5M08A

Crystal structure of mycobacterium tuberculosis pkni kinase domain, c20a_r136a double mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
MALASGVTFAGYTVVRMLGASAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHADVNPANVVLTSQDQRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDRQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PknI
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Signaling protein
total genus 71
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m08A01
3EQFA 4GKIA 4CT2A 3IW7A 2XEYA 3SDJA 2GNHA 3R7UA 3TCPA 5A6NA 4G6LA 2R0IA 2CNVA 2R7BA 2JKMA 3MDYA 4QMLA 2WHBA 3DFAA 2PVKA 3OW3A 3RWQA 4BCFA 4ERKA 3FI8A 1O6LA 4FZ7A 4IDTA 4XJ0A 4DFZE 4E5BA 3K3JA 4GVJA 2GFCA 2R3OA 2WTIA 5EDQA 4CT1A 2WTVA 4H36A 1YOMA 3BHUA 4E4XA 2OZOA 4K1BA 3K5UA 1SVHA 4I22A 4FI1A 4JL9A 2UZWE 4D9UA 4IFGA 2JDOA 2YCFA 4WD5A 4X7QA 4MTAA 3RGFA 1J1BA 1V0PA 2P4IA 4OR5A 2WAJA 2E2BA 4PNKA 4IEBA 2HW7A 1APME 4KS8A 3LLTA 4D2SA 3FZPA 4Z55A 4FTLA 4E4MA 2J0LA 3RM6A 3RVGA 4E5AX 2XIYA 3Q4TA 5KBQA 3UC3A 2G1TA 5KE0A 3D5XA 4RVKA 4AP7A 4U6RA 3K54A 5AV3A 1K2PA 2P0CA 3GU8A 3QTIA 2XF0A 3TACA 4YJRA 2OIDA 3W1FA 2V62A 2VTLA 5EQEA 2OBJA 5C8NA 5JQ5A 1QL6A 4LMNA 3UG2A 4TWCA 4DINA 2BDJA 4XG2A 3WZDA 4C38A 5GIOE 4NK9A 2JDSA 2Z2WA 3Q52A 4QP7A 5C9CA 4BZOA 4RLLA 4ERWA 2VX1A 4EK8A 5E91A 3O23A 3RCDA 1ZYSA 2NRUA 4G3EA 4ZS4A 3ZRKA 3PZHA 4E1ZA 4D9TA 5ITAA 4TT7A 3ET7A 2VTAA 3ACKA 3F5GA 4TW9A 3IW4A 5AUZA 2OICA 4IH8A 4ZTNA 4QTBA 1U54A 3VS2A 4ALVA 2YM4A 3E62A 1URWA 3KRLA 5FM2A 2RFEA 5C4LA 5CANA 5EHYA 2WFYA 3GOPA 3QXPA 4QMPA 4MYGA 3UDBA 4BN1A 4YHTA 5KX8A 5EFQA 4J53A 4AOJA 3BCEA 4EOIA 1U5RA 2G2IA 3OXTA 4EI4A 5IEYA 5IH6A 2O65A 4GSBA 4FEWA 3HRFA 1L8TA 3MESA 2BRBA 2PZIA 1HOWA 3R63A 2XNGA 3U4UA 5C4KA 3DA6A 2R3QA 4L68A 4NW6A 1L3RE 2I0VA 5LXMA 4CMUA 1OM1A 4FSZA 5AAGA 3WOWA 3Q9XA 1YXUA 5CASA 3FC2A 2CJMA 5HBEA 2QODA 4AN9A 4QMQA 3NPCA 3QTRA 3UJGA 5B2MA 2GMXA 4UN0C 1FVTA 4XMOA 5CEQA 3NSZA 3A7JA 3NNUA 1H01A 2W4KA 4MH7A 5FTOA 5I9WA 4IMYA 5HKMA 3WE8A 2CKPA 4FKTA 4I23A 4YC8A 2P55A 2EXMA 3FMKA 5DVRA 4ZTLA 5GHVA 1PXJA 3FKNA 4HVGA 3FJQE 3ZBXA 5AIKA 5E4HA 3RALA 3V6RA 3COIA 3NAXA 5E8VA 3GFEA 4FKLA 4G3CA 2HK5A 1ZLTA 2XH5A 3Q60A 1H0WA 1DM2A 2QOIA 2VO6A 4ZTMA 2P2IA 4AZSA 4K0YA 4PNIA 5HTCA 5IISA 3GBZA 5EI8A 4GUBA 5E92A 4U3YA 4E6DA 5M57A 3PXRA 4R7BA 5A46A 4WIHA 2BAKA 3D5VA 3IG7A 4CFWA 5EI6A 3KVXA 4O91A 3RP9A 4DFXE 4XLIA 2J0JA 4YLKA 3VBWA 1VEBA 2OGVA 5D41A 4F7NA 4ITIA 3TUCA 4TYIA 5DN3A 2UW0A 2BAJA 2XYNA 3CP9A 1ND4A 1W82A 4BDJA 2YISA 3Q96A 3W2SA 2YAKA 2XRUA 3ZEWA 2GS2A 2PMNX 4A4XA 2JBOA 2XIRA 2YWVA 3EFJA 5AEPA 2YIWA 4HPUE 5IA0A 4QYGA 3BIZA 2QOBA 1KUTA 3PA4A 2CGUA 2YZLA 3QD4A 3RAHA 2IVVA 4CFNA 4G9RA 3U6HA 4ACCA 1RW8A 3ZSHA 3BU3A 5BVKA 2CCIA 2R3GA 2IJMA 4GU9A 3S1HA 2X6DA 3LFDA 5HNIX 3A7GA 2AC3A 5C03A 2F7XE 5AX3A 3BBTB 2HWOA 2PVJA 3UVQA 1XH6A 4XV3A 3WZKA 3ZO4A 4RWJA 3EQCA 3VJNA 4YTIA 3P7BA 4BI1A 1WBPA 4F6SA 3CJFA 1XWSA 5ANDA 5IH5A 4FUXA 1OUYA 4F9YA 4AW5A 5HCZA 4GJ3A 4WG4A 3UZTA 4E73A 3AMBA 4GRBA 2BRNA 4OLIA 3ZTXA 5IPJA 1J3HA 1MRUA 3OCBA 3P78A 4U44A 5B2KA 4RFMA 3E92A 2JC6A 3LFQA 3MA6A 4Y8DA 3QD2B 3CSVA 5FDXA 3SXFA 4YC6A 5M4FA 3MB6A 3NVKI 1OL7A 2CKOA 4RIXB 3ANRA 2Q0NA 2I0YA 4H58A 4WO5A 3W16A 1H1RA 4ZLZA 1YQJA 2IZTA 1PKDA 3RPOA 4HYIA 3LJ2A 4TWOA 5IA5A 5D9HA 3RWPA 2VTTA 2WKMA 4GMYA 5M4CA 3FEGA 2VD5A 4AW0A 3EQGA 4B0GA 5L8LA 3FMNA 5A4TA 2RFNA 5GJGA 4G5PA 4QP8A 4IB1A 5KBRA 4I20A 4J8NA 2QOOA 4IDVA 5LOHA 4I6BA 4QMYA 5IUHA 3E5AA 4YZBA 4X6QC 4R3CA 5EHOA 3L9PA 4JX7A 4MQ2A 3MGYA 2W4OA 5EYCA 2O5KA 4YTFA 4I1ZA 3GCPA 5CU2A 3PJ3A 3TNIA 2JITA 2XIXA 2BDFA 3PP1A 2VWWA 3CD3A 4O0TA 4ZTRA 3AQVA 2B52A 4EKLA 2VO0A 4J98A 3FQEA 3ORZA 3LJ1A 2JAVA 3Q2MA 4LQMA 4CLJA 1NY3A 4EOSA 4DGNA 1PHKA 3OTVA 4I94A 4I93A 4USFA 3PXKA 3FV8A 2B54A 3LKMA 5TO8A 4O7VA 3HUBA 1LEWA 4EC9A 5IQHA 2F49A 4ANMA 3UQFA 3NR9A 3QGWA 4KINA 3IKAA 3NIZA 4AXAA 5BQ0A 5CEPA 4XG6A 2IW8A 4D4RA 3JXWA 2CPKE 2R3KA 3D0EA 4FKQA 3RMFA 1BMKA 4RSSA 1W98A 4ZTHA 3BLRA 4DT8A 1PMEA 3JUHA 4OBQA 1FGKA 4F1OA 3FLYA 5HVKA 2WB8A 3PJ2A 3FAAA 3FLNC 4LG4A 4DYMA 3DK6A 5L6OA 2ZM3A 3FXXA 3Q5IA 4JIKA 1YVJA 2JIVA 2RG5A 3I0OA 1XHAA 4YHJA 4D2RA 4D4VA 2W1DA 2W1GA 3PRFA 4RGJA 4CMOA 4V0GA 4L43A 2ITTA 2X2LA 3FLZA 4F09A 4JBOA 2X4ZA 5FD2A 5I9UA 3M2WA 5ANIA 4Y72A 3A2CA 1GJOA 4IX6A 4JBQA 2BTSA 3IGGA 4DG2E 2XNBA 3RKBA 4D58A 5IMXA 3ZO2A 1E9HA 2WEIA 3VUDA 3KXXA 3V04A 3F2NA 4FODA 2QQ7A 2B0QA 3P7AA 4NM5A 1R0PA 3ZZWA 4USEA 2J5FA 2XB7A 4RWKA 4UV0A 3RM7A 4YO6A 4CQEA 1QPDA 4MD9E 3ZRLA 5I0BA 2V7OA 3IOPA 4RWLA 5ETIA 2YERA 3MY0A 3C4ZA 3KFAA 2PVLA 4O7LA 2OFUA 3QWKA 4O0YA 3GGFA 1OBDA 4E93A 5L2WA 3TM0A 4BDGA 3R7EA 3HZTA 5CNOA 5FG8A 4JDJA 2GNFA 4L00A 4BIBA 4YJQA 2J6MA 3BLQA 1SVEA 2VTQA 4GT5A 4RIYB 4YC3A 1WBWA 5AP3A 4DF3A 2X4FA 3NW7A 3KULB 4FTMA 3QKLA 4K2RA 3MH1A 4IVDA 4AZWA 2VTHA 1ZY4A 3FZTA 4YHFA 1J7IA 3OOMA 4EQCA 3NYVA 3W2QA 4PDOA 3QCSA 2QOQA 2HYYA 3ROYA 4FTJA 5J9YA 3IGOA 3ULIA 3E87A 1JKLA 3HA8A 1OVEA 4FGRA 3PTGA 4MKCA 4RIWB 3KF4A 5CF8A 2A4LA 2W1EA 3KN5A 5I9VA 5AUXA 2PPQA 5D7VA 4QMWA 3QD0A 4BGHA 4YO4A 4PUZA 