3UZRA

Crystal structure of aminoglycoside phosphotransferase aph(2'')-ib, apo form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
299
structure length
299
Chain Sequence
MVNLDAEIYEHLNKQIKINELRYLSSGDDSDTFLCNEQYVVKVPKRDSVRISQKRELELYRFLENCKLSYQIPAVVYQSDRFNIMKYIKGERITYEQYHKLSEKEKDALAYDEATFLKELHSIEIDCSVSLFSDALVNKKDKFLQDKKLLISILEKEQLLTDEMLEHIETIYENILSNAVLFKYTPCLVHNDFSANNMIFRNNRLFGVIDFGDFNVGDPDNDFLCLLDCSTDDFGKEFGRKVLKYYQHKAPEVAERKAELNDVYWSIDQIIYGYERKDREMLIKDVSELLQTQAEMFIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside phosphotransferase
publication title Crystal structure of aminoglycoside phosphotransferase APH(2'')-Ib, apo form
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 100
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uzrA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3uzrA02
3TZ7A 4GU6A 4TYEA 3A62A 1E9HA 4HYIA 3ZYAA 3BQCA 4C4IA 2OF4A 4TWCA 2C5VA 2ITXA 5EK7A 3TDWA 2VAGA 4QO9A 5CYIA 3OTVA 4ZZNA 4MXCA 4EUTA 5BX0A 4OTQA 1YWRA 3V01A 2WTKB 3HA8A 2XUUA 3JVRA 3NR9A 5HLPA 3LVPA 4E6QA 3DPKA 4FTRA 3ROYA 4CCUA 4PP7A 1AQ1A 2Q0BA 3GFWA 1YWNA 2BALA 3CP9A 2BAKA 4PP9A 4UB7A 3B8QA 4F70A 3VIDA 4LV5A 4I6QA 4IAYA 4YLLA 2YITA 3PJ3A 1JKLA 4JS8A 4I94A 1Y8YA 2C0OA 3QQKA 3LFFA 4O82A 1OGUA 4BZNA 4FI1A 4E4MA 2R3MA 4RWLA 3O23A 3ULZA 2C68A 2QOOA 2Z8CA 4G6OA 3W2RA 4CTCA 4O6LA 5E8VA 5C4KA 2BIYA 3MPMA 5LVPA 3VW8A 1R78A 1GNGA 4AP7A 4BCOA 1JSTA 4LUDA 2XBAA 4EHZA 4RWKA 3VUDA 4AU8A 3QGYA 4LYNA 4KAOA 4QPSA 5EYCA 4JX3A 3VQUA 2YERA 3KREA 4GKHA 4U7ZA 4B4LA 2EB3A 5DR9A 3ACKA 1BI7A 2XK4A 3BYUA 4NIFB 4RC2A 1J3HA 4FKIA 4JBVA 4QYYA 5IG1A 2Y0AA 3OY3A 5E4HA 2R3QA 4KABA 2QHMA 2WKMA 4AOIA 4HPUE 4FT5A 3QRJA 5IMXA 2WB8A 2QOIA 3DOGA 4B9DA 1WBWA 3ORIA 2CPKE 3F7WA 3V51A 4XH6A 3OZ6A 2H9VA 3N4VA 2ITOA 3COKA 5TF9A 4RGJA 4ANMA 1LR4A 2Q0NA 2X9EA 4RZWA 3VAPA 4FKOA 3KVWA 3MH0A 2OO8X 4PV0A 4ZTQA 3DQWA 4X3FC 4EWQA 4OBQA 2OI4X 2UZLA 1U4DA 3DBCA 2B4SB 5AX9A 2QLUA 1UKIA 4F65A 4QQJA 3NYOA 4GUBA 4I4FA 3BV2A 4FL1A 2XKDA 4F9BA 4UWCA 4FTMA 4NM3A 3GCUA 3QRTA 2FYSA 3Q96A 5A54A 2J5EA 1ZXEA 4FSTA 3Q5IA 4MEDA 4YC3A 5TT7A 2UVZA 3U9NA 3IO7A 4AZWA 2V7OA 5EDRA 3HL7A 2BRGA 4RPVA 4YJOA 5J7HA 2UZOA 4FTIA 3QTXA 5IA5A 1NVRA 3RTPA 5FEQA 1ND4A 1ERKA 4DTAA 2IVUA 1PYEA 2R3PA 5DRDA 4R7IA 4RA5A 1R39A 3CTJA 2BZIB 3UVQA 4XNEA 3FDNA 4RLKA 4IB0A 3DXNA 4V04A 3NCGA 4W4VA 4WNMA 5IQIA 2UW0A 4CKIA 3ZH8A 1NA7A 5EW9A 1YXXA 1CMKE 2BPMA 3ROCA 5L2IA 3I81A 5D12A 4CRSA 2V62A 2JDOA 4QP4A 3LMHA 3UMXA 2XK7A 3L8VA 4G34A 3GCVA 3FEGA 3HZTA 3V8SA 2OBJA 3PJ8A 4J8MA 4BBMA 2YDIA 2QC6A 4FE2A 4BKJA 4UYAA 2XNMA 4AFEA 2C6KA 3FI3A 4QTAA 4JL9A 5AAFA 3KMWA 3A7IA 4FKGA 4G6NA 4BTJA 4IQ6A 3P08A 4BRXA 3FMNA 4E26A 4YJPA 1WBSA 3V8WA 2G15A 4XP2A 2QURA 4J96A 1BYGA 4JG7A 3GEQA 2I0EA 2PVNA 5I9WA 4DH7A 3CD3A 4IVBA 3NEWA 3OF0A 4NH1A 5JFWA 2GQGA 3PA3A 3P79A 1WVYA 2YZAA 3MY5A 1ZOGA 2YM5A 1Q8TA 2C6TA 4M7IA 4GVJA 4IAZA 2CCHA 1Q4LA 4EOQA 5AV0A 3V5QA 3QZFA 2BKKA 4DITA 4ZTMA 4EQMA 2ZVAA 3PVGA 2F7EE 3O8TA 3D14A 3MESA 5EHOA 3TNQB 3TNWA 3MGYA 5CSXA 3UZPA 3REPA 5HNIX 2JBPA 1ZLTA 5AWMA 4Z7GA 2WU7A 2Y4IC 3MSSA 4LOOA 2DWBA 2B9FA 4OGRA 3BYOA 4QTDA 4USEA 3P7BA 4GG5A 5CXHA 4NK9A 2XNEA 1YXTA 2X6EA 4ALVA 1ZMVA 3WIKA 4Y5QA 4ZLYA 3GUBA 3OWKA 1Q61A 4LGHA 5ICPA 4UEUA 4C4EA 2B9JA 2WTCA 4PDPA 1Y91A 1PYXA 2ITVA 3FYKX 3TKHA 4MXAA 2B54A 3Q9YA 4BCNA 4BCIA 3OC1A 1SMHA 1Q8YA 3DS6A 1XH8A 2XA4A 2FSLX 5ACKA 3P4KA 4QP3A 5DFPA 3IOPA 2GDOA 4DC2A 3EQFA 5HTBA 2OXYA 3E7OA 2YA9A 3D2IA 2QOQA 5CSPA 5JRSA 4RVLA 5LMKA 4FVPA 4KIOA 1XBAA 3LM0A 5CAVA 4FYNA 2XYNA 2VTJA 3DTCA 3HV6A 3MPTA 2V5QA 3PZEA 5TKDA 2BDWA 4PMMA 1DAYA 2QI8A 3ZBFA 2WIPA 3DB6A 1RJBA 4F99A 3NGAA 4RIOA 4K1BA 4S32A 1VYWA 3O51A 2CGVA 3OT8A 4LI5A 2BTRA 5GNKA 1FMOE 4MTAA 4QYGA 2JLDA 3NNVA 3P86A 4WUNA 4ZY6A 3LJ2A 4OUCA 4BYIA 1ZY5A 1ZARA 5HBHA 4FSZA 3DBFA 3MFTA 5AUZA 1KE7A 3VBQA 4C2WA 3EIDA 5CASA 3PSDA 2J6MA 4KBCA 3KXMA 3QTZA 4L8MA 2JIUA 3O71A 3OVVA 3P23A 4Z16A 3RMFA 3FLZA 4E20A 3OCBA 2Z7RA 1VYZA 3FZOA 1ZYSA 1TQMA 2J0LA 2FB8A 3VHKA 2RL5A 2BRHA 4IADA 4FYOA 3S00A 4K33A 3ORMA 3GC0A 3L8XA 3PXFA 5BVOA 5HU9A 4PDOA 4R6VA 2P4IA 3NIZA 3L9PA 4NM5A 3KC3A 4RWIA 5CX9A 3NSZA 3OTUA 4I6BA 4L67A 4RLLA 3RZBA 4F7SA 1JOWB 1YRPA 3I0OA 2GFCA 3LIJA 2ZMDA 3FMKA 4DEGA 2RKUA 4DINA 5IH5A 4ZMFA 5M08A 4CT2A 4UBAA 4DEDA 1QPDA 2IWIA 2WIHA 1XH5A 2B0QA 3C4WA 1DI8A 1U46A 2XIZA 1REJA 3E3BX 5ANEA 1G8AA 2R3RA 3U4UA 1JLUE 4AGWA 4KRDA 1OKYA 3PJ2A 5C4LA 4KBKA 1H1SA 2Y9QA 1WCCA 2J90A 3G9LX 2HENA 4LRKA 4YUQA 1QMZA 4JXFA 5AV4A 5D11A 3ZLXA 1OITA 2O2UA 3KN6A 4V01A 5AM6A 3SOAA 5IEYA 4MQ2A 3H9RA 4H1MA 5EM5A 2RG5A 2ZDUA 3R1NA 1WBVA 5AUUA 3DBQA 5E8SA 5CT7A 2XEYA 3V5WA 4AX8A 3OCSA 1R0EA 4CEGA 4N70A 5AP3A 3W2SA 2XK8A 2G2FA 2I40A 2BZHB 4B8LA 2YHVA 4C38A 5HLNA 2QOKA 3GXLA 3PJCA 3QQGA 4K11A 4OBPA 3NYXA 3FLQA 4CG9A 1ZYCA 2GTNA 4YC8A 3DK7A 4ZSLA 1GIHA 1OKVA 2PUIA 3II5A 2XP2A 2PVYA 4M0YA 5E92A 3ZUTA 2HZ0A 3QQFA 2X6DA 4ZOGA 1ZMUA 3FPMA 4IFGA 4QMSA 2HK5A 3RKBA 4C02A 2R5TA 2IVSA 1PXIA 3DFCB 3UOHA 4XLIA 4YTIA 5M4FA 3F88A 2OJ9A 3R63A 5H2UA 4DFXE 2QODA 3W1FA 5GHVA 3W8LA 2OSCA 4HVHA 5L6PA 4O2PA 4J53A 2ZM1A 2R3OA 