 4GG5A 4GFMA 3NNVA 4N57A 1YXUA 5CXHA 4ZIMA 4C4FA 3QTSA 2ITNA 3FPMA 4AN2A 4ENYA 5AJQA 2VTQA 5FD2A 1YOMA 4HZRA 4UY9A 3MVMA 4MXOA 3MFTA 3PLSA 4ERKA 3F61A 5CQUA 1ZXEA 4F99A 2IZSA 4I5CA 4FT7A 4QP2A 2X2KA 3WYYA 3L9MA 3R00A 3W0NA 2I6LA 3E88A 2PUUA 2J4ZA 3W0PA 4RQVA 3PYYA 2W99B 2P3GX 2VU3A 4FX3A 4XP3A 2WTCA 5A4EA 2W1GA 4BIBA 5BPYA 3O17A 4UZDA 3ZCLA 3ZO3A 5IH5A 3PXQA 5DG5A 4QMQA 2Z8CA 4ZY5A 3N4UA 4Y8DA 5M53A 5AUYA 2OJIA 2BDFA 3E7OA 3EQGA 4KSQA 4O22A 5JN2A 4YZMA 5IA2A 3VS7A 4ASEA 4FSTA 2UV2A 2BZKB 2RG6A 2V7OA 2ZMCA 4QP7A 3NMUF 3TT0A 1H1SA 2OIQA 3V5LA 4C7TA 4EI4A 3E3BX 3SXSA 4FKVA 3UPZA 3CTQA 2J0MB 3PJ8A 2ZMDA 2I1MA 4DEIA 3ULZA 2GNJA 2WMRA 2QCSA 3TJDA 5HU3A 5JQ5A 4R3RA 4AGCA 4QTCA 2RFNA 1UV5A 4F0FA 3LPBA 4YTFA 5BVDA 4OBOA 3QKKA 5CANA 3K2LA 4U3YA 2JKQA 3Q2JA 3SOCA 4FA2A 4DEDA 4MBIA 1LP4A 4O27B 2PMLX 3VWAA 5FBOA 2QU6A 3MPMA 3QQGA 4DGLC 2C6OA 5E8XA 1OITA 4YLKA 3ORMA 3GNIB 3NS9A 4QMTA 4KAOA 4ANLA 3P0MA 2OW3A 2G2FA 4ZSAA 2WTKC 5HI2A 2BRGA 3LMHA 5IQCA 5CF4A 5GIPE 5DWRA 3HMNA 3OBGA 4U45A 3KRJA 3O8PA 3VAPA 4JIKA 3VBXA 4NJ3A 3R01A 4JL9A 4EBVA 4K8AA 5A6OA 4ZSEA 4YO4A 2VWUA 4IH8A 4D4SA 4ACCA 3LAUA 1Y8YA 4J7BA 3P23A 3GT8A 5ETAA 3W0MA 5CU6A 4BCJA 4F70A 2ZV8A 3JVSA 5EOLA 2A2AA 3S2PA 2XJ2A 3F5XA 3VUDA 5J7HA 2C5NA 4IVAA 2HY0A 2EVAA 2UZOA 5M57A 3GFEA 4B99A 3DTCA 3A4OX 3II5A 4FTMA 3RAKA 3R28A 1ZLTA 3DBEA 4B6LA 4MD9E 1UNHA 3U87A 3VBYA 4YJUA 4PX6A 4RX8A 4MBLA 4TYEA 1OMWA 5CXZA 3O51A 3Q4ZA 4QMZA 4A4LA 3FLNC 4AZVA 4EOJA 1K9AA 1SMHA 2HY81 4PV0A 3D9VA 2BIKB 2R3OA 2HENA 4YJVA 4O96A 2VWIA 2I7QA 3DXQA 3LJ2A 3WE8A 4J1RA 4U6RA 2RF9A 2PUNA 2W5BA 3ZMMA 3MIAA 4H3QA 3KF4A 4C4EA 3HP5A 4PNKA 4QYYA 3SLSA 2ONLC 4MD7E 3UTOA 2UZNA 4YHTA 3VF9A 1QPEA 4XBRA 4IAYA 4CMTA 5LXMA 4H3BA 4RZVA 3VUKA 1L3RE 3QC9A 4YR8A 2PVJA 3PJ3A 5IZFA 5AP5A 3DZQA 1A48A 1UWHA 3DV3A 5CEIA 3OMVA 2H34A 3C1XA 4A9SA 2QO7A 4NJDA 4AF3A 2C5VA 3WF6A 2LGCA 3SVVA 2E9PA 4FVRA 5DT4A 4YJRA 4C37A 4RX7A 2VTRA 4DFUA 4RC2A 2RG5A 3FPQA 3PY3A 3HV5A 2BKKA 4GL9A 2XNNA 1KUTA 1U5QA 2ITQA 4NZWB 3UO5A 2XCHA 3A7HA 4V0GB 4BVUA 2X8EA 3FHRA 3OS3A 4FSMA 4FUXA 4PF4A 2J0IA 3AT4A 5JQ8A 4CFWA 3DT1A 4M69B 2XYUA 2VN9A 4HGTA 4ZTHA 5CF6A 3PXFA 4O81A 4DH3A 3PXYA 3OT3A 3GUBA 4O7TA 3ZDIA 2BRMA 4TWCA 3PRIA 4O21A 5HO8A 4ZZMA 4DA5A 4H39A 4ACHA 4PMTA 1YWNA 4CSVA 3HMOA 1H24A 4R5SA 4K6ZA 3MTLA 4GT3A 3SRVB 2XBJA 1W0XC 5DH3A 4RVMA 2XK3A 4Y83A 2EB3A 1ZOGA 2CMWA 4FNYA 5HLWA 4EH2A 4FEVA 2YDJA 2R7IA 3NDMA 3FQSA 4MWIA 3TACA 4Q5EA 5ETCA 3R83A 3TIYA 3ZO1A 4CFNA 3MGYA 4D4YA 1OKWA 3OXZA 5ICPA 3BZ3A 2W1ZA 1Q8WA 3R1NA 5KMOA 2CGVA 3HRCA 3MDYA 4GK3A 5AV2A 3CSVA 3BQCA 5ITAA 4GYGA 3ZEPA 3GP0A 4WOVA 2E2BA 3QQFA 3GC0A 3QTWA 2IO6A 3L9NA 4NIFB 3VF8A 4AGWA 4B0GA 3QXOA 2QURA 3F3TA 5FXSA 5CAPA 1F3MC 4GKIA 3UMXA 2CGWA 3QX2A 1Y91A 3HECA 4IM2A 1Y6BA 2JBPA 4RIYB 4E4XA 4S33A 5HG9A 5HIDA 4AQCA 5E90A 4E73A 1ZZLA 1O6YA 2RL5A 4X3FC 2UUEA 3TXOA 5C8NA 3TEIA 2WOTA 3C4ZA 4K11A 5BUEA 3E7VA 5GIOE 5M07A 2GNHA 4FIGA 5IEVA 4DITA 4DHFA 1CSNA 3QTUA 3FYJX 1J7UA 5AP4A 5LWMA 5JFXA 4G3EA 2JC6A 3BBTB 5DT3A 4N6YA 2IG7A 3SXRA 4D5KA 4O91A 3I1AA 2C5OA 3JR1A 4EZ3A 4FK6A 5A6NA 2FH9A 5IQAA 4XG8A 5DE2A 3Q04A 4EC9A 4DFXE 3ZSIA 1NVQA 1OIYA 1VYWA 3KCKA 4G34A 4IADA 1VYZA 4JT3A 4L52A 2J0LA 4D9TA 1H4LA 1Q5KA 3E8DA 3F3VA 4Q9ZA 2X2LA 4FL2A 2FUMA 4EH5A 3PP1A 2A1AB 5KKRC 1FVRA 4IWPA 4XRJA 4BIDA 4DH8A 2W1FA 2JKKA 3Q4CA 1AD5A 3R8UA 1CKIA 3KCFA 3W2RA 5AAGA 3QRKA 2WMVA 3OY3A 1FGKA 3QRTA 5C01A 3R6XA 1BUHA 5HCZA 3RPSA 3ZO2A 3W2OA 2FVDA 3E93A 3HX4A 3Q32A 4YJTA 5EDRA 4C58A 1BYGA 4NCTA 4F7LA 3A7FA 3NAXA 3THBA 5CAOA 2YHVA 3DQWA 3FZ1A 3Q6UA 5CLPA 4F7SA 5HQ0A 4KWPA 2PVLA 3R9HA 1YRPA 5CI7A 3NVKI 5FTGA 4FG9A 4EZ5A 4UXLA 2FYSA 1JSVA 4TWOA 4I6HA 4OR5A 2PYWA 2X7GA 2IW9A 3KMMA 2R3IA 4O0RA 5HCXA 1GZKA 1PJKA 2IVUA 4FV8A 5E8VA 5AUZA 4ONAA 5AM6A 4CCUA 3G2FA 4F9WA 3SV0A 3R1SA 4EH8A 3VBQA 4BI0A 1TKIA 1U5RA 3OXIA 3V8WA 1V0PA 3BU3A 3EQRA 2G01A 3DKGA 1WBWA 2C6EA 3OZ6A 4HCTA 4UXQA 3SW7A 4EKLA 2JFLA 1UVRA 2QOFA 4QTBA 5H9BA 4I0RA 4TYGA 1H07A 2F4JA 3DTWA 3GC7A 3DLZA 2WIHA 2R3NA 3DB6A 3GFWA 3MFRA 4FKWA 3QTRA 5I9UA 3NIEA 4YJOA 4IX6A 4R1YA 1WAKA 2R3PA 4DE4A 4WBBB 3EB0A 1XH5A 4O0UA 4RLKA 1RW8A 2UW6A 5AUXA 3UJGA 4L3LA 4FE2A 3Q52A 4X2GA 4QP1A 1JSTA 4G16A 2RKUA 5J9YA 2Z02A 4GJ2A 5CVHA 5IU2A 2JGZA 3AOXA 3OUNB 3VBWA 2YA9A 4AZFA 5DFPA 3O8TA 5JSMA 4F65A 3EHAA 3U54A 4C4HA 1OPJA 4DFNA 3CJFA 2OU7A 5J95A 2C6DA 5GINE 4U98A 1CM8A 3V6RA 3FUPA 3UVRA 3PY1A 4XV2A 5HE1A 3AC5A 2ZV9A 3GC8A 5JGDA 3AC4A 3F3ZA 1QCFA 4QMMA 4C34A 5KMJA 5JRQA 4QYHA 2QOHA 2I0EA 1PXIA 4EKKA 2C4GA 2O65A 2Y0AA 3NAYA 1H27A 4K77A 2QG5A 3PPJA 3MJ2A 2R2PA 5HX8A 3HAMA 2YCRA 3EFJA 4IM0A 2IPXA 2C47A 3F3WA 4X3FB 3RNIA 4BCFA 3UZTA 2VX0A 5FRIA 3KULB 4Y95A 4AZEA 5B2KA 5CEMA 5F94A 4S32A 4HCUA 3S4QA 5AUUA 3QLGA 4GYIA 2J0JA 3FYKX 2BPMA 3ZC6A 5J1VA 4F64A 4HZSA 4CLJA 3DJ5A 4PQNA 4AX8A 4EZ7A 2O64A 4IB1A 3UZRA 5IA3A 3WZJA 5HTCA 3OY1A 4RIOA 2R3FA 3SQQA 4X21A 3G33A 3QUEA 4RA5A 