4I92A 4DFNA 5D11A 2FVDA 3FYKX 5AP4A 4GL9A 5J7HA 3PPZA 4IAFA 4NKSA 5LCKA 3RZBA 3KK8A 4BRXA 4DH7A 4XOYA 1SNXA 2GNJA 4NW5A 2UZTA 3M1SA 4KIOA 4RC3A 2XUUA 4HVIA 2FYSA 4GT4A 4NYEA 4I4EA 2GQRA 2PSQA 3C7QA 5DA3A 4EOJA 3MVMA 4BR3A 1IAJA 2IZUA 3D2KA 2VWIA 2XNPA 3GCQA 4O7ZA 4DT9A 1SYKA 3PJ1A 4IW0A 5AUVA 3FMHA 4FYOA 1PW2A 2OFVA 4C7TA 4QP4A 1OIRA 4TNBA 4O6LA 1OUKA 3U54A 5LQFA 2W4JA 4UBAA 3RI1A 3A7IA 3JY0A 4QOXA 3MSSA 1GOLA 4NJDA 5CZIA 4D4SA 2X2KA 4CFUA 4TY1A 4YPSA 5I9ZA 2WZJA 3L9LA 1BL7A 4KA3A 3QQGA 4F1TA 2I40A 1OIYA 5M07A 3CD8A 2YIYA 3KCKA 4E6CA 3SLSA 4ONAA 1NVQA 3UO4A 4FV5A 2BR1A 4TYHB 5JN2A 2FA2A 2C3IB 2X0GA 3LFFA 3Q4CA 1XBAA 3HX4A 3L8SA 4MWHA 3TIYA 3TEIA 3HP2A 4EH6A 2Z7LA 1WBTA 2C5NA 2UW6A 3WIKA 1CKJA 1V0BA 3E3PA 4CTBA 4I5PA 3PXYA 5DEYA 3QQKA 4IZ5A 3ZSGA 5CEOA 1RE8A 2OJGA 4X21A 3MBLA 4AUAA 3UNKA 3ATTA 4XG3A 4QMSA 3RPSA 5LMKC 1OBGA 2W1ZA 3FKLA 3MA3A 4WG5A 5HORA 3BX5A 5DEWA 4Y83A 3UQCA 3FDNA 3G6GA 4M69B 3E7VA 3ETAA 3F3VA 5IQEA 3MY1A 3P79A 4GUEA 2AYPA 4JRNA 2VTNA 4B4LA 2YAAA 3DS6A 4ZLYA 3V3VA 2BZKB 4HJOA 1OMWA 4FIEA 3NGAA 3F69A 3LPBA 3VO3A 4IADA 1JOWB 5HD7A 4HYUA 1BI8A 3AC2A 3ORKA 3HGKA 4QP2A 4JQEA 3FZOA 4IANA 4JJRA 3VBVA 4BGQA 4DEHA 4DEEA 4YTCA 2RKUA 3BHVA 2NNWB 1G3NA 3UP2A 4AE6A 2I0EA 3ZCLA 4BBMA 5AV2A 4FL1A 5CVHA 4RVLA 5CU4A 3TNPC 3U6JA 3PUPA 5IZFA 5DR9A 1WBSA 3TI1A 5DT4A 3H4JA 3BELA 4NTTA 5AAFA 3R8VA 2HAKA 1YI4A 3FLQA 4IACA 4EOMA 4IVBA 2V22A 2W9ZB 4U43A 2WD1A 4XUFA 3JY9A 4YBKA 2XMYA 3BE9A 2B9IA 5K3YA 1PXIA 3NRMA 4II5A 3W8LA 2GS7A 4XG4A 3G2FA 5CQUA 5CVGA 5CZHA 4RJ7A 1OPKA 1REKA 4GK2A 4FKGA 5CU6A 3SOAA 4FA2A 3C5UA 4I0TA 4WBBB 1Q3WA 4L3PA 4RA4A 1BUHA 1PJKA 3ODYX 4NFMA 4O38A 4CTCA 4JG8A 1YDRE 2X8DA 3OWKA 1SM2A 4RQVA 3OHTA 4BZDA 4F0GA 4A9YA 4F6WA 1MUOA 2YWPA 3PA3A 4ZZOA 3HV4A 3GC7A 2UZLA 4EOOA 1YOJA 4APPA 4EWHA 4XOZA 3F7ZA 4J99A 5A4CA 2XCHA 1M2RA 2UZBA 5EW9A 4QMNA 5BVNA 4FV9A 3H0YA 3R9RA 1DS5A 1PMUA 2FSLX 2H6DA 4AOTA 1FINA 3MV5A 5L6WL 1CKIA 3ZM9A 4CNHA 2IVUA 3V8TA 4P90A 4IC7A 5HX6A 2PZYA 5CYIA 5DFPA 1GIHA 2R0UA 1R39A 1F0QA 3FXZA 4FV7A 3A7FA 5HG8A 1YWVA 3QRIA 2PTKA 3UIUA 5L2IA 4CGAA 4GG7A 4JAJA 4F7JA 3AMYA 2ZB0A 1XH5A 3B2TA 1M7QA 2C1BA 2J51A 3BHHA 3RJCA 5BVDA 4CLIA 4YJSA 3MPTA 1KE6A 4I41A 5AX9A 3W55A 2WMWA 4D0XA 5EH0A 3EN7A 4FK3A 2R3MA 4O7NA 5D1JA 5FTQA 3Q6UA 3ZU7A 2OI4X 3D7TA 4AZFA 3NYNA 3F5PA 1WBNA 4ZTQA 5JMSA 4LL5A 1ZZ2A 3UOKA 4I21A 5FRIA 4R3PA 5CEIA 3HEGA 2VU3A 3DU8A 5JEBA 3LW0A 3B8QA 3ORIA 4FSWA 4IWQA 2RIOA 3QXOA 4CCUA 4F70A 3UO5A 4BZNA 2HZ4A 4C3FA 5CAOA 5AMNA 5M44A 4NCTC 2GCDA 3DGKA 3GU4A 3VUHA 3QALE 3T3UA 3PY0A 4MXOA 4XH6A 2QI8A 1GIIA 5FXQA 3P7CA 1CSNA 3ZEPA 4G6NA 4GFGA 4PV0A 1ZY5A 3G51A 5BX0A 5K4IA 3RINA 3OT8A 5H3QA 4O96A 2ITQA 3OXZA 4GS6A 4S34A 3VAPA 2UZDA 3C1XA 2XJ0A 3LXLA 4IHPA 2IW6A 3OXIA 3THBA 4ZMFA 3O8PA 1JSVA 4FKWA 4X2GA 2WEVA 2XA4A 3NW6A 1OL2A 2YDIA 3BQRA 5CSVA 4EOPA 1STCE 3GI3A 3NUAA 5JGBA 5LCJA 3VQHA 4PDSA 1Z57A 4EHZA 4AZVA 4ZY5A 2R4BA 4O22A 1H1QA 3L8PA 1PXPA 4EHGA 5BVOA 2O2UA 4X3FB 1OPJA 3MIAA 3A4PA 2OK1A 3BRBA 4L44A 1Z5MA 3CEKA 4WUNA 2XK6A 2QU5A 5ACBC 4ZSAA 4QMOA 5A4EA 2ZV7A 4N57A 4X2NA 3SRVB 2FSTX 4F63A 4C36A 5T3QA 2C0TA 3HV7A 2PUNA 4JT3A 4IB5A 3BV3A 2J0MB 5BVEA 3MTLA 4ZZNA 3UIBA 3S3IA 3HA6A 3Q5ZA 3PVWA 2BKKA 2PUUA 1JAMA 4WT6A 4IB3A 4JDHA 5CSHA 1LP4A 2OIQA 2X39A 4YLLA 3VS7A 5JFWA 3H0ZA 4O7SA 4TRLA 5DNRA 3SQQA 4OTFA 4MQ1A 4AS0A 3FQSA 4GCJA 4FV6A 3DQXA 1WFCA 2W06A 4P4CA 4NU1A 5ANGA 3MI9A 3FXWA 3P0MA 4F4PA 5LVMA 3BBWA 3Q2JA 2UZEA 3OY3A 4FV3A 1IG1A 3BEGA 4U79A 4CFVA 4DEDA 5JGDA 2JKKA 4I6HA 3DBCA 3GT8A 2C5VA 3EJ1A 4ANBA 4R5YA 3IW5A 2J50A 2W96B 2GU8A 1H1PA 5J87A 3SW4A 3F82A 2UVZA 4KBAA 1UU9A 3GCVA 5EG3A 4E5WA 3I60A 4DEIA 2OJIA 2VTRA 2I7QA 5HLPA 4ANQA 4FBXA 3C4FA 4QYFA 4O0VA 3DV3A 1Y57A 3I5NA 1VJYA 4JOAA 2XBJA 2XK3A 1ZOEA 4HOKA 4PDYA 2GFSA 4FOCA 4G34A 5TT7A 2WMBA 4F9CA 1B39A 2J2IB 5AA8A 3AGLA 3DNDA 3LCTA 4NSTA 3WYYA 4DGLC 3DBFA 2PULA 3C0IA 3N4TA 4KAOA 3VS1A 4M7IA 2G15A 3FSKA 4IM3A 5E90A 4FOBA 3C4EA 1RDQE 3UVPA 2PU8A 4FZFB 4KSQA 3VUIA 3AC3A 4Z3VA 2F7EE 3DPKA 4EQUA 2PUPA 4AT3A 4FZ6A 5L2SA 2ZVAA 4R1VA 3IDCA 3ERKA 4DFBA 3ZUUA 4Y85A 3PJCA 4MD7E 4S33A 3RPYA 4JLCA 5FEEA 4L52A 3HAVA 4YGAA 4DH5A 1H8FA 3AG9A 3UYTA 4IM0A 4AG8A 4CV8A 3EKKA 1FBNA 1M7NA 3DAKA 3SVVA 4RVMA 4HCTA 4X0MA 3NYXA 1ZMVA 4UEUA 4FT3A 1XBCA 4WNKA 5DE2A 4ENXA 3IDBA 1R1WA 2WIPA 4M0YA 5EKOA 3ZLSA 2GQGA 3PY3A 5CAPA 4BBEA 3NUPA 4FKPA 4E7WA 1VYWA 3PSBA 2UW9A 4CSVA 3EL7A 3OEFX 3R71A 4NJ3A 4YURA 3BYUA 3LMIA 2W9FB 3HRCA 4FTCA 2VTIA 4Q5EA 3PXQA 3CPCA 2REIA 4QQCA 3DBQA 3ANQA 3CQWA 5I4NA 4DG0E 4MD8E 4AQCA 1JKTA 2O64A 5LVLA 4EZ5A 5IF1A 5GIPE 3EZRA 2JGZA 2PE1A 2XZSA 2V7AA 5AA9A 3PYYA 4E20A 1TQIA 3W18A 3RK9A 1JQHA 4FTKA 2WO6A 4RG0A 5A3XA 3VUMA 2X81A 4K18A 2QOHA 3D83A 4KKGA 3DXPA 4JXFA 1OL6A 2ZMCA 4GKHA 3EN9A 3V5JA 3MIYA 4TWNA 4DFLA 2C0OA 1IA8A 4ITHA 4LL0A 5CXHA 5I9YA 4OTIA 5LARA 1HCKA 3LCSA 5A6OA 1IAHA 3ORNA 2CNQA 4HPTE 4AN3A 4F0FA 4ARKA 4G6OA 4EH5A 1OZ1A 5CLPA 4ZY4A 1FPUA 3TKHA 5ANKA 3D5UA 2Y4PA 3DJ5A 4TXCA 1BKXA 4C3PA 3UC4A 1TQPA 4WUAA 2WGJA 1AGWA 4CKJA 1U54B 4DA5A 3F3UA 2QOCA 