1H1WA 2YWVA 2W1GA 1JKTA 5E1SA 1WBOA 3ZEPA 4BGGA 2QOLA 5CEMA 3NNUA 4YO6A 4FEXA 2BUJA 3NX8A 3ZS5A 4HW7A 4FV5A 4E1ZA 2C6MA 3ZFXA 3E92A 4O38A 3ZLYA 1M17A 1VR2A 3MWUA 3EL8A 4CGAA 4PWNA 4II5A 3LQ3A 4YLJA 4C36A 5CWZA 5H9BA 3GU6A 2YWPA 4DN5A 3U6JA 4GS6A 5HE1A 3E8DA 4F0GA 3BE2A 3DZOA 3PXRA 1H1RA 4DT8A 4O91A 3IECA 4JBOA 1K2PA 3D5XA 3UVPA 3GBZA 3OXZA 1XWSA 4CKRA 1T46A 4ZJVA 3CY2A 4EH4A 2PMLX 3AG9A 3LXLA 1QPEA 1FPUA 3MB7A 4YHFA 5FTGA 3ZC5A 4AF3A 3CJFA 4YO4A 4BDDA 3OUNB 1SVEA 2QLQA 4FODA 5KMIA 4MXYA 4DFYA 3NNXA 4EOJA 4GV1A 2QCSA 5KHWA 4YTFA 3P5KA 2XEZA 1IASA 4ZS0A 3UP2A 1FOTA 3EJ1A 4MYGA 2PVRA 5A3XA 1J7UA 1WBNA 3GC9A 4FV0A 4GK4A 3FV8A 2NP8A 2OJIA 3SW7A 4CFFA 1WVWA 1V1KA 3V6SA 3LKMA 3ZSHA 1U5RA 3LXPA 4JQEA 5B2MA 4RC3A 4BGHA 2C5OA 4RIWA 3BU3A 3MJ1A 3G2FA 2XK9A 4R7HA 4X3FA 1O6YA 5GJFA 3F7ZA 5DT4A 1REKA 2ERZE 3L8SA 2F2CB 4CXAA 4M3QA 4NM0A 4P5ZA 4WRGA 2YEXA 2OKRA 3V6RA 3RHKA 3DLSA 4FV1A 4QTBA 3VN9A 1TVOA 3IDPA 4OT6A 4X2NA 3QZGA 3UYTA 5BPYA 5IA3A 4XV2A 2BDJA 4BHZA 4YTHA 4FIGA 1B39A 2RFEA 5CALA 3CS9A 3R0TA 2VGOA 4ANBA 2RIOA 4C0TA 3BYSA 1A06A 2ZYBA 5LVMA 2F57A 4GU9A 3AT4A 3HRCA 4A9RA 5KX8A 1OKZA 4KB8A 3TEIA 3E93A 3VJOA 4FKTA 4IACA 4MAOA 3GC8A 4KS8A 3C4CA 4S2ZA 5ANOA 2J5FA 3D0EA 5B2LA 4FBXA 4PMPA 3D7ZA 3FE3A 3S4QA 5HZNA 5DLSA 2B1PA 5L6OA 4O7VA 2X39A 3U4WA 3VQHA 5CNOA 5T6KA 2PU8A 3UNKA 2PMIA 4AGCA 3R2YA 1WAKA 2HZ4A 4U41A 3F2RA 1IR3A 4U9AA 4JDHA 3CGFA 5E8UA 5F1ZA 1FMKA 2BAJA 2PVHA 5J87A 3TKUA 4AW5A 2GS7A 3E7VA 5KKRB 3CQEA 2CN8A 4FG8A 4LUEA 5AP5A 2GCDA 4ANLA 4DGOA 3TCPA 4IC7A 5EM7A 2Q83A 5HE0A 4M69B 3HV5A 3UBDA 4DEIA 3GCQA 4FTCA 4RJ5A 3LXNA 1ZYDA 1XQZA 4CFUA 4F9AA 4J52A 3ZDIA 4K2RA 1AD5A 3KMUA 2YZLA 4FZ6A 5IQDA 3EHAA 1YI6A 4D5HA 3KCFA 3RK7A 3EYGA 3LJ1A 3ORLA 3IK3A 4I20A 4EZ5A 2R3HA 3TTIA 4O7ZA 3UIUA 4AT4A 5M51A 2JKMA 2VWBA 3HMNA 3G9NA 5HIBA 5GJDA 3WYYA 3HRBA 3VF8A 5E91A 3I0QA 4FICA 3CPBA 2YCQA 3QD4A 3U54A 2O0UA 4BDCA 3ODYX 2P0CA 5HEZA 1JNKA 2JKOA 4OBOA 5A14A 3GFEA 4RX7A 3N4TA 3RVGA 4L9IA 1ATPE 1YI4A 3AD4A 1UU7A 4AGUA 1J7IA 5JSMA 3EQHA 4R78A 2LAVA 2YM6A 3GCSA 4IAFA 3UQFA 5TOZA 2GS2A 4IHPA 2EUFB 1V0PA 3NYNA 3Q3BA 3NUSA 2EVAA 5GJGA 1RDQE 4BI1A 1V0OA 3I79A 2W05A 2B52A 2IG7A 3MA3A 3QL8A 5BUJA 2PE1A 5IMEA 3C7QA 5K5XA 3NUAA 5DN3A 4F7JA 4FIEA 2XKCA 3P1AA 4FTQA 4JIAA 1FBNA 5FXSA 3PXYA 2PZIA 3MDYA 3FC1X 3KB7A 4KKHA 4C58A 4GJ3A 1BMKA 5F20A 4ZTHA 1WBPA 4G3GA 4NT4A 3T8OA 2CKOA 4AE6A 4HCTA 4CFVA 3DDQA 3A8WA 4O84A 2C69A 2F2UA 4L3LA 1Q3WA 5M4UA 4IB3A 4NTTA 5EH0A 4O83A 2ZM3A 4R3CA 3UOLA 3TDVA 3Q4ZA 2HWOA 3H10A 2OWBA 4YJQA 4OW8A 5IZFA 4BYJA 2OIDA 2QOBA 4QP2A 2XNBA 3PXQA 4MBLA 1O6LA 3GP0A 4ZZOA 5AADA 3R01A 1M2QA 1XKKA 4MCVA 2WZJA 4BDFA 3PP1A 1CKIA 5I9VA 2G2IA 3UNZA 4C2VA 1E1VA 2V7AA 4QP7A 4RIWB 5EOLA 4Z55A 1LEWA 2GTMA 3HMIA 3OFMA 4X3FB 3DKFA 4D5KA 4MKCA 4QTEA 3R83A 3E64A 5ETCA 2XNPA 4AA0A 5E1EA 3AXWA 3F82A 4H36A 5LARA 3ZXTA 4ENXA 4G31A 5DT0A 1OPKA 5DBXA 2WGJA 3N9XA 3S0OA 1CKJA 2EWAA 4EOKA 1U54A 4HPTE 4FSUA 5BVNA 5IDPA 4AW2A 1GZNA 2OXDA 3HAVA 5KZ0A 3WYXA 3EQCA 4QYFA 3RK5A 4EORA 2GHLA 3IKAA 4TT7A 5CSWA 1Q8WA 3E3PA 5J8IA 4O7OA 5I9XA 4YJVA 2YM4A 2I0VA 1P4OA 3H0ZA 1VJYA 3H9OA 4QP9A 5I9YA 3PVBA 4ZSEA 3V3VA 2VX3A 3MY0A 3V8TA 4FZDB 4AFJA 3FMHA 4DH8A 2BR1A 5M06A 2VTHA 2R3KA 4AN2A 3R71A 3ENMA 4ZY5A 2VWZA 3Q9WA 4U44A 4E8AA 3RI1A 1PXKA 4HVIA 4FIHA 5HHWA 3FPQA 3FI4A 4NM7A 2XNOA 4KD1A 4ZTLA 2C6OA 3PYYA 5CSVA 3UTOA 4WG3A 2AC3A 5FD2A 2OFUA 2R0IA 4QP1A 3BEGA 3E8CA 4O7NA 3TN8A 4IC8A 3SAYA 4O6EA 3VBWA 3NCZA 3TV4A 3VS0A 3FZTA 3W32A 4CT1A 4FUYA 1W0XC 1YXUA 4OTWA 1PMEA 1QCFA 2FVDA 2Z02A 3L9NA 2BHEA 1Y57A 3M2WA 4V05A 4ZLOA 4FR4A 4FV6A 1XJDA 4QMOA 3VRYA 1JBPE 5KMNA 3EFLA 4I92A 4YZ9A 2WEIA 3MVJA 3LCDA 2BHHA 4I5PA 5HQ0A 5HKMA 2IW6A 2W1HA 3D7TA 3OT3A 4QPAA 3ZZWA 3ULIA 5HBEA 4CV8A 3FMEA 4I5HA 4NU1A 3ORTA 3VWAA 3Q2JA 3NUUA 5C27A 3R7UA 4GMYA 2VTQA 5IQHA 2CNUA 1J91A 2IPXA 4L6QA 2PTKA 4ZJIA 2A2AA 3CPCA 3WZEA 2HIWA 2R7BA 1ZZLA 3F2NA 5CQWA 3ZONA 2WHBA 4EH6A 4L7SA 4G3DA 3QCYA 2UUEA 3EN7A 5ANGA 3FQEA 3UC3A 4HYSA 1OIUA 2C6EA 2CKQA 5B7VA 3R8UA 2UW4A 3FL5A 5HX6A 2WMVA 4RRVA 3OWLA 4FOBA 3IGGA 2YJSA 4L3JA 2PYWA 4L43A 4BN1A 4M84A 4JJRA 4G3EA 2XNGA 1GY3A 3TACA 3AQVA 4FT9A 2I1MA 4F9CA 3KY2A 5M57A 3QKMA 1PRYA 2UZWE 2VO7A 1P5EA 3DQXA 5M53A 4N0SA 3VS5A 2W5HA 3G33A 5EQPA 4CVAA 4UYNA 5KKRC 4QNAA 1FVRA 3HMMA 4E5BA 3FZRA 1PXPA 5A4TA 5A6NA 5I5ZA 3UDBA 3DDPA 3SHEA 4BIEA 2HZIA 4EJ7A 4YJUA 4CMOA 2W1DA 4ACCA 2VN9A 5CAUA 4IX3A 1UNGA 3VUIA 4J71A 3NLBA 3TV7A 2PZRA 3S95A 3ENHA 3U87A 3QQJA 2QR7A 3DJ5A 2G01A 1NVSA 2ITPA 4WBOA 4Q9SA 5ETAA 4KKGA 3QYWA 4NWMA 4CKJA 5EI8A 4PUZA 2VZ6A 5AP4A 1FVVA 3DAKA 3KRLA 5EI6A 3BV3A 4FL3A 4R1YA 2Z7QA 1R0PA 4GCJA 4JDJA 5HVYA 4ACGA 3MY1A 4FSMA 4YTCA 3MVHA 3HGKA 3KXXA 3NVKI 2PUUA 3CR0A 2AUHA 3FBVA 3PG3A 3UVRA 3R8VA 3TG1A 4EZ3A 5HBJA 5KBRA 4DHFA 1Q5KA 2C6DA 1U54B 2C5NA 1KUTA 3ZHPC 5JK3A 2W4JA 3ZFYA 5CVGA 1KOBA 1OIQA 1VEBA 2IVVA 4I4EA 1U5QA 4LMNA 4WIHA 3QCQA 1BX6A 4FKUA 5T3QA 1Q97A 1JWHA 5JZNA 3EFWA 4ASDA 3TZ9A 4ITJA 3VJNA 3PE1A 1OM1A 4XG9A 3HP2A 3RM7A 3RPSA 2W17A 3R28A 2PE2A 2CMWA 4B8MA 5HTCA 3W0QA 3DGKA 4F64A 5JGBA 5K4IA 4MVFA 3I6UA 3UG2A 