3UZRA

Crystal structure of aminoglycoside phosphotransferase aph(2'')-ib, apo form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
299
structure length
299
Chain Sequence
MVNLDAEIYEHLNKQIKINELRYLSSGDDSDTFLCNEQYVVKVPKRDSVRISQKRELELYRFLENCKLSYQIPAVVYQSDRFNIMKYIKGERITYEQYHKLSEKEKDALAYDEATFLKELHSIEIDCSVSLFSDALVNKKDKFLQDKKLLISILEKEQLLTDEMLEHIETIYENILSNAVLFKYTPCLVHNDFSANNMIFRNNRLFGVIDFGDFNVGDPDNDFLCLLDCSTDDFGKEFGRKVLKYYQHKAPEVAERKAELNDVYWSIDQIIYGYERKDREMLIKDVSELLQTQAEMFIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside phosphotransferase
publication title Crystal structure of aminoglycoside phosphotransferase APH(2'')-Ib, apo form
rcsb
source organism Escherichia coli
total genus 100
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uzrA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3uzrA02
5GNKA 4HZSA 5DN3A 5AP4A 5HO7A 5A4CA 1OL2A 3LJ2A 2WMVA 2C6OA 2GHMA 2RL5A 4QRCA 4AX8A 3EB0A 1NY3A 1R0PA 3A2CA 2WMWA 3EQIA 4XG8A 5C1QB 5HTBA 1IR3A 1OKVA 4ITHA 2QO9A 5CF4A 4QYEA 1Z5MA 2CGXA 4IADA 3PIXA 3WF6A 1DI8A 1GOLA 3BLHA 4D9TA 3PZHA 5AM7A 4ACHA 4H1JA 1LEWA 3TACA 3QUEA 4CZTA 2HY0A 4P2KA 3MY5A 3KCKA 4YZBA 2CGUA 4QP8A 5LXMA 3OTVA 4U3YA 3MVLA 2XF0A 3T3UA 4M68A 5JGBA 3RKBA 3EIDA 3ZHPC 4RC3A 2GTNA 3DLZA 3CS9A 3OXIA 4BDGA 5C8NA 2XK7A 4ZSLA 4JRVA 2VTNA 4FKUA 3VBXA 2PE1A 2PZ5A 3BYMA 2AC5A 3QD3A 1BI7A 2UW4A 3QKKA 2YISA 2DYLA 4ALVA 3G0FA 2QOHA 4BCOA 4BDJA 5FM3A 5CAVA 3VIDA 4IB0A 4BTJA 4C62A 4D1XA 1O9UA 3DK7A 4FZFB 4LGGA 3G6HA 5HORA 4DTAA 4F6SA 1PF8A 1G5SA 3V04A 2YEXA 2J5EA 4U81A 4EC8A 3DTCA 3GC0A 2WQMA 1W0XC 4EK3A 2RKUA 2GNHA 4O7YA 4EWQA 3P5KA 4NM0A 1Q8TA 4K11A 5CWZA 3FPMA 5AWMA 4Y73A 4BHNA 4F09A 3QKMA 4EOQA 2WMRA 2EU9A 5BQ0A 5E1EA 2ERKA 3E8EA 2OJFE 2QHNA 1YDSE 2C5NA 2J90A 2HXQA 2GQSA 4ZMEA 3QQLA 2C4GA 4FTJA 4DEBA 2JC6A 4EEVA 4KNBA 5T3QA 3VS2A 3NYVA 4ZK5A 3FLSA 2BDJA 2VTPA 2VTMA 4QYGA 1FVVA 2RG5A 5GIPE 2ZDUA 3HRCA 3A60A 3NZ0A 4ZTQA 4KD1A 2XJ2A 2WTIA 2PVFA 4BDDA 3GC9A 4EZ3A 2GSFA 5HIBA 5AIKA 4JDHA 4IIRA 2J9MA 3V5WA 2ZJWA 3KVXA 2P55A 3IOPA 3ENHA 4GUBA 2ZMDA 4WG5A 5C01A 2O5KA 3A8XA 5H8GA 2LAVA 4C4EA 4DG3E 3OTUA 4PDSA 4YU2A 5KMNA 3R7YA 3ULZA 3BU6A 4IAAA 4NYEA 4L3PA 4QYHA 2UZEA 3C4ZA 2BAQA 5CEMA 3IDCA 5LVMA 3UGCA 3NMUF 4FL2A 5CSXA 3LPBA 4CQEA 2GDOA 3ELJA 4BZDA 4NCTC 4AA4A 5CSPA 3ZSHA 4E5AX 2RFNA 2EXMA 2HCKA 4FTMA 4C3RA 2FUMA 2QONA 2Z2WA 4FT5A 4KS8A 3FY0A 3M42A 1GZKA 3F5XA 3BEGA 3WZKA 4KSPA 4JX3A 3PXRA 5BPYA 2QHMA 1YOMA 1YDRE 3ODZX 4M0YA 5LCKA 4B0GA 2CNUA 1H4LA 5FDXA 3TKUA 3V5QA 4XCUA 3QTIA 2PVYA 4USDA 4JAIA 4V0GB 3ATSA 4FTAA 1MUOA 4O27B 3OZ6A 2OZAA 5IQGA 4QQ5A 4U97A 4H3BA 3W2RA 1PXKA 4AN2A 3G15A 3NGAA 3UO4A 4J97A 2WPAA 2ITUA 5KZ0A 3QD2B 4GKIA 2HZNA 3OS3A 5GHVA 3EQBA 4I21A 2C3JA 2ZM4A 3CP9A 3QGWA 3VF8A 3RHXA 2V62A 3L8SA 3LHJA 2I0EA 4FSZA 4MD9E 4LUEA 4W8EA 1W7HA 2V55A 2RFEA 4XG7A 2P33A 3D7TA 3MVJA 3TCPA 2B1PA 2XKCA 1YI3A 3D5UA 2WMUA 3HMPA 4QMZA 4XV1A 1KE7A 1ZOEA 3FUPA 3O51A 4RFZA 3DBCA 3KRWA 5ETCA 1BUHA 2NRYA 5DEWA 5KHWA 4YPSA 4IAFA 1H1QA 2WQOA 2XIZA 4AW0A 3FZOA 3ZM4A 3VS7A 4EH2A 3TKHA 4FT7A 2QQ7A 2QLUA 5EW3A 5J1WA 1Y8YA 4WUAA 4YC3A 4Z55A 3GBZA 3PSDA 3FZ1A 2JEDA 4I20A 3LLAA 4CTCA 1Q99A 4CFUA 3QTZA 5AUUA 4L68A 1RE8A 4LM5A 1YXSA 4M84A 4JDIA 4BDCA 4B6LA 5E8SA 4XOYA 4KIOA 2QO7A 4GV1A 5FTOA 3BIZA 3G51A 2J2IB 4XRLA 4GIIA 2B55A 4QNYA 3Q3BA 3R83A 4KWPA 4A07A 2JKQA 2UW7A 4ZLOA 5EYCA 3LCOA 3BYOA 3Q32A 3HMMA 3JR1A 4QTAA 1M2PA 1ZMVA 4H05A 3G9LX 4K1BA 3R8VA 4ANMA 2UVXA 4R6VA 2J7TA 2WIHA 2H96A 5E92A 3RALA 2C6TA 1H24A 4R5SA 4LRKA 3TTIA 4M67A 4BY9E 1J7IA 1JBPE 2WB8A 3I60A 5AP2A 5L8JA 4D5KA 3EOCA 3ZZWA 5BYYA 1DAYA 4PDOA 4QP7A 5HE3A 1SNXA 3ZLXA 3BU5A 4FEWA 3QRUA 4L44A 3EFJA 3DQXA 3F7ZA 5B2KA 4L6QA 1JSVA 5M4FA 3W2SA 1IRKA 3HEGA 3O0GA 4JDKA 4S34A 4ZY5A 3VBQA 5EI8A 5CEPA 3MESA 4QQCA 4DCEA 3AD6A 5DT4A 5GJGA 3ANRA 4X3FC 2W4KA 3VUMA 3O8TA 3P4KA 1FQ1B 4U9AA 4KKGA 4BB4A 1W84A 4I6QA 3W2PA 4DGNA 3KL8A 4HYIA 4EORA 5E8ZA 1U59A 3D9VA 4YGAA 2C1AA 1UU3A 3TV6A 1V0PA 3UVRA 3UMXA 3V6RA 2C5VA 2ZM3A 3F2RA 4XG4A 1UNHA 5A4QA 3UO6A 4ZTLA 5KMIA 3PJ3A 1WAKA 4RJ5A 4EYJA 5M4IA 3R1YA 4AXAA 3EN7A 3DBQA 4AW2A 4DEAA 3R02A 3LFAA 3LJ1A 3IECA 4NFMA 2X9EA 5FM2A 3UOHA 5IA0A 5GIOE 4FV8A 2OZOA 3GGFA 4YLJA 3VBTA 1Y91A 4BCGA 3I0OA 2UZDA 4QMUA 3PSCA 5HU3A 1IASA 2OI4X 4FKSA 2Y7JA 3O17A 4ZAUA 3QCSA 4NWMA 1JPAA 3TXOA 3FYJX 4H1MA 3D14A 3NS9A 3QD4A 4EH4A 4FSNA 3MN3A 2EB2A 3LXLA 2QOOA 1Q5KA 2YABA 5AV2A 4O7TA 2XNPA 3GQLA 5EM8A 3ZFYA 3ZRLA 4LOQA 4GG7A 3P78A 5LMKA 1H0WA 4TY1A 3CKWA 4OBQA 3RK7A 2ZAZA 4BYJA 2YFXA 4S30A 2BVAA 4PV0A 3KB7A 3PYYA 2XNEA 3NSZA 4NKSA 2ITOA 2F4JA 2HENA 3M11A 2WTKC 3PDTA 1PW2A 4F7NA 4F9WA 2XVDA 3A4PA 4P5QA 3ZBFA 2WTWA 1WVXA 3BYSA 1JAMA 3QTXA 5H8BA 2VWZA 5CAOA 3DJ6A 3LVPA 4WT6A 5DFPA 3MYGA 4IC7A 1ZLTA 4C59A 4G6OA 5IDPA 4HNFA 4ACCA 2IW9A 5A9UA 2RGPA 3L1SA 3RWPA 2XYUA 3MY1A 4BIBA 3PVGA 4KABA 4A06A 3O23A 2XKFA 4O83A 4QNAA 5AEPA 2F2CB 4KBAA 2J6MA 2YDIA 3MB7A 5K4JA 5LVLA 4FT3A 1CM8A 2C0IA 2WTDA 3DA6A 3BBWA 4YZ9A 2BZHB 3EYGA 4JL9A 4AFEA 1CKJA 4AGWA 2W5AA 4GFMA 4IVBA 3FI3A 4YJOA 4GL9A 5HE0A 2VTTA 1F5QA 4O6LA 4FTNA 3PY0A 3ALOA 