3LM5A 4XEYA 3ULZA 2V55A 1Z9XA 3OBJA 4ITJA 1TVOA 4FX3A 4TNDA 2JKOA 3MY5A 3R7YA 3VNTA 3SA0A 4X6RA 3D94A 2YZAA 4KIQA 3QA8A 2WU7A 2XKDA 4MXZA 3VN9A 4G9CA 1DAYA 2X2MA 4IVAA 4Y46A 4YJTA 4IX5A 2WTWA 4C59A 3C4CA 4R6VA 4RJ6A 2R9SA 4D55A 5CI7A 5A4QA 1PRYA 2BDWA 4N6ZA 3C4XA 1Q4LA 2RG6A 5BYZA 4DFUA 3IDPA 3MTFA 2Z8CA 4QMXA 3C9WA 5HE3A 4PL4A 1S9JA 3EQDA 5AM7A 3UO6A 4ACMA 4NM7A 4HGSA 5HGIA 2BRMA 3JYAA 4O7WA 2YDJA 5M09A 4FSTA 4BC6A 1SMHA 4YP8A 2JKQA 4FV2A 3NUNA 1RQQA 2AC5A 1OKYA 4FEUA 2QOLA 3PRIA 3HV5A 4FTNA 1YKRA 4AGDA 3AD4A 2JLDA 5G6VA 3AC4A 4F7LA 4B6LA 3BZ3A 2HW6A 4FUYA 3F3ZA 5AP2A 2WQOA 4E6QA 5KKRC 4N70A 3ZONA 3LCDA 3G9NA 5FDPA 4J96A 3LM0A 3PPKA 3PSDA 1Q24A 5HLNA 4NZWB 1J1CA 3ZHPC 3PY1A 2OF4A 1Q8YA 4EOLA 1YXTA 2VV9A 4O0SA 4WBOA 4PMPA 4NIFB 3U9CA 4ZSGA 5AUYA 3HV3A 4OW8A 4RMZA 3ENHA 3R8MA 4OTRA 1REJA 4MHAA 5EYKA 4FIFA 4FV8A 3W33A 3QRTA 4AGCA 4LM5A 2G2HA 4WNMA 2P2HA 4BCIA 3MJ1A 5KMKA 4BYIA 2WTKC 3AT4A 3FY2A 5E8WA 3DZOA 1JPAA 3KEXA 2C6OA 2OW3A 2C6LA 4XP0A 2QVSE 1U46A 1J7UA 2OH0E 2J5EA 3L1SA 4FT7A 4XNEA 4K9YA 4ALUA 4QYEA 4TYEA 4G1WA 4WNPA 2YACA 2OWBA 3UQGA 4WSYA 5HVYA 3EB0A 2BROA 3OP5A 3QCXA 4U40A 3GFWA 4GEOA 2YCQA 1M2PA 2HIWA 2UZNA 3DTWA 4HVSA 3GXLA 4I24A 3O8TA 4J71A 3U51A 5A14A 4RQKA 4FNXA 1JKSA 2R3LA 4M13A 3QF9A 4I5HA 2IVTA 4V04A 2R3NA 2ZMDA 3FI2A 3IOKA 3QC4A 1RJBA 3GCUA 3QBNA 3TKUA 2UV2A 2OLCA 3G0FA 4QNAA 4ZSLA 4XBUA 2PZRA 5H8GA 3AC5A 4M68A 1QCFA 1ZAOA 1YW2A 2YITA 3BI6A 4UWYA 4WKQA 5AP5A 1A48A 2IVSA 3QZIA 4TKSA 3UG1A 3WF5A 3U6IA 4IAIA 3ZC5A 3OY1A 4O2ZA 5EDPA 2C6IA 2DQ7X 4ZIMA 4L7FA 4UXLA 4BCJA 5C01A 4D1SA 2VWXA 2SRCA 4BDDA 1H1WA 4BHZA 4R78A 4PP7A 5AV0A 4FICA 5HQ0A 3VHKA 4K33A 3R21A 4UB7A 5FP6A 3GVUA 3QD3A 2WMSA 1H08A 2C3LA 3GOKA 3PZEA 4R5SA 2IG7A 1GY3A 4M84A 3VC4A 4BTJA 4DLIA 3UMWA 2PVNA 4L3LA 2ITYA 2BILB 3D5WA 2F2UA 5JGAA 2WOTA 4C3RA 2XYUA 4IWDA 1ZYCA 2QO2A 3BE2A 3PA5A 4V05A 4FT9A 3S95A 1YI3A 5AV1A 4A9RA 4JG6A 3QCYA 5KHXA 3BPRA 5CWZA 2EB3A 3FC1X 3BHTA 3QUDA 4L53A 3E8NA 5CT0A 5F1ZA 4GJ2A 2X1NA 4ZMEA 4HGTA 3QKMA 4FZAB 3UIMA 3A4OX 2YN8A 2VO7A 3AC1A 1M52A 5AM6A 4DBNA 4DTKA 2C4GA 3AD6A 5JFXA 5KKRB 2GNGA 4IBMA 4IAYA 4M12A 3ACJA 4MXAA 4C2WA 5E1SA 4AACA 5DI1A 4XP3A 1H27A 4DEAA 4HYHA 3E7OA 2BZIB 4PTCA 3BGZA 2HOGA 5TR6A 2EU9A 1FQ1B 5L3AA 4GYIA 3GU6A 1PF8A 2UVXA 4O27B 4EUUA 2XKCA 2YCSA 3MVLA 4HCUA 4LRMA 5ACKA 4PMTA 4FG9A 5DGZA 5FQDC 3VBQA 4FTAA 1R78A 1IASA 1O9UA 1PXNA 2XK8A 2XM8A 4FSMA 4AWIA 4DH3A 3TDWA 3LMHA 4FEXA 2CGXA 3REPA 4OBPA 3CY2A 1XJDA 4EK3A 2RL5A 4W4XA 2C5XA 3BGPA 3R2BA 4GW8A 2WTKB 4EBVA 4GG5A 3EN4A 3QRJA 5JFSA 1OI9A 2C5YA 2PZPA 3FHRA 4AE9A 4AN2A 1BX6A 3RHKA 4ZLOA 3UZRA 1ZMUA 2VX3A 5A4LA 4I6QA 2JDVA 4IZYA 4YZMA 4HVDA 3NCZA 2C6DA 3MS9A 2HENA 3KMUA 5J5SA 4V0GB 3KREA 3ORXA 3NWWA 3M42A 3SX9A 5L2TA 3V8WA 4J1RA 4DTAA 3W2RA 3RTPA 2P33A 3TV6A 5CALA 2R3JA 1Y8GA 3FMEA 1GAGA 3ZLWA 4N6YA 3UOJA 3DXQA 3QAME 4UY9A 1Y6BA 4AZTA 2WMAA 3CQEA 3EN6A 4P7EA 4TYGA 3V5PA 4CKRA 4ZSJA 1IEPA 1OL5A 2A0CX 3NNVA 3CJGA 2G9XA 3HVCA 4G3GA 4ZAUA 1OIQA 1W83A 5CAVA 5LWMA 3UE4A 2ITUA 4DITA 3NS9A 5B0XA 3FUPA 1PXLA 2UW5A 3LZBA 5EW3A 4E26A 3EMGA 3BU5A 2VTMA 3TWJA 4FSYA 5J95A 4CZUA 4BDAA 1ZOHA 4U80A 3F88A 2A27A 1ZYJA 3KMWA 2F57A 5IQIA 5HE0A 4RC4A 4BDCA 4U97A 4HCVA 2F7ZE 3IS5A 4IWPA 2KTYA 2R3IA 3Q32A 2QO7A 1VR2A 5CTPA 1Q62A 3GU5A 4RX8A 3GC8A 5H8BA 3GP0A 3A62A 3TJDA 2IPXA 3DDPA 5BUIA 3FSFA 4HVHA 5CAUA 5FUTA 3QTZA 4KRCA 4IM2A 2HZNA 4MAOA 4MBJA 5KMOA 4ZP5A 4OTWA 4E8AA 4AFEA 1URCA 4G3FA 4AT5A 5HD4A 4LRJA 5CSWA 4UWBA 3RPRA 3R22A 4NWMA 4RX7A 3OZ6A 2PL0A 2OU7A 4IWOA 4BCNA 4BDFA 3QZFA 3HUCA 4L8MA 3RPVA 4CG9A 3H9FA 2RFSA 1YWNA 3W2OA 2J7TA 5DBXA 3ZLYA 4B8MA 4RX5A 5IG1A 4BI2A 5C8KA 5CQWA 1JWHA 1NXKA 1UU8A 5DLSA 2Z02A 3JVRA 4PP9A 2BAQA 4F6UA 1KE9A 2R3HA 4GVAA 2PVHA 4GFMA 4W4YA 5ANEA 3E63A 5CEKA 5E1EA 3FY0A 4FVQA 2R3PA 4AFJA 2BZHB 2VTOA 2ETRA 4FG8A 4M15A 4OGRA 4YTHA 3SV0A 1YHSA 5D12A 5ICPA 1UNHA 3D4QA 1G5SA 4B7TA 4QP3A 5I5ZA 3SW7A 4WOVA 3G90X 4OUCA 3WZEA 3KVWA 4ASDA 3OWLA 1GIJA 4O0XA 4M97A 4ZXTA 1ZWSA 3P9JA 4FKIA 4FNYA 2OJJA 1Q5KA 3HYHA 3EQPA 3FYJX 1MP8A 3VS3A 3F9NA 5DIAA 4ZK5A 5HESA 5I9XA 4MNEA 1U4DA 1H24A 5JK3A 4EH3A 1GNGA 4BCHA 5EQPA 4CG8A 4E6AA 3PXZA 3VVHA 1NVSA 2FB8A 3QX4A 2ITZA 4BDEA 1R0EA 2BPMA 2I0HA 3O7LD 3PG3A 3QHWA 2PY3A 2VGOA 3ZXZA 3ATSA 4EWQA 4ZEGA 2PE2A 2GQSA 1WVWA 4BICA 3ZRMA 4L42A 3SAYA 4DBXA 2YM6A 3QQHA 4RJ4A 1YXVA 4A9UA 3U55A 1YXXA 4QMMA 3OD6X 2YEXA 4QMUA 5EYDA 1UKHA 2BHEA 3UGCA 3QTWA 3WF6A 3D9VA 4FIHA 4YSMA 4Q5HA 1M2QA 3LQ3A 4EYMA 5CAQA 4EYJA 2GHGA 3VBXA 4FT5A 5E8TA 3S0OA 4RX9A 3KKVA 3WZJA 5KMMA 4J52A 5JZNA 4DGGA 3O50A 3MFSA 4LOPA 3GC0A 5FGKA 3CC6A 1W84A 4QQJA 2B53A 3CLYA 2CN5A 5EOBA 4Y95A 3OOGA 4CCBA 4YPDA 3D7ZA 3DNEA 4TPTA 3MPAA 3ZFXA 4R3RA 4F08A 4LMUA 4XG9A 3LIJA 5HCYA 4ZZMA 3ZUTA 1FVRA 3P5KA 4EKKA 3O2MA 4RBLA 3MH3A 5K5XA 3V51A 1K3AA 5F95A 3ZYAA 2GNIA 2HZ0A 2YABA 4OT6A 5D10A 4B9DA 3B2WA 3EOCA 4TYJA 2XK9A 4FL2A 4JRVA 4R77A 4FL3A 3TUDA 4PL5A 2WXVA 4EH8A 4KRDA 2X7FA 4C61A 2QC6A 4YNEA 4P2KA 3HMOA 4HNIA 2IW9A 3ZUVA 2ZDTA 1IR3A 1YDSE 2GSFA 3ZC6A 1LUFA 1UWHA 5HI2A 1PMVA 2QOKA 