4F9WA 4WT6A 2FA2A 4J7BA 4U45A 3VUMA 4BR3A 2X81A 5BNJA 1PW2A 2OZOA 2XVDA 5C8MA 5CAOA 4H3PA 5CLPA 4O7RA 4PY1A 1URWA 3FMJA 2ETMA 2E9UA 2J0IA 3BYVA 4WSYA 3FSFA 2X0GA 2W1FA 3LCSA 4HJOA 3W55A 2CSNA 4GH2A 4RJ7A 1FQ1B 2BMCA 4JG6A 5E9EA 5CEQA 1PXJA 5EYMA 1GZOA 2WQEA 5CXZA 5D9HA 3ZM9A 3Q9ZA 3FWQA 3VBVA 3DJ6A 2VTMA 3FZPA 1GZ8A 4IH8A 3BEAA 3A8XA 3A4PA 4DAWA 3F5UA 3WILA 2PULA 2WQBA 2X4ZA 4XG2A 2ZJWA 4JOAA 3TNPC 4BGQA 4EQCA 4FV2A 3G90X 3NZ0A 2A19B 3I6WA 3O0GA 3BCEA 5FTOA 2UW6A 4QMLA 1H07A 4X0MA 4EBVA 3D7TB 1BL7A 1T45A 3EN5A 4XJ0A 1JSUA 2QU5A 3MS9A 4WOVA 5GINE 1UV5A 4ZXTA 5E8TA 3IW6A 4L45A 2H34A 2CLQA 3OXTA 2HYYA 3ANRA 2GNFA 4JI9A 4Q2AA 4UXLA 3BHTA 3ZC6A 4Z9LA 3D5VA 3T3UA 4AOJA 3KMMA 4H3BA 3FLNC 5D7VA 4MD8E 4O0YA 5CEOA 3OWPA 5EW3A 5IEXA 4EWHA 2C3JA 4IWPA 4IAKA 4FKPA 4EKKA 3QD2B 3SVVA 2IZRA 4W8EA 4XV1A 4FIFA 2VTSA 3OCGA 4FSWA 4NW5A 4S31A 4QMZA 3RK9A 1YDTE 3U6IA 4D1XA 4E7WA 2JAVA 2EXMA 2VTLA 2BROA 4BTKA 5DE2A 3ZTXA 4F6SA 1JPAA 4CRLA 1ZOEA 2QD9A 2R3FA 3UQCA 5C03A 4BIBA 1SM2A 5HICA 4FZAB 2X8IA 5L2SA 4I6FA 4KINA 2UZBA 5C8NA 3FXXA 4WO5A 4RZVA 4RIYA 3ID6C 1GAGA 2GNGA 4JR3A 4MK0A 2OJJA 5AP2A 5FDXA 4ASEA 1GIIA 4FKLA 3RAIA 4DYMA 3ZO1A 2VWVA 4U97A 5DG5A 3EYHA 1A9UA 3R7OA 4I6HA 3OW4A 4BCHA 3KRWA 2GHMA 5IF1A 1M2RA 4DGNA 3A7JA 3G15A 1MRYA 4IE9A 4RJ3A 2FUMA 2XS0A 1MQ4A 3RHXA 2RFSA 3D94A 3KFAA 4WBBB 3VRZA 1OKWA 1H0WA 3NUYA 4JT3A 3W2PA 4W4XA 4ASZA 3NVMB 2Z2WA 1AGWA 1GJOA 2A1AB 3CKXA 3EB0A 3F9NA 3HMPA 4H3QA 4NL0A 4O0XA 5EQEA 4ARKA 5LJJA 5HIDA 4EYMA 4C34A 1OVEA 4YJRA 3OEZA 3R1SA 5A46A 1SYKA 2BRMA 4PTEA 1UU9A 4G9CA 3BLHA 4FUXA 4DEAA 5KMJA 3PG1A 5AUYA 4C35A 5BVDA 4DLJA 4ZSJA 1XBCA 3QTRA 4F63A 3POZA 3KU2A 2BRNA 3KXNA 4J8NA 1G5SA 2IW8A 5L3AA 4DH1A 2VV9A 3QD0A 5LXMA 4CLJA 2OH0E 3GC7A 4I22A 4MD9E 3QWKA 2YIWA 3C4EA 4YZMA 1Z57A 3IDBA 3LCOA 5EHLA 4BTFA 3WF9A 5BYZA 4DT9A 5AAGA 2HXQA 4CV9A 1ZRZA 3ITZA 4S34A 1OL7A 3CSVA 4TWNA 3N4UA 3TUDA 2WPAA 4GT4A 3QA8A 4JRVA 4FEUA 3W0OA 2GQRA 3DNEA 5BVWA 4N6YA 2YM8A 3TM0A 2VTRA 4EH3A 4FV8A 2UZEA 4BIDA 4E4XA 3COMA 1QPCA 2VX0A 4EK8A 1RE8A 4ZSAA 2IZUA 3UGCA 4XCUA 3PY0A 4QMQA 3VS4A 4TYIA 3TNIA 4U40A 3QKLA 4DCAA 2VD5A 3IONA 3W33A 1UWJA 2R9SA 4R1VA 3VBXA 4WZYA 2C3KA 1XH6A 3AGMA 4JDKA 3P0MA 5CANA 4NZWB 5I4NA 1UA2A 1UNLA 4K77A 3FYJX 3CXWA 4MH7A 3WZKA 4AGDA 1BL6A 4LV8A 3RGFA 3UQGA 2PVMA 5BVKA 4XG8A 2W99B 1APME 3EQPA 3EZVA 3KRJA 5FP6A 3SD0A 3VF9A 3NAYA 4Y8DA 4F1TA 4O0VA 4QQTA 5DPVA 5E8XA 4RFYA 3QYZA 4FTJA 4IWOA 3OHTA 3BU6A 3O7LB 2FO0A 3PWYA 3OS3A 3KGAA 2O65A 5E8ZA 3W18A 3F61A 3I7CA 5HE3A 5A4EA 2ZDTA 3C13A 3PIYA 2SRCA 2XM8A 3DAJA 3V04A 2JAMA 3QQHA 2C47A 4YBJA 5L8LA 5EM8A 5KBQA 2GQSA 4IBMA 2WQMA 1H28A 4QTCA 4MQ1A 3MH1A 4XG7A 3F2AA 4XX9A 2W06A 1Z9XA 4FTKA 3C4ZA 2FSTX 4USDA 3K3IA 1P4FA 2CN5A 4NW6A 5FM2A 1PXNA 5IUIA 2ONLA 4J95A 4NKAA 4F4PA 3RWQA 3H30A 5EKOA 3I5ZA 4EH9A 1UNHA 3TT0A 2JDSA 4EK6A 4NJ3A 4EH7A 4U81A 1XH9A 3PLSA 3SRVA 3HECA 3EWHA 3W0SA 3ZU7A 4RT7A 3R9HA 5I0BA 2CDZA 3QALE 3V5TA 3D15A 3Q5ZA 4RFZA 4I0SA 3HKOA 4BTMA 3GU7A 2WMQA 4F0IA 2WMWA 4PL3A 5K4JA 5FTQA 4X3JA 5CVHA 4W4WA 1SVHA 3MTLA 4RIYB 4E4LA 4DH5A 4Y73A 4R3PA 5HG8A 4TYHA 4EEVA 2WTJA 5FUTA 4XRLA 3U9CA 5IUGA 2ITYA 4X6RA 3Q6WA 2C0IA 3A7FA 4U79A 3RINA 2RFDA 1H8FA 3NYVA 4Q5EA 4TW9A 4RVKA 4DEEA 5I9ZA 5KNJA 5BVEA 2EXCX 4FIJA 3W16A 4I24A 3C5IA 3A61A 4N4SA 3E5AA 2QKWB 4S33A 4MXOA 2WFYA 4GK3A 3WZDA 4IX6A 4CZUA 3VUHA 5DR2A 4QMVA 3R7VA 3CIKA 3ZSGA 3TXOA 2UZTA 1SNXA 3NPCA 4XLVA 1JAMA 5AP0A 4KUJA 5ETFA 4QYEA 5FBOA 3BKBA 3RP9A 3RALA 5A4QA 1YOMA 3FJQE 3PZHA 3OUKA 3JR1A 3UPXA 3ZO2A 5CAPA 5LCJA 4O7LA 3LZBA 3QKKA 2X2LA 4U8ZA 2O3PA 3O17A 5AA9A 4UZHA 1YI3A 4FOCA 2WMRA 1F5QA 4YPSA 2ITUA 3VULA 3MIAA 4H39A 4I93A 1JSVA 2QG7A 1PKGA 4EYJA 2F4JA 5HCXA 2WAJA 1HCKA 4KA3A 4U3YA 5FXRA 2QVSE 3O7LD 1Q99A 3R7EA 2VWWA 4J99A 3KL8A 4BC6A 2LGCA 3MH2A 3OBGA 4GFMA 3EFKA 4D9TA 3MA6A 5FG8A 2XYUA 1LPUA 1BKXA 2UW3A 2Y8OA 5I9UA 5HLWA 3BYMA 3DZQA 4YNEA 4YZNA 3O8UA 3W2QA 4QMMA 4X2FA 3ZBXA 3BGQA 4XMOA 1YWVA 2WEVA 5CT0A 2XMYA 3BBWA 3ZLSA 2ZMCA 4D0WA 3MI9A 4Y95A 1Q24A 4D2RA 2IW9A 3MVLA 2DS1A 4MX9A 2VNWA 2WO6A 2ZOQA 4O7WA 4XEYA 1DAWA 4OTIA 3H4JA 3Q4TA 2IZSA 4G17A 3VNTA 2B9IA 1E1XA 3IW5A 4EHGA 2W4OA 4L68A 2XBJA 3V5PA 4BDJA 3U6HA 3RPOA 4DTKA 2VO0A 4QMXA 5E8WA 3VO3A 5ANKA 4B6LA 2C5XA 2IJMA 3QQUA 4Q5HA 4ZS4A 5IA1A 5IQFA 1XR1A 2CGWA 4WNOA 3RPVA 1J1BA 4I41A 4EKLA 3W0MA 4P90A 1W83A 3LFAA 4GT3A 1P14A 3TZMA 4FKSA 1SNUA 2W9FB 3T9TA 2QKRA 3B2TA 1WZYA 4KNBA 4TL0A 4D2SA 3DCVA 4RJ8A 5EDQA 1H4LA 5EM6A 4KKEA 3Q4UA 3CQWA 3FL4A 1S9IA 2PUPA 3A7GA 4IM3A 2YISA 1H25A 3BLQA 3QLFA 2HCKA 2WTDA 3DK6A 3COIA 2BFXA 5GIOE 4BCQA 4YU2A 3DK3A 3GU8A 4E4NA 1M52A 5LWNA 2DYLA 3DA6A 2DUVA 3PA5A 5FBNC 3LFQA 2HELA 2UZNA 3AD6A 5KMLA 5KMMA 3C4XA 5CTPA 1IEPA 3PP0A 3L9MA 5FGKA 3SRVB 3RCDA 3QHWA 2NNWB 4JQ7A 2H96A 4NFMA 3JY0A 5HIEA 4MNEA 5IPJA 4ENYA 2RF9A 3CE3A 4O0RA 3UJGA 2UV2A 4XS2A 4YURA 2JIIA 1PMVA 3P7CA 5AUXA 4HVSA 5AA8A 4H05A 3CLYA 3DV3A 2ZV8A 1NXKA 4QRCA 5T68A 3Q4CA 3R9DA 3R9OA 3W2CA 4P5QA 3WF8A 4D58A 4TYHB 3MFRA 3H9FA 2YIYA 2YABA 3QC4A 1B38A 4LG4A 4LRJA 2PVLA 2ZAZA 2ZV9A 3QD3A 5LWMA 2VO6A 3ACJA 1OBDA 3RWPA 2OZAA 