5M08A

Crystal structure of mycobacterium tuberculosis pkni kinase domain, c20a_r136a double mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
MALASGVTFAGYTVVRMLGASAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHADVNPANVVLTSQDQRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDRQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Serine/threonine-protein kinase PknI
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 71
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m08A01
4ONAA 3AQVA 4JR7A 5E8UA 4ERWA 1XH4A 4YJSA 3I7BA 3R21A 4V01A 1Z9XA 3BHTA 2PE0A 1H0WA 3UZTA 1JKLA 3DPKA 2WTIA 2ZV9A 3L8SA 2F2UA 4YZBA 4EH5A 4ENYA 3EQIA 4FKLA 4NIFB 2QOHA 4EH8A 5KBRA 3WYYA 4IAKA 1OBGA 2OICA 4AS0A 2GMXA 1LPUA 4YPDA 4YJQA 4IWDA 4QMYA 4TNDA 1Q24A 2LGCA 4RJ4A 3PUPA 4GK2A 2UZTA 4ZTMA 4KS8A 2VGOA 1U46A 1MRUA 1Q8UA 4FR4A 3W8LA 4EORA 2YM7A 5IMXA 2UZNA 2OJGA 2YM4A 4FGBA 2ZB1A 3CS9A 2QCSA 3FE3A 5AWMA 5J5SA 5DLSA 4AG8A 5AJQA 3QWKA 3DFAA 3RTPA 5LVPA 3UQFA 3OD6X 1J7LA 3VRZA 1IR3A 1AGWA 2EB3A 2R3NA 4L7SA 4S32A 5JN2A 4BDIA 3L8PA 2X81A 1B38A 3WILA 3TM0A 4FTAA 2BR1A 4IQ6A 5KKRB 5CXHA 3PVBA 1PXPA 4QPAA 4U3YA 1BI8A 2J0JA 5CAQA 3JY9A 5BVNA 2BUJA 4AZVA 4FKOA 2WMRA 4G5PA 4RIXA 3UODA 5JFXA 4DTKA 4RIXB 3COKA 2P3GX 4TYHA 4XOZA 3MB7A 5B2KA 5EQEA 2JDVA 3C50A 2JFMA 3U8WA 2C5OA 4MTAA 2Y6MA 1J1CA 2UUEA 5KMKA 4EBWA 2PVYA 2BTSA 3F5XA 3TV6A 3BBTB 3CSVA 3OY1A 4QMXA 3QRTA 3TCPA 2W5HA 4YUQA 3PVGA 3ZBFA 4OT6A 5HTBA 4OBOA 3UVQA 4Y95A 3QUEA 4YBKA 3R8ZA 3R02A 4EZ5A 5M09A 1JKSA 3RMFA 4BZDA 3UJGA 3QA8A 4FT7A 4DEHA 4GUBA 4FKWA 4AFJA 4IAYA 5ANEA 3QCQA 4FSNA 2YDIA 2C5XA 2VTHA 3BRBA 3MPMA 3ORXA 5K5XA 1ZZLA 5AUZA 4NT4A 3QGWA 3FMKA 5A9UA 4MHAA 2IVVA 2OZOA 2ETMA 5L2WA 4M15A 4DT9A 4DH1A 4FYNA 3P08A 3TZ8A 2FYSA 3ZLXA 4G3EA 4DFNA 4I5CA 3VBXA 3R8VA 1OKYA 4H36A 3KEXA 1IASA 2OXYA 3VF8A 3LCTA 4GT4A 4ZSLA 2QO2A 4FIEA 3LM5A 4K18A 4FBXA 2ITWA 1JNKA 4YJUA 4ZMEA 3TZ9A 3FLYA 2G2HA 4F1MA 1VYZA 2JC6A 2ITUA 3E8NA 4X6RA 2XKDA 5EK7A 4V04A 3NZ0A 4DEEA 2V7AA 3PXYA 5M55A 4O0VA 4FTJA 3OG7A 3PA5A 3RHXA 4A07A 4R1YA 2CSNA 1H01A 4P7EA 1GJOA 4Y72A 5CX9A 4C02A 5I9XA 5DBXA 5JH6A 2VTAA 3HV5A 5L3AA 3TG1A 4Z55A 4IM3A 4KBCA 4JDHA 4Y5HA 2EUFB 2YM8A 3N51A 4J7BA 5CU0A 4ANBA 4DGGA 4FZFB 3VIDA 3UMXA 4Q9ZA 4D4VA 3EHAA 3PG3A 2REIA 3UGCA 2UW8A 4ZMFA 4RWIA 2UV2A 2GFCA 1M2QA 5CVGA 3DCVA 4EOMA 4KSQA 3GC9A 4CFVA 1YOLA 1UKHA 2PZRA 3EN6A 3Q9ZA 5FTQA 3LQ3A 4ZTLA 3UIUA 2XNGA 5EOLA 3L9PA 3QC9A 1MQBA 5FG8A 1K2PA 3WF8A 2OJJA 4TT7A 3TNQB 2XCHA 3ENHA 4A9RA 3CTHA 4ACGA 2JKOA 3MH0A 5JGAA 2FSMX 4TN6A 3I4BA 4R3PA 1G3NA 1OPJA 2GFSA 3UNJA 4DBNA 3I1AA 5EDPA 2OFUA 2XK3A 3L8XA 3BWJA 2VWZA 3GU6A 3BEGA 3RALA 4DH5A 4XP0A 4BI0A 3R0TA 1BL7A 2JKMA 4ZJJA 4D4RA 4F9BA 2UW4A 5DRDA 4RX8A 1M7NA 5IQBA 4LUDA 1KE6A 1PXMA 4XG6A 4GG7A 4U7ZA 3MJ1A 2ZDTA 5GINE 5IQFA 2X6EA 4UZDA 2JKQA 2W96B 4IHPA 3TIYA 4G6NA 3IOKA 2V22A 3I5ZA 4USEA 4YZMA 2X0GA 3Q4ZA 3PFQA 3K2LA 1DI9A 3ALOA 3ENMA 4FV7A 5IA5A 4EEVA 5KMMA 4L3LA 5CU3A 3OEFX 4W4XA 2O64A 5BUIA 4IWQA 3FLWA 2CHLA 2ITTA 3VJNA 5HU9A 3ZO3A 4C4GA 4I6HA 4RLKA 4XG8A 2PZPA 3Q4UA 1LP4A 4DBXA 1G5SA 3TV4A 4EUTA 5E8VA 4LRJA 5BMSA 3C4ZA 3WIGA 4FNWA 4FKTA 3VQUA 3BGZA 1CMKE 5E7RA 4CMUA 3NPCA 2C3JA 3E88A 2BDWA 2VWVA 5DT4A 4FT5A 5AADA 3CKWA 4FOCA 3DBEA 4FV8A 3R63A 3KKVA 4FX3A 2WMWA 5LARA 3P7BA 5C03A 2XJ2A 2XKEA 2P0CA 3G15A 4FL2A 5E4HA 3ZUVA 3HV3A 3QHWA 4RA5A 3MN3A 4UWCA 4D2SA 2FSLX 4WUNA 5IUIA 5CLPA 3DQWA 3UC4A 5LJJA 5DI1A 3OUKA 4FNYA 2WTJA 3KK9A 4PTEA 4JDIA 3RJCA 3OBJA 2WTVA 3QZHA 2C30A 3RAKA 2YITA 4JNWA 4MK0A 4CFWA 4MNEA 5A6NA 3CQWA 3FQSA 3MJ2A 3TNWA 3ORMA 5M06A 3MVHA 4X2GA 2C3KA 3FEGA 4U40A 1OM1A 4E5AX 4L3JA 5DH3A 2ZMDA 4CNHA 1URWA 4BDEA 3PXKA 1DM2A 4PF4A 2BRMA 4FTQA 2F4JA 3AMBA 3C1XA 4I4EA 3UYSA 4ALVA 2X9EA 3OC1A 3AGMA 1H1WA 2ZM3A 2X4ZA 4JJRA 4O2PA 3TJCA 2G2FA 4AZSA 5HO8A 4D9TA 3NUXA 4U80A 2YWVA 3MGYA 4DTAA 2RGPA 2ACXA 4YTIA 4F09A 2BALA 4IIRA 5LWNA 2XKFA 1IA9A 3MA3A 5BX0A 3TV7A 4FKSA 3V5JA 3QXPA 4A9UA 3RK5A 4O0RA 4X2JA 3NVKI 5AX3A 3EJ1A 4BICA 2HWOA 5CS6A 5EM8A 4ZTSA 1Y8GA 1O6YA 1Y8YA 3E3PA 2PZIA 2OK1A 4MWIA 2VU3A 3OP5A 4WBOA 2PVKA 3FWQA 2J5EA 4NKSA 1JOWB 3FZOA 1HCKA 2BAQA 1R0EA 2OIBA 3S2PA 4AT4A 4IZ5A 1XWSA 2UW3A 5IPJA 1JBPE 2IWIA 3NAXA 3LFSA 1SNXA 3DA6A 4BGQA 3A7GA 4I24A 1W98A 3EQBA 3F5GA 3R01A 3F7WA 4EOIA 4R7IA 3RPRA 1PKDA 4F7LA 4I6FA 4AW0A 3NRMA 3DJ6A 4IVDA 2A1AB 3BQRA 4O81A 5ETCA 2QHMA 3TUCA 3KCFA 5CAUA 1NY3A 4F6UA 5L2TA 4WRGA 2R5TA 2BRHA 2YEXA 5IH5A 2QOQA 1PMNA 2WXVA 3DOGA 3A8XA 4B4LA 4X21A 1QPEA 4I22A 3F66A 4FSRA 4LOQA 3CGOA 3PRIA 4KS7A 3V6SA 4WA9A 2GNFA 3OWPA 4BDJA 3M11A 2XYUA 3HV6A 3UIBA 5EQPA 2OH4A 3DDQA 4QYHA 4QMMA 2QOKA 1JKTA 4BDBA 4WG5A 3DXNA 1Q8WA 4N6ZA 1W84A 5IEVA 3ROYA 5HIDA 2OH0E 4B6LA 1H08A 3LKMA 5HX8A 1XH8A 5EQYA 5AUXA 3QTXA 5G6VA 4YTCA 1E1VA 3BU3A 2R3MA 3D5WA 1JVPP 3CD8A 1ZRZA 3HECA 3W2CA 4W4VA 2O65A 2VTSA 3OBGA 3TNPC 4E4LA 1UWHA 4QP9A 2C69A 4J97A 4R78A 2E9NA 3RK7A 4LMUA 4O38A 1V0OA 4MCVA 4JI9A 2XNEA 3LXKA 3NS9A 4MBIA 2H96A 3QXOA 4Z7GA 4U8ZA 5E1SA 2GS7A 4FZ6A 3HLLA 2Z7QA 1ZOEA 3DLZA 2C0IA 3U6HA 