1GIHA 3PE1A 4AOIA 3TG1A 3W33A 4D5HA 4FZFB 4P5QA 4ZJIA 2YIYA 4GIHA 4TYHB 3EJ1A 4AT3A 3RHXA 4HGLA 4A9YA 3LCOA 1SVHA 4G6LA 5EHYA 4U80A 5TT7A 3ZXZA 4YLJA 1ND4A 3R9DA 1ZRZA 4GSBA 5CSXA 4Z7HA 3QD3A 1H0WA 5LJJA 4LUEA 3QA8A 4BTKA 5EK7A 4B8LA 5H8EA 2XUUA 4S31A 4GJ3A 3MV5A 4R7BA 1P14A 1OGUA 4AUAA 4TN6A 4CTCA 3FMKA 1JVPP 4OTDA 1SVEA 4NSTA 5HE2A 3REPA 2HW7A 4FGBA 2O2UA 2YWPA 4XJ0A 3TI1A 4CCBA 3EKNA 3FMNA 3FMEA 4E6CA 2RIOA 2CKPA 4DFYA 1WMKA 5IMXA 4XH6A 2R0IA 4CFUA 1CKPA 3ZLYA 4B8MA 4DEEA 2GS6A 3FLZA 4IVCA 4QP8A 4DFZE 4K33A 4U41A 4LI5A 1A06A 1M7NA 5ANOA 4I41A 2X4ZA 4IB0A 5AP1A 4ARKA 2C3IB 3H9RA 3R0TA 4OW8A 5E8UA 1JOWB 3BX5A 3LFDA 4FIIA 2PUIA 3H30A 4KBCA 4MBJA 5KO1A 3MW1A 4RMZA 3HA8A 5AV4A 4Y85A 2FA2A 1Q8ZA 2C6IA 2F2CB 4L6QA 1JKLA 2R3RA 3A99A 5KNJA 5I5ZA 1E1XA 4ZS0A 4E1ZA 3LXNA 2PU8A 2IWIA 5TO8A 5I0BA 4WBOA 2UW0A 3OTVA 4LYNA 3R9NA 4BF2A 4BCOA 4IFCA 3KU2A 1WVYA 3R2YA 3D15A 1OBGA 4FODA 4IHPA 4O0YA 4RFZA 5J8IA 2YFXA 4MXAA 5JH6A 2WHBA 4O84A 3HKOA 4F09A 1MUOA 1R1WA 2C5YA 4L3PA 5EM6A 4RX5A 5GNKA 5IH6A 5CENA 2GHGA 3OEZA 5HIEA 2QONA 1URWA 1JKSA 2VTSA 3KXNA 4L53A 4USDA 5LMAA 4AE9A 5A14A 4L01A 4YNOA 1UU3A 3DXPA 2BHHA 4DH5A 1OZ1A 3EMGA 4LUDA 3NUXA 1IA9A 2YM7A 2WMUA 4UALA 4L46A 3H4JA 5AV0A 4WNKA 4ANSA 4QMLA 4KINA 1MQBA 4I20A 5LOHA 2UZDA 4ALWA 3S1HA 3C50A 1YDTE 1MP8A 2PY3A 4P7EA 2YEXA 3DNEA 3OCSA 3R7UA 4ZMFA 3BV2A 4QMYA 3VJNA 1CKJA 5T68A 3EN7A 2R3LA 2BR1A 2VGPA 3LQ8A 4LFIA 3F5UA 5DHJA 2ZOQA 5CI6A 3MN3A 4M0YA 3MY0A 3PJ1A 3FI4A 4RRVA 3HP2A 5E8TA 3FAAA 5EQPA 4IAFA 3Q3BA 5CAUA 3R02A 3PIZA 5CTPA 4EK4A 4NH1A 2XIXA 3SG9A 4FTOA 5HBHA 4C2WA 3HV7A 4AA4A 4CFVA 2HZIA 5C03A 2GFSA 2XYNA 4CEGA 4JDHA 2WAJA 4RIXB 2UVXA 1OB3A 2XK6A 5HCYA 5HLNA 5LMKA 4JXFA 3S3IA 5JEBA 4EUUA 2V22A 1H00A 4TPTA 4D4RA 5IQBA 1URCA 2VO6A 3KF7A 2C0OA 3QCQA 3KRLA 3LCSA 3PPKA 4L43A 2HAKA 4O7WA 4RFYA 1EH4A 1W7HA 4RGJA 4F7JA 4EEVA 5CU2A 3V3VA 4KRCA 4CTBA 1Z5MA 2PVRA 4C35A 1PXPA 4BCQA 1OKZA 4E4MA 5E4HA 1GZ8A 2QOQA 1NA7A 2NNWB 2UW5A 3LMGA 3DKCA 2GTMA 5L8JA 5A4TA 2BIYA 1M2QA 2W7XA 2Z2WA 3LJ0A 4G5PA 4JIAA 1SVGA 4XUFA 2OWBA 4QP4A 2CHLA 3P1AA 3FXZA 1OL1A 3IGOA 5CEQA 4I6QA 3PA5A 4IANA 4RPVA 2PVHA 4NYEA 1M52A 4DTAA 1APME 4FTLA 5J87A 1Q61A 4HNFA 4I93A 3DCVA 3OHTA 4IZ5A 2WTVA 4FV1A 5EW8A 2HZ0A 4NKSA 3W0RA 1UNGA 3BU5A 3Q53A 1KE5A 4GK2A 4BCKA 4D1SA 4XLVA 4F1MA 3E8NA 3MYGA 3Q4UA 4MNEB 3RPVA 4EUTA 4TTHB 3NUSA 4IZ7A 4H36A 3MPAA 2GHMA 2P2IA 3UYTA 2BDJA 1O6KA 4M67A 3QCSA 2OLCA 1YXVA 3F82A 3KB7A 4C61A 3D5XA 4EONA 5JT2A 1ZYDA 3DFCB 3FMMA 3UMWA 2C3LA 2RGPA 4MQ2A 2Z7LA 3ZUTA 3ANQA 3R22A 4YZCA 1H1QA 5BMSA 3MH2A 3R1QA 2PWLA 3QRUA 1YDSE 4QQCA 4TT7A 4EQMA 3EQDA 4CFFA 3A8XA 4BI1A 4CG8A 2CNVA 2J0KA 4B4LA 3NNWA 4JS8A 4FZ7A 1Q8UA 5G6VA 4FEUA 3UVPA 2XP2A 3QU0A 2GFCA 3TL8A 4EOKA 3ZBXA 2HZNA 1R39A 2XIZA 4BBFA 3PG1A 2LAVA 2UZLA 4FI1A 2IZUA 5CZIA 3FY0A 4KS7A 1YWVA 2VTAA 5A46A 4CT1A 4CMOA 3F2NA 1O6LA 3FBVA 3OWPA 3QCXA 4IEBA 5BX0A 1U54A 1XH7A 3H9FA 3SA0A 5DYJA 2KTYA 4ZZNA 4OBPA 3CY2A 3FC1X 2ETMA 3ZSHA 2BAKA 4JDKA 3D7TA 3MVLA 1ZMWA 3RK5A 5I4NA 3IOPA 4ZEGA 4AXAA 4QYFA 2YN8A 3POOA 1B39A 2XK4A 3C5UA 3C4EA 2JAMA 4QQ5A 2QD9A 4HVGA 4O6LA 4BCHA 3DK6A 2OBJA 3ALOA 4EOPA 2XK7A 4FV4A 5FTOA 1IASA 3ZM4A 4FT9A 4UWCA 3KN5A 1IEPA 3QHRA 4PDPA 4YJQA 1WFCA 3LXKA 3PWYA 4WKQA 1W83A 3WIKA 3HGKA 3ZFMA 4FTNA 2O63A 2W5HA 3CLYA 4BDAA 5I9VA 2PL0A 3CGFA 3D5VA 5DR6A 3QRIA 3MI9A 1G8AA 1H25A 4FKRA 2YERA 3PY0A 5JZNA 3A62A 5FEEA 5C27A 3BELA 5KMMA 3ZTXA 3MVJA 3RM7A 2Z60A 2ITTA 3HMPA 4F1OA 2VWXA 4G1WA 1PHKA 4EK6A 3R9OA 3HDMA 3E8EA 3QF9A 4A9UA 4LG4A 3WZEA 4U3ZA 4EK3A 1XH6A 3FKLA 3Q5ZA 3QL8A 2WU7A 4CKRA 3PTGA 5LCKA 2BAJA 3S0OA 1YQJA 3CD3A 3CQEA 1IAJA 4IB3A 2HOGA 4CFMA 3P7BA 5AA9A 5AA8A 3NZ0A 4E26A 2VTTA 4MXZA 5FQDC 4QMUA 5L6PA 3BYOA 3RPRA 4EYMA 5M44A 4A4OA 4A07A 3OG7A 5AAEA 1LUFA 4O7PA 3RK9A 2BAQA 3N9XA 3A4PA 4GT5A 1UNLA 4FSQA 5EYMA 3ROYA 1OPKA 2XRWA 2PMOX 4MX9A 1QPJA 2V5QA 4RA4A 3BWJA 3HRFA 2B54A 5ACBC 4AE6A 4PUZA 4NTSA 3PXRA 2XNPA 3JXWA 3S95A 4CKJA 4USEA 3LCDA 1R0EA 5L2IA 5AX3A 4E4NA 2VTIA 2V62A 1LEZA 4BZNA 4IFGA 2QO2A 4EJNA 3ALNA 2B1PA 3HL7A 3HUCA 5KCVA 3PUPA 3E5AA 5AP2A 2OH0E 2EXCX 2C0IA 3LLTA 4QTAA 3NYNA 5TKDA 3W2QA 5C8KA 5JKGA 3UVQA 3BHTA 2F57A 4FEWA 4RJ6A 4XEYA 5GJGA 5M4UA 2QLQA 1JWHA 4RWIA 4DGMA 4KKHA 1OIQA 3HV4A 4R78A 1UU8A 4M7IA 4BDJA 4BI2A 4Q2AA 4BBEA 3GCVA 3OBJA 4FT3A 2YCQA 1YI4A 2G9XA 4LV5A 5I9XA 1ZOHA 2IW6A 3G9NA 2YZAA 1KE8A 1GIJA 1P4FA 1WVWA 4FOBA 2BROA 4JLCA 4M68A 3LFAA 3HZTA 5JFSA 4CT2A 5FXRA 3OUKA 3EFWA 3O71A 1H08A 4QNAA 3VBTA 2BZIB 3AT2A 3Q5IA 4TXCA 5IUGA 5C9CA 3CPBA 2WTJA 4ZLYA 4D4VA 3OEFX 3AMBA 5L2TA 1V0BA 3FSKA 4BIEA 4PP7A 3COMA 2GU8A 2JIVA 3MFUA 2YIQA 3WIGA 4WIHA 2VWBA 2Z7RA 4FTRA 2BMCA 3V5PA 5BVFA 4H58A 2BKZA 4ZTSA 3BLHA 4BTJA 5IDNA 4UX9A 3LE6A 3NYVA 5TOZA 3CJGA 4BGQA 4ERWA 1UU9A 3QQUA 1VEBA 4WHZA 2OFUA 2FSMX 3BHYA 3G15A 3ZLSA 5CEKA 5IQFA 3IDBA 3SX9A 4D55A 4GG7A 4GVJA 3TNPC 2WMTA 3MB6A 1UWJA 3DJ6A 5DT0A 3NEWA 