3TNHA 3PVBA 3FPMA 2ONLA 4EH2A 3DB6A 3OUKA 4U8ZA 3CIKA 4JNWA 4MXCA 3KB7A 4BTMA 1WMKA 3ZLXA 3OROA 2QURA 2BRGA 2VZ6A 2I6LA 4DHFA 1KV1A 3QQJA 3FMDA 4FR4A 3R04A 4UWCA 2IZSA 3D14A 3DTCA 3GQLA 4J8MA 1OKZA 4UX9A 2Y4IC 4JAIA 3G6HA 3QZHA 4RJ8A 2DYLA 4DC2A 4X3JA 4QMZA 3LOKA 2JFMA 3PVUA 4UYNA 4ZJJA 4Z16A 4DGMA 3UZPA 3QTQA 3ITZA 3OEZA 1PKGA 1VZOA 4LV5A 2OXXA 3RK5A 5AUTA 4U41A 4EC8A 2UUEA 2FSOX 4YMJA 5KO1A 5BMSA 3I6WA 2G2FA 4GU6A 5CT7A 4JR3A 4LGHA 4WG3A 5AJQA 2C3JA 3BYMA 4FNZA 3QA0A 5LMAA 5LVOA 2WOUA 3F61A 2C68A 2X8IA 5M53A 1UNGA 2Z7QA 4YJVA 4TTHB 1I44A 1NA7A 2VWUA 3TJCA 3Q53A 3NUUA 2WQNA 5K4JA 5BUEA 2WPAA 4C4FA 3NCGA 5KNJA 1WBVA 3MYGA 4G31A 3NNXA 4HW7A 1FMKA 5CSXA 2Z60A 4PQNA 5C1QB 2ACXA 2BUJA 2W5BA 4N4SA 2ZM4A 2HWPA 4PMSA 2QHMA 5JQ8A 3U4WA 1DI8A 3KXGA 4BVUA 4EZ7A 1A06A 5EQYA 3Q4UA 4GIHA 1XR1A 4CFFA 3S00A 1JKKA 3NUYA 3CE3A 4R7HA 3ZOSA 4CEGA 5LJJA 1TKIA 3P86A 3OT3A 3LFAA 3POZA 1H00A 3W32A 5IA2A 4O0WA 3VUKA 3FMLA 3GENA 5HE1A 3PIXA 3R8ZA 4Y5QA 5CU3A 2DUVA 3U9NA 3ZMMA 2PVRA 4Z7HA 3BYOA 2ZOQA 4BDIA 3LQ5A 4QP1A 4GFOA 1QPEA 4X2KA 3SG9A 3KXNA 3U87A 3V5WA 2F2CB 4GV1A 3VW6A 1G8SA 4O86A 2W1CA 4EK5A 2LGCA 4PF4A 4KUJA 2XNNA 2W17A 3VS4A 4O7RA 5H9BA 1UA2A 4TZRA 2E9VA 4DEGA 3F3WA 5EKNA 1XO2B 1KWPA 2WMTA 4G5JA 4XV9A 3HMPA 5KZIA 3UMXA 4RPVA 4QMTA 4U81A 5IA4A 2ZM1A 2H9VA 1M17A 3HV6A 2ETKA 4EOKA 4YSJA 4A4OA 1CDKA 2XNEA 4IQ6A 5CXZA 4OBOA 2CLQA 3ENMA 2YM3A 4JI9A 2E9UA 2JBPA 1UV5A 3QKKA 3SGCA 4AA5A 3LFCA 5K9IA 3HECA 2CGWA 4MNFA 2ERKA 3AC8A 3R73A 1Q8UA 4KSPA 4DEBA 5HHWA 3ZS5A 2C1AA 5BUJA 2ITNA 4AW2A 3QU0A 5AIRA 3KRJA 3AMAA 5DH3A 5CF6A 4PTGA 2WTJA 4X3FA 3KMMA 5CS6A 4FK6A 1UKIA 3R8LA 4DCAA 1BLXA 1H28A 4EBWA 4U7ZA 1H0VA 2NRYA 2QOFA 3M11A 4BDBA 2FGIA 3FLWA 4LYNA 4KB8A 4BBFA 4YUQA 4WHZA 1XH9A 3VJOA 2B55A 5E8XA 5AFVA 4O84A 3ZZEA 4FTUA 5DR6A 4RIOA 2QO9A 1ERKA 4FEQA 5FXRA 2FO0A 3G15A 5IEVA 2GHLA 2ESMA 2VN9A 4FKSA 3DKFA 4A4LA 3VS0A 3UOLA 4ANSA 5JFVA 4XX9A 3S4QA 4EK6A 1OITA 4I4FA 4O0RA 3UP7A 3MFUA 2XJ2A 3LFEA 2OSCA 4D5HA 3DLZA 1KSWA 3QUPA 4QT1A 3VUGA 4M14A 5FBOA 2VTJA 5FLFA 4BYJA 3BYSA 4O2PA 2KULA 4I0RA 5HO8A 1GZOA 1JVPP 3R8UA 4F9AA 2WMUA 4U5JA 1P2AA 3O51A 3E88A 1P4OA 3I81A 3DXNA 4IX3A 4XV1A 3VS6A 3OWPA 3FZ1A 2VRXA 2GTMA 5A54A 5DOSA 5L6PA 2QR7A 3A61A 3A60A 3CGOA 1OECA 3E8DA 3LVPA 3QYWA 4FV4A 4M8TA 1KV2A 1UU3A 2OZAB 4HGEA 2YHVA 4X2JA 5GINE 4I6FA 4XHKB 3EH9A 3QYZA 3R9HA 2YDKA 3VF8A 5M51A 2BKZA 1XH4A 3KXMA 3MW1A 3RK7A 2BMCA 3W10A 3NVMB 3PIZA 4C4EA 2QD9A 4B99A 2X7GA 2CDZA 3EQHA 4KWPA 3WBLA 5F94A 2XK4A 5HCXA 3KY2A 3V5TA 4EK4A 1WCCA 5HTBA 4BIEA 2C6TA 2WIHA 1ZMWA 5L8JA 4Q9ZA 4FV0A 3SHEA 3PWYA 4S31A 1KE8A 3OWJA 3O96A 3FPQA 3L8XA 2BFXA 2VGPA 3OF0A 3CS9A 3CTQA 3HRBA 3N9XA 4C4JA 4OT5A 4BIDA 3UBDA 3G5DA 3TNWA 1WAKA 2HZIA 2VWBA 1WZYA 3Q6WA 3EQIA 4ZS0A 4IAKA 3R30A 4C02A 2R7IA 2W1FA 2WMVA 3LCKA 4QTDA 4MBIA 2X8EA 4YZ9A 3F7WA 3W8QA 1CKPA 2OG8A 2YM8A 2AUHA 2R3RA 3MH2A 3GCSA 3OCSA 4FTRA 1CTPE 4CRLA 5IDNA 4CMTA 1KOAA 4ASZA 1XBBA 5J1VA 2QG7A 4ASXA 1H26A 1XQZA 5EM5A 5L8KA 3K3IA 2B9FA 3H9RA 4AZEA 4FIJA 4RVTA 4YNOA 2PE0A 3E8EA 3H30A 2PMOX 2VTSA 4FC0A 4ACHA 2BTRA 1FMOE 1UWJA 1I09A 2ZV9A 4N0SA 4O21A 3QLGA 4PX6A 3R9DA 4XRJA 2WQMA 3PIYA 4A7CA 5KMLA 4A07A 4HNFA 1K9AA 1X8BA 3U8WA 3F2RA 2VNWA 2Y9QA 1B6CB 4CD0A 2BZJA 4D0WA 4YJOA 4W4WA 2C47A 4K77A 5DRDA 2ZYBA 3AT3A 2B7AA 4IZAA 3ZO1A 3BV2A 4K8AA 3V5LA 4BI0A 2OIBA 4RZVA 3N4UA 3ZSIA 5IQGA 4JG7A 5CNNA 5B2LA 4FKJA 3KL8A 4RZWA 3S2PA 2VAGA 1PXKA 3P4KA 4L67A 5HE2A 3V8SA 2O3PA 3JVSA 4R7IA 1UU7A 4UZDA 2W99B 2CGVA 2UZVA 3C5IA 4RRVA 3FI3A 5AV4A 2J90A 3R1SA 5DYJA 4AW1A 4DGOA 2WQBA 4EJ7A 3I0QA 1O6YA 4QO9A 5JKGA 3POOA 4F9BA 3VRYA 4RC2A 4C58A 3QZGA 2FSMX 4LI5A 3UOHA 5AUUA 2C6KA 2CN8A 2X9EA 4FVPA 4EH9A 4XYFA 5IQDA 1S9IA 3T9IA 4YR8A 4M67A 4WNOA 5IQBA 1YDTE 1IRKA 1UNLA 3LXNA 1KE5A 4HYSA 1MRYA 3G33A 2OF2A 3MB7A 1G8AA 2B9JA 1ATPE 2YIRA 3COHA 3IECA 2R3FA 3OUNB 5CEMA 5JH6A 1LEZA 3NUSA 4QQ5A 4ENYA 3SXRA 3PFQA 2CNUA 1BI7A 4IFCA 3DAJA 3LE6A 2YM5A 4BCGA 4IB0A 4D1XA 4BDKA 1WVYA 4PL3A 5FTGA 3D15A 3QUEA 3QX2A 3DFCB 4RA5A 4RLKA 2E9NA 2ZDUA 3BU6A 2JIUA 3DJ6A 3SG8A 4ZOGA 4MWIA 3VBYA 3EZVA 3KF7A 4QNYA 3BGQA 3GB2A 2R5TA 3EYGA 3MFRA 3O0GA 5JRSA 3R1QA 3JPVA 4UYAA 3LFSA 4LRKA 4L6QA 2YA9A 4MBLA 4I5MA 2PWLA 4NL0A 3C4WA 3OW4A 1T46A 4FYNA 4U42A 3EYHA 4I3ZA 4MVFA 2EWAA 4APCA 3SXSA 5ANOA 3QC9A 1OPLA 3FBVA 4IAAA 5DRBA 2PVYA 4V01A 3TKIA 2J9MA 3Q9YA 2GPHA 4O81A 2VTPA 5A9UA 4CXAA 3II5A 3HP5A 4PY1A 5ETAA 4YLJA 3PWDA 4HZSA 4O0UA 3DBEA 3G0EA 3IO7A 1JBPE 4WA9A 5D7AA 5DR2A 3OCTA 4K11A 3IPHA 3R7IA 4NUSA 2EXCX 2UZUE 4S2ZA 2ITVA 3GQIA 5HZNA 2GTNA 2GS6A 3IW8A 3UODA 5J8IA 4LOQA 4XP2A 1OKVA 1ZARA 5CX9A 3W2CA 2BALA 2GHMA 2WMXA 2Y7JA 4EH4A 4IAZA 3PE1A 2W5HA 1M14A 2Y8OA 4D4YA 4D28A 3Q3BA 2XIKA 4QTEA 4NM0A 3PP0A 3MH0A 5EHLA 3CGFA 1W8CA 2PMLX 4YBJA 2YJSA 5M56A 1MQBA 1YXSA 3PG1A 4BGGA 4U0IA 4NT4A 5KHWA 3FQHA 2C3KA 3AD5A 5GJDA 5CF4A 5BVFA 4FT0A 3NEWA 3N51A 4ASEA 2ITOA 5IQCA 2H34A 4FSUA 2YJRA 4QQTA 1Q97A 3H3CA 3R7VA 2RF9A 3E64A 3ORTA 5EDRA 1PY5A 3F3TA 4BDHA 4C0TA 4FIIA 3TT0A 2Z7SA 2PVFA 2QHNA 1SZMA 2VWYA 3OTUA 