3K54A 4G17A 4RZVA 3UBDA 2C1AA 1Y91A 4FKIA 5J7HA 3N4VA 2PMIA 4GU9A 5KO1A 3SOCA 4XBUA 3TXOA 4AW5A 3NIEA 4XHKB 3POZA 5CWZA 4EZ7A 4YP8A 3W2OA 1YXVA 3R7EA 4CV8A 3ALNA 3VBWA 4AX8A 4E6DA 3QKLA 2HZNA 4J1RA 5K4IA 3KK8A 4UV0A 2HW6A 3GC7A 4S34A 3PY3A 2YIYA 3PLAE 3HUCA 3LLTA 4N70A 3VQHA 4KBAA 3F61A 1I44A 5EHOA 2BAJA 5FEDA 3V5TA 2WMUA 3JVSA 4EHVA 2VO7A 2W1CA 3HUBA 3OF0A 4FG7A 4J8MA 3HMNA 4NYEA 3QD2B 5FRIA 3F9NA 3R9NA 4HYIA 3OEZA 3R22A 5A4TA 1UU7A 3HMPA 3TEIA 5CXZA 3KN6A 4R5YA 4ZLYA 4F1TA 2YM3A 3SV0A 5IA3A 3PJCA 4EONA 5ANJA 4DG3E 4FSQA 3S4QA 4HVSA 3V04A 4RJ6A 4C4HA 4GYIA 4XV2A 2A0CX 4U41A 3K3JA 2Y0AA 3B2WA 4R6VA 3UQGA 3FQHA 3EKNA 1SVHA 4WG4A 3CC6A 3ZZEA 4IJPA 5DWRA 5AUTA 3ZFMA 3MTLA 4G2FA 4QP4A 2YHVA 4HNFA 3NR9A 5E8WA 2I40A 2GS6A 3V5QA 4FICA 2XA4A 4QP8A 1Q3DA 2IN6A 2Q83A 3PDTA 3MFTA 3QYWA 4M84A 4O7YA 3ZM9A 4AN2A 3D5VA 3FC1X 3PP1A 4XUFA 1YI3A 3HKOA 3BX5A 1WAKA 4D4YA 1KE9A 1KE7A 2W4KA 3DBCA 4U9AA 4EJNA 4ZJIA 4H3QA 5HE2A 2VRXA 2J2IB 2RL5A 4U42A 4B8MA 3KXZA 2XK9A 3D83A 4U44A 4N57A 2I1MA 4FSZA 3SXRA 3WF9A 4FZAB 4TKSA 3ZBXA 3CTJA 4EOSA 2WKMA 3OY3A 3QHRA 3R8LA 4TW9A 1F3MC 4DG0E 2PL0A 4APCA 2QU6A 4JX7A 4D4SA 3KMMA 3PTGA 3NCZA 3QRKA 3QKMA 5BVOA 5M56A 4C61A 3PYYA 2IPXA 2J0KA 2I0HA 2B9FA 4AGWA 2BRNA 3NNUA 4FTUA 5LCKA 3IKAA 1R1WA 3QRJA 5AV2A 3VS0A 4ZS0A 2QD9A 4ANLA 5IISA 4AXAA 1AQ1A 4RJ3A 4F64A 2R3QA 2QKRA 4YZNA 3VS3A 1YWRA 3ORNA 5IA0A 4FZ7A 4XCUA 4ZSEA 2VGPA 3LCKA 2PE1A 3HAVA 5F1ZA 2BDFA 3BYSA 4S30A 4I4FA 3MY1A 2CPKE 4O7WA 3QZFA 2W0JA 5BUEA 2XM8A 4BCQA 4RX5A 2G1TA 4O82A 4BIEA 3PZHA 2WTKB 2O0UA 5EHLA 5H8GA 3UOJA 4OBQA 5AUYA 3VS4A 5DE2A 4AW2A 4LV5A 3LXNA 3PLSA 1PYXA 2YCSA 1FBNA 4B9DA 1W7HA 1XH6A 3CCNA 3DKCA 3LAUA 1PMUA 2C0OA 2EXCX 2YIWA 3JUHA 4JVGA 2BTRA 4RMZA 5CVFA 3FL4A 4ORKA 3LFEA 5CEIA 2JIVA 5CAVA 4FVQA 5AP2A 5ACKA 3F2AA 4AACA 3GC0A 3NUAA 3P23A 4JIAA 4NTTA 4BKJA 4JRNA 2EWAA 4MXZA 3FMDA 3IDBA 4BTMA 1J7IA 3KFAA 5C1QB 4O7SA 4DAWA 2WOTA 4DGNA 3EN9A 4CFNA 2VTLA 3PJ2A 4Y5QA 3UIMA 2ESMA 5DT3A 5BNJA 3KMUA 3GT8A 3QUDA 4FKQA 1GY3A 3D2KA 4CFFA 4EH2A 3DKGA 3FI3A 5EW3A 5IQIA 4EQMA 3FBVA 3GQIA 4ZLOA 2Q0BA 2XK7A 3F7ZA 3E8DA 4FV4A 1IAJA 4D55A 2PUPA 2Y9QA 5D12A 2BPMA 3QX4A 1XQZA 2VO0A 2XIRA 3VS2A 1M2RA 4M68A 1IA8A 3DK7A 1DS5A 1KUTA 3BLHA 4IB3A 4ASDA 4FT3A 2WHBA 1VYWA 4DC2A 1H26A 5E1EA 4YHFA 3MW1A 4FKVA 2W06A 4L68A 4NK9A 4C35A 4KWPA 3TWJA 4QTBA 5AIKA 2QO7A 3KA0A 4EHEA 5HICA 4DGLC 3PG1A 5HNIX 3WE8A 4E8AA 2YDKA 2XNBA 2E9VA 3HMOA 2HZ0A 3CPBA 1Y57A 3QX2A 1BI7A 3QLGA 3SKCA 3WF5A 2J51A 4BDAA 4OTWA 5HI2A 1BL6A 4OGRA 4BCJA 5CF6A 2C3IB 4ZY5A 2RF9A 4M67A 4DA5A 5B2LA 3NYNA 2PTKA 1WBTA 3GB2A 2OJIA 4WBBB 1JQHA 3UNKA 3HAMA 4MKCA 4ACHA 4N4SA 4BTFA 5DFPA 4PNIA 4YZDA 2JD5A 1YVJA 3GOPA 3HL7A 2VTPA 3V5WA 3FDNA 3KRWA 5BVFA 5C27A 1OBDA 1OL5A 3LFFA 5L8JA 4FTLA 3NWWA 4WO5A 2Y6OA 3DU8A 2V5QA 4F7SA 5EYCA 4JG7A 5KBQA 3DBDA 4KD1A 5L6WL 3OTVA 2XB7A 3FKOA 3TKHA 2PMLX 3OOGA 4WRSA 4IEBA 2C47A 2I0VA 2C6MA 3COHA 3DAKA 3O8UA 3R9OA 3D9VA 3VUGA 2R7BA 3JPVA 4RIYA 4D2RA 1OIYA 3GCUA 4QMOA 4RIYB 2XIYA 4FTMA 5DIAA 4D1XA 3LCDA 4IE9A 4R3RA 1SZMA 4PY1A 2QQ7A 2ETKA 2EB2A 3KRJA 4QMTA 4QQTA 3SAYA 4F9WA 2JIIA 2PMOX 3WOWA 4DF3A 3AT3A 3KXHA 5KNJA 4TWPA 3MVLA 3V8WA 4ZLZA 3S00A 3FUPA 4XMOA 4D0WA 5EDRA 4RC3A 4C37A 4FIHA 4UWYA 4YLKA 2J50A 4R77A 5BUJA 2NPQA 3LLAA 4QPSA 4FGRA 3I7CA 3LXPA 1BKXA 3OW3A 4BVUA 1PXKA 5KHXA 3CQEA 3CY3A 3O7LD 3QAME 5IQEA 3KGAA 4XRJA 3DKOA 4LGHA 3H9FA 4Q9SA 4R5SA 5LCJA 3QD3A 1E1XA 2G2IA 3ZDUA 5LXMA 2JFLA 4PTCA 3LFBA 3O23A 5HE0A 3H0ZA 4YLLA 3MVMA 3CQUA 4QP7A 1Q97A 3A62A 5K5NA 4EH9A 3R30A 4BCOA 4AF3A 2GNGA 1ZYCA 3PPZA 4RX7A 3ZH8A 4YU2A 1V1KA 3HVCA 2R0UA 2VTJA 4K2RA 5DR2A 3VJOA 3MPTA 3NVMB 1Q41A 4QP6A 4ANSA 4M13A 2HENA 4BCMA 2W1FA 4RX9A 3O51A 5T6KA 5DVRA 3KVXA 3N9XA 5BVKA 3QTUA 3VW8A 3PIZA 4ASXA 4MBJA 5C8MA 4LGGA 3V51A 3QRIA 5FM2A 4C3PA 4D0XA 5K3YA 4ALUA 4DGOA 1ZY4A 3IECA 4L3PA 3GI3A 5AX9A 2O63A 3CP9A 5CTPA 3IDCA 4GT3A 4K77A 2JBOA 2OJFE 5AIRA 2F9GA 2FVDA 3H4JA 4IVCA 3ZXZA 4ASZA 5CZHA 3R04A 5ANKA 1GIJA 4I0RA 4LL0A 4LRKA 3AC3A 3NIZA 4HGEA 4LUEA 4WD5A 5M57A 1NVRA 3CJGA 5M4UA 1OB3A 1UKIA 2OXXA 3HRCA 4K8AA 5AV0A 3W8QA 5EI2A 2YIQA 5CNNA 3DXPA 4RJ7A 4MD8E 1K3AA 1UNGA 2WEVA 1X8BA 3DB8A 3WF7A 4FV5A 4CMTA 5C8NA 3QTQA 5F20A 2FGIA 4YSJA 4IJ9A 4KRCA 4MEDA 3ZRMA 3MFSA 4E4XA 3NNWA 4PDSA 3KN5A 1ZYSA 3FLNC 2C4GA 3PSBA 3ZO2A 3GQLA 4JOAA 4U79A 4YNOA 4HYHA 1O6KA 1SVGA 2P33A 5EM6A 3U55A 2F7EE 2XKCA 5KCVA 3H10A 2OKRA 4KABA 3Q9WA 3LMHA 4JT3A 5EG3A 1YDRE 4WKQA 1SMHA 1FGIA 4EQCA 3QQGA 1ERKA 2C6KA 3QCXA 3R1NA 4GVAA 3PJ1A 2IG7A 3NUUA 3S95A 3R9DA 4DEBA 4WHZA 3GXLA 3I60A 2XJ1A 1PXJA 3V5LA 3UO6A 2VZ6A 1Q8YA 3PE1A 5F95A 4QMQA 2Y8OA 4LI5A 3RK9A 1R3CA 4M7IA 4RGJA 3SQQA 2YJSA 5E9EA 4AE9A 4V0GA 1UNHA 4IB0A 5KX8A 2X2LA 1WVWA 4V0GB 3COMA 2C68A 3QZGA 4OTIA 5JRQA 4NWMA 3MA6A 4TYIA 3OT3A 1OPLA 1W0XC 4C3RA 4E4MA 4FV6A 3ZMMA 5AV4A 3NW7A 3GU8A 4EH7A 1B39A 4LOPA 2Y4PA 5C9CA 3R9HA 4C59A 4CKJA 3I0QA 4DCAA 5BYYA 3UVPA 5HD4A 4G6OA 2OIDA 4IB5A 3BV3A 4Z9LA 5J87A 3ZC5A 3ROCA 3BE9A 1UVRA 2PZ5A 5HESA 3UE4A 3GCVA 4OTDA 3RPSA 2R3KA 4JBPA 4C2VA 4USFA 