3ZSGA 5DI1A 2J50A 4FIFA 4JDIA 2YJSA 3FI8A 4I0TA 4HPTE 5F4NA 3GQLA 2CJMA 2YZLA 3LQ5A 3LVPA 3PVBA 4XV9A 3ZONA 2OO8X 5AUVA 2BDWA 3TCPA 4O82A 2OJJA 3D83A 3UIBA 2ITUA 5HBEA 4HGEA 3QBNA 3UGCA 3UQFA 4IAKA 3LLAA 4D9UA 3G90X 2AYPA 4RX9A 2B0QA 3DBFA 4I6BA 4UZHA 3ITZA 4F4PA 2BTSA 4FL3A 1NY3A 3NCGA 4YUQA 3EFKA 3QUPA 2F49A 3EFLA 2PVYA 4JVGA 3TUDA 2DS1A 2C69A 3NW5A 3O50A 4DLJA 2UZBA 3ZC5A 3PA4A 4XG6A 2YM3A 4JR7A 4QMPA 3SHEA 4E6DA 1B38A 2F7EE 3FQHA 2PPQA 5HKMA 3TKIA 4AW2A 4F9BA 1H1PA 1IA8A 4ZSGA 4AW0A 4XP2A 4IDVA 2Y7JA 4PTEA 5LWNA 2J6MA 1NVRA 1JKTA 3NUAA 1E9HA 2BVAA 2W1HA 4I24A 3MB7A 4U7ZA 4JBOA 4UWBA 4NM3A 4ITIA 3B2TA 3LMIA 3UIMA 1P2AA 3PVWA 2BALA 4BDGA 4YP8A 4R1VA 2R3QA 2H6DA 4K9YA 5FEDA 5C8MA 4I21A 3IDCA 2GQGA 3DBCA 4IVBA 1Y8GA 2WZJA 5HE0A 1P4OA 1OECA 4RFMA 3M1SA 2UVZA 3PA3A 5AMNA 4WSYA 2ETKA 2X1NA 2XM8A 3WI6A 4YZNA 1J1BA 3U6HA 3U51A 2W96B 2WEIA 4EH9A 3OFMA 2NRUA 3V5WA 5EW9A 4YGAA 5M55A 1T46A 1FVVA 4FKSA 2O3PA 1OPLA 1Q62A 4DLIA 3JS2A 3GCQA 1YI6A 5EM7A 5EW3A 4LRKA 5KUPA 3F2RA 2OXXA 4PDOA 5K9IA 2UZEA 1Q4LA 4YC3A 3OTUA 4S2ZA 4BICA 1JNKA 2PZIA 3QRJA 3RWQA 3BYVA 2J2IB 3OC1A 4GUEA 2X0GA 3FDNA 2CLQA 4DGOA 4F6WA 4RIWB 4J97A 5M56A 3QWKA 2O8YA 1PF8A 2BFYA 2QOBA 4I0SA 4PL5A 3ZUVA 5J1WA 3VO3A 2X4FA 4BCGA 4G2FA 4CKIA 4NM7A 3DZOA 4O7YA 4A9RA 3WF5A 3PP0A 1ZY4A 3B2WA 4YHJA 2YCSA 5LCJA 4ZTMA 3AG9A 3VVHA 3EQFA 4JRVA 4MH7A 3QFVA 1BI8A 3KC3A 4FT5A 4CVAA 3Q6WA 1J7LA 5K3YA 3BHVA 2PZRA 2AC5A 1ZYJA 4JX3A 3GENA 4D0WA 5HNBA 1PMEA 3LM5A 4G6NA 2W1DA 4HVIA 1YXSA 2YIWA 2ITPA 3E3PA 1W84A 2ITYA 5HVYA 2C3KA 5HG5A 3W8QA 5IEYA 3ZRKA 4Y73A 3UP7A 1XH9A 4DBNA 4C38A 4YSMA 5IA5A 4DH1A 4RC3A 3PIYA 4FKUA 2W4KA 2OIDA 3MSSA 3C5IA 2OJFE 4AGUA 4YZ9A 3ODZX 2P4IA 3UC4A 2IVSA 3OW3A 3OT8A 2CN5A 3I6UA 5E9EA 3V01A 3NX8A 4E5AX 4NFMA 4O7VA 1J91A 2ZB0A 4ANQA 2B4SB 4FOCA 4QP3A 4IX3A 2VTLA 2JDTA 2PK9A 4FGRA 4FTTA 3KL8A 4S30A 3FZTA 2C68A 3GVUA 3R7VA 3RAWA 3O0GA 3EN6A 3EL8A 2R3GA 3TZ9A 3EYHA 3QCYA 4E5BA 3UOLA 4FKIA 4PY1A 3W32A 1SYKA 1XO2B 2JDSA 4M8TA 4FV6A 4G9RA 1PXOA 2JKOA 5D41A 5E8YA 3ORIA 2CCIA 2V0DA 4NM5A 4EH4A 4F0IA 4F7NA 4AW5A 2WQEA 3GCUA 3BYSA 3QD4A 3TNIA 4FIEA 3H0ZA 4NW6A 5I9YA 4DTKA 4GMYA 3ZEWA 1M2PA 1R3CA 1Q24A 3UG1A 4BYIA 3V5JA 3ZS5A 1YOLA 4R6VA 5AWMA 2W5AA 1OVEA 5FLFA 4FTAA 1BX6A 4C2VA 3ANRA 3SRVA 2JLDA 4QMVA 5DBXA 3S00A 3D14A 1HCKA 3RINA 2VWZA 3V6SA 4WNOA 1TQIA 2C6TA 3LIJA 3UOHA 3SKCA 5AIRA 3HEGA 3IOKA 1REJA 4NUSA 5ANGA 4DH7A 4KIOA 5CNOA 1WVXA 4ACGA 5KE0A 3L9LA 2OIBA 2CGUA 3VHKA 3W2CA 4CV9A 1QL6A 3HLLA 4GFGA 4XOZA 2XVDA 3K54A 2HELA 3CGOA 4XNEA 5CY3A 4YLLA 4PRJA 4V05A 3RMFA 3BIZA 5B7VA 3KXMA 2CKOA 4YJSA 4EOLA 1SZMA 3NNXA 4J95A 3HAVA 4U81A 5CT0A 4OT6A 4W8EA 4IM3A 2P55A 4NW5A 4QP6A 5KMLA 3HV6A 5T6KA 2J9MA 2RFDA 3CTJA 4PP9A 1REKA 3R30A 4W4VA 5BVWA 2JITA 4QTDA 2ZM4A 5AAFA 2I0VA 4EH7A 4XOYA 3D5WA 3ORKA 3B8QA 4BDDA 3ZFXA 4HJOA 3P4KA 3FKNA 4JX7A 4DT9A 2YABA 3Q96A 3R63A 4YTIA 5JK3A 3W0OA 2OXDA 3ORNA 5EDPA 4GEOA 2RFSA 3M42A 3PXKA 4APPA 5HLPA 4MVFA 3FL5A 4LM5A 4ZSLA 4FIJA 5AP6A 3CQUA 1X8BA 5M09A 2HK5A 2X6DA 3IECA 4XV3A 4C4IA 4BGHA 2QVSE 3SC1A 3IKAA 3ROCA 1XJDA 3DS6A 4FC0A 4QMWA 2OJ9A 5BNJA 5D7AA 2QKRA 3ENMA 3PDTA 3DNDA 2HW6A 1RQQA 3PRFA 3QZFA 4LOOA 3QAME 4YC6A 4AN9A 5HTBA 1WCCA 3BWFA 2C30A 3P78A 4ZZOA 4U0IA 1PMVA 3MY5A 5BYYA 2XNEA 1BLXA 2BFXA 3ORPA 4OTHA 3T9TA 3JYAA 2QLUA 1CTPE 4PWNA 4AAAA 5L6OA 2ONLA 3ZHPC 4QNYA 2G15A 1IG1A 3WF9A 3LXLA 3CIKA 1NVSA 2B9IA 3R7IA 3GU7A 4GH2A 1A9UA 3G6HA 4JG8A 3PPZA 5J9ZA 2CKQA 2XNOA 3C7QA 4IWDA 4O6EA 3MA6A 3FZPA 4FKPA 5A9UA 2X39A 4RVTA 5CNNA 3QHWA 4BZOA 4QMNA 3QGYA 2JEDA 3H10A 2HYYA 1QMZA 3IW8A 4LMNA 1GNGA 1DS5A 1OM1A 3FMJA 4NKAA 4DEAA 2BRBA 1YXTA 4DGGA 2AUHA 3AT3A 3NR9A 1JQHA 3EZVA 3QLFA 5E1SA 4FV2A 4AG8A 3L1SA 1PXMA 2Q0BA 3LM0A 3V8TA 4IZAA 4NFNA 4W8DA 3HMIA 4FEQA 4Z16A 3UC3A 3LCTA 3ELJA 4EOOA 1OUKA 3UODA 3D7ZA 4BYJA 5BVOA 3OP5A 2Y4IC 1PRYA 2PMNX 2R4BA 3P9JA 3R1YA 4M15A 5AV1A 3LFBA 4RBLA 5KMIA 1XBCA 3A7GA 1PXKA 3MH0A 5L6WL 5E92A 4L67A 3HUBA 2RFEA 1MQ4A 2XKFA 4FZ6A 3EN9A 4ITHA 5HGIA 4A9TA 4J52A 3W55A 4DCAA 3WZUA 5CU0A 1W82A 2JDRA 3QALE 1Q99A 2QG7A 3BV3A 3OOGA 4XLIA 1OL2A 2C6LA 3GU8A 4O7LA 4HCVA 2W17A 2CDZA 4IX5A 2PUPA 3TUCA 2W1IA 4RLLA 2J90A 3ZRMA 3FE3A 4MWHA 4JG7A 4BDHA 3LFFA 2Y6MA 4L3JA 2J7TA 3U4WA 4D0XA 3KEXA 4FKTA 4F63A 2PSQA 5KZIA 1GZOA 4BY9E 3FC2A 3HV3A 1UU7A 4EK5A 4L44A 5HBJA 1TQPA 2YAAA 1XKKA 3UOKA 4TYJA 2WQBA 4Y5HA 4X0MA 5AUTA 2PE1A 1U4DA 5J5SA 4FK3A 4ZTQA 2PE2A 1T45A 3A60A 3L8VA 4FSZA 5D11A 2YM5A 3AC8A 5FDPA 3A2CA 3NUNA 4IE9A 4IJPA 4N70A 1KE9A 1OL7A 1Q8TA 4MXXA 4X3FA 4BB4A 3WE4A 3PZEA 4KB8A 3BGPA 4NT4A 3KULA 3U6JA 3VN9A 3QTIA 2E9OA 2VAGA 3RKBA 3TV7A 5DGZA 3E63A 5HO7A 3R8MA 4DEHA 2VZ6A 4DT8A 5E8SA 2OZAB 5AIKA 4X3JA 5ANEA 4ITJA 3OW4A 3EN4A 3PWDA 4XX9A 3W8LA 4TNBA 4Y5QA 4CMUA 1FVTA 4P4CA 4RWJA 2OKRA 1DAWA 3KRRA 3E64A 5ETIA 2YJRA 2WTDA 3TKUA 3DY7A 4DG0E 3OF0A 4JAJA 4FTJA 4XG3A 2YDIA 3QTQA 2ZM1A 4FG8A 4BTMA 3PJ2A 2PZPA 