5LMBA 5TKDA 2ITXA 4KD1A 2J0IA 4P5ZA 5LVNA 1PMNA 2HY0A 3PXFA 4MXXA 2J4ZA 4RIXA 1OKWA 2ERZE 3DK7A 2BIYA 4TL0A 1UVRA 3QHRA 4JIAA 1W7HA 4EORA 1YOLA 5AP7A 2IZRA 3WF8A 3ZO3A 4ZJVA 2QLQA 4FEVA 4O6EA 5F9EA 1H07A 2IN6A 4FTOA 4GIIA 4E4NA 4GYGA 2W5AA 4YU2A 4C62A 4K6ZA 5HIDA 2ZB1A 1XKKA 4ACGA 2QKRA 3HDNA 3R01A 1GZ8A 5DWRA 3R83A 4OTQA 1YI6A 5IQAA 3KGAA 3I79A 5EK7A 3MN3A 3R0TA 4AU8A 4BCPA 4FE2A 4CFMA 4YZNA 5HVJA 4F9WA 3TZ9A 4RFZA 3EN5A 1H4LA 4Y73A 2F4JA 4ZTSA 3Q04A 5FEQA 3IK3A 3E8CA 1F3MC 3ZXTA 5EM8A 3QGYA 4HZRA 3WF9A 5J1WA 3LCOA 5JT2A 2C30A 2BVAA 1PXOA 3IW6A 4RJ3A 4AGWA 2W0JA 3OBGA 4YJUA 5E8SA 3TTIA 5HNGA 1E1VA 4DLJA 5JRQA 4FGBA 3TZMA 3BYVA 3LAUA 5GNKA 4RFYA 4AA0A 5F4NA 4QP9A 3R6XA 2JAMA 3RNIA 2NPQA 1DI9A 3DK3A 3LXPA 3IQ7A 4M3QA 2WQEA 3RAKA 5GJFA 4XV2A 3RAIA 3TIZA 4EH7A 5KZ0A 4EOQA 2HELA 5KMIA 5IUIA 3QQLA 4DAWA 3Q4ZA 2B1PA 1CMKE 2VWVA 3QLFA 1NT2A 4W4VA 3TV4A 1R3CA 4O83A 3I6UA 4AX8A 4Z9LA 3T3VA 4ALWA 4C2VA 4DE4A 1VYZA 2QCSA 1IA9A 2X6EA 4S32A 3ORMA 2HXLA 3LFBA 4RJ5A 3ALOA 1OIUA 3HL7A 4I5CA 4XG8A 5DPVA 5EOLA 2Y0AA 2CMWA 2PVMA 5CF5A 3W2PA 3NX8A 3PLSA 4JQ7A 2WTDA 2XIZA 2Y6MA 4F99A 3GC9A 5J9ZA 2WU6A 3EL8A 4L7SA 1BL6A 1BYGA 4MXYA 5IQFA 4AF3A 3E93A 2B9HA 5EM6A 5BNJA 2ZV2A 4QYYA 3QCQA 4JDKA 4Q9SA 4DCEA 3RHXA 3ALNA 2PK9A 4BF2A 1Q3DA 1JSTA 2OXDA 2WELA 3P1AA 4RWIA 5AUWA 3EQBA 5FP5A 4BHNA 1NVRA 1FVVA 4FSNA 2W05A 3KK9A 4L3JA 3RCJA 4CFXA 2FH9A 3PSCA 4G16A 1P4FA 5HICA 5F20A 1EH4A 1YHWA 2UVYA 5KMNA 3WI6A 3CR0A 4FG7A 4EZ3A 2JFLA 2XCKA 4RT7A 4Q2AA 2VWZA 4C35A 4QYHA 5M55A 3I4BA 5HG9A 2V0DA 3EFKA 4BCQA 5C27A 5E8ZA 3LXKA 3C0HA 2XS0A 3OVVA 4G3DA 4H1JA 4C4HA 3LHJA 5H8EA 2HXQA 5HIBA 5M4UA 5AP6A 4KABA 2ZV8A 3MVJA 5EW8A 2JDRA 2C5OA 4RIYA 2R2PA 3UTOA 3MVHA 4ZSEA 4H3QA 1W0XC 3KULA 3NYOA 4KIPA 4L45A 4O82A 2LAVA 3PJ8A 2VNYA 4G2FA 4PMMA 5E9EA 3TL8A 2VO3A 1Q41A 2IWIA 3FLSA 3L9MA 3R1NA 3AXWA 4GK3A 4RIWA 3ZBFA 3BWJA 4YJNA 1SVGA 4GH2A 4YJPA 5HEZA 3R02A 5C8MA 4IVCA 1NW1A 3FHIA 1Y6AA 2QLUA 3A8WA 5T68A 3NDMA 3DY7A 4G17A 4FZDB 4AOIA 3TV7A 3KRXA 3UIXA 4LFIA 2JIIA 2DS1A 2ONLC 1O6KA 3TG1A 5E7RA 4BKJA 4IX4A 5M06A 2OJ9A 2C6EA 4XBRA 3QTXA 2OH4A 3EIDA 5TF9A 3BWFA 3BKBA 5CU0A 3AT2A 3CKWA 1OB3A 3FZSA 3QTUA 5G1XA 2B4SB 4EQMA 1FGIA 2RGPA 3QRUA 4QTCA 4H1MA 4TWPA 3QWJA 4FTIA 3F2AA 4WRSA 5ETCA 3UPXA 4I0SA 5BMMA 4CVAA 1P14A 3OFMA 3F66A 4JQ8A 3CTJA 3KXZA 4IE9A 4O7TA 4J97A 2Q83A 1A9UA 2UZOA 2PHKA 3F6XA 5DG5A 3HAMA 3O8UA 2XJ1A 1SNUA 4JR7A 3ODZX 3V6SA 5HX8A 4FVRA 1J91A 3LQ8A 5CSPA 4BTKA 2A1AB 4S30A 4W8DA 3ZM4A 4CKIA 3KXHA 2UW7A 4MNEB 3A7HA 3VULA 5HNBA 5AWMA 4FKVA 2XKFA 5HU3A 2GNLA 4JS8A 3OC1A 2XP2A 3EFLA 1WBOA 2V5QA 2VX0A 3OG7A 4U45A 4A9SA 4EL9A 2H8HA 2W7XA 3BLHA 3DJ7A 4MEDA 4UZHA 5HBHA 3GU7A 4TYHA 3R7OA 3FL5A 3HMIA 4NH1A 4QMVA 5CY3A 3F5XA 3OS3A 5HG5A 5IH4A 4Z7GA 1ZXEA 3MWUA 3A99A 2EUFB 3QQUA 4C4GA 2I1MA 5HG7A 5K5NA 4KKHA 3EWHA 1QPCA 1AD5A 4BCOA 3OCGA 4NM3A 3CY3A 1Q99A 3DKOA 4OTHA 3HMMA 3TNQB 5IDPA 3I7BA 4MK0A 1JSUA 1LR4A 5T6KA 1WVXA 3WARA 2XBAA 3R1YA 2G01A 1Q61A 2XRWA 3CCNA 3NLBA 3WZUA 3Q9WA 3DZQA 3N4VA 3KRWA 3VIDA 5BYYA 3PLAE 4F1MA 2VUWA 4QPSA 3R9NA 3LFNA 2QG5A 5DHJA 3TZ7A 2JDTA 3CQUA 4NKAA 2EB2A 4FMQA 3KQ7A 4DTBA 2OKRA 3PPJA 3HNGA 5DT3A 2A2AA 2PMIA 4J95A 2E9OA 4D5KA 2PZ5A 1J7LA 2BCJA 3AGMA 5B7VA 3EHAA 5FM3A 4KKEA 3FE3A 3NUXA 4MF1A 2CKQA 3EQRA 1V0OA 3CXWA 3KC3A 5CI6A 3ROCA 3WYXA 4Y5HA 2P3GX 2ZJWA 4L01A 4DG3E 2YIQA 3C51A 2JEDA 4JBVA 3VQUA 3O71A 3SOCA 4H39A 4P5QA 3SD0A 4JVGA 3VW8A 4LOOA 5AP0A 3R28A 4C34A 1E1XA 2YFXA 2F9GA 3TN8A 3O7LB 1PXMA 5EYMA 3VS5A 3B8RA 4ID7A 3ORLA 1AQ1A 2YM7A 4O7YA 3A8XA 2YIXA 3QL8A 2GDOA 2WMQA 3R2YA 3H10A 4KNBA 4LV8A 4AAAA 5E8YA 2EVAA 3NNWA 5HIEA 2XNMA 5IMEA 5CVFA 3Q9ZA 3VBTA 4L9IA 2IO6A 2XKEA 2UW4A 5BPYA 3O17A 1V1KA 3DKGA 2ZAZA 4A06A 2C0IA 1GZNA 5HO7A 2WNTA 2CCHA 4X2FA 1MRVA 1CM8A 4OTGA 1F5QA 4X3FC 3L9NA 3DT1A 3ZFYA 2DWBA 4MX9A 1U5QA 3FKOA 4HGLA 5FBNC 4DH8A 4C33A 1LPUA 1PYXA 3T8OA 3IONA 5H2UA 5HLWA 3UPZA 4CV9A 3BHYA 2OO8X 3DQWA 3MPMA 2E9PA 2WTCA 2X7OA 4FTQA 4H3PA 2QNJA 3HKOA 1JNKA 3ZFMA 3HDMA 2BFYA 3I5ZA 1OGUA 5IU2A 4OTDA 5IEXA 3WIGA 5TOZA 1QMZA 3K5VA 2J0KA 3GUBA 3PDTA 2XEZA 4PDPA 4BB4A 3SC1A 3MJ2A 5KUPA 2W1IA 4PWNA 4KBKA 3ZDIA 1GZKA 3D7TB 1ZYDA 3HMNA 3JR1A 4WRGA 4IJPA 3BQCA 5FXSA 5BVWA 2C6MA 3LLAA 3UYSA 4XG7A 1T45A 4U3ZA 3EFWA 3PVGA 3D2IA 3NIEA 5LMKA 3DBDA 1Y91A 4EHEA 3ELJA 4BCKA 2CLXA 3JS2A 4AA4A 3EKNA 4USDA 4KS7A 4XLVA 2CSNA 5EM7A 1Q8WA 4BTFA 4B8LA 5HU9A 4W8EA 4KBCA 3UVRA 5EI2A 3FWQA 5HBJA 1JLUE 3HLLA 3VRZA 3VWAA 4TN6A 4XRLA 3DLSA 3E3BX 4IC8A 4H3BA 5JSMA 1KOBA 3DAEA 3FZRA 4LUDA 5AP1A 5KCVA 3LMGA 3MFTA 2Q0BA 2QU6A 3QFVA 4FV1A 2NP8A 1ZRZA 4H05A 3F5UA 3R9OA 4DH1A 4M0ZA 3RAWA 2Z7RA 1QPJA 3UNJA 2BRHA 5FEDA 1YHVA 4C37A 4EEVA 5M08A 5IA1A 4IZ7A 3NMUF 2XNOA 3ID6C 4DFYA 1ZOGA 2WMRA 4D1ZA 1H1SA 3FI4A 3KCFA 4AGUA 1MQ4A 5M4IA 3DDQA 2C69A 4NFNA 2OXYA 3I1AA 3WE4A 3WF7A 4ZY6A 3C50A 3CTHA 1DAWA 4FTTA 2Y4IB 4A9TA 2CKEA 4FKOA 3P23A 4MCVA 2UW8A 4BCMA 2ETMA 4YZCA 2QKWB 4QTAA 2H96A 3BEAA 1Y8YA 5IUGA 5AAEA 4ZJIA 5KMJA 5ETFA 3T9TA 4XS2A 3K2LA 3SRVA 2XVDA 1OL1A 3C13A 1B38A 3I7CA 3KA0A 4R1YA 