1E9HA 2GNJA 1OUKA 1XH5A 4LRMA 3MVJA 4FK3A 4OTGA 4AA0A 5FEEA 3IG7A 5DOSA 3NEWA 1LEWA 3Q4CA 4L52A 3FHRA 4Y83A 3UTOA 5FP6A 3OW4A 3ZSGA 5H8BA 3FKNA 4GCJA 3T9IA 3ZZWA 5JT2A 1R39A 3SD0A 5HLPA 5JQ8A 5CEPA 4TYJA 4IVBA 5IA2A 1O6LA 3OWKA 4JXFA 1GZ8A 4Z7HA 1UA2A 5T68A 3OWJA 2GQGA 3LPBA 5CQUA 2PHKA 4A4LA 4HOKA 1PKGA 3SC1A 4UYNA 3R7YA 4QYEA 4NM5A 4PDOA 4H05A 3V8TA 2OF2A 5K4JA 2A27A 4QNAA 1TQMA 3L9MA 1PXNA 3LVPA 3IGGA 1XBAA 3G0FA 2BFXA 4EK6A 3FZSA 5IQGA 3VS1A 2CGUA 3GFWA 4RVMA 3TDVA 1PMVA 1R0PA 3AC1A 3EL7A 1V0PA 5G1XA 5M4IA 1ZMWA 2UVZA 2VTQA 4O6LA 5DGZA 3WZUA 4BZNA 4E6QA 3GGFA 3B2TA 4XP2A 5AP7A 5ETAA 4E6CA 2QC6A 3PXFA 5CU4A 3R28A 1P2AA 4HNIA 2GTNA 4ZZOA 1BYGA 3SG9A 2PY3A 3RPYA 2CNQA 3MIAA 3O2MA 1VZOA 1Y6AA 4O7VA 1OPKA 1GZKA 4AA4A 5HE3A 2ZAZA 4ASEA 4IADA 4MBLA 4YJOA 2BIKB 2VNWA 1YHWA 4G1WA 2VUWA 3UO5A 1REJA 3O0GA 4HCTA 2VV9A 2OG8A 3G2FA 4CKIA 2PVFA 2R2PA 4GIHA 1PYEA 4O2ZA 3CR0A 1OL2A 3U9NA 4YC3A 4QTAA 4CMOA 2PPQA 3A2CA 4NKAA 4QT1A 4GIIA 4LV8A 5FD2A 3TDWA 4FKJA 3B8QA 3ZO4A 2UZDA 5EOBA 3FLSA 5FUTA 3DKFA 3QQUA 2ERKA 4BDKA 3AOXA 5HGIA 3ORPA 3U54A 4EQUA 3VUHA 5CEQA 3MPAA 4BN1A 4FSTA 4I0SA 3RCDA 1DAYA 1AD5A 4ARKA 4C38A 4IZ7A 3KF7A 3WI6A 4EHGA 2X8EA 4N0SA 5DR6A 5IG1A 3ATSA 5E8YA 4P4CA 2GS2A 2W1HA 4EYMA 5KHWA 4AGDA 3HRFA 5IDNA 4AZWA 4UY9A 4FEVA 3L9NA 3LHJA 3QZIA 5CEMA 5TR6A 5ETFA 4DFUA 2R3FA 2JITA 3JXWA 5BQ0A 3COIA 4D28A 2QONA 1U54B 4KA3A 3Q32A 3G6HA 3Q96A 3FMNA 1MQ4A 4K1BA 1G8AA 4QTEA 3TZMA 2WEIA 4J98A 4XLIA 3D15A 3OROA 3VBQA 3EB0A 4EK8A 2XM9A 3OUNB 3ZFXA 3VS5A 5KE0A 5FQDC 3R73A 2PSQA 4F1OA 1V0BA 2BKKA 4ZXTA 2IVTA 3FPMA 5BPYA 3DV3A 2WTKC 4RA4A 3R7UA 5CANA 3ULIA 3A7FA 3DTWA 3BLRA 1KE8A 1W82A 3UYTA 2F2CB 2WQMA 3OCGA 2HY0A 3HA8A 4FOBA 4BIBA 4GKIA 2QOFA 3FZ1A 4GW8A 4QMZA 5DG5A 2PUIA 3FMJA 2P2IA 2QLUA 3TZ7A 4AOTA 4RFYA 4QMVA 1GOLA 4X2FA 4MXXA 2W5BA 1RDQE 4JG6A 3LM0A 4NTSA 5HORA 1CKJA 3BLQA 2QG7A 3QUPA 1GNGA 5GHVA 5EM7A 4C3FA 5HLNA 2PZYA 3IW4A 3NUYA 3MS9A 3JYAA 3L1SA 1BX6A 4NCTC 3VRYA 3VVHA 3VHKA 4IH8A 2XMYA 4NU1A 2BZJA 4H58A 4AW1A 2YIRA 3OFMA 3ORTA 1WBNA 1ZXEA 3Q2MA 2YABA 3VC4A 3KF4A 3CKXA 4HGTA 3NLBA 5EM5A 3ZU7A 2E9PA 3F5UA 4ZAUA 2XNOA 2YN8A 2XIXA 5FXSA 4YC8A 2W1ZA 4PRJA 4GK3A 3W55A 3O8PA 3EMGA 5ITAA 3HX4A 3ZUUA 1QMZA 1YI6A 3UNZA 2OWBA 3ORZA 3RNIA 5HKMA 4PL4A 3P1AA 4CTBA 3LJ0A 1OL7A 2PWLA 3BHUA 2QU5A 4IVAA 4I41A 4RG0A 3IS5A 5TF9A 3DLSA 3TUDA 4L8MA 3A4PA 4XJ0A 3NYVA 4BR3A 4AAAA 4YC6A 5I9UA 2W1EA 4B0GA 2A4LA 3MBLA 3ORLA 2QOLA 4FK6A 3KULB 1FVRA 4FL1A 4YTFA 4ACCA 3R1QA 2V55A 5A3XA 2P55A 3RCJA 2UW7A 4DYMA 4IZAA 4EOPA 4TPTA 3UVRA 5FM3A 3PWYA 3ZLYA 3R00A 2UZLA 2QG5A 3R2YA 4I1ZA 4IDVA 3OCTA 3Q9XA 4F08A 4DLJA 3ELJA 3K5VA 2AUHA 1NVQA 4GT5A 3ZRKA 4I21A 5TKDA 4I93A 4BHNA 3GU7A 4O6EA 1PRYA 3CBLA 4ANMA 2YAKA 4FA2A 2IZTA 3ITZA 5E91A 3UOLA 2W4JA 2XEZA 3AXWA 4FYOA 3SXFA 4F9CA 4G3CA 2RG5A 1TQIA 4AGUA 3HP2A 5EKOA 3A7JA 4BBMA 2YDJA 1ATPE 3C7QA 2RFSA 2RKUA 2JGZA 4G3FA 3QU0A 3MESA 4YHJA 3DXQA 4LM5A 4Y8DA 4YZCA 4AP7A 3NNXA 2Z7SA 3LFCA 2FUMA 3D4QA 1XH9A 3PZEA 4FT0A 5J9ZA 1J1BA 3KRLA 4FZDB 4BGGA 1KV1A 3DK6A 4M97A 5LVLA 2OIQA 5AUVA 2RG6A 2CNUA 2ITPA 3FI2A 4DLIA 2PYWA 4EWHA 5JZNA 2E9UA 1H8FA 2B1PA 2ZV7A 5E92A 3BWFA 5M4FA 4ZY4A 3IW6A 4IX4A 3TNHA 4FC0A 2WQBA 4C2WA 3ODYX 3WBLA 3UZPA 5AAGA 5GIPE 1Z57A 2CLXA 3R1SA 3R7OA 3VS7A 3D94A 3PJ8A 4EH4A 1H1RA 2IVSA 4FSWA 4RFZA 4ZY6A 4GKHA 3QWJA 4QYGA 3SGCA 5CF4A 4QYFA 3CGFA 4KB8A 4ENXA 4DFZE 4KUJA 3KU2A 2GHGA 2XNMA 2ZYBA 2ERZE 3AMAA 3TKIA 4BYIA 4R7BA 3VUIA 5D10A 5AFVA 4O0SA 3GBZA 4PP7A 2BZKB 4BCHA 2W99B 2WTCA 3I5NA 4K0YA 4BBEA 4EZ3A 2NO3A 3FY0A 4AZTA 4CCBA 3VBTA 5A4QA 4FTNA 5HBJA 3CTQA 4FKRA 2HELA 1OI9A 3I81A 4BZOA 5LVMA 3D2IA 4OTHA 2GNIA 5DR9A 4O7LA 3Q5ZA 4YJNA 4EC8A 4CRLA 4RRVA 1FMOE 4U0IA 4DH7A 4DN5A 5LQFA 1DAWA 3SOAA 1OL1A 4EC9A 4M14A 4WNOA 3F88A 4G9CA 5LVNA 5IUHA 3EYGA 2KULA 4ZZNA 2YZAA 4GU6A 4RJ5A 4F70A 3FI4A 2OI4X 1O9UA 3LIJA 3CY2A 5I4NA 2J6MA 4ALWA 2PMNX 4FUXA 4HZSA 4PX6A 3FMLA 2OF4A 2VTOA 4K6ZA 4LL5A 4QTDA 5ANOA 4NL0A 4J8NA 1T45A 5JQ5A 3AT2A 3C9WA 4IAZA 5AEPA 4F4PA 2C6TA 3DZOA 5BYZA 3GCQA 3OVVA 2XNPA 3RHKA 2J0LA 1S9IA 4O0XA 1ZOGA 3FKLA 1MRYA 5CASA 3NNVA 1L8TA 4JRVA 1Y6BA 4BTJA 3NW6A 3RAWA 3IPHA 1S9JA 4AA5A 2W17A 3LFAA 4U5JA 3QALE 5EDQA 2CLQA 4DEGA 3O7LB 4EOLA 2PULA 4BF2A 5HTCA 4RJ8A 2NRUA 1FVTA 2YISA 3FMEA 2CGVA 2JDTA 4O91A 3W18A 3KQ7A 4J96A 3DS6A 3U9CA 3P0MA 2H6DA 3U6IA 3G33A 3TJDA 3ULZA 4CG8A 4HVIA 4A9TA 4BDCA 1P5EA 3TUBA 4O96A 4HW7A 3QTIA 1F5QA 2BHEA 4NJDA 3W2RA 4DEIA 3H9OA 4APPA 1YOJA 1YRPA 2Q0NA 4FL3A 4AWIA 4XNEA 5L6OA 5LMKC 3Q52A 5IU2A 4RWLA 4PMPA 3PA4A 2X6DA 2ZJWA 3IQ7A 3LFDA 4CLIA 3BV2A 4K11A 5HX6A 3SDJA 4A9SA 5D11A 5HCXA 2UZEA 3SW7A 3TTIA 3TKUA 4CV9A 4FV3A 3ZEWA 2YZLA 3E64A 5JFSA 3LFQA 5AA8A 3H9RA 2GHMA 4I5PA 3ET7A 3FSFA 4KNBA 5HZNA 5AP1A 2B9JA 4Y85A 3C0IA 3FZRA 4YR8A 4Q5HA 2W1GA 5HVJA 3TIZA 3JVRA 3NW5A 1OUYA 4M69B 1H1SA 2WD1A 4DGMA 4FV9A 2QKWB 4G6LA 2XJ0A 2B9IA 2GHLA 4R7HA 4XYFA 3AMYA 4OLIA 5BVEA 4AZEA 3VNTA 2GSFA 3NX8A 4O0TA 1YW2A 3S1HA 3E3BX 4B7TA 2IW9A 1OITA 4OUCA 4TWNA 3VN9A 2R3RA 3SW4A 4A4OA 4RVTA 2ZV8A 4YURA 