4M15A 4BB4A 4ERWA 3SOCA 4O96A 5DH3A 3VW6A 1FINA 4DBXA 5ETIA 3WIGA 3HYHA 3DAEA 5HESA 5EQYA 4O0WA 5BMSA 4AN9A 2XKFA 4OT5A 2PUNA 5HCYA 3GGFA 4DFLA 4UWBA 3PTGA 2YN8A 3WE8A 3R73A 3LFBA 2W5BA 1M7QA 4OTFA 4HGSA 5FM3A 3QHRA 2I6LA 2JKKA 4AA5A 4E73A 1IAJA 3HV3A 3CKWA 4OTRA 4DFZE 2XKEA 4XBUA 4RC4A 5EI2A 2R64A 4M13A 3LMGA 3QTIA 3WBLA 3QX4A 1OPJA 5J95A 1K3AA 2X2MA 4EL9A 5CVFA 2XIXA 3PY1A 3FY2A 3EQBA 4TRLA 2JIVA 3LFEA 3T9IA 4APPA 2X2KA 4IDTA 5CQUA 4IB1A 4AZSA 3K54A 3DTWA 3ORPA 4Y85A 3NW7A 2AYPA 3C1XA 3KXHA 3L1SA 3KRXA 4QNYA 2WTVA 2ETRA 1EH4A 5E90A 3CTHA 5BQ0A 5FEEA 4ZP5A 5HG5A 3PE2A 4WKQA 4F0FA 3O50A 3DKGA 4UXQA 1Q41A 2CLXA 3KULA 4AW1A 4UZDA 2BVAA 3VBYA 3MPAA 1O9UA 3KF4A 3QX2A 1KE9A 4QMPA 4FK3A 5CEPA 1MUOA 3F3VA 2C6LA 4PNKA 3FQHA 4XG3A 4TYJA 2GS6A 4FV3A 4XYFA 1GIJA 2CKPA 3ODZX 4DE4A 3QC9A 3SGCA 2VUWA 3ALNA 2VTIA 4GK2A 1J1CA 4BDKA 4NSTA 5J9LA 3AD5A 4IW0A 1Y6AA 2VRXA 1TKIA 4ID7A 3D9VA 3FLYA 5C9CA 3V5JA 3OEFX 2GNJA 4ANQA 1UVRA 3H3CA 4BI0A 4QQCA 3UOJA 4C7TA 3WI6A 4EH2A 2W5AA 1YDSE 3T3VA 4CG8A 3V5LA 3R9RA 4AOTA 3G51A 3HVCA 5KMKA 2C1AA 4CSVA 1KV2A 3CC6A 5KUPA 5LCKA 4FV9A 5EOBA 2V0DA 3FKNA 3QA0A 2BILB 1OIYA 2EU9A 4EOIA 4RMZA 4PNIA 4IWQA 2B53A 3CBLA 2ACXA 2OIBA 1K9AA 3LJ0A 2CKEA 5HCZA 4O2ZA 3LLTA 5AUVA 2F7ZE 5CU2A 2XCKA 4BF2A 4FTOA 3TJCA 3IG7A 3QGWA 4UWYA 2PZPA 3A99A 5BYLA 4GEOA 5LVNA 2UZUE 3U55A 2CCIA 4QMUA 3MIYA 1I44A 4X2GA 4X6QC 3WF7A 5HG7A 1YVJA 4MNEB 4D4VA 1RQQA 5AUTA 2QOFA 4K8AA 2CGXA 4LMUA 3ZOSA 2E9VA 4PTGA 2O8YA 5FP5A 4CFMA 2YDJA 5CI6A 3H0YA 3R21A 2QQ7A 2VTOA 4J97A 4U6RA 2B9HA 3QAME 3AGLA 4O81A 5AP7A 4XP0A 4YC6A 3VS3A 3OW3A 1M2PA 5ACBC 4RJ6A 2QOHA 4HGLA 4QMYA 1IRKA 3BWFA 5JZJA 2PZ5A 2F49A 3AC3A 3UO4A 1ZYJA 3DFAA 3Q6UA 1W8CA 4BBEA 4DA5A 2OZAB 5EFQA 5AM7A 5IQCA 3ZFMA 3E62A 1I09A 4IAIA 4JX7A 2GFSA 4RVTA 4IJ9A 2PSQA 3NWWA 5H8GA 5BVFA 4GFOA 2XJ0A 4RVMA 2FSMX 2ZB0A 5FEDA 5HGIA 4RQVA 3ZUUA 2W1IA 3ORXA 1ZAOA 4IDVA 4F09A 2OU7A 2GMXA 4FSQA 3R9NA 2A4LA 2ONLC 3FSKA 4XP3A 4D4YA 2RFNA 2RG6A 2OK1A 5JGDA 5KCVA 4TWOA 2VTNA 3EQGA 3HUCA 3ZM4A 4ZLZA 4M0ZA 2YCSA 4M68A 4X21A 4BCMA 4CMTA 4DG3E 1WVXA 4XV3A 4E93A 5KHXA 5J9YA 5DA3A 4ZTNA 5DR6A 2NRUA 2B7AA 4L44A 2R3LA 5L2TA 3RM6A 2OLCA 4EOOA 3TKIA 3KEXA 3GENA 4C4FA 2HY81 3PDTA 4G3CA 4H1JA 3BE9A 3F3WA 2R3GA 3DT1A 1P2AA 1VZOA 3QUPA 3UE4A 3WARA 5LVOA 4UN0C 3LPBA 2HWPA 2HY0A 3E88A 3TIZA 4GYGA 4JDIA 4AWIA 4YR8A 3NIEA 4OR5A 4BCKA 3CQUA 3FMLA 5DHJA 2I0YA 3S3IA 3E8NA 1KOAA 3JXWA 4D55A 3SG8A 4JR7A 1OL5A 4AA4A 1NY3A 3W8QA 3KULB 4AW0A 3FI8A 2YAAA 5HVKA 2X1NA 2DQ7X 3F6XA 3PLAE 4NUSA 2YIXA 3TV6A 3F5GA 1YDRE 3TYKA 5F4NA 1HOWA 3BWJA 2OIQA 4GFGA 4F7LA 4IM0A 4GW8A 3WE4A 2CNVA 4YBKA 5HO8A 2WD1A 2XB7A 1H01A 4WA9A 4CFWA 4C3RA 4U43A 2XJ1A 3MN3A 4XBRA 2YACA 4LQMA 4A7CA 4D9UA 5DIAA 4WNPA 2JGZA 3UIBA 4NCTC 4DEBA 5IA2A 1PHKA 3OWJA 1W82A 5CU3A 3MH3A 4PTCA 2WMTA 5A4LA 3BPRA 2BAQA 2XIRA 2FGIA 3QCSA 4QOXA 2YCRA 2GNHA 1SZMA 4RFMA 4BDIA 4QMNA 1URCA 3N51A 4ZAUA 3FXWA 3UZRA 5AEPA 2UW5A 4ACHA 3ELJA 1W7HA 3UNJA 3VVHA 2VWYA 4MNFA 5CU4A 2YM7A 4RX9A 3IW4A 3OOMA 2VO3A 1KSWA 2ESMA 2J50A 2J4ZA 2QO2A 3GQIA 4O7TA 3FY0A 3SKCA 1JKKA 3EN6A 3QF9A 3F66A 4I21A 5HD4A 2HW7A 4A4OA 4HGTA 2RGPA 1Q62A 4DFUA 3UO5A 1WBTA 3QZHA 4TWPA 3R8ZA 5JRQA 3IDCA 2YIRA 5IDNA 4FTTA 4R5YA 4YZDA 3R7IA 1MQBA 5EW8A 5IA0A 4PDYA 4D28A 2XM9A 2P2HA 5M09A 3LCTA 2QR8A 5L8JA 3PXZA 2ETKA 3EFJA 4EBWA 3NS9A 2J7TA 3AC8A 4MXZA 3C9WA 3HA6A 4LM5A 1JKSA 3W10A 2PE0A 4AXAA 2IN6A 3I4BA 4DEHA 3R6XA 3LM5A 4JAIA 1DM2A 5L8KA 4L00A 5JH6A 5LQFA 2VWXA 4ITHA 4JVGA 4O0SA 2B55A 5G6VA 3JY9A 2XNNA 1BUHA 3VHEA 3MB6A 4IWDA 3U8WA 3LAUA 5IQEA 4A06A 1CSNA 4A9YA 4F6WA 2WMXA 4DGGA 3SA0A 1FGKA 4ZJJA 2IVTA 2JBOA 3KCKA 4XG4A 3PSCA 3C0GA 2JD5A 2X7GA 5JMSA 3A2CA 3A7HA 4EHEA 1YHWA 2ZM4A 4A9UA 3EL7A 1SVGA 5AP6A 2XK3A 4YHTA 4A9SA 4C3FA 1STCE 1XH4A 4DG0E 3BX5A 3C0IA 3MFUA 3ZRMA 4EK5A 1LUFA 5HVJA 5HORA 4JBQA 3BGPA 3G0FA 4C33A 4I5CA 2R7IA 2X8EA 3OXIA 3OY1A 2F9GA 3AMAA 4MD7E 3DJ7A 2OXXA 2UZDA 3IW7A 4FTAA 4ZSGA 1OPLA 3FKOA 3CJGA 3EN9A 4G2FA 1FGIA 4RBLA 5EG3A 4ZEGA 2P33A 3F5PA 3AT3A 4LOQA 3QTUA 4TKSA 4PMSA 4Y72A 4GUEA 2J2IB 5H8BA 3UIMA 5J5SA 1U59A 3NW5A 4FNXA 2W7XA 3ZZEA 3MW1A 3HV4A 3SXFA 2PY3A 2XCHA 1H26A 1L8TA 1H24A 4FT3A 3SG9A 4F08A 5IQGA 5JT2A 4C37A 2O63A 5DEYA 2X9FA 4FKQA 4U0IA 2X4FA 2PMOX 3QZIA 4FT7A 4JIKA 4WG4A 4IZ7A 1ZZ2A 2OICA 3P78A 3Q52A 2R3JA 4AN3A 4B99A 3P7AA 2VWIA 4DCEA 3BGZA 4Q9ZA 3ERKA 3VS7A 4DH3A 3BU5A 5JQ5A 3UOKA 2PWLA 3ZXZA 5EDPA 4JRNA 3NUNA 4YHJA 1M7NA 3E87A 4CFXA 2G9XA 5B0XA 5A4CA 2WMBA 1IAHA 1OL6A 3OOGA 4FEVA 4NJDA 4PDSA 4IAAA 4APCA 2XF0A 2UW7A 1PF8A 4J98A 5TO8A 3M1SA 3MTFA 4IVAA 4ZIMA 4BDGA 3P9JA 5DOSA 2J0MB 3I60A 3MYGA 3QWJA 4IFCA 5F9EA 4R77A 1IA8A 4FEQA 4AQCA 4EOMA 4I0RA 4AZEA 4RQKA 4E5AX 1TQPA 2PVKA 4N6ZA 3CY3A 4NKSA 4C4GA 2UW9A 2OF2A 3PPKA 5LVLA 5CF6A 2QO9A 1L3RE 3SXRA 4BCFA 5M56A 3CD8A 4HYHA 3HAMA 2ZV7A 4K0YA 4E6AA 4AS0A 1YXSA 5IQAA 3GU5A 2Z7SA 4FG7A 3ZSIA 2FH9A 4D1ZA 4ALWA 3PRFA 2Z60A 4M8TA 5AMNA 4FNWA 3R8MA 2ITQA 4EHVA 2ITZA 5BMMA 4PQNA 3MJ2A 4TXCA 4BZOA 5LMBA 4BDHA 4C4HA 4FKJA 1PXLA 4J1RA 3C51A 4G3FA 1H08A 5M44A 2VWUA 5IH4A 2H6DA 3LQ8A 4P7EA 