1CDKA 1SYKA 3HDNA 3ZUUA 4BBMA 2YCSA 3TNPC 3D2KA 3PVBA 2ZV9A 4HCUA 4NK9A 3CTQA 4W4WA 5CSHA 4DTKA 4DEEA 2CJMA 4UX9A 3AGMA 3JXWA 2HXLA 5EYKA 1JSUA 1CKIA 3C7QA 3HP2A 2R3JA 4G9CA 4GJ2A 4RZVA 4EL9A 4FKIA 1FMOE 3Q9YA 2VX1A 3EN6A 4AGDA 3V8TA 3HAMA 1SVHA 4IB3A 4O2PA 2PYWA 4P90A 2QVSE 1UKHA 2O63A 5CSWA 3ZSGA 5HU9A 3FMJA 3FWQA 3EN4A 3KREA 4PL5A 4AG8A 1J1BA 5TR6A 4ZZMA 4E73A 1H1SA 4C3FA 1FGIA 4OTDA 3ACKA 4XP0A 4CFNA 4D9UA 2VWXA 5J9LA 3CC6A 2YAKA 2I40A 4FKTA 5IA1A 5CLPA 5CF6A 4QTEA 5CTPA 3ZDIA 4N70A 1WBTA 1YXUA 4RJ8A 1XH4A 3W0QA 4FV7A 2G1TA 5HE1A 1GJOA 1A48A 3P86A 1Q8UA 4JRNA 2W1IA 3FXZA 2IJMA 1PXLA 2JAMA 3QA0A 3TI1A 2R7IA 4PMSA 3NW6A 3QZIA 2GS2A 3KULB 5DVRA 2CKQA 4BBFA 5C27A 3KGAA 4L7FA 4EOPA 2ZVAA 5JQ5A 4DT8A 4AE6A 5HO8A 2OW3A 5E8XA 4AT5A 4L53A 4WKQA 3GU6A 3QFVA 2BUJA 4FKLA 3BEAA 2ITXA 4EK4A 4F9YA 3E92A 4EONA 2P2IA 5C26A 3F9NA 3UG1A 5HNBA 3PUPA 4M8TA 4UXLA 3W2OA 3QCQA 3QTWA 4ZIMA 5KBQA 4OT5A 3UMWA 3ITZA 3P79A 3PTGA 3SGCA 3DGKA 5CZIA 1XBAA 2JDVA 2I0YA 4CFVA 5FGKA 3OUKA 2YERA 5L2WA 3FC1X 4JAJA 5GJDA 1Q8WA 5CEQA 3AG9A 3HRFA 4RIXB 2F7ZE 5AUVA 3KU2A 4YJRA 5JGAA 3NAYA 4BI2A 4QYFA 3OEZA 2BHEA 4GYIA 4O7SA 5AP6A 3WE4A 4O0XA 2C5OA 3GI3A 1FMKA 2QR8A 3EQGA 3KN5A 5TOZA 2F2UA 4JJRA 2BRNA 3LCSA 5IZFA 4JBOA 2JITA 1KOAA 2C6LA 4D0XA 5C03A 3RCJA 4BGQA 1WVWA 5FBNC 3GB2A 3KMMA 3L8VA 3DAEA 3UVPA 3U6HA 3TJCA 3ID6C 3LZBA 4G5PA 3SVVA 2XZSA 4W4VA 3IDBA 1LUFA 4C4IA 2XP2A 3TZ9A 4JVGA 2X8DA 1R0EA 1ZOGA 2O64A 3A7GA 3IK3A 1YWVA 3LXKA 3QYZA 3CJGA 4I4FA 3P7BA 3QD0A 1ZYJA 3CE3A 4LOPA 2VTJA 3FKLA 4ZTSA 4UALA 1VEBA 1A06A 3E63A 1K9AA 1S9IA 4XLVA 2GNGA 3HUCA 4MWIA 1PXMA 4FG8A 1OKWA 4N4SA 4JX7A 5HNIX 2PMIA 3VF9A 5A54A 4KUJA 3NWWA 4U79A 4QMPA 5I9WA 2W96B 2EUFB 4CRLA 3ZFMA 4FUXA 2UUEA 2VU3A 2CSNA 2V22A 2B0QA 4IAIA 2CKEA 2W9ZB 2C1BA 5ANIA 5FXSA 2DS1A 4J52A 4EQUA 5H2UA 4QP6A 2WEIA 3SW4A 2W1GA 4XNEA 3RPRA 4FKVA 4HNIA 4RIYA 4XS2A 1U54B 2HZIA 3R7IA 3WBLA 5FEEA 4GSBA 3OP5A 4FKGA 3T9IA 4DH1A 3AC1A 2J0LA 3DBEA 3OHTA 2JIUA 4MTAA 3EWHA 4L43A 3QKLA 1H1WA 4ASZA 3ZMMA 3EN9A 3FPQA 3VQUA 4FL3A 5JFXA 2VNWA 4QMVA 4DEHA 4X0MA 5EDPA 1P4FA 5CVFA 1ZRZA 3DT1A 4AGCA 3ZDUA 4FIGA 3RI1A 2F57A 5HLPA 4DBXA 4RSSA 4KRCA 3O7LB 1GAGA 3FMMA 3OWJA 4U7ZA 3R8ZA 3O50A 3PE1A 2W05A 4U6RA 3BHHA 5I9VA 3R1QA 4XP2A 4Y72A 3NW7A 3V01A 4L45A 5BNJA 2Q83A 3N4UA 4DC2A 3KN6A 2OJGA 3VBVA 4ITJA 4YHTA 4DAWA 2R3PA 4I1ZA 5J7HA 1OL5A 4WD5A 5CAUA 4JQ8A 2ZB0A 3F61A 4FKOA 2J4ZA 4JOAA 5E8WA 5HEZA 3TYKA 2ONLA 4Q5HA 3S0OA 5JZNA 3V3VA 1Q3DA 3W8QA 4YURA 2BDWA 3DY7A 5DI1A 2JDSA 2UZOA 4LRJA 4CCBA 5A3XA 4EI4A 2P4IA 4J95A 3BX5A 2R0UA 4EHZA 3ZYAA 4AOTA 5LMBA 3I5ZA 1I09A 4MXYA 4MH7A 5LVPA 1JLUE 1Z9XA 2PUNA 2RG6A 3ORLA 3VUKA 5AJQA 3CGOA 2PWLA 2GMXA 3ORZA 4ASDA 3FQSA 4PP9A 3W2QA 3F3VA 5EI2A 1OL1A 2VX0A 3NAXA 5LQFA 3GP0A 4RX8A 4C38A 5IMEA 4DLIA 4G3FA 2WQBA 4EZ7A 5JFSA 3BGPA 4L00A 2X6EA 5G1XA 4EH3A 5IQAA 5KMMA 3R1SA 4ZY4A 4YZMA 1IA8A 1Y6BA 2OH0E 2OKRA 2XRWA 3VVHA 5AAEA 4QT1A 3UO5A 4TYHA 4E4LA 2OFVA 5JZJA 4F63A 1SVEA 5DG5A 3DJ5A 4ERWA 3POOA 4AS0A 4QTBA 2P0CA 1ZY5A 4NT4A 3ORKA 4GU9A 3MH1A 4FGRA 1PHKA 4G3EA 3ZXZA 3HL7A 3HA6A 4CVAA 3PRFA 2VV9A 5K4IA 1PKGA 4I94A 5AFVA 3CSVA 4QP3A 2FSOX 5DHJA 4IWPA 4CFWA 2ZMCA 2HYYA 4I24A 2EVAA 3U6IA 1LPUA 4PF4A 4MXZA 2DWBA 3QALE 4CMTA 2WU7A 4AA5A 4S33A 3E3PA 4WNKA 2YM5A 1T45A 3IKAA 3QLFA 3QX2A 2YZAA 5D11A 3DFAA 4BC6A 2WTCA 4YJQA 2J0KA 2XBJA 5H9BA 3A7JA 3C1XA 3GU5A 3PFQA 3UOKA 3E8DA 2R64A 4FOBA 1XBBA 1NVSA 3U8WA 4DFLA 1H0VA 1PXPA 4RC4A 3RPSA 3WI6A 2BHHA 2WZJA 4XG9A 3ZRMA 4JBVA 3DTWA 3BKBA 4RX7A 3MVMA 3KXGA 2I0HA 3IW4A 2R3RA 3KXZA 4MBLA 4V04A 1KE5A 1PYEA 3D5VA 3KMUA 3LM0A 2IWIA 2GNLA 4OTGA 4UZDA 4ACMA 3WF7A 4MQ2A 4FGBA 4ZZNA 4CNHA 5HKMA 3A7FA 5CSVA 1FVRA 3BGQA 3AOXA 3UZRA 4F99A 4DGGA 4HOKA 4KSQA 3VO3A 4APPA 2C6EA 3TZMA 2ZOQA 5DT0A 3VNTA 4OUCA 5BVOA 1KSWA 3QTSA 3R71A 2UZVA 2CN8A 4LFIA 3V6SA 1GZ8A 4BCIA 2Y6OA 3QXPA 5LMKC 4IX3A 4JNWA 3UQFA 3LMIA 1FINA 4XJ0A 1Z57A 3D5WA 3FXWA 1ATPE 1OB3A 5AV3A 4PTEA 3ATTA 4XG3A 4FSQA 5F95A 1GZOA 5CZHA 3MVHA 3Q60A 3V5LA 5L2SA 1Q62A 2UW3A 3NNUA 4U0IA 5HICA 3G2FA 1U4DA 4GIHA 5J1VA 4U40A 4X3FB 3W32A 4KA3A 1Q8ZA 4CKRA 4IZYA 3OT3A 5AUYA 3QQFA 2FA2A 2OH4A 3RGFA 4X7QA 4K77A 3TNIA 4U41A 5A4LA 3OMVA 2XJ0A 4BDAA 3V8SA 2PUUA 2VWBA 4GFGA 4YJTA 2C6IA 3VQHA 1MRYA 1NW1A 3AT3A 3CGFA 5E91A 4TTHB 4WNMA 2PMLX 2AYPA 4HPUE 4JIKA 4IW0A 2VWVA 3VUGA 5IEYA 4GK2A 2EXCX 4G2FA 3UVQA 2JIIA 4UYAA 5EKOA 3OROA 5CS6A 4USEA 2ZB1A 4DINA 3ALNA 3FI4A 4RVKA 5CU2A 3CEKA 4IDVA 4PDPA 4FNXA 3TDVA 4AGUA 2YJSA 4C0TA 3SXSA 2ITYA 4APCA 4DT9A 1RQQA 2VD5A 3NUAA 2A0CX 3VS1A 4NM7A 3UOJA 3K2LA 1OBGA 3PXQA 4MXAA 4U8ZA 2OIBA 4ZTHA 3L9LA 3C50A 4X2JA 2G2HA 1VJYA 5AADA 3CCNA 5DR9A 1XH9A 5EOBA 4GMYA 2UVYA 4JR3A 3LQ3A 2CLXA 3KEXA 5AAFA 4V0GA 2IZUA 4ANSA 2OF2A 2C69A 3I6UA 3THBA 3SAYA 4CMOA 2OJ9A 2X2MA 4FV0A 1M14A 3NCZA 4K2RA 5M08A 4Q9SA 3NCGA 4BTKA 2WTKB 2PVRA 5D9HA 3UNZA 3EL8A 4PMPA 4YBKA 3A8WA 3BLRA 3BYVA 3R2BA 1ZYSA 2KULA 2Z7RA 4TW9A 4FIJA 3D94A 3R7UA 3WIKA 3ODYX 5EKNA 3PWYA 1ZOHA 3QYWA 4GK4A 4U80A 5HG9A 4GT3A 4EHVA 4OT6A 4RIWB 4RJ3A 3OCBA 4AUAA 2PL0A 3I1AA 2X4ZA 4L8MA 2YJRA 3AC2A 4MWHA 