4KKGA 4PL5A 4RC2A 4PDPA 4QNYA 4HPTE 4DT8A 3EZVA 4CZUA 3VUMA 3N4UA 2CGXA 2QI8A 2ZM4A 4V05A 2OFVA 2VWWA 3BGPA 1YHSA 4FIGA 4G16A 1PXLA 5F9EA 2BHHA 4UZHA 2DWBA 4LQMA 4QMWA 4XP3A 3RAHA 2NRYA 2WB8A 3KXMA 3BU5A 5FLFA 3ANRA 1IEPA 1OMWA 3D0EA 4NCTA 3FXZA 2V62A 2WMTA 4J52A 1ZYJA 4QMSA 1ZWSA 4ZTQA 3LCSA 2GCDA 5TO8A 3SVVA 3FHIA 5IF1A 5L8LA 4P90A 1VEBA 3EQPA 3F3WA 1WVXA 4F7NA 2XNNA 3RZBA 4JX3A 5L8KA 2OZAA 4OW8A 4WNKA 2PUUA 2OZAB 3QCYA 1FMKA 2XBJA 3ACKA 1I09A 4RQKA 4A4XA 4KAOA 1OKVA 5HCZA 1WMKA 4L00A 3IONA 3OOMA 3RWQA 4HPUE 4I5HA 4AZFA 1PW2A 3UP7A 3VO3A 3HDMA 4PMSA 3G51A 4WOVA 4Y73A 2CJMA 2ZV2A 3VBYA 1JKKA 1H07A 2UZBA 4AOJA 2F7XE 2XS0A 1GIIA 3LCOA 2JAVA 2GU8A 4DE4A 3LMGA 2W7XA 3QRUA 5FTGA 4BI1A 3G5DA 4CG9A 3ZSHA 3D7TB 3QQKA 1XHAA 4JR3A 4NM3A 2WELA 4IDTA 4ZOGA 2NP8A 5EI8A 4D9UA 4UWBA 4EJ7A 3BHYA 1PXIA 1P4OA 4D58A 1Q99A 3GU5A 4HVGA 3E92A 3C4FA 5AM6A 4KSPA 4DCEA 3WARA 3EN7A 2Z02A 4IWPA 2HZ4A 3FI8A 4S2ZA 1HCLA 3FLZA 4GV1A 3F82A 1H1PA 4CTCA 3E5AA 1QPJA 2CCIA 2UVYA 2VX3A 3NDMA 3UC3A 4AFEA 2V0DA 2YM6A 3HV7A 3KB7A 2OLCA 3ANQA 3HMMA 1FGKA 2QR8A 3OS3A 5EYMA 3T9TA 4LOOA 4S31A 1KE5A 5J8IA 3O8TA 3FMMA 3U51A 1STCE 4PQNA 3RWPA 3NUNA 4CGAA 4CCUA 4EL9A 1XR1A 1ND4A 4HYUA 2VWUA 4EOOA 5CQWA 5CI7A 5IA4A 3UQCA 5CSHA 4F0FA 1UU8A 2IZUA 3M1SA 2GQSA 3RI1A 4TWOA 2VTMA 4H39A 4KIQA 5LWMA 4B99A 1M7QA 3MFRA 3PRFA 2YM5A 2AC3A 2WQEA 2Y7JA 2PU8A 4L6QA 1WVYA 1HOWA 5AAFA 1BLXA 1YKRA 3R7VA 4L46A 3TT0A 5I0BA 2DS1A 5M53A 3DDPA 3R1YA 3THBA 4FEXA 5AP6A 1TQPA 3ZM4A 3E93A 3ZONA 4ACMA 5HLWA 3I79A 2GPHA 3QQLA 2VO3A 4YSMA 4DEDA 3EOCA 3R8MA 2CNVA 1UU3A 2PVMA 3H3CA 4FTIA 2XK6A 3WZDA 4DG2E 3PVUA 1OZ1A 2RIOA 4FIIA 5HBEA 3GENA 3NUPA 4AQCA 2YCFA 3W16A 3ZEPA 4JS8A 4LFIA 2NNWB 2C5NA 4FMQA 1JPAA 2QO9A 1Q62A 4KBKA 3UG2A 3Q6UA 3DT1A 2W9FB 3DJ5A 4F0GA 3LJ1A 1Q8TA 4A06A 2C6EA 5DN3A 3HZTA 2A19B 3SX9A 3N4TA 1MP8A 4HYSA 3QD4A 1KOAA 2IVUA 4TYGA 3ZLWA 4WT6A 4XEYA 2XIZA 5TT7A 4P5QA 5CAPA 1YDTE 4QMLA 5J95A 3ETAA 5B0XA 2FSTX 5M08A 2C5VA 5CT0A 2WMQA 1H0VA 5AMNA 2BMCA 4H1JA 2OGVA 4NFMA 5EYDA 3AD6A 4JBQA 5BVDA 4EBVA 2WZJA 4X3FB 3HV4A 2ITOA 5FBOA 2XCKA 3P86A 3LOKA 4D5KA 3W1FA 4GEOA 4O27B 2VO6A 4IAFA 3EFJA 2OSCA 3BKBA 4JAIA 5CNOA 2CKOA 4GJ2A 4O7TA 5E8ZA 2W05A 5FDXA 3TNIA 3ZDIA 5E8SA 3W33A 3WYXA 4BBFA 3VUDA 2X39A 3NYXA 2H8HA 4L7FA 1B6CB 4F9YA 2B53A 3AD5A 4QMUA 3U4WA 2W9ZB 4FTOA 4PV0A 4RSSA 4UXQA 3UZRA 4BCKA 4EK5A 1IRKA 1JWHA 4GMYA 1ZY5A 3TACA 2G01A 4YLJA 4Z3VA 5CU2A 3KMWA 4FT9A 3TL8A 2XZSA 4AN9A 5IEXA 5E90A 2IZSA 2HY81 3GP0A 3AGLA 3MH1A 3MFUA 4C4FA 1A9UA 2VTIA 4U97A 2PUNA 3ZUTA 4F65A 2PVLA 4GFGA 1GAGA 2F57A 3GEQA 1ZARA 3HYHA 3HGKA 3V5PA 3G0EA 4BCNA 2I7QA 4USDA 1L3RE 4FV0A 1KV2A 4EH6A 2J90A 4XLVA 4DFBA 4BCFA 4XV1A 3R8UA 4AGCA 1PF8A 5H8EA 4UALA 2VWYA 1WBSA 2JAMA 4EYJA 3Q60A 3V8SA 1GIHA 2G9XA 1ZMVA 5IQAA 4E7WA 5LMBA 4IX6A 5LMKA 3MSSA 4C62A 4NW5A 2JIUA 5DEWA 4AU8A 5HBHA 5TOZA 3RVGA 2GNLA 4G34A 1IAHA 5JFVA 2YERA 3OXZA 3OZ6A 5JSMA 2VTTA 2AYPA 3DGKA 3GU4A 1U4DA 4U45A 1RQQA 2UZWE 3MH3A 4C58A 5FDPA 3EFWA 2HWPA 1FPUA 1UNLA 4WNMA 4C0TA 3B8RA 3L8VA 3FSKA 2OXDA 1H24A 4NFNA 4IX3A 3E7OA 5E8XA 3H30A 5AA9A 2HOGA 5LOHA 3G9NA 3WF6A 4H1MA 5HVYA 4NM0A 3LW0A 1MUOA 3F3VA 5EYKA 4MXCA 5BMMA 3EFLA 2WPAA 4IM0A 4C33A 3QA0A 4I92A 4PP9A 1OKWA 2JDOA 4H3BA 2C6LA 3ZSIA 4NM7A 4IC8A 3ZS5A 5DHJA 4KKEA 1CSNA 4ITJA 1FOTA 3PPJA 4E5WA 3C0HA 4FTCA 4TYHB 5I9VA 3DZQA 4U43A 5I9YA 3KC3A 3WIKA 4QRCA 5BVWA 3RGFA 3F3ZA 1A06A 3EIDA 4DFYA 5B2MA 3U4UA 2CKEA 1CTPE 4K33A 4L44A 4MD9E 3VWAA 3DQXA 3MB6A 4FKGA 4EK3A 1YWVA 3FC2A 1PHKA 3MY0A 3EYHA 2WQOA 4CT2A 2HK5A 4FSMA 2B4SB 3BYMA 3F2RA 4HZRA 4JIKA 4HJOA 4LMNA 5HEZA 3Q2JA 3E87A 3SHEA 3W32A 4HVHA 4ZTRA 2ONLC 3DFCB 3IK3A 2IW8A 4Q5EA 4QMPA 1BMKA 1LR4A 2A2AA 3ORKA 3QQFA 4YJTA 4GK4A 5EW8A 1W83A 2AC5A 3A60A 2XVDA 3CEKA 5CAOA 4EKLA 2LAVA 3QCSA 2WOUA 4BGHA 3W2SA 3EN5A 1PMEA 4E73A 3PVWA 5I5ZA 3P7AA 3C13A 3LZBA 2PVJA 4FTRA 3RP9A 4EWQA 2Y4IC 2ITXA 4XG9A 4F7JA 5EKNA 3FJQE 2YJRA 5FBNC 3HA6A 2QVSE 1XJDA 4HGSA 3E63A 5C4KA 5KMLA 1YI4A 3FAAA 4YZ9A 2H34A 4CLJA 3LXLA 2WAJA 3GCPA 2X4FA 2BIYA 3BCEA 4QMNA 5A4EA 4U81A 5CENA 3UPXA 4BB4A 1FINA 3PSDA 3DNDA 3MTFA 4PNKA 1W8CA 5I9ZA 3BU6A 2R3HA 1CKPA 1H27A 4FVRA 4BDFA 4MXYA 2C6OA 2QOIA 3QTWA 3FZPA 4JBOA 4KKHA 3VW6A 3ZCLA 5A4LA 3ERKA 3KXXA 3GCSA 5DNRA 3FLQA 4ZTNA 4I6BA 4F0IA 1YHVA 4MF1A 4C7TA 4JQ7A 3FY2A 4MQ1A 5AP0A 5LMAA 3RPOA 3POOA 1JLUE 2IW6A 4TRLA 4UBAA 3A99A 1YOMA 1OIRA 3D7ZA 3JY0A 3PSCA 4FIJA 2VAGA 4QQJA 2Z7RA 3ACJA 2J7TA 2RFDA 5JK3A 5M44A 4C36A 5KMJA 2QODA 3OT8A 3BYUA 4WSYA 1JSVA 2O5KA 5CSVA 3E62A 2VWXA 2WMSA 4DFLA 1PXOA 3AC5A 2UZOA 3G9LX 5IMEA 2ITQA 3RINA 4JG8A 5H9BA 3Q5IA 1ZMUA 2JKKA 5IH6A 4M0YA 2X2KA 4ZTHA 5A14A 5GNKA 3A61A 4JL9A 3VUKA 3SRVA 2JLDA 2SRCA 1Q4LA 4QP3A 1M17A 3SRVB 3BHHA 5CEOA 1H4LA 5IQCA 4RT7A 5CVHA 2FH9A 4IAAA 3P7CA 3HEGA 5AV1A 4JBVA 2ZMCA 3KY2A 4CSVA 2BROA 5F94A 3FPQA 2QOCA 3CPCA 3A8WA 2HXQA 1U54A 3EQCA 4I3ZA 4XH6A 3V01A 3EH9A 4AT5A 5JZJA 3CXWA 4Q2AA 5CSWA 3A4OX 1ZYDA 2Z8CA 3GFEA 3A7IA 4MQ2A 1YWNA 2DYLA 1LEZA 3QKKA 2I6LA 3GNIB 5IQDA 5HG5A 1ZOHA 1OL6A 2E2BA 3KRRA 3CE3A 