4Y46A 2XK6A 4FX3A 3FLWA 3Q9XA 4YZBA 3ZDUA 4EI4A 5CF5A 3UZTA 4BBFA 4FVQA 2KTYA 4ORKA 3M11A 2H8HA 1JQHA 4FSYA 3BBTB 3BRBA 4G16A 2J9MA 4HZSA 4KWPA 4U3ZA 1UU8A 2GHGA 4M67A 2OH4A 2WMSA 5M07A 5FXQA 3K5UA 1KE6A 1XBBA 4EK3A 3IQ7A 4F1OA 5D7AA 4MHAA 3IS5A 4MWHA 3RAWA 5AV1A 4LL5A 1QL6A 3LFNA 1XO2B 1YOLA 4TNDA 5F94A 1YHVA 5EYDA 4I0TA 3VS1A 3QUDA 3CTQA 2FSOX 2JDTA 1UWHA 3DLZA 3EOCA 3ETAA 4QT1A 3G6GA 3DY7A 2WTKC 3A4OX 5DYJA 3S2PA 5HO7A 3ZCLA 4FZFB 2X8DA 4BCGA 2CHLA 2VX1A 5IEVA 3DU8A 4D0XA 4BI2A 3BHYA 3IGOA 4DF3A 4ITIA 1KV1A 3HUBA 3KF7A 1YHSA 4B7TA 4U94A 1MRUA 4HVDA 1OUKA 2QG5A 3ATTA 3BHHA 3C5UA 3WOWA 4FNYA 4IVDA 4N57A 2WU6A 4F6UA 4M14A 3R02A 4E6CA 4TZRA 4ASXA 4FA2A 3HLLA 2W9ZB 4O0UA 4JBPA 4C59A 4DLIA 4C61A 3OP5A 3FC2A 2IZTA 5HG9A 1UKHA 4JG8A 4IX5A 5IQBA 3QRKA 2WTIA 4IZAA 1HCLA 3PUPA 2F7XE 3QRIA 4K18A 3JVSA 5AAEA 5BUEA 4EC8A 2XIYA 4RJ4A 1TQIA 3HEGA 4YJNA 4AUAA 4A4XA 4GJ2A 1NW1A 3BIZA 4XHKB 3ZO4A 4JNWA 5A9UA 4GYIA 5AIKA 4IMYA 2W0JA 4BVUA 2BTSA 2HXLA 2W1EA 4O22A 5C1QB 1BI8A 2PZYA 4IB5A 4NTSA 1PJKA 2BRBA 4IZ5A 3GCPA 3WF5A 4XG6A 1W84A 2XRWA 3ALOA 3KRRA 4UX9A 5IH6A 1H00A 3R04A 2I7QA 1R3CA 4L52A 4I3ZA 4LOPA 3BZ3A 4NYEA 2WOTA 3W0NA 3LE6A 5CF8A 3AT2A 5HNBA 3GVUA 3D2KA 3SW4A 4ZK5A 3Q04A 4KSQA 2WMUA 5DI1A 5AJQA 1B6CB 3D83A 3VUGA 5KO1A 3QTWA 4CLIA 3DKCA 5L6WL 1WMKA 2UW8A 2WNTA 4RA4A 5CZIA 3GU4A 3KA0A 2XH5A 3OROA 3MBLA 4YSJA 5JEBA 5LMAA 3E8EA 4MBJA 2YCFA 3QFVA 1RW8A 2UVYA 3DNDA 4MXXA 4L53A 1CTPE 3AC5A 4ZTSA 4I1ZA 4QMWA 4RX8A 5CSHA 3PJ1A 3QXPA 2P2IA 4FGRA 4KS7A 3C0HA 3DBDA 5KZIA 2C3LA 3KXZA 3K3JA 4L7FA 3NRMA 4NCTA 4BDAA 4DGMA 1PY5A 2PVFA 3S1HA 2P55A 2GNIA 2WTWA 1KE5A 4G9RA 1NT2A 2ERKA 5EHYA 3I1AA 4YMJA 4IANA 4U98A 2Y6OA 3FHRA 4U42A 3DBEA 4L3PA 4R7BA 4OTHA 4FT0A 4A07A 4YP8A 2Y4PA 3UYSA 4EH5A 4UV0A 5AIRA 4OTGA 5ANDA 3BHUA 4EONA 4KIQA 4EC9A 4PRJA 3L8PA 4FZ7A 3GOPA 2G1TA 3B2WA 3HP5A 4G6LA 4IX4A 4O7YA 3DB8A 4AZTA 3JS2A 5JFVA 5ITAA 3GOKA 3IOKA 4EOSA 4L01A 1Y8GA 2R3NA 5KE0A 5J1VA 2E2BA 3TTJA 4M97A 5E7RA 2ITTA 4IVCA 1OB3A 3F3ZA 2Y7JA 3TL8A 3Q2MA 4CTBA 5DT3A 3LCKA 4HYUA 5EKNA 4X2KA 3KQ7A 5TR6A 3RPYA 2GU8A 5FQDC 5H8EA 3D5UA 1YKRA 3TIYA 4HCUA 2J0JA 3WF6A 2PHKA 4TY1A 1OL1A 4WRSA 5CF4A 5FDPA 5HNGA 3VBTA 3MV5A 4F9YA 4EH8A 1XHAA 3R22A 4KSPA 4F1MA 3RNIA 2QNJA 4CNHA 3AC4A 2BCJA 4FTUA 1JVPP 3F5XA 3PVUA 3OMVA 3UG1A 4BDEA 3PSBA 4BY9E 5C26A 5DEWA 3BQRA 2JITA 4FTNA 3WZUA 3PY3A 3QQLA 3UP7A 3FQSA 3R8LA 3UC4A 3ZEWA 4S30A 2HZNA 4LFIA 1M14A 5LOHA 3UPZA 2VU3A 2GPHA 3AOXA 5AV2A 5G1XA 2QOCA 2UZVA 4CZTA 3HNGA 4YSMA 4EZ7A 5AP1A 2A27A 2G2HA 4QMTA 3JYAA 4BICA 1F0QA 4B0GA 1ZOHA 5J1WA 2YJRA 4AAAA 4OLIA 3ORKA 3CCNA 3SDJA 4AT3A 1PMUA 1OIRA 2V55A 4XV9A 2O64A 3LW0A 2BDFA 3ZRKA 4AT5A 3IW8A 3Q53A 3QCXA 4ONAA 4DTBA 4HNIA 4WHZA 3HRFA 2XRUA 2Z7LA 3COHA 3UO6A 5M55A 1CM8A 3W0PA 2YAKA 3O8PA 3FMMA 3F69A 1IA9A 4YZCA 4BHNA 4FC0A 4MWIA 2VGPA 2R4BA 2ITWA 3GI3A 5D10A 5J9ZA 5AX3A 1OI9A 3G5DA 2JDRA 2JFLA 3R2BA 1NVQA 3BI6A 3IPHA 4P4CA 4PX6A 4XOYA 3LHJA 4FMQA 4X7QA 5AFVA 3PFQA 5IA4A 3FZSA 2W4KA 3OD6X 3AMYA 2XZSA 3TI1A 3QTQA 3QRUA 4FKWA 5CS6A 4C4JA 5HU3A 4RX5A 4FG9A 3PIZA 3R00A 2IO6A 4W8DA 4LL0A 3FKLA 4YGAA 1H1QA 4ZZMA 2QHNA 4CCBA 1UU3A 5CZHA 3E63A 1ZMWA 3EH9A 3W2OA 4L46A 2NO3A 4DBNA 3G0EA 2BZJA 4FVRA 4E6DA 3UIXA 5JFSA 2EB2A 4P2KA 4WD5A 3KVXA 5CENA 3BHVA 4WUAA 3NMUF 5KMOA 4F7NA 5CU0A 2CJMA 4DFNA 4BCJA 4BDBA 5BUIA 4FL2A 3FI2A 3R1QA 2PPQA 3QUEA 4Z3VA 3NDMA 3L9LA 1O6KA 3PPZA 3R1YA 4LRMA 3U51A 4USFA 4U5JA 4XUFA 4FV7A 2R3IA 4GL9A 4A9TA 3LFDA 1ZY4A 4IZYA 1OECA 5D1JA 3DXPA 2E9PA 2C5YA 2P3GX 5HI2A 1MP8A 3BLRA 2GNLA 1GOLA 4GRBA 2XJ2A 1F3MC 2E9OA 2W1ZA 3JUHA 4LGGA 3KK9A 4FKVA 3EQIA 4D4SA 4PL4A 3CEKA 3VS6A 4ALUA 3FZ1A 2JC6A 3FHIA 4K6ZA 4OTDA 3HDMA 4CD0A 3AC2A 2W1CA 3TJDA 3ANQA 3HMOA 2OW3A 1OUYA 4EUUA 4IIRA 3GT8A 5HE2A 4FSNA 4K9YA 5F95A 3ORZA 4XRJA 3QBNA 5E8YA 4C3PA 5CAQA 4HNFA 4HCVA 3ET7A 3I5NA 5GIPE 1LP4A 4G5JA 4CFNA 3AC1A 1GZKA 5C8KA 4O0TA 4RSSA 3FUPA 2OJFE 4G5PA 2QO7A 3G6HA 4V0GA 2O5KA 3FLSA 1WFCA 5CI7A 5K5NA 2J51A 4R5SA 2BIKB 1Z5MA 4YLKA 5DNRA 1A48A 2X7OA 3GNIB 3C4FA 1KE8A 2JDVA 3ORNA 3NAXA 4HZRA 5IUHA 3EMGA 2J0KA 2C1BA 2WOUA 2Y6MA 4O86A 3SV0A 4O7SA 2V22A 2WMAA 1IG1A 3EQDA 1MRVA 5FLFA 1CDKA 3R7YA 5AUWA 2BZKB 4TTHB 4D1SA 4I5MA 4ZTRA 3TUCA 3NNWA 3AMBA 3LMIA 4KIPA 4BZDA 1YQJA 2ZV2A 4IJPA 4RIXA 4YJSA 3B8RA 2YDKA 1V0BA 5EYKA 3F3UA 4ZMEA 5HX8A 3UODA 4TN6A 5K3YA 4EOLA 4EQUA 2YFXA 1XH7A 3SC1A 2OGVA 3WZJA 5JKGA 5M4IA 3BELA 4IM2A 3R30A 3FAAA 3LFCA 5AV3A 3PIXA 4TYGA 3VUKA 2WXVA 4ERKA 3THBA 5M4CA 4YPDA 3RAHA 3GB2A 3TWJA 5K9IA 4GT5A 2REIA 5HD7A 2W96B 2YIQA 2QONA 2HAKA 3ATSA 3NW6A 3Q32A 2VTTA 3I7BA 3PXKA 3C50A 1CKPA 4FV4A 5A6OA 3PWDA 5ANJA 1R1WA 5CNNA 2OG8A 4U80A 3ZO3A 4BCPA 4GSBA 4FIIA 1YOJA 3K2LA 2WQOA 1H0VA 4AE9A 4KBAA 4QP8A 3EQRA 4EOPA 3PVWA 4RWJA 5DGZA 2QU6A 2YM3A 4H58A 4UALA 4M12A 3SXSA 3FMDA 2ZB1A 3DKOA 2OFVA 1LEZA 3O2MA 1BLXA 3F3TA 4UY9A 4XOZA 5BYYA 3EZRA 3TUBA 2KULA 2E9NA 3R8PA 1OL2A 4AG8A 4AZFA 1Q3DA 3QLGA 3SX9A 3EN4A 3KXGA 4A4LA 4DFBA 4DGLC 3LOKA 2VTAA 3EKNA 5LMKC 4JLCA 2PVJA 4FGBA 1PXOA 2PMNX 3NUPA 2CNQA 3A60A 4KRCA 1Y6BA 2AC5A 2VTPA 4FNZA 2C3IB 3D4QA 3QTSA 