4M69B 1P14A 2QKRA 1GIJA 4L3LA 3TUCA 1OITA 4C4FA 3OXTA 4EK8A 2F7EE 5GJFA 3TJDA 3QCXA 5I9XA 3GOPA 1XKKA 4GFOA 3PG1A 2PK9A 4IEBA 1V0OA 1OIRA 4DITA 4DLJA 1H1PA 3KK8A 1XWSA 2X39A 5IQEA 4E1ZA 5BVKA 3AMAA 3B2WA 3UDBA 3WYYA 3TUBA 5B2LA 4CEGA 4L01A 4GU6A 4A9UA 3SX9A 4C4HA 1QPEA 4PMMA 4U42A 4NSTA 3ZOSA 4NJDA 1H25A 4DFXE 4L42A 3BHTA 2H9VA 3FMDA 1YOLA 4FICA 5EW9A 3VS3A 2G2IA 1XHAA 5AV1A 3CQEA 3LXNA 4YMJA 4RG0A 4RC2A 2WTVA 4FTRA 4RWJA 3HV5A 4KKHA 3LFFA 4UZHA 5D41A 2HWPA 2IW8A 1M7NA 3WILA 3WZDA 2PY3A 2CGVA 4HYHA 3FSFA 2JKMA 4I93A 4NW5A 4O38A 3RVGA 3ZUVA 4EQMA 2UW6A 5AUWA 3JYAA 2GPHA 4EZ5A 1DS5A 4I6FA 2J51A 1J1CA 4XP3A 4TKSA 1A9UA 5E4HA 1ZWSA 4RVLA 4WNOA 3C0HA 3LLTA 5HIEA 1TKIA 4ANLA 3ZSIA 2PMNX 4I23A 1OM1A 3S00A 4AE9A 4MXXA 4K6ZA 4PP7A 1Q97A 3OG7A 4KAOA 4FEXA 2FH9A 3ORPA 3IW5A 2I1MA 3BHYA 5FEDA 4TN6A 3QRIA 2R9SA 4QMYA 2GS6A 2YZLA 3R2YA 5DT3A 3S95A 5JEBA 2X8IA 4IBMA 4O0SA 3LFCA 2PVMA 1H27A 3EQFA 4FTIA 4TPTA 4AAAA 4CV9A 4EHGA 2PSQA 2R3MA 4FIHA 5L3AA 1DI9A 4FIFA 3T8OA 3U4WA 3K54A 3I4BA 3PY3A 5CVHA 1IAHA 4AT3A 1ZAOA 2Q0NA 1KOBA 3MFRA 4FZAB 2OBJA 4HVIA 3FKNA 4F9BA 5LJJA 3GC7A 4AZWA 4DH8A 3QQGA 3BRBA 3KXHA 4RWLA 1UU9A 1ZYDA 4ONAA 4IZAA 3REPA 5DRDA 3AT2A 3RNIA 2XMYA 2UW8A 5IQFA 4BZOA 4D4YA 3LXPA 4E8AA 3P08A 2WMQA 4D55A 5AP1A 4M14A 1R39A 2FSTX 3SG8A 3LMHA 1XBCA 3UP2A 3CXWA 5I5ZA 4AN3A 4DFYA 1P5EA 3VS5A 3MW1A 3KXXA 2XS0A 3GXLA 3OD6X 4WIHA 5H8EA 3A7HA 3PJCA 3U4UA 5IQHA 4IM0A 5EG3A 3I7CA 5EHYA 3QC4A 3FBVA 1DM2A 5CANA 2X7GA 4O0UA 4FV4A 3NVKI 1UU7A 3NYNA 2VX3A 3IPHA 1GZNA 4ALUA 3VBYA 3K5VA 2R3IA 5CALA 2VAGA 3OY1A 4TT7A 4EHEA 1YXXA 4FIEA 2OK1A 4ZSEA 1O6KA 3LIJA 4FUYA 3TIZA 4B8MA 4JIAA 1BX6A 5JQ8A 3ORTA 4QTCA 2W9FB 3MWUA 3NUSA 4RFMA 2WHBA 5D10A 1YI4A 1NVRA 4USFA 5L2IA 4UEUA 3ZEPA 4JQEA 2HZ0A 2BILB 5TKDA 1G8AA 3KXMA 3EQDA 2IVSA 2XK9A 3Q5IA 4DG2E 4B4LA 4K18A 5CXHA 3W55A 3HA8A 4G31A 3PXZA 4QTDA 4ENYA 1P2AA 2XNOA 2BROA 5BUJA 4TZRA 1OIQA 4XLIA 3QAME 4FSUA 4PTCA 4YC8A 5AUTA 2JFLA 4GCJA 4DA5A 4U43A 2WO6A 5J9ZA 4GVAA 4MF1A 1KE8A 3CQUA 4FA2A 4OLIA 5HD4A 3PIYA 4Y8DA 4MD8E 2BRBA 2QLQA 4EWHA 5HX8A 2GCDA 3EQHA 3L8XA 3HV6A 4F64A 4CG9A 1J3HA 4UWCA 5JSMA 1IA9A 4LV8A 2R3LA 3FKOA 4AF3A 3PWDA 2GTMA 5DGZA 4YLKA 4CFFA 4KINA 5EHLA 2OIDA 4AW1A 3DXQA 4TWNA 2XIXA 3R28A 4DE4A 4TXCA 3BPRA 4YTCA 2X7FA 1YWNA 2IZRA 2C6MA 3DCVA 2VO3A 5BVWA 4YTIA 3ULIA 3A7IA 4O0YA 3QXOA 4YJPA 1L3RE 1TQMA 3QHWA 2VNYA 4FNWA 3W2CA 3ZBXA 4F0GA 3FLQA 3TUDA 5J9YA 4HGEA 4YZDA 5CENA 4HGTA 4A4XA 3EHAA 3Q4CA 3FHRA 3F3UA 3I81A 2PE2A 3BZ3A 5AX9A 5HE2A 5D1JA 1UNGA 5JH6A 5KMOA 5KZIA 4HVHA 3R8UA 5IH6A 1QPCA 5HX6A 3TZ8A 4G3CA 2SRCA 3G5DA 4F0IA 5LVOA 1UWJA 4U44A 3IW7A 2WOUA 3TV4A 4E7WA 5KMKA 3HGKA 4GRBA 4PUZA 3ZO1A 3KULA 3C51A 1Q24A 2ACXA 2QU5A 3K5UA 4IJPA 4YZCA 1PYXA 5BVFA 2GS7A 5IA5A 4O0TA 3EFKA 2BPMA 5TF9A 4DGMA 4M0ZA 5CF8A 2JKOA 4XBUA 4LG4A 3VUDA 5A4EA 3F7WA 4TYEA 1LR4A 4JG7A 4ZSAA 2OU7A 3QUPA 3UTOA 3F3WA 5K3YA 1SVGA 3IO7A 1SZMA 3MSSA 2PPQA 2Z8CA 5DR2A 4QPAA 4ZTNA 2Q0BA 3MS9A 3E5AA 4CMUA 2X4FA 3HKOA 3DAKA 3GEQA 3TWJA 5DH3A 5CXZA 2CGWA 4GH2A 3DKFA 3GQIA 2XJ1A 4X2FA 1OZ1A 2UZTA 3GUBA 3KC3A 3LFBA 3BGZA 3KRRA 4RIXA 4BKJA 5M06A 2WELA 3UNKA 4YJUA 4YP8A 4CZUA 2B54A 5FEQA 2P3GX 3HRBA 4KRDA 1E1XA 4O7WA 3KF7A 3P1AA 4IVAA 4JXFA 4DYMA 3DU8A 2XKDA 4JI9A 4AFJA 4PX6A 3EFWA 4K33A 3DQWA 5L6OA 1V0BA 3AC3A 4O81A 4ASEA 4HCVA 2QR7A 3QQKA 5E90A 1ZZLA 3RINA 3QUDA 4ACGA 3QTRA 5L6WL 2ITZA 2NRUA 4HPTE 3RHKA 4TYJA 3ET7A 5CYIA 3ZO3A 4CLIA 3QL8A 1F3MC 3MFUA 3NIEA 1WBWA 4ARKA 2UVZA 4CSVA 3OW4A 3WYXA 3SOCA 2LGCA 2ITNA 2Y0AA 1WBNA 3FL4A 2CKOA 4FI1A 3P7AA 4B9DA 3FI8A 3OBGA 4MVFA 4NTSA 3VULA 3GENA 3SA0A 5LVNA 2H6DA 3MJ1A 4CTBA 1OL6A 1REJA 4C3PA 3UNJA 1PMUA 1NXKA 5EM7A 3MA6A 2WFYA 5AAGA 3GU7A 4J99A 1H1RA 2C3LA 4JDJA 5E8YA 4ASXA 1UA2A 3MDYA 4KIQA 2C5YA 1QCFA 4IAKA 4B7TA 3FZSA 4F1TA 3W0SA 1ZYCA 2VRXA 2XBAA 4AWIA 2FVDA 3CKXA 4C61A 3R01A 5HBJA 4DEGA 3H30A 1BL7A 5IEXA 4I5HA 3ERKA 2Z02A 4BHZA 2YM3A 3UG2A 5AV4A 3C13A 3DJ7A 3MV5A 4D4VA 2I0VA 4ZSJA 1U54A 5IPJA 2G2FA 4MNFA 2IVVA 5IA3A 4E26A 1J91A 4HJOA 4WBBB 5FRIA 5CAQA 3QWJA 3VC4A 3PSBA 4EOKA 2PZPA 4WUNA 2A2AA 1H8FA 2WEVA 4DGOA 3DKCA 4IAZA 4YNOA 3LCKA 2OO8X 4IDTA 3ZLYA 3DDPA 3PJ2A 4N0SA 3UIUA 1XJDA 4EJNA 5TT7A 1JQHA 1J7UA 1OMWA 5CVGA 2W7XA 1TVOA 2J0MB 4JBQA 3R73A 1X8BA 1WVYA 2XEZA 3PPJA 3SRVB 4GKHA 1SNUA 5I4NA 3EQRA 3KRXA 4XG6A 2X2LA 2R3FA 4EH6A 5HBEA 2PULA 3BCEA 3GNIB 3F5UA 3OCTA 5KUPA 4QMQA 4EKKA 4CD0A 4F4PA 1PJKA 3DBDA 3UC4A 1KWPA 3H9RA 3O8UA 5M07A 3NLBA 4FYNA 3LW0A 3ANQA 2C3IB 5C8MA 2J0IA 4H36A 3E8CA 3Q5ZA 1LEZA 3PIZA 3NEWA 4NTTA 3UODA 2OXDA 1IG1A 1ZMWA 2G15A 3QQHA 5LCJA 2XK4A 4FZ7A 4MKCA 3U51A 3WZJA 5FQDC 3NIZA 3L8PA 4U5JA 5CAPA 1Q3WA 3BHVA 3OCGA 2W5BA 4OW8A 2UV2A 4O0WA 4MD7E 3EH9A 3KMWA 4HGSA 5ANGA 4D1SA 1OUYA 3CY3A 2BAKA 1YHSA 2G01A 3Q04A 4JG6A 3RMFA 4P4CA 3EN5A 5CU6A 5ANOA 2JLDA 5EHOA 1RDQE 3BLQA 4KB8A 3LKMA 5E9EA 4AZVA 4ZS0A 3LFDA 4QP9A 4DH5A 1BL6A 4EQCA 4BVUA 4FV1A 3PA3A 4RX9A 3FYKX 4Y95A 3WZEA 1YDTE 4FNYA 4IACA 3ZLWA 4I6BA 4B99A 3OEFX 5IA4A 3LFNA 4Y46A 1JVPP 4EK5A 4Q5EA 3DNEA 3N4VA 1VZOA 3PP1A 2ITTA 4R3PA 5KO1A 3T3VA 4WA9A 4KBKA 3V51A 