4I6FA 4AT5A 4TW9A 2PVKA 3VRZA 3T3VA 3O8UA 4EQUA 1H26A 1YW2A 4U40A 4EOMA 4ZXTA 2H96A 2X9EA 3C4FA 4WG4A 3WILA 3W18A 2ITVA 3LFSA 2HWOA 4JOAA 2WPAA 4FT0A 4EOSA 4O7OA 4KA3A 4C59A 2CNQA 2XK8A 3VS5A 2W4JA 3GOPA 3IG7A 2P0CA 4HYIA 4BHZA 4RJ5A 3LKMA 4C4GA 4ZAUA 5CF8A 4DN5A 4N4SA 4IC7A 3AD5A 3D7TB 4IAZA 3RI1A 2VTPA 4BDIA 5L8LA 2X7OA 3ZRLA 1XR1A 3VW8A 4IACA 2B7AA 4KRDA 5HIBA 3ZFYA 5IUIA 4YZBA 2QHMA 1UKHA 4YPSA 2J5FA 5A4CA 3W0SA 3EQPA 4XCUA 3SOAA 4AACA 4EHGA 2WIPA 1LR4A 3FQEA 2JBOA 4HW7A 2UW8A 3CEKA 4IDTA 5CYIA 5A4QA 2R3HA 3UNKA 4ZY6A 4FBXA 3NUUA 4X6QC 3WF8A 2ZB1A 1ERKA 3BI6A 4EOIA 3QYWA 3MPTA 3PG3A 3KVXA 3ACJA 3GXLA 4AW1A 4GV1A 3UYSA 4AN3A 5IQEA 3FKOA 3BGQA 3QX4A 4FSNA 3JPVA 5HORA 2Y4IB 3NW6A 3U9NA 4F9AA 5EHLA 3AQVA 2Q0NA 4QRCA 3F2AA 4I4FA 5CWZA 3NLBA 4M12A 2W1EA 4GIIA 3R7YA 3COIA 5GJDA 2Y8OA 3ZM9A 2WFYA 3BKBA 4EL9A 4D2SA 3EIDA 5K5NA 2BTRA 2FSLX 2UZUE 4PTCA 5HESA 3QQKA 1E1VA 3ULIA 5BUJA 5JMSA 5KBQA 3QKMA 1R0PA 5HU9A 3FI2A 3R8ZA 3VW6A 3DXNA 3RP9A 4C36A 5AEPA 5CZHA 3M11A 4QT1A 1Y6AA 4UB7A 2XKCA 4NM0A 4PDYA 3T8OA 3PVGA 4LRJA 4JBVA 5IQIA 3UPXA 4IWQA 3ZLWA 5M4CA 3ORTA 3OVVA 4R3PA 5HNGA 3DK7A 1BI7A 2XZSA 2EB2A 4R5YA 3VUGA 4TWNA 2EU9A 2VWVA 1KSWA 3VIDA 5B2LA 4KKEA 3FHIA 4DEGA 3BE2A 4I5MA 4TRLA 4JG6A 5IG1A 5E91A 4DBXA 5CAVA 4YBKA 2OI4X 3GBZA 3OWKA 5F1ZA 2JDVA 2W05A 2C1AA 3LFEA 4GW8A 5FBNC 5LVNA 5EQYA 3BYMA 2ZV7A 4JBPA 3T9IA 4F1TA 4U43A 3Q60A 4J8NA 5EFQA 5I9WA 3IPHA 1OBDA 4H1JA 5CSVA 3ZLXA 4JBQA 3OOMA 3QD2B 3I0OA 4GS6A 4DGNA 2ETRA 2SRCA 3NYOA 4FR4A 4M0ZA 5GHVA 5F20A 5DOSA 3G5DA 3GQIA 4DC2A 4QP9A 1UKIA 3PSDA 4G3FA 4H3PA 5BYLA 4CD0A 3VQHA 3Q9WA 3LHJA 5HICA 4BN1A 4FUYA 5ANJA 3ZOSA 4GCJA 5EM8A 4E7WA 4FYOA 2IZRA 2VTJA 3F7WA 4II5A 5EOBA 3V5QA 4JJRA 3H3CA 3I60A 3D4QA 4FNZA 4JDJA 4K1BA 4EQCA 4Z55A 5DA3A 3C9WA 4D58A 2CGXA 3LJ1A 4BDKA 3EQCA 1J7IA 3TJCA 4FZDB 3IW4A 3RZBA 3FEGA 4I3ZA 4RJ3A 4EK8A 4IW0A 5DR2A 2A19B 3QQHA 3DLSA 3PLAE 2B53A 4YC8A 2WMWA 3R04A 4AA5A 5IMEA 2GCDA 3DGKA 4UV0A 4ZY4A 1XH8A 4QOXA 2QODA 5FM3A 3TTIA 2BRNA 3ORZA 3JUHA 1DAYA 2JDOA 1F5QA 4HOKA 2WKMA 1ZMVA 4CNHA 1YHWA 4XS2A 4LOPA 3DDQA 1WBVA 4JQEA 3BE9A 3R9RA 5FXQA 2QNJA 4OT5A 3SAYA 3VS6A 3KFAA 3CE3A 1PYXA 2GSFA 3CQWA 4G31A 4ZTLA 3ODYX 2QI8A 4XYFA 2ITZA 2PZ5A 1DM2A 5DEYA 4ZMEA 2J51A 3KQ7A 5BMMA 4I94A 5CASA 3FL4A 4MQ1A 1HOWA 3ETAA 4LRMA 3UIUA 5AADA 3O23A 3Q9ZA 3POZA 2ERZE 4RJ4A 4ZTNA 4MTAA 4U5JA 3MJ1A 3KA0A 3LFCA 3DKOA 4NCTC 3NCZA 3F6XA 1OUYA 4GU6A 4F9YA 4HYHA 4X2KA 1ZYSA 3FMDA 4LMUA 4DF3A 4DEBA 2XB7A 3EZRA 3FMHA 4ANMA 1WBSA 4AP7A 1PXJA 3EQHA 4FTIA 4PL4A 4IAAA 2XNBA 3F5PA 2IVTA 4L68A 4MCVA 2UZWE 4L8MA 2OXYA 4F9CA 2F7ZE 2VRXA 2Y4PA 5KMNA 2QOLA 4CQEA 3MESA 4CRSA 4I1ZA 2GS7A 4FYNA 4ZJVA 3C0GA 4PTGA 4IAIA 3R8LA 4EC8A 4KIPA 2CPKE 5A3XA 5CF5A 2OG8A 4EHZA 3KK8A 4MXYA 1H1RA 3IGGA 4FV5A 2XMYA 2ZM3A 2XK9A 3NW7A 2OSCA 5ETFA 2XS0A 3A7IA 4DTBA 3RAIA 4W4YA 3A8WA 2UZVA 5HEZA 3DOGA 4BZDA 2XIRA 2YWVA 3NGAA 2REIA 4DAWA 4BC6A 2C6KA 4XP0A 3VULA 2EWAA 3D2KA 3HYHA 4GRBA 3NWWA 3CC6A 4QQTA 4KABA 3KMWA 4OTGA 3TDWA 4RVKA 3MH1A 5FGKA 4QYEA 4FG7A 3RWPA 4R7IA 3FWQA 3RPYA 5LVOA 4WRSA 3Q2MA 1FQ1B 3EN5A 4IVDA 4H05A 4AOTA 2XJ0A 3HA6A 5AUWA 2W9ZB 2GS2A 2ERKA 3I5ZA 3JVRA 4R7HA 4FV7A 3VUHA 3FJQE 3AC1A 5HZNA 2ITWA 4EBWA 5EHOA 2XA4A 1SNUA 2GMXA 4U8ZA 3ZBFA 3VUMA 2QKWB 3JY0A 3RCJA 3G9LX 3V51A 4MD8E 5DEWA 3GU5A 4FMQA 2PE0A 4I5HA 5BQ0A 3F9NA 4O2ZA 4PMSA 4YZDA 4X2FA 4OTRA 2QR7A 3P7AA 4O7RA 5FP5A 4ZP5A 3VBVA 1JKKA 3AMYA 3E87A 3OCBA 2OFVA 5IEXA 3K5UA 2QR8A 2DWBA 2XEZA 2CSNA 4JNWA 3U9CA 4CZUA 1YDRE 3UG2A 1H28A 4HYUA 4C33A 4ALVA 4A06A 4O7SA 3RK7A 4YMJA 4CV8A 4QMXA 2JFMA 4WT6A 1I09A 4MXCA 4GVAA 3DBQA 3UO6A 4EH6A 3MA3A 5FG8A 3COKA 3NSZA 5EQEA 3VJOA 3W16A 3DAKA 4P5ZA 4D1XA 3R8PA 4G6OA 4HVSA 3FZRA 1PYEA 1TQMA 4O0XA 4U79A 2EXMA 4BDFA 4UN0C 3F88A 2OGVA 3AGMA 5IISA 4PMPA 3MFSA 5IF1A 3ERKA 4HGSA 2A0CX 3F3UA 1FBNA 4A4XA 3T3UA 5AP3A 4YO6A 3CP9A 3UNZA 2P33A 4RJ7A 3I81A 3SG8A 2XNGA 2JIUA 3F66A 3D0EA 3DA6A 3E8CA 2NO3A 3I7CA 3F69A 2VD5A 3KY2A 2I40A 4I5PA 2DQ7X 3QKLA 4IJ9A 4L00A 4P90A 4ENXA 3L9PA 5KMKA 3VUIA 2ZV2A 3MTFA 4GKHA 2YM8A 2OF4A 3RPOA 3IS5A 2QOKA 1NT2A 3HNGA 2WEVA 4LGHA 4N0SA 1J1CA 2QHNA 2GHLA 4C02A 4FTQA 1GZNA 4K0YA 4O2PA 1H1WA 3LFNA 5AFVA 2OZOA 4IWOA 4FTUA 4J96A 3R8VA 1DI8A 2F9GA 3Q4TA 3A7JA 5CS6A 5CU4A 5HD4A 5DPVA 5E1EA 3ZZEA 2HXLA 3R7EA 4NWMA 1PMUA 3WOWA 3W10A 2YIXA 3G51A 4O0VA 4MAOA 2VGOA 4HNIA 3EQIA 3SDJA 4B9DA 3LZBA 5IDPA 1KV2A 1H8FA 4QO9A 5HE3A 2PTKA 2VNWA 3KXGA 1KE6A 1WBTA 1O9UA 4OUCA 3ORLA 2NRYA 5DNRA 3SXFA 2CCHA 3U55A 4E20A 2C0TA 3FLWA 4E4LA 5JGBA 3KKVA 3UO4A 5CT7A 4QQJA 3C13A 4U44A 5EI8A 1G5SA 3FI3A 2JAVA 3RM6A 2Z7QA 3OROA 2HCKA 1XBAA 4TKSA 3OCGA 4E5WA 3KRWA 5M06A 2GPHA 5EG3A 4PMMA 2VO7A 4ACDA 5C1QB 5M51A 3GCPA 1GY3A 3JY9A 2BUJA 4UYNA 4EJ7A 1BMKA 2NPQA 4G17A 1PMNA 4ACMA 1RE8A 4JQ7A 4IX4A 2H8HA 1WBNA 3A61A 5CVGA 1VZOA 3CCNA 5EKNA 4FVQA 3MH3A 4O7ZA 2IN6A 4XG2A 3EQBA 3HRBA 4FSUA 2G1TA 4YSJA 1YHSA 