5IA3A 3CKXA 3V01A 2O63A 4F64A 2W1HA 4IJ9A 4LUEA 3VF9A 5C26A 2RFDA 3GEQA 3P08A 3TXOA 1KE7A 3PE2A 4FKUA 3QRKA 4FKRA 4E4LA 3QQFA 3DKCA 2QR8A 3COMA 3ORPA 4QP6A 4F0IA 4AT4A 4EONA 2Y6OA 3DB8A 2ITWA 4IIRA 4GT3A 3GNIB 4ANLA 3R8PA 4CRSA 4EHVA 3TZ8A 4ORKA 1YWRA 3KU2A 2PUIA 3G9LX 1TQMA 1YRPA 3OMVA 1Q8ZA 4FSQA 3KN6A 3NZ0A 4JDIA 4QPAA 3UNZA 2BHHA 5JZJA 2HCKA 2NO3A 3QTSA 4FSRA 1XH7A 5J9LA 4PRJA 3AOXA 3TUBA 3WILA 2JD5A 5LVPA 2HY81 4JBPA 2XK7A 4CZTA 3CPBA 3R00A 4LGGA 4UXQA 2ITPA 2BIKB 4XCUA 2A19B 4FNWA 4GK4A 3FL4A 1XH8A 3ZH8A 1Q8TA 2O0UA 2UW3A 4U9AA 2YCRA 3V5QA 4EJNA 3DCVA 5BYLA 5AADA 2FUMA 4J7BA 4NTSA 3VHEA 2X9FA 5CENA 4ACDA 3NAYA 4NCTA 3CBLA 3COKA 3TTJA 4YZDA 5ANJA 3TDVA 3SKCA 2PYWA 1FOTA 3FMMA 2OZAA 5DT0A 1U59A 2CHLA 1H25A 3ZDUA 4F7SA 4JX3A 4C4IA 1ZZLA 2XM9A 3LJ0A 4EUTA 4DN5A 3L8VA 4QRCA 3C0GA 4L46A 5E8UA 1HCLA 5LWNA 1P5EA 4FIGA 4F65A 3KRRA 4BY9E 3FMJA 2R64A 2OJFE 1PYEA 2QONA 4UALA 3DOGA 2O8YA 3H9OA 4PTEA 3NW5A
chains in the Genus database with same CATH superfamily
3EQFA 4GKIA 4CT2A 3IW7A 2XEYA 3SDJA 2GNHA 3R7UA 3TCPA 5A6NA 4G6LA 2R0IA 4LV7A 2CNVA 2R7BA 2JKMA 3MDYA 4QMLA 3PFYA 2WHBA 3DFAA 2PVKA 3OW3A 3RWQA 4BCFA 4ERKA 3FI8A 1O6LA 4FZ7A 4IDTA 3PUFC 4XJ0A 4DFZE 3K3JA 4E5BA 4GVJA 2GFCA 2R3OA 2WTIA 5EDQA 4CT1A 2WTVA 4H36A 1YOMA 3BHUA 4E4XA 2OZOA 4K1BA 3K5UA 1SVHA 4I22A 4FI1A 4JL9A 2UZWE 4D9UA 4IFGA 2JDOA 2YCFA 4WD5A 4X7QA 4MTAA 3RGFA 1J1BA 1V0PA 2P4IA 4OR5A 2WAJA 2E2BA 4PNKA 4IEBA 2HW7A 1APME 4KS8A 3LLTA 4D2SA 3FZPA 4Z55A 4FTLA 4E4MA 2J0LA 3RM6A 3RVGA 4E5AX 2XIYA 3Q4TA 5KBQA 3UC3A 2G1TA 5KE0A 3D5XA 4RVKA 4AP7A 4U6RA 3K54A 5AV3A 1K2PA 2P0CA 3GU8A 3QTIA 2XF0A 3TACA 4YJRA 2OIDA 3W1FA 2V62A 2VTLA 5EQEA 2OBJA 5C8NA 5JQ5A 1QL6A 4LMNA 3UG2A 4TWCA 4DINA 2BDJA 4XG2A 3WZDA 4C38A 5GIOE 4NK9A 2JDSA 2Z2WA 3Q52A 4QP7A 5C9CA 4BZOA 4RLLA 4ERWA 2VX1A 4EK8A 5E91A 3O23A 3RCDA 1ZYSA 2NRUA 4G3EA 4ZS4A 3ZRKA 3PZHA 4E1ZA 4D9TA 5ITAA 4TT7A 3ET7A 2VTAA 3ACKA 3F5GA 4TW9A 3IW4A 5AUZA 2OICA 4IH8A 4ZTNA 4QTBA 1U54A 3VS2A 3W0QA 2YM4A 4ALVA 3E62A 1URWA 3KRLA 5FM2A 2RFEA 1ST4A 5C4LA 5CANA 5EHYA 2WFYA 3GOPA 3QXPA 4QMPA 4MYGA 3UDBA 4BN1A 4YHTA 4AXEA 5KX8A 5EFQA 4J53A 4AOJA 3BCEA 4EOIA 1U5RA 2G2IA 3OXTA 4EI4A 5IEYA 5IH6A 2O65A 4GSBA 4FEWA 3HRFA 1L8TA 2XARA 3MESA 2BRBA 2PZIA 1HOWA 3R63A 2XNGA 3U4UA 5C4KA 3DA6A 2R3QA 4L68A 4NW6A 1L3RE 2I0VA 5LXMA 4CMUA 1OM1A 4FSZA 5AAGA 3WOWA 3Q9XA 1YXUA 5CASA 3FC2A 2CJMA 5HBEA 2QODA 4AN9A 4QMQA 3NPCA 3QTRA 3UJGA 5B2MA 2GMXA 4UN0C 1FVTA 4XMOA 5CEQA 3NSZA 3A7JA 3NNUA 1H01A 2W4KA 4MH7A 5FTOA 5I9WA 4IMYA 5HKMA 3WE8A 2CKPA 4FKTA 4I23A 4YC8A 2P55A 2EXMA 3FMKA 5DVRA 4ZTLA 5GHVA 1PXJA 3FKNA 4HVGA 3FJQE 3ZBXA 5AIKA 5E4HA 3RALA 3V6RA 3COIA 3NAXA 5E8VA 3GFEA 4FKLA 4G3CA 2HK5A 1ZLTA 2XH5A 3Q60A 1H0WA 1DM2A 2QOIA 2VO6A 4ZTMA 2P2IA 4AZSA 4K0YA 4PNIA 5HTCA 5IISA 3GBZA 5EI8A 4GUBA 5E92A 4U3YA 4E6DA 5M57A 3PXRA 4R7BA 5A46A 4WIHA 2BAKA 3D5VA 3IG7A 4CFWA 5EI6A 3KVXA 4O91A 3RP9A 4DFXE 4XLIA 2J0JA 4YLKA 3VBWA 1VEBA 2OGVA 5D41A 4F7NA 4ITIA 3TUCA 4TYIA 5DN3A 2UW0A 2BAJA 2XYNA 3CP9A 1ND4A 1W82A 4BDJA 2YISA 3Q96A 3W2SA 2YAKA 2XRUA 3ZEWA 2GS2A 2PMNX 4A4XA 2JBOA 2XIRA 2YWVA 3EFJA 5AEPA 2YIWA 4HPUE 5IA0A 4QYGA 3BIZA 2QOBA 1KUTA 3PA4A 2CGUA 2YZLA 3QD4A 3RAHA 2IVVA 4CFNA 4G9RA 3U6HA 4ACCA 1RW8A 3ZSHA 3BU3A 5BVKA 2CCIA 2R3GA 2IJMA 4GU9A 4DDGA 2X6DA 3S1HA 3LFDA 5HNIX 3A7GA 2AC3A 5C03A 2F7XE 5AX3A 3BBTB 2HWOA 2PVJA 3UVQA 1XH6A 4XV3A 3WZKA 3ZO4A 4RWJA 3EQCA 3TYKA 3VJNA 4YTIA 3P7BA 4BI1A 1WBPA 4F6SA 3CJFA 1XWSA 5ANDA 5IH5A 4FUXA 1OUYA 4F9YA 4AW5A 5HCZA 4GJ3A 4WG4A 3UZTA 4E73A 3AMBA 4GRBA 2BRNA 4OLIA 3ZTXA 5IPJA 1J3HA 1MRUA 3OCBA 3P78A 4U44A 5B2KA 4RFMA 3E92A 2JC6A 3LFQA 3MA6A 4Y8DA 3QD2B 3CSVA 5FDXA 3SXFA 4YC6A 5M4FA 3MB6A 3NVKI 1OL7A 2CKOA 4RIXB 3ANRA 2Q0NA 2I0YA 4H58A 4WO5A 3W16A 1H1RA 4ZLZA 1YQJA 2IZTA 1PKDA 3RPOA 4HYIA 3LJ2A 4TWOA 5IA5A 5D9HA 3RWPA 2VTTA 2WKMA 4GMYA 5M4CA 3FEGA 2VD5A 4AW0A 3EQGA 4B0GA 5L8LA 3FMNA 5A4TA 2RFNA 5GJGA 4G5PA 4QP8A 4IB1A 5KBRA 4I20A 4J8NA 2QOOA 4IDVA 5LOHA 4I6BA 4QMYA 5IUHA 3E5AA 4YZBA 4X6QC 4R3CA 5EHOA 3L9PA 4JX7A 4MQ2A 3MGYA 2W4OA 5EYCA 2O5KA 4YTFA 4I1ZA 3GCPA 5CU2A 3PJ3A 3TNIA 2JITA 2XIXA 2BDFA 3PP1A 2VWWA 3CD3A 4O0TA 4ZTRA 3AQVA 2B52A 4EKLA 2VO0A 4J98A 3FQEA 3ORZA 3LJ1A 4DHIB 2JAVA 3Q2MA 4LQMA 4CLJA 1NY3A 4EOSA 4DGNA 1PHKA 3OTVA 4I94A 4I93A 4USFA 3PXKA 3FV8A 2B54A 3LKMA 5TO8A 4O7VA 3HUBA 1LEWA 4EC9A 5IQHA 2F49A 4ANMA 3UQFA 3NR9A 3QGWA 4KINA 3IKAA 3NIZA 4AXAA 5BQ0A 5CEPA 4XG6A 2IW8A 4D4RA 3JXWA 2CPKE 2R3KA 3D0EA 4FKQA 3RMFA 1BMKA 4RSSA 1W98A 4ZTHA 3BLRA 4DT8A 1PMEA 3JUHA 4OBQA 1FGKA 4F1OA 3FLYA 5HVKA 2WB8A 3PJ2A 3FAAA 3FLNC 4LG4A 4DYMA 3DK6A 5L6OA 2ZM3A 3FXXA 3Q5IA 4JIKA 1YVJA 2JIVA 2RG5A 3I0OA 1XHAA 4YHJA 4D2RA 4D4VA 2W1DA 2W1GA 3PRFA 4RGJA 4CMOA 4V0GA 4L43A 2ITTA 2X2LA 3FLZA 4F09A 4JBOA 2X4ZA 5FD2A 5I9UA 3M2WA 5ANIA 4Y72A 3A2CA 1GJOA 4IX6A 4JBQA 2BTSA 3IGGA 4DG2E 2XNBA 3RKBA 4D58A 5IMXA 3ZO2A 1E9HA 2WEIA 3VUDA 3KXXA 3V04A 3F2NA 4FODA 2QQ7A 2B0QA 3P7AA 4NM5A 1R0PA 3ZZWA 4USEA 2J5FA 2XB7A 4RWKA 4UV0A 3RM7A 4YO6A 4CQEA 1QPDA 4MD9E 3ZRLA 