3NUUA 2HELA 4MBJA 2W5HA 3FZPA 4RJ7A 3HNGA 5KE0A 3PA5A 4ZP5A 4A9TA 5FXRA 1PXNA 4TWCA 5JN2A 1W82A 3C0IA 4IFCA 5JGDA 3GCSA 3ORNA 4GYGA 2VO0A 2HIWA 1PXIA 3F3ZA 3KK9A 2GFSA 3PVUA 4O7RA 4PL3A 5FBOA 3HV4A 2E9PA 4Q9ZA 3E7VA 4CXAA 1Q41A 4XH6A 4QMNA 5ETAA 4A7CA 5HNGA 4M3QA 3EQPA 5HCZA 3QU0A 4L46A 4BCMA 3UYSA 1UU8A 5DNRA 2ZV2A 1URCA 2UZNA 3AT4A 1CMKE 3L9PA 3N9XA 4UN0C 2R3HA 3QHRA 4BCHA 1K2PA 4C34A 2W4OA 4E6CA 2W06A 3P23A 3Q9ZA 4BIDA 2J5FA 4N6ZA 4O2ZA 4XBRA 5HZNA 2C0OA 2GHLA 2PE0A 2ETMA 5DLSA 5I0BA 4BGGA 2PVJA 2YM4A 4OR5A 3TKIA 3MTLA 4ACDA 4QQTA 1BMKA 5ITAA 2XKEA 3FY2A 3NR9A 1VR2A 1CTPE 2O2UA 2VTOA 2XNGA 2CCIA 4UV0A 3R6XA 4L9IA 5J5SA 5M4CA 1OIYA 3SLSA 3H9OA 5M56A 2V0DA 4Z9LA 3Q4TA 4CG8A 5LOHA 2X2KA 4LYNA 3RK9A 1FVTA 3OBJA 4RWIA 4FZDB 4FEUA 4XOZA 3I0QA 5HBHA 3F69A 4GW8A 4QO9A 1MQBA 3HMOA 1XH7A 3P9JA 3BQRA 3TEIA 3TN8A 5BX0A 2PZIA 3ZC6A 4E93A 4AQCA 1XQZA 2W1EA 2R0IA 2AUHA 1WFCA 2XK6A 2YWPA 2BIYA 3HUBA 3NNXA 2WKMA 3LCTA 1Y57A 2KTYA 4Y5HA 3AC5A 3GT8A 4FV5A 5AP5A 4UWBA 1FBNA 3QZGA 4YJSA 3E7OA 4LL5A 3WZUA 5A6OA 2ITPA 3GFWA 4RQKA 4UY9A 3G6GA 5ICPA 3VUHA 1WBOA 5IQDA 3ZEWA 3F6XA 3BU3A 3AMBA 4BDEA 2GQGA 1QPJA 4ZXTA 5DA3A 3VHEA 4S31A 4UWYA 3ZTXA 4AW5A 1ZARA 2UW5A 4ANQA 5IH5A 1PMVA 4FSYA 3N4TA 5IQCA 1GY3A 3AD5A 3PJ8A 4C4JA 1MP8A 1PMNA 2JGZA 4X3FA 5AA9A 5I9ZA 2X8EA 1UKIA 4MNEB 3W16A 3IDPA 4GS6A 4BRXA 4FT9A 4BF2A 3R9HA 3VS6A 4FV9A 1WMKA 5K5XA 2OFUA 3FI2A 1JKSA 2QOKA 4DG0E 3NNWA 3DK6A 4R7BA 3MGYA 4AOIA 4ZZOA 1Q4LA 1QPDA 1BKXA 3A61A 3JUHA 2WD1A 3ENMA 3EZRA 5HG7A 5A46A 3PPZA 4C36A 4D2SA 4GT4A 4NM3A 3ZM9A 2BTSA 4BDFA 5G6VA 2CKPA 2QI8A 4R7IA 4DF3A 3T9TA 3RAWA 1LP4A 3OT8A 5DR6A 2H8HA 3UIMA 4PNIA 2VTQA 2QO2A 4LL0A 2CNVA 2YCQA 5TO8A 3S4QA 4EBVA 4EOLA 2HK5A 4CT1A 4ZLYA 4F7LA 3C9WA 4GK3A 5A4TA 5IISA 4FTLA 5E8VA 3SHEA 2XNBA 3SXRA 3VAPA 3ZH8A 4A4OA 2UZWE 1G8SA 4CV8A 3LFEA 2W17A 3F82A 1R1WA 3ZS5A 3FMKA 4D4RA 2BZIB 3HZTA 2RF9A 4II5A 2FGIA 3FQHA 4IM2A 5E8TA 4RVMA 5IQBA 4TNDA 2VGOA 3IGGA 3EJ1A 2JD5A 1KV2A 2A27A 2BKZA 5AM6A 3OWKA 4FR4A 4NZWB 3F88A 4AZSA 2YIWA 4M7IA 2XCKA 2X81A 4G34A 3G90X 2FYSA 4ZJVA 4KS7A 1YKRA 3MH2A 2XIKA 4DCAA 1UV5A 3HX4A 4O7ZA 4XRJA 5BYZA 4G5JA 3LQ8A 3FLZA 4IANA 5DIAA 4JR7A 1MRUA 4IHPA 5IUIA 1BYGA 4M13A 3HECA 1PXJA 3NUXA 5T6KA 4RIWA 2DQ7X 5BMMA 4O91A 1NVQA 4ORKA 4YO6A 1AQ1A 2ZM1A 4D28A 3TT0A 4L67A 4RT7A 3ZZEA 3VS4A 4FTQA 3DKGA 4AZEA 3AC8A 4BDIA 3RWQA 4G1WA 1YVJA 3MIYA 1P4OA 5EQEA 1DAWA 4DFNA 2P2HA 3TNWA 2VTSA 2QKWB 3Q9XA 4CFMA 2B9IA 2IN6A 2OG8A 3O71A 2QOLA 3DS6A 4V05A 2HW7A 4B8LA 4QMSA 3JVRA 1OPKA 4I5PA 3R8MA 4EH8A 5L8KA 5CY3A 3QA8A 2WOTA 3POZA 4C4GA 5B2MA 5M09A 4FVQA 3LMGA 4BCNA 3UIXA 2PVLA 2NNWB 4FL1A 4LGHA 4W4YA 4U94A 3ZONA 3O2MA 2AC3A 3G33A 3MFTA 2RFSA 4C58A 3QTUA 4ITIA 3H0YA 3QTQA 1UWHA 2QCSA 3R04A 4NM5A 4M15A 1HOWA 4DBNA 4ZJIA 3S3IA 3VWAA 4FV3A 3W0MA 1URWA 4Y5QA 5KMLA 3CJFA 3DXNA 2W99B 3ORMA 4FBXA 2JDOA 1XH8A 2WMSA 4BCQA 1W98A 5IQIA 4U98A 3I79A 5KCVA 5M44A 1XH6A 4ZSGA 4G3GA 1Y6AA 4I5CA 3D2IA 3D15A 3ZFXA 1VYWA 5DWRA 3Q2MA 1TQPA 4RX5A 3QRTA 4BDBA 4DFUA 1FPUA 2YITA 5ACBC 4OBOA 4E5BA 2NO3A 3NRMA 2ZV7A 5HQ0A 4XX9A 5HG5A 4EC9A 3MI9A 4IVCA 4R77A 5EQYA 3OFMA 5HGIA 4RZWA 4D5HA 4O7PA 3R30A 4PTGA 4TRLA 3M1SA 4IE9A 4AOJA 3NVMB 3DAJA 2HAKA 1ZMUA 3UOLA 4EBWA 2DUVA 5D12A 2WNTA 5LWNA 1KE6A 4QMXA 3OUNB 3K3IA 2GQRA 2XIYA 3HVCA 2Y9QA 4BDHA 1BI8A 4FVPA 2VO6A 4ANBA 1JWHA 5ACKA 3SDJA 3TTJA 1M52A 2E9VA 3C0GA 2YHVA 3RM7A 4DH7A 3E62A 3OVVA 3QX4A 4IH8A 3WF9A 4YTHA 3GOKA 1YXTA 4WG3A 3Q52A 5FP6A 4BBEA 3U9NA 3OCSA 3I6WA 4C33A 3BV3A 4FV2A 5JK3A 4P7EA 4FG9A 2XNMA 3ZO4A 3DZOA 3NW5A 5EYDA 5CEIA 4BN1A 4YC6A 1KUTA 3OW3A 2GNJA 2OXXA 5JFVA 2ZDTA 3C4WA 1O6YA 4UBAA 3C4CA 2WMXA 3UP7A 4YUQA 4E5WA 3DXPA 2OJIA 1BLXA 4FKRA 3ZXTA 2QG5A 4QQJA 3RJCA 4O86A 4CCUA 3FV8A 4FYOA 1H01A 1OPJA 2YIQA 3BELA 4DFZE 4O84A 4NKAA 1OECA 2QOIA 4IX4A 4X3JA 3E93A 2IG7A 1FOTA 4GEOA 5IUGA 2B9JA 4R7HA 3NDMA 4IB1A 3IW6A 4KBCA 4RWKA 2JAVA 4X2KA 4A4LA 2O0UA 1AD5A 2Y8OA 4FSTA 2CNQA 4IQ6A 4EOJA 2BALA 5A14A 2IPXA 4CLJA 2ETKA 4FTTA 5EM5A 1CKPA 2BRHA 4YLLA 1OIUA 4WBOA 4R1VA 4Z3VA 4H39A 2XRUA 4G3DA 4OTRA 3W33A 5JRQA 4O0VA 5C4KA 3UJGA 3NUPA 2F49A 3S2PA 3L9MA 2EWAA 3R63A 4RRVA 2ESMA 2VN9A 3ORIA 4NIFB 5EK7A 2WMTA 5H3QA 3V5PA 1PKDA 3EFLA 2VWUA 3RM6A 3KF4A 2PUPA 4W8DA 2J0JA 4S32A 3W18A 1Q8YA 4QMTA 2V5QA 2V7OA 1L8TA 2BTRA 5E7RA 3AMYA 3ETAA 2CLQA 3BYUA 3PE2A 2C5XA 1JKKA 3OY3A 4MX9A 3SD0A 4ZTRA 2PZYA 5HLWA 3OWPA 4HVGA 5HVKA 3CTJA 5J87A 4RLLA 2G9XA 4MXOA 2O65A 2RIOA 3HMIA 3W1FA 4IWQA 2GNFA 3VW6A 4IZ5A 3A62A 3ACJA 4EYMA 1H26A 1STCE 5K5NA 3D5XA 2BRGA 3FC2A 2HY81 3MFSA 3RAIA 3BBTB 4R1YA 5FG8A 4E4MA 5BVDA 2WAJA 1R78A 4FTKA 3BE2A 5DOSA 3R8LA 4K9YA 5HHWA 1ERKA 2Y4IC 4YJVA 4Y85A 2Z7LA 1OI9A 4IX5A 4QP2A 5EW8A 4XV3A 3PJ1A 4V01A 1OL7A 3MA3A 3VJNA 4BZNA 2JKKA 4FEVA 3EZVA 2HZ4A 4YSJA 3PY1A 1JKTA 1KV1A 4E6DA 4FTUA 5F94A 2XM8A 1PY5A 4G6LA 2BZJA 4I0SA 5EH0A 2O3PA 3QWKA 4S2ZA 5AP3A 3Q2JA 2HOGA 4FKQA 4ZY6A 3AGLA 5M53A 3FJQE 4RLKA 3SKCA 2F7XE 1IAJA 2YCFA 3FZTA 3LAUA 4NJ3A 3PRIA 4QMLA 1H00A 2WU6A 5AMNA 3CLYA 2B4SB 3ROCA 4E4NA 3ZLSA 3TL8A 3KVWA 4OTQA 3DNDA 3UE4A 2ERZE 5FP5A 1PRYA 2YA9A 