5FTQA 1L8TA 2UW4A 3TNWA 4O83A 1F0QA 2OK1A 3LFQA 2WTKB 5K5XA 4O86A 2PZYA 4ALUA 4YNEA 3RAHA 3FV8A 3BHHA 3IONA 3UQGA 2PMIA 5K4IA 4C0TA 3H0YA 1GIIA 4FTCA 3BGZA 5AP7A 4ZJJA 1MRYA 4AGDA 4LOQA 3AMAA 4AA0A 1V1KA 3HMMA 2QQ7A 2BILB 4Z3VA 1W98A 2E9UA 2GDOA 4M97A 2WOUA 4MHAA 4RZWA 3QZGA 2I0HA 5TF9A 3KVWA 3D5UA 2I0YA 3ET7A 3I4BA 4FKLA 4AU8A 4LL5A 5HVJA 1XH4A 1Q3DA 1ATPE 2QC6A 4AZTA 3TNQB 2OICA 1RDQE 3NVMB 4NTTA 5CAQA 5LVMA 1U59A 3C4WA 3NYXA 3FXWA 4HVDA 2WB8A 5EYCA 3AD4A 3ZZWA 3KN6A 1FMKA 2GQRA 2UVYA 3GC9A 3KREA 5C26A 4CFXA 2Z7SA 1LEWA 2AC3A 3DAJA 4I92A 4V0GA 5EYKA 4D28A 1B6CB 3I6WA 5KX8A 2WQMA 4O0WA 3RHKA 3TZ7A 5DR9A 4FSWA 4J98A 2R0UA 5IQHA 2WO6A 3CKWA 1ZYCA 1FGIA 3HDNA 2PHKA 2PVFA 1Q97A 3LOKA 2HIWA 1WBPA 4M13A 1BKXA 2ZVAA 3AGLA 3NNUA 4BTFA 4FTKA 3UZPA 1AQ1A 1Z9XA 1ZWSA 1XQZA 5CSPA 5LMKC 3ZH8A 2VO3A 3ZUUA 3VS0A 4NU1A 3BRBA 5CX9A 3QUDA 1JAMA 5M4FA 3MWUA 3SW4A 5KHWA 3C51A 1KOAA 3DDPA 3ENHA 2VV9A 3TZ8A 5K4JA 1JLUE 3W0QA 3I0QA 4LQMA 5ANKA 1IAHA 3VQUA 4KUJA 1KE7A 4O0SA 3MS9A 5CQWA 3GCSA 4L7FA 4ZLZA 3CBLA 4BDBA 4FSRA 5D10A 5E8ZA 4G3DA 2R64A 1FINA 2ZJWA 4FNXA 4RIWA 4EH3A 2X9FA 1YKRA 4F6SA 5EI2A 4AFEA 2BRHA 3DB8A 4AZSA 3I79A 4DG2E 1ZOEA 2VO0A 2J5EA 3BYUA 4D1ZA 2WELA 3B8RA 4NL0A 1KV1A 2G2HA 2B55A 4AS0A 1TVOA 4ORKA 3C4CA 4A7CA 4FV0A 4RIYA 1GJOA 2YAKA 3ZU7A 3ZXTA 4B7TA 4RQKA 4KBAA 2B52A 5T3QA 5AM7A 3R7OA 4ZLOA 3U6IA 4W4WA 5FDXA 3FZOA 5AP0A 4D2RA 1PKDA 2WMBA 3CS9A 5EKOA 4K2RA 1OKVA 4WNPA 5DN3A 3WYXA 5CEOA 5LVPA 4O7NA 4LGGA 4AZWA 4FICA 4JAIA 5DRDA 4YJNA 4APCA 5C4LA 2F2UA 5HHWA 2BCJA 1WBOA 3WZKA 4J99A 3DK3A 1Y57A 3FLYA 4I23A 3TWJA 4IQ6A 1H01A 3UOJA 1OI9A 5DRBA 1K2PA 2VTMA 2R9SA 1OIUA 3KXXA 3QWJA 5H3QA 2GNLA 3TM0A 3DU8A 5ANIA 5IH4A 3QYZA 5EH0A 5JFWA 1K3AA 4WNMA 2C5XA 1Q41A 4IBMA 1JPAA 5F9EA 3UP2A 3FXXA 3PE2A 2G2IA 5D7VA 3UNJA 1YHVA 4CRLA 1VJYA 2BZHB 1J3HA 2C6MA 3PJCA 5JGAA 4GUBA 3RGFA 3RVGA 3QD0A 3TKHA 1OKYA 5LARA 2GNGA 4BCPA 5BUIA 2IVVA 1UA2A 4UEUA 3PIXA 4YHFA 1PXLA 2WU6A 5BVKA 3KXHA 4BKJA 1FMOE 2XH5A 4XRLA 3BLQA 3EH9A 3NUYA 4YBJA 4ZK5A 3P79A 1S9JA 4JI9A 4XG9A 3TV6A 2HZ4A 5DIAA 5HG7A 4TL0A 2Y9QA 5LVLA 3UQCA 3BEAA 3FLSA 4ZOGA 4KD1A 4L42A 2IW8A 4CZTA 4DYMA 3RCDA 3DQXA 1DI9A 3P7CA 1XWSA 4BCMA 4QPAA 5LQFA 4KSPA 4RWKA 2YCFA 3TUBA 4IB5A 4OGRA 2UZTA 3P5KA 4DFLA 4LV8A 3ZO4A 3G6GA 4FKQA 5BVEA 5HX6A 2ESMA 4Q5HA 1NW1A 2R3KA 3H9OA 1SM2A 1FOTA 3L8SA 5IA4A 2W1CA 4C3RA 5H2UA 2PVMA 2W9FB 2ITOA 4Z7GA 4KKGA 3AC3A 3KXZA 4RVLA 5KKRB 3VRYA 1HCLA 2FGIA 4GT4A 4WZYA 4MEDA 1PXNA 2HWPA 2X8IA 5DVRA 3SGCA 4QMSA 2YM6A 4TY1A 4FIHA 4G3GA 3WARA 3IDPA 4KBKA 3OWJA 4QYGA 4E6QA 4FZAB 4OTIA 3ZDUA 4Y46A 1PW2A 2ZAZA 4TWPA 4IIRA 4PL3A 2C3JA 4HPUE 4C4JA 4JRNA 2A27A 3M2WA 3LCKA 2W4OA 3CD8A 2R7BA 3L8XA 4X6RA 5GJFA 4OBQA 3RTPA 4R77A 3OCTA 4O38A 3VC4A 2CLXA 3GB2A 3SD0A 2VTOA 2QO9A 3C4XA 3CR0A 5L2WA 5H8GA 3QQJA 3P86A 3PVUA 4GFOA 1YXXA 3NRMA 1XHAA 2PULA 3G0FA 1RJBA 3CXWA 3ORXA 4U42A 4XBUA 3VS4A 1PKGA 5L8KA 2VX1A 5HD7A 4E6AA 1M17A 2IJMA 2XBAA 4V01A 3DAEA 2WGJA 3Q9YA 1FPUA 2FSOX 3QQLA 3GU6A 5H8BA 4E8AA 4YU2A 4WUAA 2H9VA 4P2KA 3AD6A 2GNFA 1JBPE 2X2MA 4G3CA 3VS1A 2UW9A 3DPKA 2OH4A 3W1FA 4OTFA 4TYIA 4H1MA 1STCE 2VX3A 3W2PA 5IA0A 4DINA 4FV3A 3N4TA 2PVNA 3BLRA 3QZIA 4XG4A 5CEPA 3GGFA 4CG9A 2XNMA 3KRXA 4BGGA 2FB8A 5KBRA 5IQDA 4MYGA 2C1BA 4FVPA 4KS8A 5FP6A 3C0IA 4QMOA 3QGWA 1XBBA 5FEQA 5D9HA 3ATTA 3BQRA 5EM5A 4F08A 2WNTA 4ZTRA 5C4KA 1KOBA 3FMLA 5JZJA 4I22A 4WD5A 3EOCA 4W4XA 2XJ1A 4N6ZA 3TIZA 1IRKA 3QXPA 4TYHA 1NXKA 2QU5A 4U9AA 4DG3E 5M08A 5DLSA 5I9ZA 4X7QA 2GTNA 3WZDA 1ZY5A 2DYLA 4M3QA 4OTWA 1YVJA 5M4IA 2O0UA 3FZSA 4JQ8A 3VS3A 3TDVA 3MBLA 4EOQA 3EL7A 4GU9A 3R21A 3QTZA 3PZHA 1OIRA 3UE4A 3TV4A 4G5JA 4WG5A 1MRVA 5FM2A 3G0EA 3LQ3A 2Y6OA 3N51A 5AX9A 4BR3A 2JKMA 1U54B 5BYZA 3R71A 3V5TA 4EHEA 5J9LA 4F6UA 2WQNA 3KK9A 3BPRA 4XHKB 5A54A 2X6EA 3AXWA 3QTXA 3ID6C 5EI6A 3E62A 1ZMUA 1G8SA 1CDKA 2P2HA 3QZHA 5JRSA 3BCEA 4MKCA 1JSUA 2R3JA 2VUWA 2X7FA 3MVHA 1P5EA 3NIZA 4GK4A 4OTQA 4XV1A 2JD5A 3PSCA 3KMUA 3O96A 5F95A 2JIIA 4J53A 2YM4A 5AV3A 4PNIA 5FUTA 5HG8A 5KZ0A 5HNIX 3TYKA 4PDSA 2ACXA 3K3IA 3WBLA 4BHNA 4O0TA 1PY5A 4TNDA 3GU4A 4C62A 4EWQA 5B2MA 2UW7A 3IO7A 1Q8YA 4EHVA 2WMXA 4USFA 1ZAOA 4IMYA 3U4UA 4AFJA 2A4LA 3E92A 2UW3A 5HVKA 4M84A 3VS2A 4FEXA 2V7AA 4WA9A 4RSSA 2WXVA 3LW0A 3GI3A 2XCKA 1VR2A 4I4EA 3BU6A 4YTHA 5JFVA 4AWIA 1ZARA 3IK3A 3R2BA 4YJPA 4LL0A 4Q9SA 2XRUA 2QOIA 4ZS4A 3D94A 3TTJA 2XKDA 4L7SA 2XIKA 3CPCA 2VWYA 2YDKA 4AOJA 3CKXA 2CKEA 4RWLA 3O7LB 4DFBA 1I44A 1R78A 3UIXA 4UBAA 5L2SA 5CSHA 4MNFA 1QPCA 2VWWA 4FKOA 3MIYA 4CGAA 2WTIA 3HVCA 1YWRA 4XG7A 2BZJA 4YPDA 3U8WA 1QPDA 3K3JA 2QOCA 3TNHA 2O5KA 3UDBA 3DKFA 3TZMA 2B9FA 2FO0A 2ZDUA 3CTHA 4XMOA 3QA0A 1M2RA 1GOLA 2WTWA 4UYAA 1KWPA 3Q9XA 3NPCA 1H0VA 2VTHA 2VNYA 3NUPA 5IUHA 4IC8A 4J71A 4DCEA 2X81A 4C3PA 4OLIA 4TZRA 2WMAA 4CLIA 4YTCA 3UBDA 3I7BA 5CSWA 2E9VA 3W2SA 1BL6A 5EDQA 2V55A 3F7ZA 1SNXA 4FKGA 1W8CA 4BDEA 4MF1A 1OL5A 3ATSA 3DFAA 3TN8A 4AT4A 3L8PA 5IQGA 1BL7A 4BDCA 2OF2A 2ITXA 2WQOA 3V04A 2B9HA 4YURA 2E9NA 4FKJA 3OD6X 5TR6A 4QTEA 2OZAA 4ASDA 2OJGA 4ASXA 5L3AA 3D2IA 3EYGA 4UWYA 3GEQA 5IA1A 2F7XE 5IPJA 3OWLA 3F5GA 4IZYA 1Q3WA 4L9IA 2YACA 2WD1A 4FL1A 4U94A 4EYJA 3IW5A 4JR3A 2EUFB 5G1XA 4K18A 5E8WA 4BRXA 5ANDA 4BBMA 4WRGA 2X8DA 1GAGA 4KIQA 5KHXA 4FSYA 4U97A 4V04A 5EYDA 1S9IA 3DJ7A 1ZZ2A 4MK0A 4RG0A 2GQSA 3BEGA 1WZYA 3DBDA 3P08A 4Y72A 3VHEA 3COHA 2YISA 4J8MA 4EORA 4HVHA 2Q83A 3FLQA 3EKKA 2IZTA 4WO5A 3RALA 3K5VA 3O2MA 4RIXA 4G9CA 3BBWA 3IW6A 4R3CA 2WMSA 3EWHA 1MRUA 3CY3A 4RC4A 2XKEA 4NK9A 5E7RA 5D12A 5LMBA 2XEYA 5ACKA 2XIYA 1M7QA 4X2JA 3PSBA