4HOKA 4Y5HA 5ANIA 1DS5A 4C62A 2GSFA 2ITNA 4L42A 4FEWA 4DG2E 2WELA 3HX4A 2C30A 1S9JA 2X7FA 3GQLA 4ANSA 4W4YA 5IU2A 4FTLA 3CGOA 2JEDA 4O7PA 3JPVA 5JGAA 1Q8ZA 2NPQA 4TPTA 1YXVA 4X2JA 4YJTA 4PL5A 4E5WA 4GIIA 2WQNA 5JFXA 2A0CX 5B2KA 2JFMA 1OBGA 3PRIA 1OMWA 2C4GA 1KWPA 4GVAA 4JQ8A 1DI9A 4IEBA 3Q60A 1ZWSA 4CMUA 5DRBA 4HVGA 3SQQA 2HW6A 3DXQA 4CQEA 3W0RA 4MF1A 1YW2A 1W98A 4QYHA 3LLAA 1H27A 1PKDA 3MVMA 4GG7A 2R0UA 3EKKA 4O21A 2HOGA 2PL0A 5DVRA 5C01A 3K5VA 1G8SA 3OCTA 4JAJA 5IISA 4YNOA 3LXKA 1QPJA 4WNKA 4AZVA 1G3NA 3KKVA 4AACA 3SLSA 3NUXA 3VC4A 3RAKA 3M42A 4PMTA 4PF4A 5FRIA 2C6IA 4FKRA 4QP6A 3ZLWA 4D4RA 3RJCA 3ZUVA 5L2WA 2UVXA 5D41A 4EK4A 2XIKA 4Y83A 3HDNA 4ACMA 4FSRA 1OZ1A 4V0GB 3RCJA 2JKQA 1X8BA 3O96A 4RG0A 3D5WA 3TNHA 3LFSA 3LQ5A 3FXZA 4Z7HA 1H1PA 3HV7A 3PA4A 4NFNA 3MFSA 2CGUA 5CY3A 3ZMMA 3OG7A 1FVTA 2BKZA 5CEIA 4GIHA 4HGEA 2R2PA 5DWRA 5H3QA 3POOA 2PK9A 4O27B 3VS2A 2VNYA 2Y4IB 4G1WA 3QU0A 5CEKA 4QQ5A 4GKIA 4ZY4A 5JN2A 4I23A 4MBIA 4R3RA 2OJGA 3ZRLA 5JQ8A 1PMNA 4WG5A 4FK6A 1Q8UA 3QXOA 4ACDA 3RPRA 2BFYA 2NRYA 2C0TA 1J7LA 1PXMA 3KK8A 3OBJA 3PPJA 4RIXB 4TNBA 5CU6A 3TZ8A 4EJNA 3KN5A 2I0HA 3UMWA
chains in the Genus database with same CATH superfamily
3TZ7A 4GU6A 4TYEA 3A62A 1E9HA 4HYIA 3ZYAA 3BQCA 4C4IA 2OF4A 4TWCA 2C5VA 2ITXA 5EK7A 3TDWA 2VAGA 4QO9A 5CYIA 4BJJA 3OTVA 4ZZNA 4MXCA 4EUTA 5BX0A 4OTQA 4DHIB 1YWRA 3V01A 2WTKB 3HA8A 2XUUA 3JVRA 3NR9A 5HLPA 3LVPA 4E6QA 3DPKA 4FTRA 3ROYA 4CCUA 4PP7A 1AQ1A 2Q0BA 3GFWA 1YWNA 2BALA 3CP9A 2BAKA 4PP9A 4UB7A 3B8QA 4F70A 3VIDA 4LV5A 4I6QA 4IAYA 4YLLA 2YITA 3PJ3A 4AAYA 1JKLA 4JS8A 4I94A 1Y8YA 2C0OA 3QQKA 3LFFA 4O82A 1OGUA 4BZNA 4FI1A 4E4MA 2R3MA 4RWLA 3O23A 3ULZA 2C68A 2QOOA 2Z8CA 4G6OA 3W2RA 4CTCA 4O6LA 5E8VA 5C4KA 2BIYA 3MPMA 5LVPA 3VW8A 1R78A 1GNGA 4AP7A 4BCOA 1JSTA 4LUDA 2XBAA 4EHZA 4RWKA 3VUDA 4AU8A 3QGYA 4LYNA 4KAOA 4QPSA 5EYCA 4JX3A 3VQUA 2YERA 3KREA 4GKHA 4U7ZA 4B4LA 2XALA 4AQKA 2EB3A 5DR9A 3ACKA 1BI7A 2XK4A 3BYUA 4NIFB 4RC2A 1J3HA 4FKIA 4JBVA 4QYYA 5IG1A 2Y0AA 3OY3A 5E4HA 2R3QA 4KABA 2QHMA 2WKMA 4AOIA 4HPUE 4FT5A 3QRJA 5IMXA 2WB8A 2QOIA 3DOGA 4B9DA 1WBWA 3ORIA 2CPKE 3F7WA 3V51A 4XH6A 3OZ6A 2H9VA 3N4VA 3PUFC 2ITOA 3COKA 5TF9A 4RGJA 4ANMA 1LR4A 2Q0NA 2X9EA 4RZWA 3VAPA 4FKOA 3KVWA 3MH0A 2OO8X 4PV0A 4ZTQA 3DQWA 4X3FC 4EWQA 4OBQA 2OI4X 2UZLA 1U4DA 3DBCA 2B4SB 5AX9A 2QLUA 1UKIA 4F65A 4QQJA 3NYOA 4GUBA 4I4FA 3BV2A 4FL1A 2XKDA 4F9BA 4UWCA 4FTMA 4NM3A 3GCUA 3QRTA 2FYSA 3Q96A 5A54A 2J5EA 1ZXEA 4FSTA 3Q5IA 4MEDA 4YC3A 5TT7A 2UVZA 3U9NA 3IO7A 4AZWA 2V7OA 5EDRA 3HL7A 2BRGA 4RPVA 4YJOA 5J7HA 2UZOA 4FTIA 3QTXA 5IA5A 1NVRA 3RTPA 5FEQA 1ND4A 1ERKA 4DTAA 2IVUA 1PYEA 2R3PA 5DRDA 4R7IA 4RA5A 1R39A 3CTJA 2BZIB 3UVQA 4XNEA 3FDNA 4RLKA 4IB0A 3DXNA 4V04A 3NCGA 4W4VA 4WNMA 5IQIA 2UW0A 4CKIA 3ZH8A 1NA7A 5EW9A 1YXXA 1CMKE 2BPMA 3ROCA 5L2IA 3I81A 5D12A 4CRSA 2V62A 2JDOA 4QP4A 3LMHA 3UMXA 2XK7A 3L8VA 4G34A 3GCVA 3FEGA 3HZTA 3V8SA 2OBJA 3PJ8A 4J8MA 4BBMA 2YDIA 2QC6A 4FE2A 4BKJA 4UYAA 2XNMA 4AFEA 2C6KA 3FI3A 4QTAA 4JL9A 5AAFA 3KMWA 3A7IA 4FKGA 4G6NA 4BTJA 4IQ6A 3P08A 3UDSA 3FMNA 4BRXA 4YJPA 4E26A 4BJJB 1WBSA 3V8WA 2G15A 4XP2A 2QURA 4J96A 1BYGA 4JG7A 3GEQA 2I0EA 2PVNA 5I9WA 4DH7A 3CD3A 4IVBA 3NEWA 3OF0A 4NH1A 5JFWA 2GQGA 3PA3A 3P79A 1WVYA 2YZAA 3MY5A 1ZOGA 2YM5A 1Q8TA 2C6TA 4M7IA 4GVJA 4IAZA 2CCHA 1Q4LA 4EOQA 5AV0A 3V5QA 3QZFA 2BKKA 4DITA 4ZTMA 4EQMA 2ZVAA 3PVGA 2F7EE 3O8TA 3D14A 3MESA 5EHOA 3TNQB 3TNWA 3MGYA 5CSXA 3UZPA 3REPA 5HNIX 2JBPA 1ZLTA 5AWMA 4Z7GA 2WU7A 2Y4IC 3MSSA 4LOOA 2DWBA 2B9FA 4OGRA 3BYOA 4QTDA 4USEA 3P7BA 4GG5A 5CXHA 4NK9A 2XNEA 1YXTA 2X6EA 4ALVA 1ZMVA 3WIKA 4Y5QA 4ZLYA 3GUBA 3OWKA 1Q61A 4LGHA 5ICPA 4UEUA 4C4EA 2B9JA 2WTCA 4PDPA 1Y91A 1PYXA 2ITVA 3FYKX 3TKHA 4MXAA 2B54A 3Q9YA 4BCNA 4BCIA 3OC1A 1SMHA 1Q8YA 3DS6A 1XH8A 2XA4A 2FSLX 5ACKA 3P4KA 4JMQA 4QP3A 5DFPA 3IOPA 2GDOA 4DC2A 3EQFA 5HTBA 2OXYA 3E7OA 2YA9A 3D2IA 2QOQA 5CSPA 5JRSA 4RVLA 5LMKA 3UDTA 4FVPA 4KIOA 1XBAA 3LM0A 5CAVA 4FYNA 2XYNA 2VTJA 3DTCA 3HV6A 3MPTA 2V5QA 3PZEA 5TKDA 2BDWA 2NYAA 4PMMA 1DAYA 2QI8A 3ZBFA 2WIPA 3DB6A 1RJBA 4F99A 3NGAA 4RIOA 4K1BA 4S32A 1VYWA 3O51A 2CGVA 3OT8A 4LI5A 2BTRA 5GNKA 1FMOE 3TMOA 4MTAA 4QYGA 2JLDA 3NNVA 3P86A 4WUNA 4ZY6A 3LJ2A 4OUCA 4BYIA 1ZY5A 1ZARA 5HBHA 4FSZA 3DBFA 3MFTA 5AUZA 1KE7A 3VBQA 4C2WA 3EIDA 5CASA 3PSDA 2J6MA 4KBCA 3KXMA 3QTZA 4L8MA 2JIUA 3O71A 3OVVA 3P23A 4Z16A 3RMFA 3FLZA 4E20A 3OCBA 2Z7RA 1VYZA 3FZOA 1ZYSA 1TQMA 2J0LA 2FB8A 3VHKA 2RL5A 2BRHA 4IADA 4FYOA 3S00A 4K33A 3ORMA 3GC0A 3L8XA 3PXFA 5BVOA 5HU9A 4PDOA 4R6VA 2P4IA 3NIZA 3L9PA 4NM5A 3KC3A 4RWIA 5CX9A 3NSZA 3OTUA 4I6BA 4L67A 4RLLA 3RZBA 4F7SA 1JOWB 1YRPA 3I0OA 2GFCA 3LIJA 2ZMDA 3FMKA 4DEGA 2RKUA 4DINA 5IH5A 4ZMFA 5M08A 4CT2A 4UBAA 4DEDA 1QPDA 2IWIA 2WIHA 1XH5A 2B0QA 3C4WA 3BLAA 1DI8A 1U46A 2XIZA 1REJA 3E3BX 5ANEA 1G8AA 2R3RA 5BV3A 3U4UA 1JLUE 4AGWA 4KRDA 1OKYA 3PJ2A 5C4LA 4KBKA 1H1SA 2Y9QA 1WCCA 2J90A 3G9LX 2HENA 4LRKA 4YUQA 1QMZA 4JXFA 5AV4A 5D11A 3ZLXA 1OITA 2O2UA 3KN6A 4V01A 5AM6A 3SOAA 5IEYA 4MQ2A 3H9RA 4H1MA 5EM5A 2RG5A 2ZDUA 3R1NA 1WBVA 5AUUA 3DBQA 5E8SA 5CT7A 2XEYA 3V5WA 4AX8A 3OCSA 1R0EA 4CEGA 