2UZBA 2YM6A 4KIPA 4AN9A 2HWOA 5IG1A 3AXWA 4FSMA 4D1ZA 4Z7GA 3NNVA 4J8MA 5F20A 2FO0A 2XB7A 5C9CA 3U6JA 4AZFA 2CCHA 5IH4A 4FEQA 4IFGA 4O96A 4YBJA 3NYOA 3WARA 3GCUA 3H4JA 1TQIA 4NUSA 3EL7A 2W1ZA 1JSTA 2ZV8A 3N51A 3IONA 3JS2A 1OGUA 2CDZA 4BTFA 3PLAE 2VTHA 2ONLC 4J1RA 2A19B 2X0GA 3F2NA 4MXCA 3W8LA 5HLNA 2Z60A 2R7BA 3V5JA 4I6HA 4U45A 4ZLZA 4J96A 5B7VA 4OTHA 3CPBA 5GINE 5CASA 3UQCA 3MBLA 1V1KA 4F1OA 3D4QA 3FLNC 4IZ7A 3RAKA 4PDYA 3R1NA 4LRMA 4HYSA 1OBDA 1OUKA 2PUIA 3SQQA 4I4EA 4BIEA 5IU2A 3PZEA 2Y6MA 1OKYA 2C6KA 2BIKB 2NP8A 4RJ6A 3WIGA 4BICA 2YWVA 3DK3A 3FMLA 4O6EA 4WHZA 5IA2A 2RFDA 4O7VA 4JG8A 4RBLA 2R4BA 2ITQA 5CNOA 3BQCA 1W83A 4YNEA 2GFCA 3Q6WA 5HTCA 3TNQB 3EKKA 3DPKA 1VYZA 4O82A 3AQVA 4RVTA 4C37A 4DFBA 4F1MA 2WIPA 3SG9A 2JFMA 3QQJA 5EI6A 4MBIA 2XM9A 2R5TA 5KX8A 3GCPA 3LJ0A 2PVHA 4C7TA 5AP0A 3B8RA 2BR1A 4HVSA 1F0QA 5JRSA 4ENXA 4F9CA 5ANEA 2OZAB 3DBFA 2CN5A 4QP4A 4CFXA 3O8PA 4JQ7A 4QOXA 4J53A 2C30A 2XA4A 5IDNA 4ZOGA 4PQNA 3HDMA 1U5QA 2CMWA 3KFAA 3R8PA 1JNKA 3WOWA 5A6NA 5CEOA 3CPCA 3D0EA 3FAAA 3PXYA 3WE8A 3WF8A 2QOCA 4C35A 4F7JA 4Z7HA 2X7OA 3EQCA 3F2AA 3DV3A 4HW7A 4FVRA 2XUUA 4QMMA 4OTIA 2IO6A 3A4OX 1YRPA 3D7TB 3LE6A 4M97A 4YSMA 3U55A 3FHIA 4EUTA 2BFYA 3W0OA 3F5PA 1CSNA 2PMOX 3EYHA 3KA0A 4I3ZA 3HP5A 4WNPA 2XNNA 4Q2AA 3BHUA 3UIBA 3DB8A 3COHA 5M51A 3HLLA 2VUWA 2OXYA 2WTJA 3FMNA 4XUFA 2QOBA 3SRVA 3O96A 3C5UA 2IZSA 4HYUA 4IWDA 2W1DA 4QPSA 5E1SA 3GU4A 3P7CA 4IB5A 2VO7A 4R5YA 3E88A 3Q96A 3RP9A 4WRSA 5FD2A 1E9HA 4IVDA 3JY9A 5EOLA 1EH4A 1SMHA 3UQGA 1B38A 2IZTA 3FE3A 2QNJA 3R9RA 2YN8A 4NFNA 3MPMA 5EQPA 3RTPA 4A9SA 4EUUA 5BUEA 4IWOA 2GHGA 2Y4PA 3L9NA 4YHJA 1REKA 1T46A 2XYNA 4RFYA 3U54A 4C02A 4EK6A 4LQMA 5BVEA 3TM0A 1RW8A 3UYTA 2I6LA 2JIVA 3KXNA 3QLGA 4F70A 3VW8A 5I9UA 2X1NA 2YIXA 4NL0A 5L2TA 4WZYA 5BUIA 2UZUE 4F0FA 2R3GA 1RJBA 3R22A 4AA0A 4BR3A 2B9HA 4RA4A 4X2GA 4IX6A 3H10A 3JY0A 4XV9A 4YPDA 4RPVA 4TYGA 4R3RA 3KKVA 2QU6A 4X2NA 3D7ZA 4AT4A 3RAHA 4G9RA 4FT0A 5T68A 3TNHA 4MQ1A 4DHFA 5L6PA 4DN5A 2CHLA 2O8YA 3QZFA 4O0RA 5HESA 3TV7A 5DBXA 1XO2B 2QODA 5M4UA 5AA8A 3C4FA 2WQEA 2R3QA 2QOFA 3FSKA 1GIHA 4OGRA 4WO5A 4XYFA 3UC3A 3ZCLA 1M17A 4CKJA 1QL6A 4F6UA 2YIRA 4MHAA 4DGLC 4J8NA 2GU8A 4JBPA 3MY0A 4F9AA 3MPAA 1M2RA 4XHKB 2BCJA 2ITWA 4MAOA 1WBVA 1ZXEA 3MB6A 4BYIA 4FIIA 4BCPA 4I0TA 1MRVA 1YI6A 4E6AA 5EDQA 2IVUA 4TWOA 5EDRA 4FK3A 3PXKA 3Q4UA 3GCQA 3SC1A 5I9YA 3COIA 1K3AA 5CNNA 5FTGA 4MCVA 3PA4A 2X6DA 4UB7A 5C4LA 3FLWA 4JLCA 4JT3A 3V5TA 3SV0A 1NT2A 4K8AA 5DEYA 3CD8A 2W1FA 1GNGA 3H0ZA 5DE2A 2BRMA 2WXVA 2Z7SA 2JBOA 4YHFA 5EFQA 4D2RA 5IEVA 4J7BA 5C8KA 5CF5A 3DB6A 1Q61A 3BE9A 3CTHA 3QGYA 2E9NA 2B52A 1XR1A 5FUTA 3COKA 2OIQA 3G9NA 4ZEGA 4XMOA 2W1HA 3HYHA 3QRJA 3VJOA 4D58A 3P0MA 5CX9A 2E9OA 1J7LA 2UW9A 3PPKA 4HZRA 2VTRA 2VWWA 2A4LA 3OF0A 5FXQA 1I44A 1HCKA 2WGJA 1YHVA 3IOKA 3VBWA 3UPZA 2JDTA 4RJ4A 5CQWA 1APME 3KCFA 3LOKA 3HV7A 2QURA 5BMSA 2PTKA 3JVSA 4H3PA 3KQ7A 3TZ7A 4CT2A 3RZBA 2YCRA 4CRSA 5KKRB 3HAVA 3OOGA 3CR0A 3COMA 3I7BA 5HG8A 3SXFA 2E2BA 4F65A 4BCJA 1YHWA 3OWLA 4X6RA 5HIDA 3F3TA 1S9JA 2VTLA 2BKKA 2X9FA 5KHXA 5M57A 3WF5A 5CU3A 3AD4A 4L3JA 4LOOA 4XV2A 5ANJA 2XEYA 3DLSA 5FLFA 3S1HA 2IW6A 3CD3A 1H28A 2QG7A 2B9FA 3E87A 3DFCB 5CI6A 5HD7A 3C5IA 3R9DA 3UZPA 5B0XA 2C3KA 3FXXA 4D0WA 3FMEA 3E8NA 3MTFA 4NCTA 5JKGA 2BMCA 2OSCA 5EYMA 3R21A 4AACA 4Y83A 3BI6A 3KY2A 1OPLA 4XG2A 3RCDA 3LFSA 3PG3A 3QC9A 4UYNA 4L7SA 5D7AA 1WBSA 3R00A 2ETRA 1PMEA 2PHKA 3DZQA 1OKZA 2IVTA 3GFEA 3HV3A 4ZS4A 1WCCA 5K9IA 3C4XA 5AX3A 1AGWA 3NUNA 3QF9A 3R9NA 2NPQA 2V7AA 4WOVA 4KKEA 3TIYA 4C2VA 3MJ2A 4MNEA 1NA7A 4O7LA 3NYXA 2XIRA 3R7VA 2XK8A 3LFQA 4TWPA 4TYIA 5BYLA 1HCLA 3VRZA 1FGKA 5FTQA 2YIYA 3OC1A 4N57A 4OBPA 1UVRA 4FKPA 3FDNA 4O7NA 3U9CA 3H9FA 3NX8A 5CI7A 5DYJA 1U5RA 4GVJA 3FQEA 5F9EA 5HCYA 1W8CA 3DKOA 4EKLA 5IUHA 5KKRC 3ZRKA 4R78A 3O7LD 3ZUTA 4FMQA 1H07A 2PVNA 5HCXA 2CPKE 2C6DA 2FB8A 2W4JA 5LMAA 5DPVA 2C0TA 4ZMFA 4FOCA 4IAYA 4X21A 4FC0A 1YQJA 4LUDA 5KBRA 2YM8A 3H3CA 4UXQA 5ANDA 3ROYA 4EOIA 3W0RA 3QCYA 4FX3A 3RPYA 1WBPA 5J95A 2OLCA 2R3NA 2VWYA 2XK3A 4IC8A 4LV5A 4P5ZA 4E20A 2F9GA 3Q6UA 5ETIA 3DDQA 2OF4A 3DOGA 4F6WA 4O22A 1R3CA 3IS5A 3OXZA 1GIIA 2ZYBA 3W10A 5CQUA 5CEKA 3HMNA 4W4XA 4H58A 2A1AB 1ZY4A 4LMUA 2YDJA 4RQVA 4AZTA 4PL4A 3CY2A 4NU1A 5EM6A 2WQNA 3GCVA 4ALWA 2BAJA 1M2QA 4BDKA 3W0PA 1JKLA 4PRJA 2FSMX 3KRJA 1U46A 2W1CA 1MQ4A 5F1ZA 4MYGA 5LARA 4FV6A 2VTIA 3QRKA 4D4SA 2EB3A 3UBDA 2ITVA 3FEGA 3MH3A 2REIA 1SM2A 2YAAA 3E64A 4E4XA 3LM5A 1B39A 5E8UA 4J71A 4I22A 3C4EA 2JDRA 4I92A 3QBNA 3VS0A 4RIOA 3IW8A 4FSRA 3RPVA 4TL0A 3K3JA 5L8LA 2FSLX 4BI1A 1JOWB 4EOSA 1E1VA 4WG4A 2W0JA 4LMNA 3SOAA 2C68A 2H34A 4OTFA 5CU4A 5CU0A 3R9OA 4AP7A 4PNKA 4K0YA 5J8IA 3ZO2A 4ZTMA 4G16A 3MIAA 4N6YA 2B7AA 5JFWA 2PVKA 4EH9A 4QYYA 2I7QA 2HW6A 2XCHA 4GT5A 4X6QC 3IGOA 3MH0A 5IMXA 5AV0A 2VZ6A 3OOMA 4ID7A 4DH3A 1B6CB 4L52A 4RGJA 5AUZA 4BCFA 1YOJA 2VGPA 3VRYA 4WRGA 3ZC5A 4AU8A 4QP1A 3CQWA 4HGLA 2R3KA 3B2TA 2YDKA 4E6QA 3VN9A 4EH7A 4FG7A 1ZZ2A 2OICA 4RA5A 2UZLA 2YACA 4C2WA 2OGVA 1PXOA 3QZHA 3RK5A 3ZU7A 3LQ5A 4FTOA 4HCTA 4RIYB 1YXVA 2Y4IB 3IQ7A 4J98A 3U87A 5JT2A 3MPTA 1QMZA 5AIRA 