5I0BA 2V7OA 3IOPA 4RWLA 5ETIA 2YERA 3MY0A 3C4ZA 3KFAA 2PVLA 4O7LA 2OFUA 3QWKA 4O0YA 3GGFA 1OBDA 4E93A 5L2WA 3TM0A 4BDGA 3R7EA 3HZTA 5CNOA 5FG8A 4JDJA 2GNFA 4L00A 4BIBA 4YJQA 2J6MA 3BLQA 1SVEA 2VTQA 4GT5A 4RIYB 4YC3A 1WBWA 5AP3A 4DF3A 2X4FA 3NW7A 3KULB 4FTMA 3QKLA 4K2RA 3MH1A 4IVDA 4AZWA 2VTHA 1ZY4A 3FZTA 4YHFA 1J7IA 3OOMA 4EQCA 3NYVA 3W2QA 4PDOA 3QCSA 2QOQA 2HYYA 3ROYA 4FTJA 5J9YA 3IGOA 3ULIA 3E87A 1JKLA 3HA8A 1OVEA 4FGRA 3PTGA 4MKCA 4RIWB 3KF4A 5CF8A 2A4LA 2W1EA 3KN5A 5I9VA 5AUXA 2PPQA 5D7VA 4QMWA 3QD0A 4BGHA 4YO4A 2XAMA 4I92A 4PUZA 4DFNA 5D11A 2FVDA 3FYKX 5AP4A 4GL9A 5J7HA 3PPZA 4IAFA 4NKSA 5LCKA 3RZBA 3KK8A 4BRXA 4DH7A 4XOYA 1SNXA 2GNJA 4NW5A 2UZTA 3M1SA 4KIOA 4RC3A 2XUUA 4HVIA 2FYSA 4GT4A 4NYEA 4I4EA 2GQRA 2PSQA 3C7QA 5DA3A 4EOJA 3MVMA 4BR3A 1IAJA 2IZUA 3D2KA 2VWIA 2XNPA 3GCQA 4O7ZA 4DT9A 1SYKA 3PJ1A 4IW0A 5AUVA 3FMHA 4FYOA 1PW2A 2OFVA 4C7TA 4QP4A 1OIRA 4TNBA 4O6LA 1OUKA 3U54A 5LQFA 2W4JA 4UBAA 3RI1A 3A7IA 3JY0A 4QOXA 3MSSA 1GOLA 4NJDA 5CZIA 4D4SA 2X2KA 4CFUA 4TY1A 4YPSA 5I9ZA 2WZJA 3L9LA 1BL7A 4KA3A 3QQGA 4F1TA 2I40A 1OIYA 5M07A 3CD8A 2YIYA 3KCKA 4E6CA 3SLSA 4ONAA 1NVQA 3UO4A 4BJJA 4FV5A 2BR1A 4TYHB 5JN2A 2FA2A 2C3IB 2X0GA 3LFFA 3Q4CA 1XBAA 3HX4A 3L8SA 4MWHA 3TIYA 3TEIA 3HP2A 4EH6A 2Z7LA 1WBTA 2C5NA 2UW6A 3WIKA 1CKJA 1V0BA 3E3PA 4CTBA 4I5PA 3PXYA 5DEYA 3QQKA 4IZ5A 3ZSGA 5CEOA 1RE8A 2OJGA 4X21A 3MBLA 4AUAA 3UNKA 3ATTA 4XG3A 4QMSA 3RPSA 5LMKC 1OBGA 2W1ZA 3FKLA 3MA3A 4WG5A 5HORA 3BX5A 5DEWA 4Y83A 3UQCA 3FDNA 1XMLA 3G6GA 4M69B 3NFFB 3E7VA 3ETAA 3F3VA 5IQEA 3MY1A 3P79A 4GUEA 2AYPA 4JRNA 2VTNA 4B4LA 2YAAA 3DS6A 4ZLYA 3V3VA 2BZKB 4HJOA 1OMWA 4FIEA 3NGAA 3F69A 3LPBA 3VO3A 4IADA 1JOWB 5HD7A 4HYUA 1BI8A 3AC2A 3ORKA 3HGKA 4QP2A 4JQEA 3FZOA 4IANA 4JJRA 3VBVA 3W0MA 4BGQA 4DEHA 4DEEA 4YTCA 2RKUA 3BHVA 2NNWB 1G3NA 3UP2A 4AE6A 2I0EA 3ZCLA 4BBMA 5AV2A 4FL1A 5CVHA 4RVLA 5CU4A 3TNPC 3U6JA 3PUPA 5IZFA 5DR9A 1WBSA 3TI1A 5DT4A 3H4JA 3BELA 4NTTA 5AAFA 3R8VA 2HAKA 1YI4A 3FLQA 4IACA 4EOMA 4IVBA 2V22A 2W9ZB 3BL9A 4U43A 2WD1A 4XUFA 3JY9A 4YBKA 2XMYA 3BE9A 2B9IA 5K3YA 1PXIA 3NRMA 4II5A 3W8LA 2GS7A 4XG4A 3G2FA 5CQUA 5CVGA 5CZHA 4RJ7A 1OPKA 1REKA 4GK2A 4FKGA 5CU6A 3SOAA 4FA2A 3C5UA 4I0TA 4WBBB 1Q3WA 4L3PA 4RA4A 1BUHA 2AEGA 1PJKA 3ODYX 4NFMA 4O38A 4CTCA 4JG8A 1YDRE 3UDSA 2X8DA 3OWKA 1SM2A 4RQVA 3OHTA 4BZDA 4F0GA 4A9YA 4F6WA 1MUOA 2YWPA 3PA3A 4ZZOA 3HV4A 3GC7A 2UZLA 4EOOA 1YOJA 4APPA 4EWHA 4XOZA 3F7ZA 4J99A 5A4CA 2XCHA 1M2RA 2UZBA 5EW9A 4QMNA 5BVNA 4FV9A 3H0YA 3R9RA 1DS5A 1PMUA 2FSLX 2H6DA 4AOTA 1FINA 3MV5A 4F78A 5L6WL 1CKIA 2NYAA 3ZM9A 2IVUA 3V8TA 4P90A 4IC7A 4CNHA 5HX6A 2PZYA 5CYIA 5DFPA 1GIHA 2R0UA 1R39A 1F0QA 3FXZA 4FV7A 3A7FA 5HG8A 1YWVA 3QRIA 2PTKA 3UIUA 5L2IA 4CGAA 4GG7A 4JAJA 4F7JA 3AMYA 2ZB0A 1XH5A 3B2TA 1M7QA 2C1BA 2J51A 3BHHA 3RJCA 5BVDA 4CLIA 4YJSA 3MPTA 1KE6A 4I41A 5AX9A 3W55A 2WMWA 4D0XA 5EH0A 3EN7A 4FK3A 2R3MA 4O7NA 5D1JA 5FTQA 3Q6UA 3ZU7A 2OI4X 3D7TA 4AZFA 3NYNA 3F5PA 1WBNA 4ZTQA 5JMSA 4LL5A 1ZZ2A 3UOKA 4I21A 5FRIA 4R3PA 5CEIA 3HEGA 2VU3A 3DU8A 5JEBA 3LW0A 3B8QA 3ORIA 4FSWA 4IWQA 2RIOA 3QXOA 4CCUA 4F70A 3UO5A 4BZNA 2HZ4A 4C3FA 5CAOA 5AMNA 5M44A 4NCTC 2GCDA 3DGKA 3GU4A 3VUHA 3QALE 3T3UA 3PY0A 4MXOA 4XH6A 2QI8A 1GIIA 5FXQA 3P7CA 1CSNA 3ZEPA 4G6NA 4GFGA 4PV0A 1ZY5A 3G51A 5BX0A 5K4IA 3RINA 3OT8A 5H3QA 4O96A 2ITQA 3OXZA 4GS6A 4S34A 3VAPA 2UZDA 3C1XA 2XJ0A 3LXLA 4IHPA 4QDEA 2IW6A 3OXIA 3THBA 4ZMFA 3O8PA 1JSVA 4FKWA 4X2GA 2WEVA 2XA4A 3NW6A 1OL2A 2YDIA 3BQRA 5CSVA 4EOPA 1STCE 3GI3A 3NUAA 5JGBA 5LCJA 3VQHA 4PDSA 1Z57A 4EHZA 4AZVA 4ZY5A 2R4BA 4O22A 1H1QA 3L8PA 1PXPA 4EHGA 5BVOA 2O2UA 4X3FB 1OPJA 3MIAA 3A4PA 2OK1A 3BRBA 4L44A 1Z5MA 3CEKA 4WUNA 2XK6A 2QU5A 5ACBC 4ZSAA 4QMOA 5A4EA 2ZV7A 4N57A 4X2NA 3SRVB 2FSTX 4F63A 4C36A 5T3QA 2C0TA 3HV7A 2PUNA 4JT3A 4IB5A 3BV3A 2J0MB 5BVEA 3MTLA 4ZZNA 3UIBA 3S3IA 3HA6A 3Q5ZA 3PVWA 2BKKA 2PUUA 3P5JC 1JAMA 4WT6A 4IB3A 4JDHA 5CSHA 1LP4A 2OIQA 2X39A 4YLLA 3VS7A 5JFWA 3H0ZA 4O7SA 4TRLA 5DNRA 3SQQA 4OTFA 4MQ1A 4AS0A 3FQSA 4GCJA 4FV6A 3DQXA 1WFCA 2W06A 4P4CA 4NU1A 5ANGA 3MI9A 3FXWA 3P0MA 4F4PA 5LVMA 3BBWA 3Q2JA 2UZEA 3OY3A 4FV3A 1IG1A 3BEGA 4U79A 4CFVA 4DEDA 5JGDA 2JKKA 4I6HA 3DBCA 3GT8A 2C5VA 3EJ1A 4ANBA 4R5YA 3IW5A 2J50A 2W96B 2GU8A 1H1PA 5J87A 3SW4A 3F82A 2UVZA 4KBAA 1UU9A 3GCVA 5EG3A 4E5WA 3I60A 4DEIA 2OJIA 2VTRA 2I7QA 5HLPA 4ANQA 4FBXA 3C4FA 4QYFA 4O0VA 3DV3A 1Y57A 3I5NA 1VJYA 4JOAA 2XBJA 2XK3A 1ZOEA 4HOKA 4PDYA 2GFSA 4FOCA 4G34A 5TT7A 2WMBA 4F9CA 1B39A 2J2IB 5AA8A 3AGLA 3DNDA 3LCTA 4NSTA 3WYYA 4DGLC 3DBFA 3AKLA 2PULA 3C0IA 3N4TA 4KAOA 3VS1A 4M7IA 2G15A 3FSKA 4IM3A 5E90A 4FOBA 3C4EA 1RDQE 3UVPA 2PU8A 4FZFB 4KSQA 3VUIA 3AC3A 4Z3VA 2F7EE 3DPKA 4EQUA 4AQKA 2PUPA 4AT3A 4FZ6A 5L2SA 2ZVAA 4R1VA 3IDCA 3ERKA 4DFBA 3ZUUA 4Y85A 3PJCA 4MD7E 4S33A 3RPYA 4JLCA 5FEEA 4L52A 3HAVA 4YGAA 4DH5A 1H8FA 3AG9A 3UYTA 4IM0A 4AG8A 4CV8A 3EKKA 1FBNA 1M7NA 3DAKA 3SVVA 4RVMA 4HCTA 4X0MA 3NYXA 1ZMVA 4UEUA 4FT3A 1XBCA 4WNKA 5DE2A 4ENXA 3IDBA 1R1WA 2WIPA 4M0YA 5EKOA 3ZLSA 2GQGA 3PY3A 5CAPA 4BBEA 3NUPA 4FKPA 4E7WA 1VYWA 3W0OA 3PSBA 2UW9A 4CSVA 