4FODA 4WNPA 4L9IA 1Q61A 2BAKA 3Q04A 4PTGA 5CI6A 1YDSE 5ACBC 5A4CA 2CGWA 3QLFA 4IB1A 4ZZMA 4D1SA 4L43A 4C4EA 4CFMA 4WUAA 3ZTXA 3KRXA 4Y46A 3MWUA 4IZYA 1XKKA 5BYLA 2ITVA 2BVAA 2VWBA 3G6GA 4ITHA 4I20A 4K9YA 5IZFA 4HCVA 5AP5A 3OMVA 4NH1A 2QURA 4OTFA 3DBQA 3Q6WA 4ZSAA 3MY5A 4XOYA 2YACA 5EI6A 3NUSA 3GC8A 1URCA 3I6WA 4DFXE 3REPA 4IAIA 4GFMA 3R7IA 1Q8ZA 1NT2A 4BHZA 5DRBA 1WCCA 3A7HA 3KXNA 3PY1A 3QD0A 3V6RA 5DYJA 3II5A 3ORIA 5GJFA 2QHNA 2FA2A 4YBJA 3JS2A 3U87A 3GUBA 4EI4A 3UOKA 4ZJVA 3U6JA 2XEYA 4DINA 2J5FA 1J91A 2FB8A 3VBVA 3FV8A 3LFNA 5LVOA 4YO4A 2BILB 2O3PA 1CKIA 2UW0A 5KUPA 4XX9A 4MXAA 4YJPA 4UN0C 4CVAA 3DNEA 4MNEB 4DHFA 4CKRA 4RWKA 2YFXA 3C5UA 4X2NA 4EK4A 1GZOA 2WIPA 2WMBA 2ZDUA 2XH5A 4NZWB 3RM7A 4BDDA 2CN5A 4CFXA 3R83A 4G5JA 1OKZA 5JEBA 4NUSA 4ERKA 4KIPA 2BRBA 3HMIA 4JQEA 4RLLA 3T8OA 5KMIA 3O17A 4R3CA 5KZIA 4I94A 4BTKA 2DUVA 3BIZA 1DI8A 2HXLA 1Z5MA 3GVUA 1XH7A 2OU7A 5EW9A 2VN9A 4IX5A 4MYGA 1Q3WA 3KULA 3FMHA 4TL0A 2X7OA 3PE2A 4F9AA 2YCQA 4RVLA 1U5QA 2ETRA 4ITIA 4GYGA 4MH7A 4O7ZA 1IG1A 4HVDA 2R3OA 3DAEA 5CSPA 1RW8A 5ANDA 1QL6A 2UVXA 3QTZA 2E9OA 4YO6A 2HAKA 3Q3BA 2WU6A 3KREA 5HO7A 5JKGA 1VJYA 1YXTA 3FYJX 1XBCA 1Q5KA 3IOPA 5HHWA 2X1NA 4A9YA 5A46A 3CD3A 4EOKA 4FTTA 4E4NA 4D5HA 1UU9A 2J0IA 2VTRA 5FGKA 2HZIA 3ZHPC 2XK4A 3EFKA 4GH2A 2VNYA 5JFWA 3OXIA 1REKA 4ZSJA 2VX0A 4EKKA 2QOOA 4XG3A 3W2QA 3T3UA 3PXQA 4IANA 1CDKA 5JGBA 5CZIA 3I6UA 4GUEA 2CKPA 2PVNA 1F0QA 5L2SA 2XIKA 3IGOA 4KIOA 3L9LA 3HP5A 1WFCA 2RFEA 1ZLTA 2BZHB 4GFOA 4IMYA 4M3QA 4OTRA 4FE2A 3UDBA 2EU9A 4FEWA 4ID7A 3BHVA 2QNJA 4DEAA 3IW7A 2WGJA 5B7VA 1RE8A 3MI9A 2IZRA 3C5IA 3ID6C 3R71A 2JBPA 4ACDA 3OCSA 3SA0A 2WMVA 3SG8A 4EOQA 5HIEA 4S33A 4ZP5A 3VS6A 3NGAA 3C51A 3QBNA 4H3PA 5AP3A 3C4WA 1CM8A 3F3UA 4XG4A 3NCGA 1QPDA 1G8SA 5IUGA 1TVOA 4GRBA 4FIFA 1J7UA 4DH3A 2C1BA 3OHTA 1T46A 4E6AA 5D1JA 4W8DA 2WQNA 3LJ2A 1J3HA 3UIXA 5I9WA 2Z2WA 4RBLA 4F6WA 5AUUA 2O2UA 3QFVA 2OO8X 2ONLA 4FVPA 3IO7A 2BFYA 2JDSA 4MNFA 5CY3A 3WZKA 4BDGA 4LG4A 3FYKX 4L67A 5A6OA 4W8EA 1JSUA 4M8TA 1NVSA 4CRSA 3BPRA 3C0GA 4FEQA 4MD7E 2ITYA 4L42A 3PWDA 3ZC6A 4G31A 5KMNA 4NSTA 3EKKA 3E8EA 3P9JA 1SNUA 4PMMA 5HG8A 4GJ3A 2R4BA 4JLCA 1LUFA 4J53A 4JDJA 4QO9A 4CT1A 4WIHA 2UW6A 2Y4IB 3EQHA 3LE6A 3LQ8A 4TXCA 2XP2A 2B7AA 2W5AA 1P4FA 4FSYA 5CF5A 2B55A 4EUUA 5JGDA 5M4CA 5H2UA 4BC6A 1R78A 5ICPA 1NXKA 2OW3A 1M52A 1KSWA 1XO2B 4X3FC 5EH0A 2G15A 2QR7A 1WBVA 4FV1A 3HNGA 5IDPA 3EQDA 3EQGA 4W4YA 4EH3A 4Z16A 1WBPA 1U5RA 2P2HA 5CSXA 4YMJA 5J9YA 1SM2A 3VAPA 3KCKA 4FTKA 1OVEA 2RFNA 4IFCA 1YXSA 4O22A 4E26A 3TI1A 4FKPA 4FI1A 4ZS4A 4LYNA 4PL3A 5D7VA 4CQEA 2XK8A 2W1DA 3F2NA 1NA7A 2EVAA 3R2BA 5K9IA 4I5MA 1NW1A 3W2PA 2ITZA 4FNXA 3BEAA 3ZFYA 1M14A 4FG9A 3O50A 4TWCA 2WTDA 2VD5A 1GZNA 2CMWA 4L45A 4QYYA 3UG1A 3D14A 1PY5A 2YWPA 3KVWA 2XRWA 4HGLA 2WNTA 4JDKA 5CT7A 3JR1A 3UPZA 1XBBA 2X7GA 5CEKA 2DQ7X 5HCYA 3BELA 3DB6A 3S3IA 4CEGA 4DITA 5IQHA 3P5KA 3ZYAA 5M07A 4BDHA 2CDZA 3NAYA 3AG9A 5HG9A 4CZTA 2IJMA 4XRLA 4OTQA 3EQFA 4G9RA 5H3QA 4UX9A 1PJKA 4HCUA 3D5XA 4RWJA 1EH4A 2C3LA 2YCRA 3DJ7A 4U6RA 3DAJA 4O21A 5D41A 3V3VA 4E5BA 4RPVA 1WBOA 3C4EA 3BYOA 4YJRA 2WFYA 4IC7A 5C26A 3EWHA 4M0ZA 4F63A 2PVHA 2KTYA 5AV3A 5CALA 3FXXA 4I6QA 2R3IA 5F4NA 5J1VA 4G3DA 4W4WA 3Q4TA 4JAJA 2H9VA 3FZTA 2F7ZE 2GNHA 4X7QA 3RKBA 1H1QA 4YJVA 5CYIA 5J1WA 3P78A 2Z60A 2HYYA 2XBAA 4MXOA 3QC4A 3BI6A 5IEYA 3PIXA 3CLYA 3IDPA 1UWJA 4PDYA 3BZ3A 4QOXA 4RQVA 4UEUA 4YPSA 3DTCA 3WZEA 4E1ZA 1JSTA 1SVEA 4BCIA 5KKRC 4BIDA 4EHZA 2BCJA 2C5YA 3PXRA 2WO6A 3O96A 2OBJA 2O8YA 2I0EA 5DEYA 5L6PA 1QCFA 4BCPA 3ZO1A 3AC4A 2ITNA 4XV9A 4AE6A 1M2PA 3E7VA 3TTJA 4DTBA 2FSOX 3R6XA 4XG2A 1U59A 2PE2A 3RM6A 4AOIA 1KOBA 1FQ1B 3NMUF 4E20A 4RZWA 5HQ0A 3AC2A 5IA1A 5ANGA 4CXAA 5DT0A 1UV5A 2X2MA 2YAAA 3AT4A 3C4XA 2Z7LA 3D5UA 3BYVA 3QTRA 2I0YA 4FKUA 4RFMA 5AAEA 1YQJA 5FXRA 4UB7A 5D9HA 2R0IA 4OBPA 3FQEA 3W10A 2UZVA 3KXGA 4GG5A 4D1ZA 3QL8A 3MIYA 4O7RA 4X6QC 5AM7A 4EOJA 2F49A 2ZOQA 2CN8A 1RJBA 3E8CA 1H25A 4J95A 2R3LA 3FL5A 2J0MB 3K5UA 3P4KA 3ZXTA 2X8IA 5L2IA 5HG7A 2B9HA 3VF9A 1P14A 2HCKA 2GTMA 3QGYA 4MAOA 4X3JA 2YIXA 3MYGA 2UW5A 2R9SA 2WIHA 4A7CA 5ANIA 5AUWA 4AN3A 4NJ3A 5EHYA 1BUHA 4ZEGA 5C01A 5KZ0A 3ZRLA 5C8KA 1YXUA 3MDYA 2BDJA 3D7TA 1OECA 4FUYA 4WG3A 3ZLSA 1ZAOA 2QOBA 2R3GA 3Q9YA 3R8PA 4O0WA 1WBWA 2VX1A 4C4IA 4F6SA 4F99A 2XUUA 4ZSGA 3G90X 3NSZA 2WU7A 4YGAA 2XF0A 2JEDA 5HU3A 2VTNA 5DPVA 5GJGA 2X9FA 5CU6A 2B54A 3KL8A 2QLQA 5IH4A 4G3GA 3CIKA 4X2KA 5HNBA 4PWNA 3OXTA 4NW6A 3HRBA 4CFUA 4BRXA 4J99A 4TZRA 4P5ZA 3VHEA 1WZYA 2X8DA 4ZIMA 3H0YA 3QF9A 1ZZ2A 3OTUA 5AP4A 2UW9A 3DBFA 3BGQA 4L53A 4XBRA 3PIYA 4GSBA 2BRGA 2X7FA 3UOHA 3WZJA 2ZVAA 4OR5A 3UMWA 2BZIB 1VR2A 4FNZA 4R1VA 5KMOA 5A54A 4YNEA 3AC8A 3NYOA 2FO0A 3Q53A 3ATTA 3GOKA 3K3IA 4KINA 2HW7A 2XYNA 3BE2A 3PY0A 4TTHB 2BKZA 4RVKA 4RC4A 2R7IA 3LMIA 1OIUA 3QYZA 2GDOA 2B0QA 5FTOA 4M12A 3PJ3A 4O84A 4XV3A 3R9RA 2R64A 1FVVA 2PVRA 3F5PA 4I0TA 3PP0A 4O7NA 4O0YA 2B52A 3I0OA 4KRDA 3HDNA 5HNGA 4IFGA 5M51A 4C34A 4L01A 3S0OA 4P2KA 5D7AA 1QPCA 5HVKA 5C4LA 2XRUA 2R3PA 1YXXA 2ZB0A 4QQCA 4UXLA 4E93A 3EN4A 4BY9E 2V7OA 