3TDWA 1YWRA 3BWJA 2WMBA 4EJ7A 3Q4ZA 4CGAA 3FMHA 3NUYA 4DEDA 3W0NA 5AP7A 4NH1A 4NW6A 4I5MA 2YM7A 4GUEA 3GC8A 3PP0A 5JMSA 3AC4A 3GU8A 4IM3A 5LWMA 1M7QA 2BFXA 2JBPA 3BV2A 3E3BX 3Q9WA 1H08A 4DTBA 2GNIA 2QOQA 4QMOA 1ND4A 4LI5A 4YZNA 5FDPA 4A9YA 4WSYA 3FL5A 4TNBA 4MK0A 4FE2A 4FNZA 3I5NA 5M55A 5HVJA 2E9UA 4FTCA 3ORXA 1Y8GA 4XEYA 2R2PA 4IMYA 4M12A 2QD9A 4EOOA 3JPVA 3FZRA 2C47A 2QC6A 5F4NA 1G3NA 3R0TA 2PZRA 3F5GA 2B53A 3D83A 2XH5A 5HI2A 5ANKA 3Q53A 2PU8A 4JS8A 4ERKA 4R3CA 5AUXA 5ETFA 1WZYA 2OWBA 2VWIA 3A99A 4YJNA 2J50A 2WMAA 3M2WA 4G17A 3LCDA 3PLSA 5HVYA 4BI0A 3II5A 3VHKA 4BTMA 4ZJJA 4FKWA 3UPXA 4DEIA 4RMZA 4YO4A 3VUIA 2OJJA 2VTAA 5CT7A 2UW0A 4BCKA 1XH5A 3RPOA 3B8QA 3FLYA 4FODA 4EOMA 4PWNA 4EH5A 4OTWA 1O6LA 3PXFA 1KE9A 4MEDA 1IEPA 4FZ6A 4F08A 5BVNA 4GG5A 1YW2A 2BZKB 4YR8A 3BWFA 4Z16A 4HVDA 2R3OA 5D7VA 3EKNA 3QQUA 3TG1A 3NPCA 5KNJA 3F66A 4IJ9A 5IF1A 1UNLA 3R7OA 3CIKA 4H3QA 4U3ZA 3UZTA 5CT0A 1OVEA 3CBLA 4GJ3A 4PMTA 4FSWA 3EMGA 3GVUA 4A9RA 4I0RA 4O21A 5KMJA 2Z7QA 3PVWA 4FK6A 4CKIA 4I41A 4O7OA 3G0EA 3KRLA 3IG7A 4FKJA 4QMWA 3R7EA 5DRBA 4G6NA 4PY1A 4F7SA 3V8WA 4BGHA 3SW7A 4TYHB 2BDFA 4YTFA
chains in the Genus database with same CATH superfamily
5GNKA 4HZSA 5DN3A 5AP4A 5HO7A 5A4CA 1OL2A 3LJ2A 2WMVA 2C6OA 2GHMA 2RL5A 4QRCA 4AX8A 3EB0A 1NY3A 1R0PA 3A2CA 2WMWA 3EQIA 4XG8A 5C1QB 5HTBA 1IR3A 1OKVA 4ITHA 2QO9A 5CF4A 4QYEA 1Z5MA 2CGXA 4IADA 3PIXA 4QDEA 3WF6A 1DI8A 1GOLA 3BLHA 4D9TA 3PZHA 5AM7A 4ACHA 1ST4A 1LEWA 4H1JA 3TACA 3QUEA 4CZTA 2HY0A 4P2KA 3MY5A 3KCKA 4YZBA 2CGUA 4QP8A 5LXMA 3OTVA 4U3YA 3MVLA 2XF0A 3T3UA 4M68A 5JGBA 3RKBA 3EIDA 3ZHPC 4RC3A 2GTNA 3DLZA 3CS9A 3OXIA 4BDGA 5C8NA 2XK7A 4JMQA 4ZSLA 4JRVA 2VTNA 4FKUA 3VBXA 2PE1A 2PZ5A 2AC5A 3BYMA 3QD3A 1BI7A 2UW4A 3QKKA 2YISA 2DYLA 4ALVA 3G0FA 2QOHA 4BCOA 4BDJA 5FM3A 5CAVA 3VIDA 4IB0A 4BTJA 4C62A 4D1XA 1O9UA 3DK7A 4FZFB 4AXDA 4LGGA 3G6HA 5HORA 4DTAA 4F6SA 1PF8A 1G5SA 3V04A 2YEXA 2J5EA 4U81A 4EC8A 3DTCA 3GC0A 2WQMA 1W0XC 4EK3A 2RKUA 2GNHA 4O7YA 4EWQA 3P5KA 4NM0A 1Q8TA 4K11A 5CWZA 3FPMA 5AWMA 4Y73A 4BHNA 4F09A 3QKMA 4EOQA 2WMRA 2EU9A 5BQ0A 5E1EA 2ERKA 3E8EA 2OJFE 2QHNA 1YDSE 2C5NA 4MUQA 2J90A 2HXQA 2GQSA 4ZMEA 3QQLA 2C4GA 4FTJA 4DEBA 2JC6A 4EEVA 4KNBA 5T3QA 3VS2A 3NYVA 4ZK5A 3FLSA 2BDJA 2VTPA 2VTMA 4QYGA 1FVVA 2RG5A 5GIPE 2ZDUA 1OGYA 3A60A 3HRCA 3NZ0A 4ZTQA 4KD1A 2XJ2A 2WTIA 2PVFA 4BDDA 3GC9A 4EZ3A 2GSFA 5HIBA 5AIKA 4JDHA 4IIRA 2J9MA 3V5WA 2ZJWA 3KVXA 2P55A 3IOPA 3ENHA 4GUBA 2ZMDA 4WG5A 5C01A 2O5KA 3A8XA 5H8GA 2LAVA 4C4EA 4DG3E 3OTUA 4PDSA 4YU2A 5KMNA 3R7YA 3ULZA 3BU6A 4IAAA 4NYEA 4L3PA 4QYHA 2UZEA 3C4ZA 2BAQA 5CEMA 3IDCA 5LVMA 3UGCA 3NMUF 4FL2A 5CSXA 3LPBA 4CQEA 2GDOA 3ELJA 4BZDA 4NCTC 4AA4A 5CSPA 3ZSHA 4E5AX 2RFNA 2EXMA 2HCKA 4FTMA 4C3RA 2FUMA 2QONA 2Z2WA 4FT5A 4KS8A 3FY0A 3M42A 1GZKA 3F5XA 3BEGA 3WZKA 4KSPA 4JX3A 3PXRA 5BPYA 2QHMA 1YOMA 1YDRE 3ODZX 4M0YA 5LCKA 4B0GA 2CNUA 1H4LA 5FDXA 3TKUA 3V5QA 4XCUA 3QTIA 2PVYA 4USDA 4JAIA 4V0GB 3ATSA 4FTAA 1MUOA 4O27B 3OZ6A 2OZAA 5IQGA 4QQ5A 4U97A 4H3BA 3W2RA 1PXKA 4AN2A 3G15A 3NGAA 3UO4A 4J97A 2WPAA 2ITUA 5KZ0A 3QD2B 4GKIA 2HZNA 1G8KA 3OS3A 3EQBA 4I21A 2C3JA 5GHVA 2ZM4A 3CP9A 3QGWA 3VF8A 3RHXA 2V62A 3L8SA 3LHJA 2I0EA 4FSZA 4MD9E 4LUEA 4W8EA 1W7HA 2V55A 2RFEA 4XG7A 2P33A 3D7TA 3MVJA 3TCPA 2B1PA 2XKCA 1YI3A 3D5UA 2WMUA 3HMPA 4QMZA 4XV1A 1KE7A 1ZOEA 3FUPA 3O51A 4RFZA 3DBCA 3KRWA 5ETCA 1BUHA 2NRYA 5DEWA 5KHWA 4YPSA 4IAFA 1H1QA 2WQOA 2XIZA 4AW0A 3FZOA 3ZM4A 3VS7A 4EH2A 3TKHA 4FT7A 2QQ7A 2QLUA 5EW3A 5J1WA 1Y8YA 4WUAA 4YC3A 4Z55A 3GBZA 3PSDA 3FZ1A 2JEDA 4I20A 3LLAA 4CTCA 1Q99A 4CFUA 3QTZA 5AUUA 4L68A 1RE8A 4LM5A 1YXSA 4M84A 4JDIA 4BDCA 4B6LA 5E8SA 4XOYA 4KIOA 2QO7A 4GV1A 5FTOA 2XAOA 3BIZA 3G51A 2J2IB 4XRLA 4GIIA 2B55A 4QNYA 3Q3BA 3R83A 4KWPA 4A07A 2JKQA 2UW7A 4ZLOA 5EYCA 3LCOA 3BYOA 3Q32A 3HMMA 3JR1A 4QTAA 1M2PA 1ZMVA 4H05A 3G9LX 4K1BA 3R8VA 4ANMA 2UVXA 4R6VA 2J7TA 2WIHA 2H96A 5E92A 3RALA 2C6TA 1H24A 4R5SA 4LRKA 3TTIA 4M67A 4BY9E 1J7IA 1JBPE 2WB8A 3I60A 5AP2A 5L8JA 4D5KA 3EOCA 3ZZWA 5BYYA 3VONA 1DAYA 4PDOA 4QP7A 5HE3A 1SNXA 3ZLXA 3BU5A 4FEWA 3QRUA 4L44A 3EFJA 3DQXA 3F7ZA 5B2KA 4L6QA 1JSVA 5M4FA 3W2SA 1IRKA 3HEGA 3O0GA 4JDKA 4S34A 4ZY5A 3VBQA 5EI8A 5CEPA 3MESA 4QQCA 4DCEA 3AD6A 5DT4A 5GJGA 3ANRA 4X3FC 2W4KA 3VUMA 3O8TA 3P4KA 1FQ1B 4U9AA 4KKGA 4AQKA 4BB4A 1W84A 4I6QA 3W2PA 4DGNA 3KL8A 4HYIA 4EORA 5E8ZA 1U59A 3D9VA 4YGAA 2C1AA 1UU3A 3TV6A 1V0PA 3UVRA 3UMXA 3V6RA 2C5VA 2ZM3A 3F2RA 4XG4A 1UNHA 2XALA 4AXEA 5A4QA 3NFGB 3UO6A 4ZTLA 5KMIA 3PJ3A 1WAKA 4RJ5A 4EYJA 5M4IA 3R1YA 4AXAA 3EN7A 3DBQA 4AW2A 4DEAA 3R02A 3LFAA 3LJ1A 3IECA 4NFMA 2X9EA 5FM2A 3UOHA 5IA0A 5GIOE 4FV8A 2OZOA 3GGFA 4YLJA 3VBTA 1Y91A 4BCGA 3I0OA 2UZDA 4QMUA 3PSCA 5HU3A 1IASA 2OI4X 4FKSA 2Y7JA 3O17A 4ZAUA 3QCSA 4NWMA 1JPAA 3TXOA 3FYJX 4H1MA 3D14A 3NS9A 3QD4A 4EH4A 4FSNA 3MN3A 2EB2A 3LXLA 2QOOA 1Q5KA 2YABA 5AV2A 4O7TA 2XNPA 3GQLA 5EM8A 3ZFYA 3ZRLA 4LOQA 4GG7A 3P78A 5LMKA 1H0WA 4TY1A 3CKWA 4OBQA 3RK7A 2ZAZA 4BYJA 2YFXA 4S30A 2BVAA 4PV0A 3KB7A 3PYYA 2XNEA 3NSZA 4NKSA 2ITOA 2F4JA 2HENA 3M11A 2WTKC 3PDTA 1PW2A 4F7NA 4F9WA 2XVDA 3A4PA 4P5QA 3ZBFA 2WTWA 