4N70A 5AP3A 3W2SA 2XK8A 2G2FA 2I40A 2BZHB 4B8LA 2YHVA 4C38A 5HLNA 2QOKA 3GXLA 3PJCA 3QQGA 4K11A 4OBPA 3NYXA 3FLQA 4CG9A 1ZYCA 2GTNA 4YC8A 3DK7A 4ZSLA 1GIHA 1OKVA 2PUIA 3II5A 2XP2A 2PVYA 4M0YA 5E92A 3ZUTA 2HZ0A 3QQFA 2X6DA 4ZOGA 1ZMUA 3FPMA 4IFGA 4QMSA 2HK5A 3RKBA 4C02A 2R5TA 2IVSA 1PXIA 3DFCB 3UOHA 4XLIA 4YTIA 5M4FA 3F88A 2OJ9A 3R63A 5H2UA 4DFXE 2QODA 3W1FA 5GHVA 3W8LA 2OSCA 4HVHA 5L6PA 4O2PA 4J53A 2ZM1A 2R3OA 1H1WA 2YWVA 2W1GA 1JKTA 5E1SA 1WBOA 3ZEPA 4BGGA 2QOLA 5CEMA 3NNUA 4YO6A 4FEXA 2BUJA 3NX8A 3ZS5A 4HW7A 4FV5A 4E1ZA 2C6MA 3ZFXA 3E92A 4O38A 3ZLYA 1M17A 1VR2A 3MWUA 3EL8A 4CGAA 4PWNA 4II5A 3LQ3A 4YLJA 4C36A 5CWZA 5H9BA 3GU6A 2YWPA 4DN5A 3U6JA 4GS6A 5HE1A 3E8DA 4F0GA 3BE2A 3DZOA 3PXRA 1H1RA 4DT8A 4O91A 3IECA 4JBOA 1K2PA 3D5XA 3UVPA 3GBZA 4AXFA 3OXZA 1XWSA 4CKRA 1T46A 4ZJVA 3CY2A 4EH4A 2PMLX 3AG9A 3LXLA 1QPEA 1FPUA 3MB7A 4YHFA 5FTGA 3ZC5A 4AF3A 3CJFA 4YO4A 4BDDA 3OUNB 1SVEA 2QLQA 4FODA 5KMIA 4MXYA 4DFYA 3NNXA 4EOJA 4GV1A 2QCSA 5KHWA 4YTFA 3P5KA 2XEZA 1IASA 4ZS0A 3UP2A 1FOTA 3EJ1A 4MYGA 2PVRA 5A3XA 1J7UA 1WBNA 3GC9A 4FV0A 4GK4A 3FV8A 2NP8A 2OJIA 3SW7A 4CFFA 1WVWA 1V1KA 3V6SA 3LKMA 3ZSHA 1U5RA 3LXPA 4JQEA 5B2MA 4RC3A 4BGHA 2C5OA 4RIWA 3BU3A 3MJ1A 3G2FA 2XK9A 4R7HA 4X3FA 1O6YA 5GJFA 3F7ZA 5DT4A 1REKA 2ERZE 3L8SA 2F2CB 4CXAA 4M3QA 4NM0A 4LV7A 4P5ZA 4WRGA 2YEXA 2OKRA 3V6RA 3RHKA 3DLSA 4FV1A 4QTBA 3VN9A 1TVOA 3IDPA 4OT6A 4X2NA 3QZGA 3UYTA 5BPYA 3NFFB 4XV2A 5IA3A 2BDJA 4BHZA 4YTHA 4FIGA 1B39A 2RFEA 5CALA 3CS9A 3R0TA 2VGOA 4ANBA 2RIOA 4C0TA 3BYSA 1A06A 2ZYBA 5LVMA 2F57A 4GU9A 3AT4A 3HRCA 4A9RA 5KX8A 1OKZA 4KB8A 3TEIA 3E93A 3VJOA 4FKTA 4IACA 4MAOA 3GC8A 4KS8A 3C4CA 4S2ZA 5ANOA 2J5FA 3D0EA 5B2LA 4FBXA 4PMPA 3D7ZA 3FE3A 3S4QA 5HZNA 5DLSA 2B1PA 5L6OA 4O7VA 2X39A 3U4WA 3VQHA 5CNOA 5T6KA 2PU8A 3UNKA 2PMIA 4AGCA 3R2YA 1WAKA 2HZ4A 4U41A 3F2RA 1IR3A 4U9AA 4JDHA 3CGFA 5E8UA 5F1ZA 1FMKA 2BAJA 2PVHA 5J87A 3TKUA 4AW5A 2GS7A 3E7VA 5KKRB 3CQEA 2CN8A 4FG8A 4LUEA 5AP5A 2GCDA 4ANLA 4DGOA 3TCPA 4IC7A 5EM7A 2Q83A 5HE0A 4M69B 3HV5A 3UBDA 4DEIA 3GCQA 4FTCA 4RJ5A 3LXNA 1ZYDA 1XQZA 4CFUA 4F9AA 4J52A 3ZDIA 4K2RA 1AD5A 3KMUA 2YZLA 4FZ6A 5IQDA 3EHAA 1YI6A 4D5HA 3KCFA 3RK7A 3EYGA 3LJ1A 3ORLA 3IK3A 4I20A 4QDEA 2R3HA 3TTIA 4O7ZA 3UIUA 4EZ5A 4AT4A 5M51A 2JKMA 2VWBA 3HMNA 3G9NA 5HIBA 5GJDA 3WYYA 3HRBA 3VF8A 5E91A 3I0QA 4FICA 3CPBA 2YCQA 3QD4A 3U54A 2O0UA 4BDCA 3ODYX 2P0CA 5HEZA 1JNKA 2JKOA 4OBOA 5A14A 3GFEA 4RX7A 3N4TA 3RVGA 4L9IA 1ATPE 1YI4A 3AD4A 1UU7A 4AGUA 1J7IA 5JSMA 3EQHA 4R78A 2LAVA 2YM6A 3GCSA 4IAFA 3UQFA 5TOZA 2GS2A 4IHPA 2EUFB 1V0PA 3NYNA 3Q3BA 3NUSA 2EVAA 5GJGA 1RDQE 4BI1A 1V0OA 3I79A 2W05A 2B52A 2IG7A 3MA3A 3QL8A 5BUJA 2PE1A 5IMEA 3C7QA 5K5XA 3NUAA 5DN3A 4F7JA 4FIEA 2XKCA 3P1AA 4FTQA 4JIAA 1FBNA 5FXSA 3PXYA 3AKKA 2PZIA 3MDYA 3FC1X 3KB7A 4KKHA 4C58A 4GJ3A 1BMKA 5F20A 4ZTHA 1WBPA 4G3GA 4NT4A 3T8OA 2CKOA 4AE6A 4HCTA 4CFVA 3DDQA 3A8WA 4O84A 2C69A 2F2UA 4L3LA 1Q3WA 5M4UA 4IB3A 4NTTA 5EH0A 4O83A 2ZM3A 4R3CA 3UOLA 3TDVA 3Q4ZA 2HWOA 3H10A 2OWBA 4YJQA 4OW8A 5IZFA 4BYJA 2OIDA 2QOBA 4QP2A 2XNBA 3PXQA 4MBLA 1O6LA 3GP0A 4ZZOA 5AADA 3R01A 1M2QA 1XKKA 4MCVA 2WZJA 4BDFA 3PP1A 1CKIA 5I9VA 2G2IA 3UNZA 4C2VA 1E1VA 2V7AA 4QP7A 4RIWB 5EOLA 4Z55A 1LEWA 2GTMA 3HMIA 3OFMA 4X3FB 3DKFA 4D5KA 4MKCA 4QTEA 3R83A 3NFGB 3E64A 5ETCA 2XNPA 4AA0A 5E1EA 3AXWA 3F82A 4H36A 5LARA 3ZXTA 4ENXA 4G31A 5DT0A 1OPKA 5DBXA 2WGJA 3N9XA 3S0OA 1CKJA 2EWAA 4EOKA 1U54A 4HPTE 4FSUA 5BVNA 5IDPA 4AW2A 1GZNA 2OXDA 3HAVA 5KZ0A 3WYXA 3EQCA 4QYFA 3RK5A 4EORA 2GHLA 3IKAA 4TT7A 5CSWA 1Q8WA 3E3PA 5J8IA 4O7OA 5I9XA 4YJVA 2YM4A 2I0VA 1P4OA 3H0ZA 1VJYA 3H9OA 4QP9A 5I9YA 3PVBA 4ZSEA 3V3VA 2VX3A 3MY0A 3V8TA 4FZDB 4AFJA 3FMHA 4DH8A 2BR1A 5M06A 2VTHA 2R3KA 4AN2A 3R71A 3ENMA 4ZY5A 2VWZA 3Q9WA 4U44A 4E8AA 3RI1A 1PXKA 4HVIA 4FIHA 5HHWA 3FPQA 3FI4A 4NM7A 2XNOA 4KD1A 4ZTLA 2C6OA 3PYYA 5CSVA 3UTOA 4WG3A 2AC3A 5FD2A 2OFUA 2R0IA 4QP1A 3BEGA 3E8CA 4O7NA 3TN8A 4IC8A 3SAYA 4O6EA 3VBWA 3NCZA 3TV4A 3VS0A 3FZTA 3W32A 4CT1A 4FUYA 1W0XC 1YXUA 4OTWA 1PMEA 1QCFA 2FVDA 2Z02A 3L9NA 2BHEA 1Y57A 3M2WA 4V05A 4ZLOA 4FR4A 4FV6A 1TFFA 1XJDA 4QMOA 1JBPE 3VRYA 3EFLA 5KMNA 4I92A 4YZ9A 2WEIA 3MVJA 3LCDA 2BHHA 4I5PA 5HQ0A 2XARA 5HKMA 2IW6A 2W1HA 3D7TA 3OT3A 4QPAA 3ZZWA 3ULIA 5HBEA 4CV8A 3FMEA 4I5HA 4NU1A 3ORTA 3VWAA 3Q2JA 3NUUA 5C27A 3R7UA 4GMYA 2ZFYA 2VTQA 5IQHA 2CNUA 1J91A 2IPXA 4L6QA 2PTKA 4ZJIA 2A2AA 3CPCA 3WZEA 2HIWA 2R7BA 1ZZLA 3F2NA 5CQWA 3ZONA 2WHBA 4EH6A 4L7SA 4G3DA 3QCYA 2UUEA 3EN7A 5ANGA 3FQEA 3UC3A 4HYSA 1OIUA 1ZYLA 2C6EA 2CKQA 3R8UA 5B7VA 2UW4A 3FL5A 5HX6A 2WMVA 4RRVA 3OWLA 4FOBA 3IGGA 2YJSA 4L3JA 2PYWA 4L43A 4BN1A 4M84A 4JJRA 4G3EA 2XNGA 1GY3A 3TACA 3AQVA 4FT9A 2I1MA 1ST0A 3KY2A 4F9CA 3QKMA 1PRYA 5M57A 2UZWE 2VO7A 1P5EA 3DQXA 5M53A 4N0SA 3VS5A 2W5HA 3G33A 5EQPA 4CVAA 4UYNA 5KKRC 4QNAA 1FVRA 3HMMA 4E5BA 3FZRA 1PXPA 5A4TA 5A6NA 5I5ZA 3UDBA 3DDPA 3SHEA 4BIEA 2HZIA 4EJ7A 4YJUA 4CMOA 3PFYA 2W1DA 4ACCA 2VN9A 4I6LA 5CAUA 4IX3A 1UNGA 3VUIA 4J71A 3NLBA 3TV7A 2PZRA 3S95A 3ENHA 3U87A 3QQJA 2QR7A 3DJ5A 2G01A 1NVSA 2ITPA 4WBOA 4Q9SA 5ETAA 4KKGA 3QYWA 4NWMA 4CKJA 5EI8A 4DHJA 4PUZA 2VZ6A 