3EL7A 3OEFX 3R71A 4NJ3A 4YURA 3BYUA 3LMIA 2W9FB 3HRCA 4FTCA 2VTIA 4Q5EA 3PXQA 3CPCA 2REIA 4QQCA 3DBQA 3ANQA 3CQWA 5I4NA 4DG0E 4MD8E 4AQCA 1JKTA 2O64A 5LVLA 4EZ5A 5BV3A 5IF1A 5GIPE 3EZRA 2JGZA 2PE1A 2XZSA 2V7AA 5AA9A 3PYYA 4E20A 1TQIA 3W18A 3RK9A 1JQHA 4FTKA 2WO6A 4RG0A 5A3XA 3VUMA 2X81A 4K18A 2QOHA 3D83A 4KKGA 3DXPA 4JXFA 1OL6A 2ZMCA 4GKHA 3EN9A 3V5JA 3MIYA 4TWNA 4DFLA 2C0OA 1IA8A 4ITHA 4LL0A 5CXHA 5I9YA 4OTIA 5LARA 1HCKA 3LCSA 5A6OA 1IAHA 3ORNA 2CNQA 4HPTE 4AN3A 4F0FA 4ARKA 4G6OA 4EH5A 1OZ1A 5CLPA 4ZY4A 1FPUA 3TKHA 5ANKA 3D5UA 2Y4PA 3DJ5A 4TXCA 1BKXA 4C3PA 3UC4A 1TQPA 4WUAA 2WGJA 1AGWA 4CKJA 1U54B 4DA5A 3F3UA 2QOCA 3LM5A 4XEYA 3ULZA 2V55A 1Z9XA 3OBJA 3UDZA 4ITJA 1TVOA 4FX3A 4TNDA 2JKOA 3MY5A 3R7YA 3VNTA 3SA0A 4X6RA 3D94A 2YZAA 4KIQA 3QA8A 2WU7A 2XKDA 4MXZA 3VN9A 4G9CA 1DAYA 2X2MA 4IVAA 4Y46A 4YJTA 4IX5A 4DHJA 2WTWA 4C59A 3C4CA 4R6VA 3W0NA 4RJ6A 2R9SA 4D55A 5CI7A 5A4QA 1PRYA 2BDWA 4N6ZA 3C4XA 1Q4LA 2RG6A 5BYZA 4DFUA 3IDPA 3MTFA 2Z8CA 4QMXA 3C9WA 5HE3A 4PL4A 1S9JA 3EQDA 5AM7A 3UO6A 4ACMA 4NM7A 4HGSA 5HGIA 2BRMA 3JYAA 4O7WA 2YDJA 5M09A 4FSTA 4BC6A 1SMHA 4YP8A 2JKQA 4FV2A 3NUNA 1RQQA 2AC5A 3W0SA 1OKYA 4FEUA 2QOLA 3PRIA 3HV5A 4FTNA 1YKRA 4AGDA 3AD4A 2JLDA 5G6VA 3AC4A 4F7LA 4B6LA 3BZ3A 2HW6A 4FUYA 3F3ZA 5AP2A 2WQOA 4E6QA 5KKRC 4N70A 3ZONA 3LCDA 3G9NA 5FDPA 4J96A 3LM0A 3PPKA 3PSDA 1Q24A 5HLNA 4NZWB 1J1CA 3ZHPC 3PY1A 2OF4A 1Q8YA 4EOLA 1YXTA 2VV9A 4O0SA 4WBOA 4PMPA 4NIFB 3U9CA 4ZSGA 5AUYA 3HV3A 4OW8A 4RMZA 3ENHA 3R8MA 4OTRA 1REJA 4MHAA 5EYKA 4FIFA 4FV8A 3W33A 3QRTA 4AGCA 4LM5A 2G2HA 4WNMA 2P2HA 4BCIA 3MJ1A 5KMKA 4BYIA 2WTKC 3AT4A 3FY2A 5E8WA 3DZOA 1JPAA 3KEXA 2C6OA 2OW3A 2C6LA 4XP0A 2QVSE 1U46A 1J7UA 2OH0E 2J5EA 3L1SA 4FT7A 4XNEA 4K9YA 4ALUA 4QYEA 4TYEA 4G1WA 4WNPA 2YACA 2OWBA 3UQGA 4WSYA 5HVYA 3EB0A 2BROA 3OP5A 3QCXA 4U40A 3GFWA 4GEOA 2YCQA 1M2PA 2HIWA 2UZNA 3DTWA 4HVSA 3GXLA 4I24A 3O8TA 4J71A 3U51A 5A14A 4RQKA 4FNXA 1JKSA 2R3LA 4M13A 3QF9A 4I5HA 2IVTA 4V04A 2R3NA 2ZMDA 3FI2A 3IOKA 3QC4A 1RJBA 3GCUA 3QBNA 3TKUA 1TFFA 2UV2A 2OLCA 3G0FA 4QNAA 4ZSLA 4XBUA 2PZRA 5H8GA 3AC5A 4M68A 1QCFA 1ZAOA 1YW2A 2YITA 3BI6A 4UWYA 4WKQA 5AP5A 1A48A 2IVSA 3QZIA 4TKSA 3UG1A 3WF5A 3U6IA 4IAIA 3ZC5A 3OY1A 4O2ZA 5EDPA 2C6IA 2DQ7X 4ZIMA 4L7FA 4UXLA 4BCJA 5C01A 4D1SA 2VWXA 2SRCA 4BDDA 1H1WA 4BHZA 4R78A 4PP7A 5AV0A 4FICA 5HQ0A 3VHKA 4K33A 3R21A 4UB7A 5FP6A 3GVUA 3QD3A 2WMSA 1H08A 2C3LA 3GOKA 3PZEA 4R5SA 2IG7A 1GY3A 4M84A 3VC4A 4BTJA 4DLIA 3UMWA 2PVNA 4L3LA 2ITYA 2BILB 3D5WA 2F2UA 5JGAA 2WOTA 4C3RA 2XYUA 3NFGB 1ZYCA 2QO2A 3BE2A 3PA5A 4IWDA 4FT9A 4V05A 1YI3A 5AV1A 3S95A 4A9RA 4JG6A 3QCYA 5KHXA 3BPRA 5CWZA 2EB3A 3FC1X 3BHTA 3QUDA 4L53A 3E8NA 5CT0A 5F1ZA 4GJ2A 2X1NA 4ZMEA 4HGTA 3QKMA 4FZAB 3UIMA 3A4OX 2YN8A 2VO7A 3AC1A 1M52A 5AM6A 4DBNA 4DTKA 2C4GA 3AD6A 5JFXA 5KKRB 2GNGA 4IBMA 4IAYA 4M12A 3ACJA 4MXAA 4C2WA 5E1SA 4AACA 5DI1A 4XP3A 1H27A 4DEAA 4HYHA 3E7OA 2BZIB 4PTCA 3BGZA 2HOGA 5TR6A 2EU9A 1FQ1B 5L3AA 4GYIA 3GU6A 1PF8A 2UVXA 4O27B 4EUUA 4I6LA 2XKCA 2YCSA 3MVLA 4HCUA 4LRMA 5ACKA 4PMTA 4FG9A 5DGZA 5FQDC 3VBQA 4FTAA 1R78A 1IASA 1O9UA 1PXNA 2XK8A 2XM8A 4FSMA 4AWIA 4DH3A 3TDWA 3LMHA 4FEXA 2CGXA 3REPA 4OBPA 3CY2A 1XJDA 4EK3A 2RL5A 4W4XA 2C5XA 3BGPA 3R2BA 4GW8A 2WTKB 4EBVA 4GG5A 3EN4A 3QRJA 5JFSA 1OI9A 2C5YA 2PZPA 3FHRA 4AE9A 4AN2A 1BX6A 3RHKA 4ZLOA 3UZRA 1ZMUA 2VX3A 5A4LA 4I6QA 2JDVA 4IZYA 4YZMA 4HVDA 3NCZA 2C6DA 3MS9A 2HENA 3KMUA 5J5SA 4V0GB 3KREA 3ORXA 3NWWA 3M42A 3SX9A 5L2TA 3V8WA 4J1RA 4DTAA 3W2RA 3RTPA 2P33A 3TV6A 5CALA 2R3JA 1Y8GA 3FMEA 1GAGA 3ZLWA 4N6YA 3UOJA 3DXQA 3QAME 4UY9A 1Y6BA 4AZTA 2WMAA 3CQEA 3EN6A 4P7EA 4TYGA 3V5PA 4CKRA 4ZSJA 1IEPA 1OL5A 2A0CX 3NNVA 3CJGA 2G9XA 3HVCA 4G3GA 4ZAUA 1OIQA 1W83A 5CAVA 5LWMA 3UE4A 2ITUA 4DITA 3NS9A 5B0XA 3FUPA 1PXLA 2UW5A 3LZBA 5EW3A 4E26A 3EMGA 3BU5A 2VTMA 3TWJA 4FSYA 5J95A 4CZUA 4BDAA 1ZOHA 4U80A 3F88A 2A27A 1ZYJA 3KMWA 2F57A 5IQIA 5HE0A 4RC4A 4BDCA 4U97A 4HCVA 2F7ZE 3IS5A 4IWPA 2KTYA 2R3IA 3Q32A 2QO7A 1VR2A 5CTPA 1Q62A 3GU5A 4RX8A 3GC8A 5H8BA 3GP0A 3A62A 3TJDA 2IPXA 3DDPA 5BUIA 3FSFA 4HVHA 5CAUA 5FUTA 3QTZA 4KRCA 4IM2A 2HZNA 4MAOA 4MBJA 5KMOA 4ZP5A 4OTWA 4E8AA 4AFEA 1URCA 4G3FA 4AT5A 5HD4A 4LRJA 5CSWA 4UWBA 3RPRA 3R22A 4NWMA 1ZYLA 3OZ6A 2PL0A 2OU7A 4IWOA 4RX7A 4BCNA 4BDFA 3QZFA 3HUCA 4L8MA 3RPVA 4CG9A 3H9FA 2RFSA 1YWNA 3W2OA 2J7TA 5DBXA 3ZLYA 4B8MA 4RX5A 5IG1A 4BI2A 5C8KA 5CQWA 1JWHA 1NXKA 1UU8A 5DLSA 2Z02A 3JVRA 4PP9A 2BAQA 4F6UA 1KE9A 2R3HA 4GVAA 2PVHA 4GFMA 4W4YA 5ANEA 3E63A 5CEKA 5E1EA 3FY0A 4FVQA 2R3PA 4AFJA 2BZHB 2VTOA 2ETRA 4FG8A 4M15A 4OGRA 4YTHA 3SV0A 1YHSA 5D12A 5ICPA 1UNHA 3D4QA 1G5SA 4B7TA 4QP3A 4AAYA 5I5ZA 3SW7A 4WOVA 3G90X 4OUCA 3WZEA 3KVWA 4ASDA 3OWLA 1GIJA 4O0XA 4M97A 4ZXTA 1ZWSA 3P9JA 4FKIA 4FNYA 2OJJA 1Q5KA 3HYHA 3EQPA 3FYJX 1MP8A 3VS3A 3F9NA 5DIAA 4ZK5A 3RNYA 5HESA 5I9XA 4MNEA 1U4DA 1H24A 5JK3A 4EH3A 1GNGA 4BCHA 5EQPA 4CG8A 4E6AA 3PXZA 3VVHA 1NVSA 2FB8A 3QX4A 2ITZA 4BDEA 1R0EA 2BPMA 2I0HA 3O7LD 3PG3A 3QHWA 2PY3A 2VGOA 3ZXZA 3ATSA 4BJJB 4EWQA 4ZEGA 2PE2A 2GQSA 1WVWA 4BICA 3ZRMA 4L42A 3SAYA 4DBXA 2YM6A