chains in the Genus database with same CATH superfamily
5BVNA 2ZYBA 2DUVA 1Z57A 1OGYA 1U46A 2BHEA 2GNIA 2NP8A 1YOJA 3OXTA 3R73A 2CN8A 5CVFA 4E93A 3V8SA 3ZYAA 4L45A 3IW7A 4HYSA 4ID7A 4Z9LA 2R5TA 4WUNA 3RJCA 2R3MA 1V0OA 3QC4A 3AC2A 4ZSJA 3VNTA 4BCNA 1LPUA 1M14A 3KGAA 3LXPA 2VTNA 1YI3A 4BCIA 2XM9A 1IR3A 4CXAA 4ASZA 2YIRA 4M14A 3MY1A 1CMKE 1OL6A 2KULA 5CALA 3ACKA 5A4LA 4FNWA 2HXQA 2W0JA 3FY2A 4KNBA 4RJ8A 3PXZA 4ANBA 3BHUA 2FSTX 2B9JA 4FV9A 3N4VA 4F0GA 3GOKA 3PFQA 2YITA 4EWHA 2ZDTA 4X2NA 3FSFA 4S34A 5D1JA 4RT7A 2XF0A 2WMQA 5B0XA 3WF7A 3O7LD 3IQ7A 4QPSA 4WG3A 1G3NA 2CNUA 1ZYLA 2QOOA 2W06A 4MNEA 1AGWA 4C3FA 3I5NA 3C0HA 4GG5A 4GFMA 3NNVA 4N57A 1YXUA 5CXHA 4ZIMA 4C4FA 3QTSA 2ITNA 3FPMA 4AN2A 4ENYA 5AJQA 2VTQA 5FD2A 1YOMA 4HZRA 4UY9A 3MVMA 4MXOA 3MFTA 3PLSA 4ERKA 3F61A 5CQUA 1ZXEA 4F99A 2IZSA 4I5CA 4FT7A 4QP2A 2X2KA 3W0NA 3L9MA 3R00A 3WYYA 2I6LA 3E88A 2PUUA 2J4ZA 3W0PA 4RQVA 3PYYA 2W99B 2P3GX 2VU3A 4FX3A 4XP3A 2WTCA 5A4EA 2W1GA 4BIBA 5BPYA 3O17A 4UZDA 3ZCLA 3ZO3A 5IH5A 3PXQA 5DG5A 4QMQA 2Z8CA 4ZY5A 3N4UA 4Y8DA 5M53A 5AUYA 2OJIA 2BDFA 3E7OA 3EQGA 4KSQA 4O22A 5JN2A 4YZMA 5IA2A 3VS7A 4ASEA 4FSTA 2UV2A 2BZKB 2RG6A 2V7OA 2ZMCA 4QP7A 3NMUF 3TT0A 1H1SA 2OIQA 3V5LA 4C7TA 3AKLA 3E3BX 4EI4A 3SXSA 4FKVA 3UPZA 3CTQA 2J0MB 3PJ8A 2ZMDA 2I1MA 4DEIA 3ULZA 2GNJA 2WMRA 2QCSA 3TJDA 5HU3A 5JQ5A 4R3RA 4AGCA 4QTCA 2RFNA 1UV5A 4F0FA 3LPBA 4YTFA 5BVDA 4OBOA 3QKKA 5CANA 3K2LA 4U3YA 2JKQA 3Q2JA 3SOCA 4FA2A 4DEDA 4MBIA 1LP4A 4O27B 2PMLX 3VWAA 5FBOA 2QU6A 3MPMA 3QQGA 4DGLC 2C6OA 5E8XA 1OITA 4YLKA 3ORMA 3GNIB 3NS9A 4QMTA 4KAOA 4ANLA 3P0MA 2OW3A 2G2FA 4ZSAA 2WTKC 5HI2A 2BRGA 3LMHA 5IQCA 5CF4A 5GIPE 5DWRA 3HMNA 3OBGA 4U45A 3KRJA 3O8PA 3VAPA 4JIKA 3VBXA 4NJ3A 3R01A 4JL9A 4EBVA 4K8AA 5A6OA 4ZSEA 4YO4A 2VWUA 4IH8A 4D4SA 4ACCA 4QDEA 3LAUA 1Y8YA 4J7BA 3P23A 3GT8A 5ETAA 3W0MA 5CU6A 4BCJA 4F70A 2ZV8A 3JVSA 5EOLA 2A2AA 3S2PA 2XJ2A 3F5XA 3VUDA 5J7HA 2C5NA 4IVAA 2HY0A 3NFFB 2EVAA 4AXFA 2UZOA 5M57A 3GFEA 4B99A 3DTCA 3A4OX 3II5A 4FTMA 3RAKA 3R28A 1ZLTA 3DBEA 4B6LA 4MD9E 1UNHA 3U87A 3VBYA 4YJUA 4PX6A 4RX8A 4MBLA 4TYEA 1OMWA 5CXZA 3O51A 3Q4ZA 4QMZA 4A4LA 3FLNC 4AZVA 4EOJA 1K9AA 1SMHA 2HY81 4PV0A 3D9VA 2BIKB 2R3OA 2HENA 4YJVA 4O96A 2VWIA 2I7QA 3AKKA 3DXQA 3LJ2A 3WE8A 4J1RA 4U6RA 2RF9A 2PUNA 2W5BA 3ZMMA 3MIAA 4H3QA 3KF4A 4C4EA 3HP5A 4PNKA 4QYYA 3SLSA 2ONLC 4MD7E 3UTOA 2UZNA 4YHTA 3VF9A 1QPEA 4XBRA 4IAYA 4CMTA 5LXMA 1G8JA 4H3BA 4RZVA 3VUKA 1L3RE 3QC9A 4YR8A 2PVJA 3PJ3A 5IZFA 5AP5A 3DZQA 1A48A 1UWHA 3DV3A 5CEIA 3OMVA 2H34A 3C1XA 4A9SA 2QO7A 4NJDA 4AF3A 2C5VA 3WF6A 2LGCA 3SVVA 2E9PA 4FVRA 5DT4A 4YJRA 4C37A 4RX7A 2VTRA 4DFUA 4RC2A 2RG5A 3FPQA 3PY3A 3HV5A 2BKKA 4GL9A 2XNNA 1KUTA 1U5QA 2ITQA 4NZWB 3UO5A 2XCHA 3A7HA 4V0GB 4BVUA 2X8EA 3FHRA 3OS3A 4FSMA 4FUXA 4PF4A 2J0IA 3AT4A 5JQ8A 4CFWA 3DT1A 4M69B 2XYUA 2VN9A 4HGTA 4ZTHA 5CF6A 3PXFA 4O81A 4DH3A 3PXYA 3OT3A 3GUBA 4O7TA 3ZDIA 2BRMA 4TWCA 3PRIA 3RNYA 4O21A 5HO8A 4ZZMA 4DA5A 4H39A 4ACHA 4PMTA 1YWNA 4CSVA 3HMOA 1H24A 4R5SA 4K6ZA 3MTLA 4GT3A 3SRVB 2XBJA 1W0XC 5DH3A 4RVMA 2XK3A 4Y83A 2EB3A 1ZOGA 2CMWA 4FNYA 5HLWA 4EH2A 4FEVA 2YDJA 2R7IA 3NDMA 3FQSA 4MWIA 3TACA 4Q5EA 5ETCA 3R83A 3TIYA 3ZO1A 4CFNA 3MGYA 4D4YA 1OKWA 3OXZA 5ICPA 3BZ3A 2W1ZA 1Q8WA 3R1NA 5KMOA 2CGVA 3HRCA 3MDYA 4GK3A 5AV2A 3CSVA 3BQCA 5ITAA 4GYGA 3ZEPA 3GP0A 4WOVA 2E2BA 3QQFA 3VONA 3GC0A 3QTWA 2IO6A 3L9NA 4NIFB 3VF8A 4AGWA 4B0GA 3QXOA 2QURA 3F3TA 5FXSA 5CAPA 4BJJB 1F3MC 4GKIA 3UMXA 2CGWA 3QX2A 1Y91A 3HECA 4IM2A 1Y6BA 2JBPA 4RIYB 4E4XA 1XMLA 4S33A 5HG9A 5HIDA 5E90A 4AQCA 1ZZLA 4E73A 1O6YA 2RL5A 4X3FC 2UUEA 3TXOA 5C8NA 3TEIA 2WOTA 4DHJA 3C4ZA 4K11A 5BUEA 3E7VA 5GIOE 5M07A 2GNHA 4FIGA 5IEVA 4DITA 4DHFA 1CSNA 3QTUA 3FYJX 3ML1A 1J7UA 5AP4A 5LWMA 5JFXA 4G3EA 2JC6A 3BBTB 5DT3A 4N6YA 2IG7A 3SXRA 4D5KA 4O91A 3I1AA 2C5OA 3JR1A 4EZ3A 4FK6A 5A6NA 2FH9A 5IQAA 4XG8A 5DE2A 3Q04A 4EC9A 4DFXE 3ZSIA 1NVQA 1OIYA 1VYWA 3KCKA 4G34A 4IADA 1VYZA 4JT3A 4L52A 2J0LA 4D9TA 1H4LA 1Q5KA 3E8DA 3F3VA 4Q9ZA 2X2LA 4FL2A 2FUMA 4EH5A 3PP1A 2A1AB 5KKRC 1FVRA 4IWPA 4XRJA 4BIDA 4DH8A 2W1FA 2JKKA 3Q4CA 1AD5A 3R8UA 1CKIA 3KCFA 3W2RA 5AAGA 3QRKA 2WMVA 3OY3A 1FGKA 3QRTA 5C01A 3R6XA 1BUHA 5HCZA 3RPSA 3ZO2A 3W2OA 2FVDA 3E93A 3HX4A 3Q32A 4YJTA 5EDRA 4C58A 1BYGA 4NCTA 4F7LA 3A7FA 3NAXA 3THBA 