4JQ8A 3PPKA 4QP1A 4O83A 5JRSA 2J4ZA 4GVJA 2PK9A 4QP2A 3FXWA 3MV5A 2R3JA 2C6IA 3F6XA 1OGUA 1H00A 3F69A 3AD4A 4FSUA 4PUZA 1OIQA 4AUAA 4CD0A 3EL8A 4XS2A 4GL9A 4IBMA 1H28A 1MRVA 2P4IA 4IM2A 2WMAA 5GIOE 3IW8A 5FXQA 4FEUA 1TKIA 2W1IA 4MVFA 5E8TA 3M42A 3EZRA 2VWIA 3EQRA 3UP2A 2CCHA 4OT5A 2OJ9A 2ZM1A 3DK3A 5CF8A 4I23A 4ANQA 4MX9A 1SYKA 3RPVA 4MWHA 3TN8A 4GS6A 5JMSA 3VULA 5FP5A 5J9LA 1JAMA 4FV2A 3QQHA 3LQ5A 5EFQA 4O86A 2IO6A 4YHTA 4AT3A 2YA9A 2GQRA 2C6DA 4UYAA 4X0MA 1APME 3T3VA 3CJFA 3P79A 4N6YA 3WE4A 3BQCA 2WTWA 4X3FA 3MH2A 3ODZX 3PA3A 2UZUE 4C4JA 2J9MA 4TYEA 5HIBA 3SXSA 4QQ5A 5ETIA 4B8LA 4IW0A 2WMXA 4U3ZA 4RIWA 4DH8A 3OWLA 3M2WA 3QQJA 4RIWB 4RIOA 2EXMA 2HIWA 4XG7A 1A48A 2C0TA 3DY7A 4TY1A 5FEQA 3BBWA 5HE1A 5T3QA 2W4OA 3ZOSA 4YTHA 5HD7A 3C4CA 4BCGA 2JDRA 3O71A 3QTSA 3PXZA 4PMTA 4QTCA 5DA3A 3F3TA 3IW5A 4ZK5A 4J71A 3SLSA 4IACA 1K9AA 4FG8A 4II5A 4TNBA 3RAIA 3OCBA 4O0UA 5GJDA 3UO4A 4BI2A 4IWOA 2CKQA 1KWPA 4BYJA
chains in the Genus database with same CATH superfamily
4ONAA 3AQVA 4JR7A 5E8UA 4ERWA 1XH4A 4YJSA 3I7BA 3R21A 4V01A 1Z9XA 3BHTA 2PE0A 1H0WA 3UZTA 1JKLA 3DPKA 2WTIA 2ZV9A 3L8SA 2F2UA 4YZBA 4EH5A 4ENYA 3EQIA 4FKLA 4NIFB 2QOHA 4EH8A 5KBRA 3WYYA 3AKKA 4IAKA 1OBGA 2OICA 4AS0A 2GMXA 1LPUA 4YPDA 4YJQA 4IWDA 4QMYA 4TNDA 1Q24A 2LGCA 4RJ4A 3PUPA 4GK2A 2UZTA 4ZTMA 4KS8A 2VGOA 1U46A 1MRUA 1Q8UA 4FR4A 3W8LA 4EORA 2YM7A 5IMXA 2UZNA 2OJGA 2YM4A 4FGBA 2ZB1A 3CS9A 2QCSA 3FE3A 5AWMA 5J5SA 5DLSA 4AG8A 5AJQA 4QEBA 3QWKA 3DFAA 3RTPA 5LVPA 3UQFA 3OD6X 1J7LA 3VRZA 1IR3A 1AGWA 2EB3A 2R3NA 4L7SA 4S32A 5JN2A 4BDIA 3L8PA 2X81A 1B38A 3WILA 3TM0A 4FTAA 2BR1A 4IQ6A 5KKRB 5CXHA 3PVBA 1PXPA 4QPAA 4U3YA 1BI8A 2J0JA 5CAQA 3JY9A 5BVNA 2BUJA 4AZVA 4FKOA 2WMRA 4G5PA 4RIXA 3UODA 5JFXA 4DTKA 4RIXB 3COKA 2P3GX 4TYHA 4XOZA 3MB7A 5B2KA 5EQEA 2JDVA 3C50A 2JFMA 3U8WA 2C5OA 4MTAA 2Y6MA 1J1CA 2UUEA 5KMKA 4EBWA 2PVYA 2BTSA 3F5XA 3TV6A 3BBTB 3CSVA 3OY1A 4QMXA 3QRTA 3TCPA 2W5HA 4YUQA 4DHJA 3PVGA 4FJVA 3ZBFA 4OT6A 5HTBA 4OBOA 3UVQA 4Y95A 3QUEA 4YBKA 3R8ZA 3R02A 4EZ5A 5M09A 1JKSA 3RMFA 4BZDA 3UJGA 3QA8A 4FT7A 4DEHA 4GUBA 4FKWA 4AFJA 4IAYA 5ANEA 3QCQA 4FSNA 2YDIA 2C5XA 2VTHA 3BRBA 3MPMA 3ORXA 5K5XA 1ZZLA 5AUZA 4NT4A 3QGWA 3FMKA 5A9UA 4MHAA 2IVVA 2OZOA 2ETMA 5L2WA 4M15A 4DT9A 4DH1A 4FYNA 3P08A 3TZ8A 2FYSA 3ZLXA 4G3EA 4DFNA 4I5CA 3VBXA 3R8VA 1OKYA 4H36A 3KEXA 1IASA 2OXYA 3VF8A 3LCTA 4GT4A 4ZSLA 2QO2A 4FIEA 3LM5A 4K18A 4FBXA 2ITWA 1JNKA 4YJUA 4ZMEA 3TZ9A 3FLYA 2G2HA 4AXFA 4F1MA 1VYZA 2JC6A 2ITUA 3E8NA 4X6RA 2XKDA 5EK7A 4V04A 3NZ0A 4DEEA 2V7AA 4AXEA 3PXYA 5M55A 4O0VA 4FTJA 3OG7A 3PA5A 3RHXA 4A07A 4R1YA 2CSNA 1H01A 4P7EA 1GJOA 4Y72A 5CX9A 4C02A 5I9XA 5DBXA 5JH6A 2VTAA 3HV5A 5L3AA 3TG1A 4Z55A 4IM3A 4KBCA 4JDHA 4Y5HA 2EUFB 2YM8A 3N51A 4J7BA 5CU0A 4ANBA 4DGGA 4FZFB 3VIDA 3UMXA 4Q9ZA 4D4VA 3EHAA 3PG3A 2REIA 4JMQA 3UGCA 2UW8A 4ZMFA 4RWIA 2UV2A 2GFCA 1M2QA 5CVGA 3DCVA 4EOMA 4KSQA 3GC9A 4CFVA 1YOLA 1UKHA 2PZRA 3EN6A 3Q9ZA 5FTQA 3LQ3A 4ZTLA 3UIUA 2XNGA 5EOLA 3L9PA 3QC9A 1MQBA 5FG8A 1K2PA 3WF8A 2OJJA 4TT7A 3TNQB 2XCHA 3ENHA 4A9RA 3CTHA 4ACGA 2JKOA 3MH0A 5JGAA 2FSMX 4TN6A 3I4BA 4R3PA 1G3NA 1OPJA 2GFSA 3UNJA 4DBNA 3I1AA 5EDPA 2OFUA 2XK3A 3L8XA 3BWJA 2VWZA 3GU6A 3BEGA 3RALA 4DH5A 4XP0A 4BI0A 3R0TA 1BL7A 2JKMA 4ZJJA 4D4RA 4F9BA 2UW4A 3AKJA 4RX8A 5DRDA 1M7NA 5IQBA 4LUDA 1KE6A 1PXMA 4XG6A 4GG7A 4U7ZA 3MJ1A 2ZDTA 5GINE 5IQFA 2X6EA 4UZDA 2JKQA 2W96B 4IHPA 3TIYA 4G6NA 3IOKA 2V22A 3I5ZA 4USEA 4YZMA 2X0GA 3Q4ZA 3PFQA 3K2LA 1DI9A 3ALOA 3ENMA 4FV7A 5IA5A 4EEVA 5KMMA 4L3LA 5CU3A 3OEFX 4W4XA 2O64A 5BUIA 4IWQA 3FLWA 2CHLA 2ITTA 3VJNA 5HU9A 3ZO3A 4C4GA 4I6HA 4RLKA 4XG8A 2PZPA 3Q4UA 1LP4A 4DBXA 1G5SA 3TV4A 4EUTA 5E8VA 4LRJA 5BMSA 3C4ZA 3WIGA 4FNWA 4FKTA 3VQUA 3BGZA 1CMKE 5E7RA 4CMUA 3NPCA 2C3JA 3E88A 2BDWA 2VWVA 5DT4A 4FT5A 5AADA 3CKWA 4FOCA 3DBEA 4FV8A 3R63A 3KKVA 4FX3A 2WMWA 5LARA 3P7BA 5C03A 2XJ2A 2XKEA 2P0CA 3G15A 4FL2A 5E4HA 3ZUVA 3HV3A 3QHWA 4RA5A 3MN3A 4UWCA 4D2SA 2FSLX 4WUNA 5IUIA 5CLPA 3DQWA 3UC4A 5LJJA 5DI1A 3OUKA 4FNYA 2WTJA 3KK9A 4PTEA 4JDIA 3RJCA 3OBJA 2WTVA 3QZHA 2C30A 3RAKA 2YITA 4JNWA 4MK0A 4CFWA 4MNEA 5A6NA 3CQWA 3FQSA 3MJ2A 3TNWA 3ORMA 5M06A 3MVHA 4X2GA 2C3KA 3FEGA 4U40A 1OM1A 4E5AX 4L3JA 5DH3A 2ZMDA 4CNHA 1URWA 4BDEA 3PXKA 1DM2A 4PF4A 2BRMA 4FTQA 2F4JA 3AMBA 3C1XA 4I4EA 3UYSA 4ALVA 2X9EA 3OC1A 3AGMA 1H1WA 2ZM3A 2X4ZA 4JJRA 4O2PA 3TJCA 2G2FA 4AZSA 5HO8A 4D9TA 3NUXA 4U80A 2YWVA 3MGYA 4DTAA 2RGPA 2ACXA 4YTIA 4F09A 2BALA 4IIRA 5LWNA 2XKFA 1IA9A 3MA3A 5BX0A 3TV7A 4FKSA 3V5JA 3QXPA 4A9UA 3RK5A 4O0RA 4X2JA 3NVKI 5AX3A 3EJ1A 4BICA 2HWOA 5CS6A 5EM8A 4ZTSA 1Y8GA 1O6YA 1Y8YA 3E3PA 2PZIA 2OK1A 4MWIA 2VU3A 3OP5A 4WBOA 2PVKA 3FWQA 2J5EA 4NKSA 1JOWB 3FZOA 1HCKA 2BAQA 1R0EA 2OIBA 3S2PA 4AT4A 4IZ5A 1XWSA 2UW3A 5IPJA 1JBPE 2IWIA 3NAXA 3LFSA 1SNXA 3DA6A 4BGQA 3A7GA 4I24A 1W98A 3EQBA 3F5GA 3R01A 3F7WA 4EOIA 4R7IA 3RPRA 1PKDA 4F7LA 4I6FA 4AW0A 3NRMA 3DJ6A 4IVDA 2A1AB 3BQRA 4O81A 5ETCA 2QHMA 3TUCA 3KCFA 5CAUA 1NY3A 4F6UA 5L2TA 4WRGA 2R5TA 2BRHA 2YEXA 5IH5A 2QOQA 1PMNA 2WXVA 3DOGA 3A8XA 4B4LA 4X21A 1QPEA 4I22A 