5AP4A 1FVVA 3DAKA 3KRLA 5EI6A 3BV3A 4FL3A 4R1YA 2Z7QA 1R0PA 4GCJA 4JDJA 5HVYA 4ACGA 3MY1A 4FSMA 4YTCA 3MVHA 3HGKA 3KXXA 3NVKI 2PUUA 3CR0A 2AUHA 3FBVA 3PG3A 3UVRA 3R8VA 3TG1A 4EZ3A 5HBJA 5KBRA 4DHFA 1Q5KA 2C6DA 1U54B 2C5NA 1KUTA 3ZHPC 5JK3A 2W4JA 3ZFYA 5CVGA 1KOBA 1OIQA 1VEBA 2IVVA 4I4EA 1U5QA 4LMNA 4WIHA 3QCQA 1BX6A 4FKUA 5T3QA 1Q97A 1JWHA 5JZNA 3EFWA 4ASDA 3TZ9A 4ITJA 3VJNA 3PE1A 1OM1A 4XG9A 3HP2A 3RM7A 3RPSA 2W17A 3R28A 2PE2A 2CMWA 4B8MA 3W0QA 5HTCA 3DGKA 4F64A 5JGBA 5K4IA 4MVFA 3I6UA 3UG2A 4F9WA 4WT6A 2FA2A 4J7BA 4U45A 3VUMA 4BR3A 2X81A 5BNJA 1PW2A 2OZOA 2XVDA 5C8MA 5CAOA 4H3PA 5CLPA 4O7RA 4PY1A 1URWA 3FMJA 2ETMA 2E9UA 2J0IA 3BYVA 4WSYA 3FSFA 2X0GA 2W1FA 3LCSA 4HJOA 3W55A 2CSNA 4GH2A 4RJ7A 1FQ1B 2BMCA 4JG6A 5E9EA 5CEQA 1PXJA 5EYMA 1GZOA 2WQEA 5CXZA 5D9HA 3ZM9A 3Q9ZA 3FWQA 3VBVA 3DJ6A 2VTMA 4DDIA 3FZPA 1GZ8A 4IH8A 3BEAA 3A8XA 3A4PA 4DAWA 3F5UA 3WILA 2PULA 2WQBA 2X4ZA 4XG2A 2ZJWA 4JOAA 3TNPC 4BGQA 4EQCA 4FV2A 3G90X 3NZ0A 2A19B 3I6WA 3O0GA 3BCEA 5FTOA 2UW6A 4QMLA 1H07A 4X0MA 4EBVA 3D7TB 1BL7A 4DHZA 1T45A 3EN5A 4XJ0A 1JSUA 2QU5A 3MS9A 4WOVA 5GINE 1UV5A 4ZXTA 5E8TA 3IW6A 4L45A 2H34A 2CLQA 3OXTA 2HYYA 3ANRA 2GNFA 4JI9A 4Q2AA 4UXLA 3BHTA 3ZC6A 4Z9LA 3D5VA 3T3UA 4AOJA 3KMMA 4H3BA 3FLNC 5D7VA 4MD8E 4O0YA 5CEOA 3OWPA 5EW3A 5IEXA 4EWHA 2C3JA 4IWPA 4IAKA 4FKPA 4EKKA 3QD2B 3SVVA 2IZRA 4W8EA 4XV1A 4FIFA 2VTSA 3OCGA 4FSWA 4NW5A 4S31A 4QMZA 3RK9A 1YDTE 3U6IA 4D1XA 4E7WA 2JAVA 2EXMA 2VTLA 2BROA 4BTKA 5DE2A 3ZTXA 4F6SA 1JPAA 4CRLA 1ZOEA 2QD9A 2R3FA 3UQCA 5C03A 4BIBA 1SM2A 5HICA 4FZAB 2X8IA 5L2SA 4I6FA 4KINA 2UZBA 5C8NA 3FXXA 4WO5A 4RZVA 4RIYA 3ID6C 1GAGA 2GNGA 4JR3A 4MK0A 2OJJA 5AP2A 5FDXA 4ASEA 1GIIA 4FKLA 3RAIA 4DYMA 3ZO1A 2VWVA 4U97A 5DG5A 3EYHA 1A9UA 3R7OA 4I6HA 3OW4A 4BCHA 3KRWA 2GHMA 5IF1A 1M2RA 4DGNA 3A7JA 3G15A 1MRYA 4IE9A 4RJ3A 2FUMA 2XS0A 1MQ4A 3RHXA 2RFSA 3D94A 3KFAA 4WBBB 3VRZA 1OKWA 1H0WA 3NUYA 4JT3A 3W2PA 4W4XA 4ASZA 3NVMB 2Z2WA 1AGWA 1GJOA 2A1AB 3CKXA 3EB0A 3F9NA 3HMPA 3O5AA 4H3QA 4O0XA 5EQEA 4ARKA 5LJJA 5HIDA 4EYMA 4C34A 1OVEA 4YJRA 3OEZA 3R1SA 5A46A 1SYKA 2BRMA 4PTEA 1UU9A 4G9CA 3BLHA 4FUXA 4DEAA 5KMJA 3PG1A 5AUYA 4C35A 5BVDA 4DLJA 4ZSJA 1XBCA 3QTRA 4F63A 3POZA 3KU2A 2BRNA 3KXNA 4J8NA 1G5SA 2IW8A 5L3AA 4DH1A 2VV9A 3QD0A 5LXMA 4CLJA 3RNYA 2OH0E 3GC7A 4I22A 4MD9E 3QWKA 2YIWA 3C4EA 4YZMA 1Z57A 3IDBA 3LCOA 5EHLA 4BTFA 3WF9A 5BYZA 4DT9A 5AAGA 2HXQA 4CV9A 1ZRZA 3ITZA 4S34A 1OL7A 3CSVA 4TWNA 3N4UA 3TUDA 2WPAA 4GT4A 3QA8A 4JRVA 4FEUA 3W0OA 2GQRA 3DNEA 5BVWA 4N6YA 2YM8A 3TM0A 2VTRA 4EH3A 4FV8A 2UZEA 4BIDA 4E4XA 3COMA 1QPCA 2VX0A 4EK8A 1RE8A 4ZSAA 2IZUA 3UGCA 4XCUA 3PY0A 4QMQA 3VS4A 4TYIA 3TNIA 4U40A 3QKLA 4DCAA 2VD5A 3IONA 3W33A 1UWJA 2R9SA 4R1VA 3VBXA 4WZYA 2C3KA 1XH6A 3AGMA 4JDKA 3P0MA 5CANA 4NZWB 5I4NA 1UA2A 3VONA 1UNLA 4K77A 3FYJX 3CXWA 4MH7A 3WZKA 4AGDA 1BL6A 4LV8A 3RGFA 3UQGA 2PVMA 5BVKA 4XG8A 2W99B 1APME 3EQPA 3EZVA 3KRJA 5FP6A 3SD0A 3VF9A 3NAYA 4Y8DA 4F1TA 4O0VA 4QQTA 5DPVA 5E8XA 4RFYA 3QYZA 4FTJA 4IWOA 3OHTA 3BU6A 3O7LB 2FO0A 3PWYA 3OS3A 3KGAA 2O65A 5E8ZA 3W18A 3F61A 3I7CA 5HE3A 4F78A 5A4EA 2ZDTA 3C13A 3PIYA 2SRCA 2XM8A 3DAJA 3V04A 2JAMA 3QQHA 2C47A 4YBJA 5L8LA 5EM8A 5KBQA 2GQSA 4IBMA 2WQMA 1H28A 4QTCA 4MQ1A 3MH1A 4XG7A 3F2AA 4XX9A 2W06A 1Z9XA 4FTKA 3C4ZA 2FSTX 4USDA 3K3IA 1P4FA 2CN5A 4NW6A 5FM2A 1PXNA 5IUIA 2ONLA 4J95A 4NKAA 4F4PA 3RWQA 3H30A 5EKOA 3I5ZA 4EH9A 1UNHA 3TT0A 2JDSA 4EK6A 4NJ3A 4EH7A 4U81A 1XH9A 3PLSA 3SRVA 3HECA 3EWHA 3W0SA 3ZU7A 4RT7A 3R9HA 5I0BA 2CDZA 3QALE 3V5TA 3D15A 3Q5ZA 4RFZA 4I0SA 3HKOA 4BTMA 3GU7A 2WMQA 4F0IA 2WMWA 4PL3A 5K4JA 5FTQA 4X3JA 5CVHA 4W4WA 1SVHA 3MTLA 4RIYB 4E4LA 4DH5A 4Y73A 4R3PA 5HG8A 4TYHA 4EEVA 2WTJA 5FUTA 4XRLA 3U9CA 5IUGA 2ITYA 4X6RA 3Q6WA 2C0IA 3A7FA 4U79A 3RINA 2RFDA 1H8FA 3NYVA 4Q5EA 4TW9A 1XMMA 4RVKA 4DEEA 5I9ZA 5BVEA 5KNJA 2EXCX 4FIJA 3W16A 4I24A 3C5IA 3A61A 4N4SA 3E5AA 2QKWB 4S33A 4MXOA 2WFYA 4GK3A 3WZDA 4IX6A 4CZUA 3VUHA 5DR2A 4QMVA 3R7VA 3CIKA 3ZSGA 3TXOA 2UZTA 1SNXA 3NPCA 4XLVA 1JAMA 5AP0A 4KUJA 5ETFA 4QYEA 5FBOA 3BKBA 3RP9A 3RALA 5A4QA 1YOMA 3FJQE 3PZHA 3OUKA 3JR1A 3UPXA 3ZO2A 5CAPA 5LCJA 4O7LA 3LZBA 3QKKA 2X2LA 4U8ZA 2O3PA 3O17A 5AA9A 4UZHA 1YI3A 4FOCA 2WMRA 1F5QA 4YPSA 2ITUA 3VULA 3MIAA 4H39A 4I93A 1JSVA 2QG7A 1PKGA 4EYJA 2F4JA 5HCXA 2WAJA 1HCKA 4KA3A 4U3YA 5FXRA 2QVSE 3O7LD 1Q99A 3R7EA 2VWWA 4J99A 3KL8A 4BC6A 2LGCA 3MH2A 3OBGA 4GFMA 3EFKA 4D9TA 3MA6A 5FG8A 2XYUA 1LPUA 1BKXA 2UW3A 2Y8OA 5I9UA 5HLWA 3BYMA 3DZQA 4YNEA 4YZNA 3O8UA 3W2QA 4QMMA 4X2FA 3ZBXA 2AEGA 3BGQA 4XMOA 1YWVA 2WEVA 5CT0A 2XMYA 3BBWA 3ZLSA 2ZMCA 4D0WA 3MI9A 4Y95A 1Q24A 4D2RA 2IW9A 3MVLA 2DS1A 4MX9A 2VNWA 2WO6A 2ZOQA 4O7WA 4XEYA 1DAWA 4OTIA 3H4JA 3Q4TA 2IZSA 4G17A 3VNTA 2B9IA 1E1XA 3IW5A 4EHGA 2W4OA 4L68A 2XBJA 3V5PA 4BDJA 3U6HA 3RPOA 4DTKA 2VO0A 4QMXA 5E8WA 3VO3A 5ANKA 4B6LA 2C5XA 2IJMA 3QQUA 4Q5HA 4ZS4A 5IA1A 5IQFA 1XR1A 2CGWA 4WNOA 3RPVA 1J1BA 4I41A 3W0MA 4EKLA 4P90A 1W83A 3LFAA 4GT3A 1P14A 3TZMA 4FKSA 1SNUA 2W9FB 3T9TA 2QKRA 3B2TA 1WZYA 4KNBA 4TL0A 4D2SA 3DCVA 4RJ8A 5EDQA 1H4LA 5EM6A 4KKEA 3Q4UA 3CQWA 3FL4A 1S9IA 2PUPA 3A7GA 4IM3A 2YISA 1H25A