5CAOA 2YHVA 3DQWA 3FZ1A 3Q6UA 5CLPA 4F7SA 5HQ0A 4KWPA 4DHZA 2PVLA 3R9HA 1YRPA 5CI7A 3NVKI 5FTGA 4FG9A 4EZ5A 4UXLA 2FYSA 1JSVA 4TWOA 4I6HA 4OR5A 2PYWA 2X7GA 2IW9A 3KMMA 2R3IA 4O0RA 5HCXA 1GZKA 1PJKA 2IVUA 4FV8A 5E8VA 5AUZA 4ONAA 5AM6A 4CCUA 3G2FA 4F9WA 3SV0A 3R1SA 4EH8A 3VBQA 4BI0A 1TKIA 1U5RA 3OXIA 3V8WA 1V0PA 3BU3A 3EQRA 2G01A 3DKGA 1WBWA 2C6EA 3OZ6A 4HCTA 4UXQA 3SW7A 4EKLA 2JFLA 1UVRA 2QOFA 4QTBA 5H9BA 4I0RA 4TYGA 1H07A 2F4JA 3DTWA 3GC7A 3DLZA 2WIHA 2R3NA 3DB6A 3GFWA 3MFRA 4FKWA 3QTRA 5I9UA 3NIEA 4YJOA 4IX6A 4R1YA 1WAKA 2R3PA 4DE4A 4WBBB 3EB0A 1XH5A 4O0UA 4RLKA 1RW8A 2UW6A 5AUXA 3UJGA 4L3LA 4FE2A 3Q52A 4X2GA 4QP1A 1JSTA 4G16A 2RKUA 5J9YA 2Z02A 4GJ2A 5CVHA 5IU2A 2JGZA 3AOXA 3OUNB 3VBWA 2YA9A 4AZFA 5DFPA 3O8TA 5JSMA 4F65A 3EHAA 3U54A 4C4HA 1OPJA 4DFNA 3CJFA 2OU7A 5J95A 2C6DA 5GINE 4U98A 1CM8A 3V6RA 3FUPA 3UVRA 3PY1A 4XV2A 5HE1A 3AC5A 2ZV9A 3GC8A 5JGDA 3AC4A 3F3ZA 1QCFA 4QMMA 4C34A 5KMJA 5JRQA 4QYHA 2QOHA 2I0EA 1PXIA 4EKKA 2C4GA 2O65A 4AQKA 2Y0AA 3NAYA 1H27A 4K77A 2QG5A 3PPJA 3MJ2A 2R2PA 5HX8A 3HAMA 2YCRA 3EFJA 4IM0A 2IPXA 2C47A 3F3WA 4X3FB 3RNIA 4BCFA 3UZTA 2VX0A 5FRIA 3KULB 4Y95A 4AZEA 5B2KA 5CEMA 5F94A 4S32A 4HCUA 3S4QA 5AUUA 3QLGA 4GYIA 2J0JA 3FYKX 2BPMA 3ZC6A 5J1VA 4AAYA 4F64A 4HZSA 4CLJA 3DJ5A 4PQNA 4AX8A 4EZ7A 2O64A 4IB1A 3UZRA 5IA3A 3WZJA 5HTCA 3OY1A 4RIOA 2R3FA 3SQQA 4X21A 3G33A 3QUEA 4RA5A 1GIHA 3PE1A 4AOIA 3TG1A 3W33A 4D5HA 4FZFB 4P5QA 4ZJIA 2YIYA 4GIHA 4TYHB 3EJ1A 4AT3A 3RHXA 4HGLA 4A9YA 3LCOA 1SVHA 4G6LA 5EHYA 4U80A 5TT7A 3UDZA 3ZXZA 4YLJA 1ND4A 3R9DA 1ZRZA 4GSBA 5CSXA 4Z7HA 3QD3A 1H0WA 5LJJA 4LUEA 3QA8A 4BTKA 5EK7A 4B8LA 5H8EA 2XUUA 4S31A 4GJ3A 3MV5A 4R7BA 1P14A 1OGUA 4AUAA 4TN6A 4CTCA 3FMKA 1JVPP 4OTDA 1SVEA 4NSTA 5HE2A 3REPA 2HW7A 4FGBA 2O2UA 2YWPA 4XJ0A 3TI1A 4CCBA 3EKNA 3FMNA 3FMEA 4E6CA 2RIOA 2CKPA 4DFYA 1WMKA 5IMXA 4XH6A 2R0IA 4CFUA 1CKPA 3ZLYA 4B8MA 4DEEA 1XMMA 2GS6A 3FLZA 4IVCA 4QP8A 4DFZE 4K33A 4U41A 4LI5A 1A06A 1M7NA 5ANOA 4I41A 2X4ZA 4IB0A 5AP1A 4ARKA 2C3IB 3H9RA 3R0TA 4OW8A 5E8UA 1JOWB 3BX5A 3LFDA 4FIIA 2PUIA 3H30A 4KBCA 4MBJA 5KO1A 3MW1A 4RMZA 3HA8A 5AV4A 4Y85A 2FA2A 1Q8ZA 2C6IA 2F2CB 4L6QA 1JKLA 2R3RA 3A99A 2XANA 5KNJA 5I5ZA 1E1XA 4ZS0A 4E1ZA 3LXNA 2PU8A 2IWIA 5TO8A 5I0BA 4WBOA 2UW0A 3OTVA 4LYNA 3R9NA 4BF2A 4BCOA 4IFCA 3KU2A 1WVYA 3R2YA 3D15A 1OBGA 4FODA 4IHPA 4O0YA 4RFZA 5J8IA 2YFXA 4MXAA 5JH6A 2WHBA 4O84A 3HKOA 4F09A 1MUOA 1R1WA 2C5YA 4L3PA 5EM6A 4RX5A 5GNKA 5IH6A 5CENA 2GHGA 3OEZA 5HIEA 2QONA 1URWA 1JKSA 2VTSA 3KXNA 4L53A 4USDA 5LMAA 4AE9A 5A14A 4L01A 4YNOA 1UU3A 3DXPA 2BHHA 4DH5A 1OZ1A 3EMGA 4LUDA 3NUXA 1IA9A 2YM7A 2WMUA 4UALA 4L46A 3H4JA 5AV0A 4WNKA 4ANSA 4QMLA 4KINA 1MQBA 4I20A 5LOHA 2UZDA 4ALWA 3S1HA 3C50A 1YDTE 1MP8A 2PY3A 4P7EA 2YEXA 3DNEA 3OCSA 3R7UA 4ZMFA 3BV2A 4QMYA 3VJNA 1CKJA 5T68A 3EN7A 2R3LA 2BR1A 2VGPA 3LQ8A 4LFIA 3F5UA 5DHJA 2ZOQA 5CI6A 3MN3A 4M0YA 3MY0A 3PJ1A 3FI4A 4RRVA 3HP2A 5E8TA 3FAAA 5EQPA 4IAFA 3Q3BA 5CAUA 3R02A 3PIZA 5CTPA 4EK4A 4NH1A 2XIXA 3SG9A 4FTOA 5HBHA 4C2WA 3HV7A 4AA4A 4CFVA 2HZIA 5C03A 2GFSA 2XYNA 4CEGA 4JDHA 2WAJA 4RIXB 2UVXA 1OB3A 2XK6A 5HCYA 5HLNA 5LMKA 4JXFA 3S3IA 5JEBA 4DDGA 4EUUA 2V22A 1H00A 4TPTA 4D4RA 5IQBA 1URCA 2VO6A 3KF7A 2C0OA 3QCQA 3KRLA 3LCSA 3PPKA 4L43A 2HAKA 4O7WA 4RFYA 1EH4A 1W7HA 4RGJA 4F7JA 4EEVA 5CU2A 3V3VA 4KRCA 4CTBA 1Z5MA 2PVRA 4C35A 1PXPA 4BCQA 1OKZA 4E4MA 5E4HA 1GZ8A 2QOQA 1NA7A 2NNWB 2UW5A 3LMGA 3DKCA 2GTMA 5L8JA 5A4TA 2BIYA 1M2QA 2W7XA 2Z2WA 3LJ0A 4G5PA 4JIAA 1SVGA 4XUFA 2OWBA 4QP4A 2CHLA 3P1AA 3FXZA 1OL1A 3IGOA 5CEQA 4I6QA 3PA5A 4IANA 4RPVA 2PVHA 4NYEA 1M52A 4DTAA 1APME 4FTLA 5J87A 1Q61A 4HNFA 4I93A 3DCVA 3OHTA 4IZ5A 2WTVA 4FV1A 5EW8A 2HZ0A 4NKSA 3W0RA 1UNGA 3BU5A 3Q53A 1KE5A 4GK2A 4BCKA 4D1SA 4XLVA 4F1MA 3E8NA 3MYGA 3Q4UA 4MNEB 3RPVA 4EUTA 4TTHB 3NUSA 4IZ7A 4H36A 3MPAA 2GHMA 2P2IA 3UYTA 2BDJA 1O6KA 4M67A 3QCSA 2OLCA 1YXVA 3F82A 3KB7A 4C61A 3D5XA 4EONA 5JT2A 1ZYDA 3DFCB 3FMMA 3UMWA 2C3LA 2RGPA 4MQ2A 2Z7LA 3ZUTA 3ANQA 3R22A 4YZCA 1H1QA 5BMSA 3MH2A 3R1QA 2PWLA 3QRUA 1YDSE 4QQCA 4TT7A 4EQMA 3EQDA 4CFFA 3A8XA 4BI1A 4CG8A 2CNVA 2J0KA 4B4LA 3NNWA 4JS8A 4FZ7A 1Q8UA 5G6VA 4FEUA 3UVPA 2XP2A 3QU0A 2GFCA 3TL8A 4EOKA 3ZBXA 2HZNA 1R39A 2XIZA 5BV3A 4BBFA 3PG1A 2LAVA 2UZLA 4FI1A 2IZUA 5CZIA 3FY0A 4KS7A 1YWVA 2VTAA 5A46A 4CT1A 4CMOA 3F2NA 1O6LA 3FBVA 3OWPA 3QCXA 4IEBA 5BX0A 1U54A 1XH7A 3H9FA 3SA0A 5DYJA 2KTYA 4ZZNA 4OBPA 3CY2A 3FC1X 2ETMA 3ZSHA 2BAKA 4JDKA 3D7TA 3MVLA 1ZMWA 3RK5A 5I4NA 1TFFA 3IOPA 4ZEGA 4AXAA 4QYFA 2YN8A 3POOA 1B39A 2XK4A 4QDVA 3C5UA 3C4EA 2JAMA 4QQ5A 2QD9A 4AXCA 4HVGA 4O6LA 4BCHA 3DK6A 2OBJA 3ALOA 4EOPA 2XK7A 4FV4A 5FTOA 1IASA 3ZM4A 4FT9A 4UWCA 3KN5A 1IEPA 3QHRA 4PDPA 4YJQA 1WFCA 3LXKA 3PWYA 4WKQA 1W83A 3WIKA 3HGKA 3ZFMA 4FTNA 2O63A 2W5HA 3CLYA 4BDAA 5I9VA 2PL0A 3CGFA 3D5VA 5DR6A 3QRIA 3MI9A 1G8AA 1H25A 4FKRA 2YERA 3PY0A 5JZNA 3A62A 5FEEA 5C27A 3BELA 5KMMA 3ZTXA 3MVJA 3RM7A 2Z60A 2ITTA 3HMPA 4F1OA 2VWXA 