3F66A 4FSRA 4LOQA 3CGOA 3PRIA 4KS7A 3V6SA 4WA9A 2GNFA 3OWPA 4BDJA 3M11A 2XYUA 3HV6A 3UIBA 5EQPA 2OH4A 3DDQA 4QYHA 4QMMA 2QOKA 1JKTA 4BDBA 4WG5A 3DXNA 1Q8WA 4N6ZA 1W84A 5IEVA 3ROYA 5HIDA 2OH0E 4B6LA 1H08A 3LKMA 5HX8A 1XH8A 5EQYA 5AUXA 3QTXA 5G6VA 4YTCA 1E1VA 3BU3A 2R3MA 3D5WA 4DHZA 1JVPP 3CD8A 1ZRZA 3HECA 3W2CA 4W4VA 2O65A 2VTSA 3OBGA 3TNPC 4E4LA 1UWHA 4QP9A 2C69A 4J97A 4R78A 2E9NA 3RK7A 4LMUA 4O38A 1V0OA 4MCVA 4JI9A 2XNEA 3LXKA 3NS9A 4MBIA 2H96A 3QXOA 4Z7GA 4U8ZA 3W0MA 5E1SA 2GS7A 4FZ6A 3HLLA 2Z7QA 1ZOEA 3DLZA 2C0IA 3U6HA 3K54A 4G17A 4RZVA 3UBDA 2C1AA 1Y91A 4FKIA 5J7HA 3N4VA 2PMIA 4GU9A 5KO1A 3SOCA 1VLRA 4XBUA 3TXOA 4AW5A 3NIEA 4XHKB 3POZA 5CWZA 4EZ7A 4YP8A 3W2OA 1YXVA 3R7EA 4CV8A 1XMMA 3ALNA 3VBWA 4AX8A 4E6DA 3QKLA 2HZNA 4J1RA 5K4IA 3KK8A 4UV0A 2HW6A 3GC7A 4S34A 3PY3A 2YIYA 3PLAE 3HUCA 3LLTA 4N70A 2XAOA 3VQHA 4KBAA 3F61A 1I44A 5EHOA 2BAJA 5FEDA 3V5TA 2WMUA 3JVSA 4EHVA 2VO7A 2W1CA 3HUBA 3OF0A 4FG7A 4J8MA 3HMNA 4NYEA 3QD2B 5FRIA 3F9NA 3R9NA 4HYIA 3OEZA 3R22A 5A4TA 1UU7A 3HMPA 3TEIA 5CXZA 3KN6A 4R5YA 4ZLYA 4F1TA 2YM3A 3SV0A 5IA3A 3PJCA 4EONA 5ANJA 4DG3E 4FSQA 3S4QA 4HVSA 3V04A 4RJ6A 4C4HA 4GYIA 4XV2A 2A0CX 4U41A 3K3JA 2Y0AA 3B2WA 4R6VA 3UQGA 3FQHA 3EKNA 1SVHA 4WG4A 3CC6A 3ZZEA 4IJPA 5DWRA 5AUTA 3ZFMA 3MTLA 4G2FA 4QP4A 2YHVA 4HNFA 3NR9A 5E8WA 2I40A 2GS6A 3V5QA 4FICA 2XA4A 4QP8A 1Q3DA 2IN6A 2Q83A 3PDTA 3MFTA 3QYWA 4M84A 4O7YA 3ZM9A 4AN2A 3D5VA 3FC1X 3PP1A 4XUFA 1YI3A 3HKOA 3BX5A 1WAKA 4D4YA 1KE9A 1KE7A 2W4KA 3DBCA 4U9AA 4EJNA 4ZJIA 4H3QA 5HE2A 2VRXA 2J2IB 2RL5A 3BL9A 2AEGA 3KXZA 2XK9A 4U42A 3D83A 4B8MA 4U44A 4N57A 2I1MA 1XMLA 4FSZA 3SXRA 3WF9A 2NYAA 4FZAB 4TKSA 3ZBXA 3CTJA 4EOSA 2WKMA 3OY3A 3QHRA 3R8LA 4TW9A 1F3MC 4DG0E 2PL0A 4APCA 2QU6A 4JX7A 4D4SA 3KMMA 3PTGA 3NCZA 3QRKA 3QKMA 5BVOA 5M56A 4C61A 3PYYA 2IPXA 2J0KA 2I0HA 2B9FA 4AGWA 2BRNA 3NNUA 4FTUA 5LCKA 3IKAA 1R1WA 3QRJA 5AV2A 3VS0A 4ZS0A 2QD9A 4ANLA 5IISA 4AXAA 1AQ1A 4RJ3A 4F64A 2R3QA 2QKRA 4YZNA 3VS3A 1YWRA 3ORNA 5IA0A 4FZ7A 4XCUA 4ZSEA 2VGPA 3LCKA 2PE1A 3HAVA 5F1ZA 2BDFA 3BYSA 4S30A 4I4FA 3MY1A 2CPKE 4O7WA 3QZFA 2W0JA 5BUEA 2XM8A 4BCQA 4RX5A 2G1TA 4O82A 4BIEA 3PZHA 2WTKB 2O0UA 5EHLA 5H8GA 3UOJA 4OBQA 5AUYA 3VS4A 5DE2A 4AW2A 4LV5A 3LXNA 3PLSA 1PYXA 2YCSA 1FBNA 4B9DA 1W7HA 1XH6A 3CCNA 3DKCA 3LAUA 1PMUA 2C0OA 2EXCX 2YIWA 3JUHA 4JVGA 2BTRA 4RMZA 5CVFA 3FL4A 4ORKA 3LFEA 5CEIA 2JIVA 5CAVA 4FVQA 5AP2A 5ACKA 3F2AA 4AACA 3GC0A 3NUAA 3P23A 4JIAA 4NTTA 4BKJA 4JRNA 2EWAA 4MXZA 3FMDA 3IDBA 4BTMA 1J7IA 3KFAA 5C1QB 4O7SA 4DAWA 2WOTA 4DGNA 3EN9A 4CFNA 2VTLA 3PJ2A 4Y5QA 3UIMA 2ESMA 5DT3A 5BNJA 3KMUA 3GT8A 3QUDA 4FKQA 1GY3A 3D2KA 4CFFA 4EH2A 3DKGA 3FI3A 5EW3A 5IQIA 4EQMA 3FBVA 3GQIA 4ZLOA 2Q0BA 2XK7A 3F7ZA 3E8DA 4FV4A 1IAJA 4D55A 2PUPA 2Y9QA 5D12A 2BPMA 3QX4A 1XQZA 2VO0A 2XIRA 4AXDA 3VS2A 1M2RA 4M68A 1IA8A 3DK7A 1DS5A 1KUTA 3BLHA 4IB3A 4ASDA 4FT3A 2WHBA 1VYWA 4DC2A 1H26A 5E1EA 4YHFA 3MW1A 4FKVA 2W06A 4L68A 4NK9A 4C35A 4KWPA 3TWJA 4QTBA 5AIKA 2QO7A 3KA0A 4EHEA 5HICA 4DGLC 3PG1A 5HNIX 3WE8A 4E8AA 2YDKA 2XNBA 2E9VA 3HMOA 2HZ0A 3CPBA 1Y57A 3QX2A 1BI7A 3QLGA 3SKCA 3WF5A 2J51A 4BDAA 4OTWA 5HI2A 1BL6A 4OGRA 4BCJA 5CF6A 2C3IB 4ZY5A 2RF9A 4M67A 4DA5A 5B2LA 3NYNA 2PTKA 1WBTA 3GB2A 2OJIA 4WBBB 1JQHA 3UNKA 3HAMA 4MKCA 4ACHA 4N4SA 4BTFA 5DFPA 4PNIA 4YZDA 2JD5A 1YVJA 3GOPA 3HL7A 2VTPA 3V5WA 3FDNA 3KRWA 5BVFA 5C27A 1OBDA 1OL5A 3LFFA 5L8JA 4FTLA 3NWWA 4WO5A 3BL7A 2Y6OA 3DU8A 2V5QA 4F7SA 5EYCA 4JG7A 5KBQA 3DBDA 4KD1A 5L6WL 3OTVA 2XB7A 3FKOA 3TKHA 2PMLX 3OOGA 4WRSA 4IEBA 2C47A 2I0VA 2C6MA 3COHA 3DAKA 1TFFA 3O8UA 3R9OA 3D9VA 3VUGA 2R7BA 3JPVA 4RIYA 4D2RA 1OIYA 3GCUA 4QMOA 4RIYB 2XIYA 4FTMA 5DIAA 4D1XA 3LCDA 4IE9A 4R3RA 1SZMA 4PY1A 2QQ7A 2ETKA 2EB2A 3KRJA 4QMTA 4QQTA 3SAYA 4F9WA 2JIIA 2PMOX 3WOWA 4DF3A 3AT3A 3KXHA 5KNJA 4TWPA 3MVLA 3V8WA 4ZLZA 3S00A 3FUPA 4XMOA 4D0WA 5EDRA 4RC3A 4C37A 4FIHA 4UWYA 4YLKA 2J50A 4R77A 5BUJA 2NPQA 3LLAA 4QPSA 4FGRA 4QDVA 3I7CA 3LXPA 1BKXA 3OW3A 4BVUA 1PXKA 5KHXA 3CQEA 3CY3A 3O7LD 3QAME 5IQEA 3KGAA 4XRJA 3DKOA 4LGHA 3H9FA 4Q9SA 4R5SA 5LCJA 3QD3A 1E1XA 2G2IA 3ZDUA 5LXMA 2JFLA 4PTCA 3LFBA 3O23A 5HE0A 3H0ZA 4YLLA 3MVMA 3CQUA 4QP7A 1Q97A 3A62A 5K5NA 4EH9A 3R30A 4BCOA 4AF3A 2GNGA 1ZYCA 3PPZA 4RX7A 3ZH8A 4YU2A 1V1KA 3HVCA 2R0UA 2VTJA 4K2RA 5DR2A 3VJOA 3MPTA 4AQKA 3NVMB 1Q41A 4QP6A 4ANSA 4M13A 2HENA 4BCMA 2W1FA 4RX9A 3O51A 5T6KA 5DVRA 3KVXA 3N9XA 5BVKA 3QTUA 3VW8A 3PIZA 4ASXA 4MBJA 5C8MA 4LGGA 3V51A 3QRIA 5FM2A 4C3PA 4D0XA 5K3YA 4ALUA 4DGOA 1ZY4A 3IECA 4L3PA 3GI3A 5AX9A 2O63A 3CP9A 5CTPA 3IDCA 4GT3A 4K77A 2JBOA 2OJFE 5AIRA 2F9GA 2FVDA 3H4JA 4IVCA 3ZXZA 4ASZA 5CZHA 3R04A 5ANKA 1GIJA 4I0RA 4LL0A 4LRKA 3AC3A 3NIZA 4HGEA 4LUEA 4WD5A 5M57A 1NVRA 3CJGA 3W0RA 5M4UA 1OB3A 1UKIA 2OXXA 3HRCA 4K8AA 5AV0A 3W8QA 5EI2A 2YIQA 5CNNA 3DXPA 4RJ7A 4MD8E 1K3AA 1UNGA 2WEVA 1X8BA 3DB8A 3WF7A 4FV5A 4CMTA 5C8NA 3QTQA 5F20A 2FGIA 4YSJA 4IJ9A 4KRCA 4MEDA 3ZRMA 3UDTA 3MFSA 4E4XA 3NNWA 4PDSA 3KN5A 1ZYSA 3FLNC 2C4GA 3PSBA 3ZO2A 3GQLA 4JOAA 4U79A 4YNOA 4HYHA 1O6KA 1SVGA 2P33A 5EM6A 3U55A 2F7EE 2XKCA 5KCVA 3H10A 2OKRA 