1WVXA 3BYSA 1JAMA 3QTXA 5H8BA 2VWZA 5CAOA 3DJ6A 3LVPA 4WT6A 5DFPA 3MYGA 4IC7A 4AXCA 1ZLTA 4C59A 4G6OA 5IDPA 4HNFA 4ACCA 2IW9A 5A9UA 2RGPA 3L1SA 3RWPA 2XYUA 3MY1A 4BIBA 3PVGA 4KABA 4A06A 3O23A 2XKFA 4O83A 4QNAA 5AEPA 2F2CB 4KBAA 2J6MA 2YDIA 3MB7A 5K4JA 5LVLA 4FJVA 4FT3A 1CM8A 2C0IA 2WTDA 3DA6A 3BBWA 4YZ9A 2BZHB 3EYGA 4JL9A 4AFEA 1CKJA 4AGWA 2W5AA 4GFMA 4IVBA 3FI3A 4YJOA 4GL9A 5HE0A 2VTTA 1F5QA 4O6LA 4FTNA 3PY0A 3ALOA 1CDKA 1SYKA 3HDNA 3ZUUA 4BBMA 2YCSA 3TNPC 3D2KA 3PVBA 2ZV9A 4HCUA 4NK9A 3CTQA 4W4WA 5CSHA 4DTKA 4DEEA 2CJMA 4UX9A 3AGMA 3JXWA 2HXLA 5EYKA 1JSUA 1CKIA 3C7QA 3HP2A 2R3JA 4G9CA 4GJ2A 4RZVA 4EL9A 4FKIA 1FMOE 3Q9YA 2VX1A 3EN6A 4AGDA 3V8TA 3HAMA 1SVHA 4IB3A 4O2PA 2PYWA 4P90A 2QVSE 1UKHA 2O63A 5CSWA 3ZSGA 5HU9A 3FMJA 3FWQA 3EN4A 3KREA 4PL5A 4AG8A 1J1BA 5TR6A 4ZZMA 4E73A 1H1SA 4C3FA 1FGIA 4OTDA 3ACKA 4XP0A 4CFNA 4D9UA 2VWXA 5J9LA 3CC6A 3BL7A 2YAKA 2I40A 4FKTA 5IA1A 5CLPA 5CF6A 4QTEA 1XMMA 5CTPA 3ZDIA 4N70A 1WBTA 1YXUA 4RJ8A 1XH4A 3W0QA 4FV7A 2G1TA 5HE1A 1GJOA 1A48A 3P86A 1Q8UA 4JRNA 2W1IA 3FXZA 2IJMA 1PXLA 2JAMA 3QA0A 3TI1A 2R7IA 2NYAA 4PMSA 3NW6A 3QZIA 2GS2A 3KULB 5DVRA 2CKQA 4BBFA 5C27A 3KGAA 4L7FA 4EOPA 2ZVAA 5JQ5A 4DT8A 4AE6A 5HO8A 2OW3A 5E8XA 4AT5A 4L53A 4WKQA 3GU6A 3QFVA 2BUJA 4FKLA 3BEAA 2ITXA 4EK4A 4F9YA 3E92A 4EONA 2P2IA 5C26A 3F9NA 3UG1A 5HNBA 3PUPA 4M8TA 4UXLA 3W2OA 3QCQA 3QTWA 4ZIMA 5KBQA 4OT5A 3UMWA 3ITZA 3P79A 3PTGA 3SGCA 3DGKA 5CZIA 1XBAA 2JDVA 2I0YA 4CFVA 5FGKA 3OUKA 2YERA 5L2WA 3FC1X 4JAJA 5GJDA 1Q8WA 5CEQA 3RNYA 3AG9A 3HRFA 4RIXB 2F7ZE 5AUVA 3KU2A 4YJRA 5JGAA 3NAYA 4BI2A 4QYFA 3AKLA 4DHIB 3OEZA 2BHEA 4GYIA 4O7SA 5AP6A 3WE4A 4O0XA 2C5OA 3GI3A 1FMKA 4DDIA 2QR8A 3EQGA 3KN5A 5TOZA 2F2UA 4JJRA 2BRNA 3LCSA 5IZFA 4JBOA 2JITA 1KOAA 2C6LA 4D0XA 5C03A 3RCJA 4BGQA 1WVWA 5FBNC 3GB2A 3KMMA 3L8VA 3DAEA 3UVPA 3U6HA 3TJCA 3ID6C 3LZBA 4G5PA 3SVVA 2XZSA 4W4VA 3IDBA 1LUFA 4C4IA 2XP2A 3TZ9A 4JVGA 2X8DA 1R0EA 1ZOGA 2O64A 3A7GA 3IK3A 1YWVA 3LXKA 3QYZA 3CJGA 4I4FA 3P7BA 3QD0A 1ZYJA 3CE3A 4LOPA 2VTJA 3FKLA 4ZTSA 4UALA 1VEBA 1A06A 3E63A 1K9AA 1S9IA 4XLVA 2GNGA 3HUCA 4MWIA 1PXMA 3BLAA 1OKWA 4FG8A 4JX7A 4N4SA 5HNIX 2PMIA 3VF9A 5A54A 4KUJA 3NWWA 4U79A 4QMPA 5I9WA 2W96B 2EUFB 4CRLA 3ZFMA 4FUXA 2UUEA 2VU3A 2CSNA 2V22A 2B0QA 4IAIA 2CKEA 2W9ZB 2C1BA 5ANIA 5FXSA 2DS1A 4J52A 4EQUA 3NFFB 5H2UA 4QP6A 2WEIA 3SW4A 2W1GA 4XNEA 3RPRA 4FKVA 4HNIA 4RIYA 4XS2A 1U54B 2HZIA 3R7IA 3WBLA 5FEEA 4GSBA 3OP5A 4FKGA 3T9IA 4DH1A 3AC1A 2J0LA 3DBEA 3OHTA 2JIUA 4MTAA 3EWHA 4L43A 3QKLA 1H1WA 4ASZA 3ZMMA 3EN9A 3FPQA 3VQUA 4FL3A 5JFXA 2VNWA 4QMVA 4DEHA 4X0MA 5EDPA 1P4FA 5CVFA 1ZRZA 3DT1A 4AGCA 3ZDUA 2ZFYA 4FIGA 3RI1A 2F57A 5HLPA 4DBXA 4RSSA 4KRCA 3O7LB 1GAGA 3FMMA 3OWJA 4U7ZA 3R8ZA 3O50A 3PE1A 2W05A 4U6RA 3BHHA 5I9VA 3R1QA 4XP2A 4Y72A 3NW7A 3V01A 4L45A 5BNJA 2Q83A 3N4UA 4DC2A 3KN6A 2OJGA 3VBVA 4ITJA 4YHTA 4DAWA 2R3PA 4I1ZA 5J7HA 1OL5A 4WD5A 5CAUA 4JQ8A 2ZB0A 3F61A 4FKOA 2J4ZA 4JOAA 5E8WA 5HEZA 3TYKA 2ONLA 4Q5HA 3S0OA 5JZNA 3V3VA 1Q3DA 3W8QA 4YURA 2BDWA 3DY7A 5DI1A 2JDSA 2UZOA 4LRJA 4CCBA 5A3XA 4EI4A 2P4IA 4J95A 3BX5A 2R0UA 4EHZA 3ZYAA 4AOTA 5LMBA 3I5ZA 1I09A 4MXYA 4MH7A 5LVPA 1JLUE 1Z9XA 2PUNA 2RG6A 3ORLA 3VUKA 5AJQA 3CGOA 2PWLA 2GMXA 3ORZA 4ASDA 3FQSA 4PP9A 3W2QA 3F3VA 5EI2A 1OL1A 2VX0A 3NAXA 5LQFA 3GP0A 4RX8A 4C38A 5IMEA 4DLIA 4G3FA 2WQBA 4EZ7A 5JFSA 3BGPA 4L00A 3UDZA 2X6EA 5G1XA 4EH3A 5IQAA 5KMMA 3R1SA 4ZY4A 4YZMA 1IA8A 1Y6BA 2OH0E 2OKRA 2XRWA 3VVHA 5AAEA 4QT1A 3UO5A 4TYHA 4E4LA 2OFVA 5JZJA 4F63A 1SVEA 5DG5A 3DJ5A 4ERWA 3POOA 4AS0A 4QTBA 2P0CA 1ZY5A 4NT4A 3ORKA 4GU9A 3MH1A 4FGRA 1PHKA 4G3EA 3ZXZA 3HL7A 3HA6A 4CVAA 3PRFA 2VV9A 5K4IA 1PKGA 4I94A 5AFVA 3CSVA 4QP3A 2FSOX 5DHJA 4IWPA 4CFWA 2ZMCA 2HYYA 4I24A 2EVAA 3U6IA 1LPUA 4PF4A 4MXZA 2DWBA 3QALE 4CMTA 2WU7A 4AA5A 4S33A 3E3PA 4WNKA 2YM5A 1T45A 3IKAA 3QLFA 3QX2A 2YZAA 5D11A 3DFAA 4BC6A 2WTCA 4YJQA 2J0KA 2XBJA 5H9BA 3A7JA 3C1XA 3GU5A 3PFQA 3UOKA 3E8DA 2R64A 4FOBA 1XBBA 1NVSA 3U8WA 4DFLA 1H0VA 1PXPA 4RC4A 3RPSA 3WI6A 2BHHA 2WZJA 4XG9A 3ZRMA 4JBVA 3DTWA 3BKBA 4RX7A 3MVMA 3KXGA 2I0HA 3IW4A 2R3RA 3KXZA 4MBLA 4V04A 1KE5A 1PYEA 3D5VA 3KMUA 3LM0A 2IWIA 2GNLA 4OTGA 4UZDA 4ACMA 3WF7A 4DHJA 4MQ2A 4FGBA 4ZZNA 4CNHA 5HKMA 3A7FA 5CSVA 1FVRA 3BGQA 3AOXA 3UZRA 4F99A 4DGGA 4HOKA 4KSQA 3VO3A 4APPA 2C6EA 3TZMA 4DHZA 2ZOQA 5DT0A 3VNTA 4OUCA 5BVOA 1KSWA 3QTSA 3R71A 2UZVA 2CN8A 4LFIA 3V6SA 1GZ8A 4BCIA 2Y6OA 3QXPA 5LMKC 4IX3A 4JNWA 3UQFA 3LMIA 1FINA 4XJ0A 1Z57A 3D5WA 3FXWA 1ATPE 1OB3A 5AV3A 4PTEA 3ATTA 4XG3A 4FSQA 5F95A 1GZOA 5CZHA 3MVHA 3Q60A 3V5LA 5L2SA 1Q62A 2UW3A 3NNUA 4U0IA 5HICA 3G2FA 1U4DA 3PUFC 4GIHA 5J1VA 4U40A 4X3FB 3W32A 4KA3A 1Q8ZA 4CKRA 4IZYA 3OT3A 5AUYA 3QQFA 2FA2A 2OH4A 3RGFA 4X7QA 4K77A 3TNIA 4U41A 5A4LA 3OMVA 2XJ0A 4BDAA 3V8SA 2PUUA 2VWBA 4GFGA 4YJTA 2C6IA 3VQHA 1MRYA 1NW1A 3AT3A 3CGFA 5E91A 4TTHB 4WNMA 2PMLX 2AYPA 4HPUE 4JIKA 4IW0A 2VWVA 3VUGA 5IEYA 4GK2A 2EXCX 4G2FA 3UVQA 3PFYA 2JIIA 4UYAA 5EKOA 3OROA 5CS6A 4USEA 2ZB1A 4DINA 3ALNA 3FI4A 4RVKA 5CU2A 3CEKA 4IDVA 4PDPA 4FNXA 3TDVA 4AGUA 2YJSA 4C0TA 3SXSA 2ITYA 4APCA 4DT9A 1RQQA 2VD5A 3NUAA 2A0CX 3VS1A 4NM7A 