3BL9A 1PHKA 4G1WA 3R9OA 3HDMA 3E8EA 4EK6A 3QF9A 4A9UA 4LG4A 3WZEA 4U3ZA 4EK3A 1XH6A 3FKLA 3Q5ZA 3QL8A 2WU7A 4CKRA 3PTGA 5LCKA 2BAJA 3S0OA 1YQJA 3CD3A 3CQEA 1IAJA 4IB3A 2HOGA 4CFMA 3P7BA 5AA9A 5AA8A 3NZ0A 4E26A 2VTTA 4MXZA 5FQDC 4QMUA 3BLAA 5L6PA 3BYOA 3RPRA 4EYMA 5M44A 4A4OA 4A07A 3OG7A 5AAEA 1LUFA 4O7PA 3RK9A 2BAQA 3N9XA 3A4PA 4GT5A 1UNLA 4FSQA 5EYMA 3ROYA 1OPKA 2XRWA 4MUQA 2PMOX 4MX9A 1QPJA 2V5QA 4RA4A 3BWJA 1G8KA 2B54A 3HRFA 5ACBC 4AE6A 4PUZA 4NTSA 3PXRA 2XNPA 3JXWA 3S95A 4CKJA 4USEA 3LCDA 1R0EA 5L2IA 5AX3A 4E4NA 2VTIA 2V62A 1LEZA 4BZNA 4IFGA 2QO2A 4EJNA 3ALNA 2B1PA 3HL7A 3HUCA 5KCVA 3PUPA 3E5AA 5AP2A 2OH0E 2EXCX 2C0IA 3LLTA 4QTAA 3NYNA 5TKDA 3W2QA 5C8KA 5JKGA 3UVQA 3BHTA 2F57A 4FEWA 4RJ6A 4XEYA 5GJGA 5M4UA 2QLQA 1JWHA 4RWIA 4DGMA 4KKHA 1OIQA 3HV4A 4R78A 1UU8A 4M7IA 4BDJA 4BI2A 4Q2AA 3NFGB 4BBEA 3GCVA 3OBJA 4FT3A 2YCQA 1YI4A 2G9XA 4LV5A 5I9XA 1ZOHA 2IW6A 2XALA 3G9NA 2YZAA 1KE8A 1GIJA 1P4FA 1WVWA 4FOBA 2BROA 4JLCA 4M68A 3LFAA 3HZTA 5JFSA 4CT2A 5FXRA 3OUKA 3EFWA 3O71A 1H08A 4QNAA 3VBTA 1ST4A 2BZIB 3AT2A 3Q5IA 4TXCA 5IUGA 5C9CA 3CPBA 2WTJA 4ZLYA 4D4VA 3OEFX 3AMBA 5L2TA 1V0BA 3FSKA 4BIEA 4PP7A 3COMA 2GU8A 2JIVA 3MFUA 2YIQA 3WIGA 4WIHA 2VWBA 2Z7RA 4FTRA 2BMCA 3V5PA 5BVFA 4H58A 2BKZA 4ZTSA 3BLHA 4BTJA 5IDNA 4UX9A 3LE6A 3NYVA 5TOZA 3CJGA 4BGQA 4ERWA 1UU9A 3QQUA 1VEBA 4WHZA 2OFUA 2FSMX 3BHYA 3G15A 3ZLSA 5CEKA 5IQFA 3IDBA 3SX9A 4D55A 4GG7A 4GVJA 3TNPC 2WMTA 3MB6A 1UWJA 3DJ6A 5DT0A 3NEWA 3ZSGA 5DI1A 2J50A 4FIFA 4JDIA 2YJSA 3FI8A 4I0TA 4HPTE 5F4NA 3GQLA 2CJMA 2YZLA 3LQ5A 3LVPA 3PVBA 4XV9A 3ZONA 2OO8X 5AUVA 2BDWA 3TCPA 4O82A 2OJJA 3D83A 3UIBA 2ITUA 5HBEA 4HGEA 3QBNA 3UGCA 3UQFA 4IAKA 3LLAA 4D9UA 3G90X 2AYPA 4RX9A 2B0QA 3DBFA 4I6BA 4UZHA 3ITZA 4F4PA 2BTSA 4FL3A 1NY3A 3NCGA 4YUQA 3EFKA 3QUPA 2F49A 3EFLA 2PVYA 4JVGA 3TUDA 2DS1A 2C69A 3NW5A 3O50A 4DLJA 2UZBA 3ZC5A 3PA4A 4XG6A 2YM3A 4JR7A 4QMPA 3SHEA 4E6DA 1B38A 2F7EE 3FQHA 2PPQA 5HKMA 3TKIA 4AW2A 4F9BA 1H1PA 1IA8A 4ZSGA 4AW0A 4XP2A 4IDVA 2Y7JA 4PTEA 5LWNA 2J6MA 1NVRA 1JKTA 3NUAA 1E9HA 2BVAA 2W1HA 4I24A 3MB7A 4U7ZA 4JBOA 4UWBA 4NM3A 4ITIA 3B2TA 3LMIA 3UIMA 1P2AA 3PVWA 2BALA 4BDGA 4YP8A 4R1VA 2R3QA 2H6DA 4K9YA 5FEDA 5C8MA 4I21A 3IDCA 2GQGA 3DBCA 4IVBA 1Y8GA 2WZJA 5HE0A 1P4OA 1OECA 4RFMA 3M1SA 2UVZA 3PA3A 5AMNA 4WSYA 2ETKA 2X1NA 2XM8A 3WI6A 4YZNA 1J1BA 3U6HA 3U51A 2W96B 3KIOC 2WEIA 4EH9A 3OFMA 2NRUA 3V5WA 5EW9A 4YGAA 5M55A 1T46A 1FVVA 4FKSA 2O3PA 1OPLA 1Q62A 4DLIA 3JS2A 3GCQA 1YI6A 5EM7A 5EW3A 4LRKA 5KUPA 3F2RA 2OXXA 4PDOA 5K9IA 2UZEA 1Q4LA 4YC3A 3OTUA 4S2ZA 4BICA 1JNKA 2PZIA 3QRJA 3RWQA 3BYVA 2J2IB 3OC1A 4GUEA 2X0GA 3FDNA 2CLQA 4DGOA 4F6WA 4RIWB 4J97A 5M56A 3QWKA 2O8YA 1PF8A 2BFYA 2QOBA 4I0SA 4PL5A 3ZUVA 5J1WA 3VO3A 2X4FA 4BCGA 4G2FA 4CKIA 4NM7A 3DZOA 4O7YA 4A9RA 3WF5A 3PP0A 1ZY4A 3B2WA 4YHJA 2YCSA 5LCJA 4ZTMA 3AG9A 3VVHA 3EQFA 4JRVA 4MH7A 3QFVA 1BI8A 3KC3A 4FT5A 4CVAA 3Q6WA 1J7LA 1ST0A 3BHVA 5K3YA 2PZRA 2AC5A 1ZYJA 4JX3A 3GENA 4D0WA 5HNBA 1PMEA 3LM5A 4G6NA 2W1DA 4HVIA 1YXSA 2YIWA 2ITPA 3E3PA 1W84A 2ITYA 5HVYA 2C3KA 5HG5A 3W8QA 5IEYA 3ZRKA 4Y73A 3UP7A 1XH9A 4DBNA 4C38A 4YSMA 5IA5A 4DH1A 4RC3A 3PIYA 4FKUA 2W4KA 2OIDA 3MSSA 3C5IA 2OJFE 4AGUA 4YZ9A 3ODZX 2P4IA 3UC4A 2IVSA 3OW3A 3OT8A 2CN5A 3I6UA 5E9EA 3V01A 3NX8A 4E5AX 4NFMA 4O7VA 1J91A 2ZB0A 4ANQA 2B4SB 4FOCA 4QP3A 4IX3A 2VTLA 2JDTA 2PK9A 4FGRA 4FTTA 3KL8A 4S30A 3FZTA 2C68A 3GVUA 3R7VA 3RAWA 3O0GA 3EN6A 3EL8A 2R3GA 3TZ9A 3EYHA 3QCYA 4E5BA 3UOLA 4FKIA 4PY1A 3W32A 1SYKA 1XO2B 2JDSA 4M8TA 4FV6A 4G9RA 1PXOA 2JKOA 5D41A 5E8YA 3ORIA 2CCIA 2V0DA 4NM5A 4EH4A 4F0IA 4F7NA 4AW5A 2WQEA 3GCUA 3BYSA 3QD4A 3TNIA 4FIEA 3H0ZA 4NW6A 5I9YA 4DTKA 4GMYA 3ZEWA 1M2PA 1R3CA 1Q24A 3UG1A 4BYIA 3V5JA 3ZS5A 1YOLA 4R6VA 5AWMA 2W5AA 1OVEA 5FLFA 4FTAA 1BX6A 4C2VA 3ANRA 3SRVA 2JLDA 4QMVA 5DBXA 3S00A 3D14A 1HCKA 3RINA 2VWZA 3V6SA 4WNOA 1TQIA 2C6TA 3LIJA 3UOHA 3SKCA 5AIRA 3HEGA 3IOKA 1REJA 4NUSA 5ANGA 4DH7A 4KIOA 5CNOA 1WVXA 4ACGA 5KE0A 3L9LA 2OIBA 2CGUA 3VHKA 3W2CA 4CV9A 1QL6A 3HLLA 4GFGA 4XOZA 2XVDA 3K54A 2HELA 3CGOA 4XNEA 5CY3A 4YLLA 4PRJA 4V05A 3RMFA 3BIZA 5B7VA 3KXMA 2CKOA 4YJSA 4EOLA 1SZMA 3NNXA 4J95A 3HAVA 4U81A 5CT0A 4OT6A 4W8EA 4BJJA 4IM3A 2P55A 4NW5A 4QP6A 5KMLA 3HV6A 5T6KA 2J9MA 2RFDA 3CTJA 4PP9A 1REKA 3R30A 4W4VA 5BVWA 2JITA 4QTDA 2ZM4A 5AAFA 2I0VA 4EH7A 4XOYA 3D5WA 3ORKA 3B8QA 4BDDA 3ZFXA 4HJOA 3P4KA 3FKNA 4JX7A 4DT9A 2YABA 3Q96A 3R63A 4YTIA 3W0OA 5JK3A 2OXDA 3ORNA 5EDPA 4GEOA 2RFSA 3M42A 3PXKA 4APPA 5HLPA 4MVFA 3FL5A 4LM5A 4ZSLA 4FIJA 5AP6A 3CQUA 1X8BA 5M09A 2HK5A 2X6DA 3IECA 4XV3A 4C4IA 4BGHA 2QVSE 3SC1A 3IKAA 3ROCA 1XJDA 3DS6A 4FC0A 4QMWA 2OJ9A 5BNJA 5D7AA 2QKRA 3ENMA 3PDTA 4AXDA 3DNDA 2HW6A 1RQQA 3PRFA 3QZFA 4LOOA 3QAME 4YC6A 4AN9A 5HTBA 1WCCA 3BWFA 2C30A 3P78A 4ZZOA 4U0IA 1PMVA 3MY5A 5BYYA 2XNEA 1BLXA 2BFXA 3ORPA 4OTHA 3T9TA 3JYAA 2QLUA 1CTPE 4PWNA 4AAAA 5L6OA 2ONLA 3ZHPC 4QNYA 2G15A 1IG1A 3WF9A 3LXLA 3CIKA 1NVSA 2B9IA