4KABA 3Q9WA 3LMHA 4JT3A 5EG3A 1YDRE 4WKQA 1SMHA 1FGIA 4EQCA 3QQGA 1ERKA 2C6KA 3QCXA 3R1NA 4GVAA 3PJ1A 2IG7A 3NUUA 3S95A 3R9DA 4DEBA 4WHZA 3GXLA 3I60A 2XJ1A 1PXJA 3V5LA 3UO6A 2VZ6A 1Q8YA 3PE1A 5F95A 4QMQA 2Y8OA 4LI5A 3RK9A 1R3CA 4M7IA 4RGJA 3SQQA 2YJSA 5E9EA 4AE9A 4V0GA 1UNHA 4IB0A 5KX8A 2X2LA 1WVWA 4V0GB 3COMA 2C68A 3QZGA 4OTIA 5JRQA 4NWMA 3MA6A 4TYIA 3OT3A 1OPLA 1W0XC 4C3RA 4E4MA 4FV6A 3ZMMA 5AV4A 3NW7A 3GU8A 4EH7A 1B39A 4LOPA 2Y4PA 5C9CA 3R9HA 4C59A 4CKJA 3I0QA 4DCAA 5BYYA 3UVPA 5HD4A 4G6OA 2OIDA 4IB5A 3BV3A 4Z9LA 5J87A 3ZC5A 3ROCA 3BE9A 1UVRA 2PZ5A 5HESA 3UE4A 3GCVA 3KIOC 4OTDA 3RPSA 2R3KA 4JBPA 4C2VA 4USFA 1E9HA 2GNJA 1OUKA 1XH5A 4LRMA 3MVJA 4FK3A 4OTGA 4AA0A 5FEEA 3IG7A 5DOSA 3NEWA 1LEWA 3Q4CA 4L52A 3FHRA 4Y83A 3UTOA 5FP6A 3OW4A 3ZSGA 5H8BA 3FKNA 4GCJA 3T9IA 3ZZWA 5JT2A 1R39A 3SD0A 5HLPA 5JQ8A 5CEPA 4TYJA 4IVBA 5IA2A 1O6LA 3OWKA 4JXFA 1GZ8A 4Z7HA 1UA2A 5T68A 3OWJA 2GQGA 2ZFYA 3LPBA 5CQUA 2PHKA 3W0SA 4A4LA 4HOKA 1PKGA 3SC1A 4UYNA 3R7YA 4QYEA 4NM5A 4PDOA 4H05A 3V8TA 2OF2A 5K4JA 2A27A 4QNAA 1TQMA 3L9MA 1PXNA 3LVPA 3IGGA 1XBAA 3G0FA 2BFXA 4EK6A 3FZSA 5IQGA 3VS1A 2CGUA 3GFWA 4RVMA 3TDVA 1PMVA 1R0PA 3AC1A 3EL7A 1V0PA 5G1XA 5M4IA 1ZMWA 2UVZA 2VTQA 4O6LA 5DGZA 3WZUA 4BZNA 4E6QA 3GGFA 3B2TA 4XP2A 5AP7A 5ETAA 4E6CA 2QC6A 3PXFA 5CU4A 3R28A 1P2AA 4HNIA 2GTNA 4ZZOA 1BYGA 3SG9A 2PY3A 3RPYA 2CNQA 3MIAA 3O2MA 1VZOA 1Y6AA 4O7VA 1OPKA 1GZKA 4AA4A 5HE3A 2ZAZA 4ASEA 4IADA 4MBLA 4YJOA 2BIKB 2VNWA 1YHWA 4G1WA 2VUWA 3UO5A 1REJA 3W0QA 3O0GA 4HCTA 2VV9A 2OG8A 3G2FA 4CKIA 2PVFA 2R2PA 4GIHA 1PYEA 4O2ZA 3CR0A 1OL2A 3U9NA 4YC3A 4QTAA 4CMOA 2PPQA 3A2CA 4NKAA 4QT1A 4GIIA 4LV8A 5FD2A 3TDWA 4FKJA 3B8QA 3ZO4A 2UZDA 5EOBA 3FLSA 5FUTA 3DKFA 3QQUA 2ERKA 4BDKA 3AOXA 5HGIA 3ORPA 3U54A 4EQUA 3VUHA 5CEQA 3MPAA 4BN1A 4FSTA 4I0SA 3RCDA 1DAYA 1AD5A 3NFFB 4ARKA 4C38A 4IZ7A 3KF7A 3WI6A 4EHGA 2X8EA 4N0SA 5DR6A 5IG1A 3ATSA 5E8YA 4P4CA 2GS2A 2W1HA 4EYMA 5KHWA 4AGDA 3HRFA 5IDNA 4AZWA 4UY9A 4FEVA 3L9NA 3LHJA 3QZIA 5CEMA 5TR6A 5ETFA 4DFUA 2R3FA 2JITA 3JXWA 5BQ0A 3COIA 4D28A 2QONA 1U54B 4KA3A 3Q32A 3G6HA 3Q96A 3FMNA 1MQ4A 4K1BA 1G8AA 4QTEA 3TZMA 2WEIA 4J98A 4XLIA 3D15A 3OROA 3VBQA 3EB0A 4EK8A 2XM9A 3OUNB 3ZFXA 3VS5A 5KE0A 5FQDC 3R73A 2PSQA 4F1OA 1V0BA 2BKKA 4ZXTA 2IVTA 3FPMA 5BPYA 3DV3A 2WTKC 4RA4A 3R7UA 5CANA 3ULIA 3A7FA 3DTWA 3BLRA 1KE8A 1W82A 3UYTA 2F2CB 2WQMA 3OCGA 2HY0A 3HA8A 4FOBA 4BIBA 4GKIA 2QOFA 3FZ1A 4GW8A 4QMZA 5DG5A 2PUIA 3FMJA 2P2IA 2QLUA 3TZ7A 4AOTA 4RFYA 4QMVA 1GOLA 4X2FA 4MXXA 2W5BA 1RDQE 4JG6A 3LM0A 4NTSA 5HORA 1CKJA 3BLQA 2QG7A 3QUPA 1GNGA 5GHVA 5EM7A 4C3FA 5HLNA 2PZYA 3IW4A 3NUYA 3MS9A 3JYAA 3L1SA 1BX6A 4NCTC 3VRYA 3VVHA 3VHKA 4IH8A 2XMYA 4NU1A 2BZJA 4H58A 4AW1A 2YIRA 3OFMA 3ORTA 1WBNA 1ZXEA 3Q2MA 2YABA 3VC4A 3KF4A 3CKXA 4HGTA 3NLBA 5EM5A 3ZU7A 2E9PA 3F5UA 4ZAUA 2XNOA 2YN8A 2XIXA 3PFYA 5FXSA 4YC8A 2W1ZA 4PRJA 4GK3A 3W55A 3O8PA 3EMGA 5ITAA 3HX4A 3ZUUA 1QMZA 1YI6A 3UNZA 2OWBA 3ORZA 3RNIA 5HKMA 4PL4A 3P1AA 4CTBA 3LJ0A 1OL7A 2PWLA 3BHUA 2QU5A 4IVAA 4I41A 1ST0A 4RG0A 3IS5A 5TF9A 3DLSA 3TUDA 3P5JC 4L8MA 3A4PA 4XJ0A 3NYVA 4BR3A 4AAAA 4YC6A 5I9UA 2W1EA 4B0GA 2A4LA 3MBLA 3ORLA 2QOLA 4FK6A 3KULB 1FVRA 4FL1A 4YTFA 4ACCA 3R1QA 2V55A 5A3XA 2P55A 3RCJA 2UW7A 4DYMA 4IZAA 4EOPA 4TPTA 3UVRA 5FM3A 3PWYA 3ZLYA 3R00A 2UZLA 2QG5A 3R2YA 4I1ZA 4IDVA 3OCTA 3Q9XA 4F08A 4DLJA 3ELJA 3K5VA 2AUHA 1NVQA 4GT5A 3ZRKA 4I21A 5TKDA 4I93A 4BHNA 3GU7A 4O6EA 1PRYA 3CBLA 4ANMA 2YAKA 4FA2A 2IZTA 3ITZA 5E91A 3UOLA 2W4JA 2XEZA 3AXWA 4FYOA 3SXFA 4F9CA 4G3CA 2RG5A 1TQIA 4AGUA 3HP2A 5EKOA 3A7JA 4BBMA 2YDJA 1ATPE 3C7QA 2RFSA 2RKUA 2JGZA 4G3FA 3QU0A 3MESA 4YHJA 3DXQA 4LM5A 4Y8DA 4YZCA 4AP7A 3NNXA 2Z7SA 3LFCA 2FUMA 3D4QA 1XH9A 3PZEA 4FT0A 5J9ZA 1J1BA 3KRLA 4FZDB 4BGGA 1KV1A 3DK6A 4M97A 5LVLA 2OIQA 5AUVA 2RG6A 2CNUA 2ITPA 3FI2A 4DLIA 2PYWA 4EWHA 5JZNA 2E9UA 1H8FA 2B1PA 2ZV7A 5E92A 3O5AA 3BWFA 5M4FA 4ZY4A 3IW6A 4IX4A 3TNHA 4FC0A 2WQBA 4C2WA 3ODYX 3WBLA 3UZPA 5AAGA 5GIPE 1Z57A 2CLXA 3R1SA 3R7OA 3VS7A 3D94A 3PJ8A 4EH4A 1H1RA 2IVSA 4FSWA 4RFZA 4ZY6A 4GKHA 3QWJA 4QYGA 3SGCA 5CF4A 4QYFA 3CGFA 4KB8A 4ENXA 4DFZE 4KUJA 3KU2A 2GHGA 2XNMA 2ZYBA 2ERZE 3AMAA 3TKIA 4BYIA 4R7BA 3VUIA 5D10A 5AFVA 4O0SA 3GBZA 4PP7A 2BZKB 3BLAA 4BCHA 2W99B 2WTCA 3I5NA 4K0YA 4BBEA 4EZ3A 2NO3A 3FY0A 4AZTA 4CCBA 3VBTA 5A4QA 4FTNA 5HBJA 3CTQA 4FKRA 2HELA 1OI9A 3I81A 4BZOA 5LVMA 3D2IA 4OTHA 2GNIA 5DR9A 4O7LA 3Q5ZA 4YJNA 4EC8A 4CRLA 4RRVA 1FMOE 4U0IA 4DH7A 4DN5A 5LQFA 1DAWA 3SOAA 1OL1A 4EC9A 4M14A 4WNOA 3F88A 4G9CA 5LVNA 5IUHA 3EYGA 2KULA 4ZZNA 2YZAA 4GU6A 4RJ5A 4F70A 3FI4A 2OI4X 1O9UA 3LIJA 3CY2A 5I4NA 2J6MA 4ALWA 2PMNX 4FUXA 4HZSA 4PX6A 3FMLA 2OF4A 2VTOA 4K6ZA 4LL5A 4QTDA 5ANOA 4NL0A 4J8NA 1T45A 3PUFC 5JQ5A 3AT2A 3C9WA 4IAZA 5AEPA 4F4PA 2C6TA 3DZOA 5BYZA 3GCQA 3OVVA 2XNPA 3RHKA 2J0LA 1S9IA 4O0XA 1ZOGA 3FKLA 1MRYA 5CASA 3NNVA 1L8TA 4JRVA 1Y6BA 4BTJA 3NW6A 3RAWA 3IPHA 1S9JA 4AA5A 2W17A 3LFAA 4U5JA 3QALE 5EDQA 2CLQA 4DEGA 3O7LB 4EOLA 2PULA 4BF2A 5HTCA 4RJ8A 2NRUA 1FVTA 2YISA 3FMEA 2CGVA 2JDTA 4O91A 3W18A 2XANA 3KQ7A 4J96A 3DS6A 3U9CA 3P0MA