3UOJA 3K2LA 1OBGA 3PXQA 4MXAA 4U8ZA 2OIBA 4ZTHA 3L9LA 3C50A 4X2JA 2G2HA 1VJYA 5AADA 3CCNA 5DR9A 1XH9A 5EOBA 4GMYA 2UVYA 4JR3A 3LQ3A 2CLXA 3KEXA 5AAFA 4V0GA 2IZUA 4ANSA 2OF2A 2C69A 3I6UA 3THBA 3SAYA 4CMOA 2OJ9A 2X2MA 4FV0A 1M14A 3NCZA 4K2RA 5M08A 4Q9SA 3NCGA 4BTKA 2WTKB 2PVRA 5D9HA 3UNZA 3EL8A 4PMPA 4YBKA 3A8WA 3BLRA 3BYVA 3R2BA 1ZYSA 2KULA 2Z7RA 4TW9A 4FIJA 3D94A 3R7UA 3WIKA 3ODYX 5EKNA 3PWYA 1ZOHA 3QYWA 4GK4A 4U80A 5HG9A 4GT3A 4EHVA 4OT6A 4RIWB 4RJ3A 3OCBA 4AUAA 2PL0A 3I1AA 2X4ZA 4L8MA 2YJRA 3AC2A 4MWHA 4M69B 1P14A 2QKRA 1GIJA 4L3LA 3TUCA 1OITA 4C4FA 3OXTA 4EK8A 2F7EE 5GJFA 3TJDA 3QCXA 5I9XA 3GOPA 1XKKA 4GFOA 3PG1A 2PK9A 4IEBA 1V0OA 1OIRA 4DITA 4DLJA 1H1PA 3KK8A 1XWSA 2X39A 5IQEA 4E1ZA 5BVKA 3AMAA 3B2WA 3UDBA 3WYYA 3TUBA 5B2LA 4CEGA 4L01A 4GU6A 4A9UA 3SX9A 4C4HA 1QPEA 4PMMA 4U42A 4NSTA 3ZOSA 4NJDA 1H25A 4DFXE 4L42A 3BHTA 2H9VA 3FMDA 1YOLA 4FICA 5EW9A 3VS3A 2G2IA 1XHAA 5AV1A 3CQEA 3LXNA 4YMJA 4RG0A 4RC2A 2WTVA 4FTRA 4RWJA 3HV5A 4KKHA 3LFFA 4UZHA 5D41A 2HWPA 2IW8A 1M7NA 3WILA 3WZDA 2PY3A 2CGVA 4HYHA 3FSFA 2JKMA 4I93A 4NW5A 4O38A 3RVGA 3ZUVA 4EQMA 2UW6A 5AUWA 3JYAA 2GPHA 4EZ5A 1DS5A 4I6FA 2J51A 1J1CA 4XP3A 4TKSA 1A9UA 5E4HA 1ZWSA 4RVLA 4WNOA 3C0HA 3LLTA 5HIEA 1TKIA 4ANLA 3ZSIA 2PMNX 4I23A 1OM1A 3S00A 4AE9A 4MXXA 4K6ZA 4PP7A 1Q97A 3OG7A 4KAOA 4FEXA 2FH9A 3ORPA 3IW5A 2I1MA 3BHYA 5FEDA 4TN6A 3QRIA 2R9SA 4QMYA 2GS6A 2YZLA 3R2YA 5DT3A 3S95A 5JEBA 2X8IA 4IBMA 4O0SA 3LFCA 2PVMA 1H27A 3EQFA 4FTIA 4TPTA 4AAAA 4CV9A 4EHGA 2PSQA 2R3MA 4FIHA 5L3AA 1DI9A 4FIFA 3T8OA 3U4WA 3K54A 3I4BA 3PY3A 5CVHA 1IAHA 4AT3A 1ZAOA 2Q0NA 1KOBA 3MFRA 4FZAB 2OBJA 4HVIA 3FKNA 4F9BA 5LJJA 3GC7A 4AZWA 4DH8A 3QQGA 3BRBA 3KXHA 4RWLA 1UU9A 1ZYDA 4ONAA 4IZAA 3REPA 5DRDA 3AT2A 3RNIA 2XMYA 3O5AA 2UW8A 5IQFA 4BZOA 4D4YA 3LXPA 4E8AA 3P08A 2WMQA 4D55A 5AP1A 4M14A 1R39A 2FSTX 2AEGA 3SG8A 3LMHA 1XBCA 3UP2A 3CXWA 5I5ZA 4AN3A 4DFYA 1P5EA 3VS5A 3MW1A 3KXXA 2XS0A 3GXLA 3OD6X 4WIHA 5H8EA 3A7HA 3PJCA 3U4UA 5IQHA 4IM0A 5EG3A 3I7CA 5EHYA 3QC4A 3FBVA 1DM2A 5CANA 2X7GA 4O0UA 4FV4A 3NVKI 1UU7A 3NYNA 2VX3A 3IPHA 1GZNA 4ALUA 3VBYA 3K5VA 2R3IA 5CALA 2VAGA 3OY1A 4TT7A 4EHEA 1YXXA 4FIEA 2OK1A 4ZSEA 1O6KA 3LIJA 4FUYA 3TIZA 4B8MA 4JIAA 1BX6A 5JQ8A 3ORTA 4QTCA 2W9FB 3MWUA 3NUSA 4RFMA 2WHBA 5D10A 1YI4A 1NVRA 4USFA 5L2IA 4UEUA 3ZEPA 4JQEA 2HZ0A 2BILB 5TKDA 1G8AA 3KXMA 3EQDA 2IVSA 2XK9A 3Q5IA 4DG2E 4B4LA 3P5JC 4K18A 5CXHA 3W55A 3HA8A 4G31A 3PXZA 4QTDA 4ENYA 1P2AA 2XNOA 2BROA 5BUJA 4TZRA 1OIQA 4XLIA 3QAME 4FSUA 4PTCA 4YC8A 5AUTA 2JFLA 4GCJA 4DA5A 4U43A 2WO6A 5J9ZA 4GVAA 4MF1A 1KE8A 3CQUA 4FA2A 4OLIA 5HD4A 3PIYA 4Y8DA 4MD8E 2BRBA 2QLQA 4EWHA 5HX8A 2GCDA 3EQHA 3L8XA 3HV6A 4F64A 4CG9A 1J3HA 4UWCA 5JSMA 1IA9A 4LV8A 2R3LA 3FKOA 4AF3A 3PWDA 2GTMA 5DGZA 4YLKA 4CFFA 4KINA 5EHLA 2OIDA 4AW1A 3DXQA 4TWNA 2XIXA 3R28A 4DE4A 4TXCA 3BPRA 4YTCA 2X7FA 1YWNA 2IZRA 2C6MA 3DCVA 2VO3A 5BVWA 4YTIA 3ULIA 3A7IA 4O0YA 3QXOA 4YJPA 1L3RE 1TQMA 3QHWA 2VNYA 4FNWA 3W2CA 3ZBXA 4F0GA 3FLQA 3TUDA 5J9YA 4HGEA 4YZDA 5CENA 4HGTA 4A4XA 3EHAA 3Q4CA 3FHRA 3UDSA 3F3UA 3I81A 2PE2A 3BZ3A 5AX9A 5HE2A 5D1JA 1UNGA 5JH6A 5KMOA 5KZIA 4HVHA 3R8UA 5IH6A 1QPCA 5HX6A 3TZ8A 4G3CA 2SRCA 3G5DA 4F0IA 5LVOA 1UWJA 4U44A 3IW7A 2WOUA 3TV4A 4E7WA 5KMKA 3HGKA 4GRBA 4PUZA 3ZO1A 3KULA 3C51A 1Q24A 2ACXA 2QU5A 3K5UA 4IJPA 4YZCA 1PYXA 5BVFA 2GS7A 5IA5A 4O0TA 3EFKA 2BPMA 5TF9A 4DGMA 4M0ZA 5CF8A 2JKOA 4XBUA 4LG4A 3VUDA 5A4EA 3F7WA 4TYEA 1LR4A 4JG7A 4ZSAA 2OU7A 3QUPA 3UTOA 3F3WA 5K3YA 1SVGA 3IO7A 1SZMA 3MSSA 2PPQA 2Z8CA 5DR2A 4QPAA 4ZTNA 2Q0BA 3MS9A 3E5AA 4CMUA 2X4FA 3HKOA 3DAKA 3GEQA 4LDTA 5DH3A 3TWJA 5CXZA 2CGWA 4GH2A 3DKFA 3GQIA 2XJ1A 4X2FA 1OZ1A 2UZTA 3GUBA 3KC3A 3LFBA 3BGZA 3KRRA 4RIXA 4BKJA 5M06A 2WELA 3UNKA 4YJUA 4YP8A 4CZUA 2B54A 5FEQA 2P3GX 3HRBA 4KRDA 1E1XA 4O7WA 3KF7A 3P1AA 4IVAA 4JXFA 4DYMA 3AKJA 3DU8A 2XKDA 4JI9A 4AFJA 4PX6A 5BV3A 3EFWA 4K33A 3DQWA 5L6OA 1V0BA 3AC3A 4O81A 4ASEA 4HCVA 2QR7A 3QQKA 5E90A 1ZZLA 3RINA 3QUDA 4ACGA 3QTRA 5L6WL 2ITZA 2NRUA 4HPTE 3RHKA 4TYJA 3ET7A 5CYIA 3ZO3A 4CLIA 3QL8A 1F3MC 3MFUA 3NIEA 1WBWA 4ARKA 2UVZA 4CSVA 3OW4A 3WYXA 3SOCA 2LGCA 2ITNA 2Y0AA 1WBNA 3FL4A 2CKOA 4FI1A 1G8JA 3P7AA 4B9DA 3FI8A 3OBGA 4MVFA 4NTSA 3VULA 3GENA 3SA0A 5LVNA 2H6DA 3MJ1A 4CTBA 1OL6A 1REJA 4C3PA 3UNJA 1PMUA 1NXKA 5EM7A 3MA6A 2WFYA 5AAGA 3GU7A 4J99A 1H1RA 2C3LA 4JDJA 5E8YA 4ASXA 1UA2A 3MDYA 4KIQA 2C5YA 1QCFA 4IAKA 3W0SA 3FZSA 4B7TA 4F1TA 1ZYCA 2VRXA 2XBAA 4AWIA 2FVDA 3CKXA 4C61A 3R01A 5HBJA 4DEGA 3H30A 1BL7A 5IEXA 4I5HA 3ERKA 2Z02A 4BHZA 2YM3A 3UG2A 5AV4A 3C13A 3DJ7A 3MV5A 4D4VA 2I0VA 4ZSJA 1U54A 5IPJA 2G2FA 4MNFA 2IVVA 5IA3A 4E26A 1J91A 4HJOA 4WBBB 5FRIA 5CAQA 3QWJA 3VC4A 3PSBA 4EOKA 2PZPA 4I6LA 4WUNA 2A2AA 1H8FA 2WEVA 4DGOA 3DKCA 4IAZA 4YNOA 3LCKA 2OO8X 4IDTA 3ZLYA 3DDPA 3PJ2A 4N0SA 3UIUA 1XJDA 4EJNA 5TT7A 1JQHA 1J7UA 1OMWA 5CVGA 2W7XA 1TVOA 2J0MB 4JBQA 3R73A 1X8BA 1WVYA 2XEZA 3PPJA 3SRVB 4GKHA 1SNUA 5I4NA 3EQRA 3KRXA 4XG6A 2X2LA 2R3FA 4EH6A 5HBEA 2PULA 3BCEA 3GNIB 3F5UA 3OCTA 5KUPA 4QMQA 4EKKA 4CD0A 4F4PA 1PJKA 3DBDA 3UC4A 1KWPA 3H9RA 3O8UA 5M07A 3NLBA 4FYNA 3LW0A 3ANQA 2C3IB 5C8MA 2J0IA