4FEUA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor anthrapyrazolone sp600125
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
253
Chain Sequence
LDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 74
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4feuA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4feuA02
3MN3A 3SXRA 3H30A 3Q9WA 1G3NA 4DYMA 2WMAA 1PHKA 3QCYA 2GS7A 5KMIA 4KKEA 3AC2A 3DK3A 2OZAB 2CPKE 2C30A 2WQOA 3OEZA 4UB7A 3LLTA 4V01A 4BCNA 3H0ZA 3LQ5A 4M0YA 3D9VA 3EFLA 5FP5A 4OW8A 1MP8A 3FJQE 4IAYA 5ACKA 2F4JA 3UE4A 3MH1A 2UZDA 2CGUA 1BI8A 4KRCA 4TYIA 5HVYA 4IHPA 2QHMA 3G9NA 3CGFA 3V3VA 3OUNB 1JSUA 3RPSA 5KNJA 2GHMA 4BI1A 3R8LA 4I0TA 3EJ1A 4ARKA 5CI7A 3OROA 2VTQA 4U81A 2LGCA 2J90A 4RA4A 4YLJA 3FKLA 2QLUA 5ANDA 4ASDA 4C4EA 3MI9A 5JH6A 2YCRA 1UNHA 3DXNA 3VBQA 1GZOA 4RPVA 5KCVA 3W33A 5DE2A 3MWUA 3GC7A 2BMCA 2ITUA 3ERKA 3PJCA 4IJPA 1LR4A 4G3FA 1GIHA 3DKFA 4AE9A 1T45A 4RVLA 4FL1A 4BIEA 4Y73A 3E8CA 5BVNA 2IZSA 3DU8A 5IZFA 1V0PA 4L42A 3JUHA 3U6IA 2CNVA 5IQCA 1NVRA 2AYPA 2NO3A 4D4RA 2UW0A 2YDJA 2C3IB 4H3PA 4A4XA 1IR3A 4AA0A 5AP5A 5IQBA 4GFMA 4QQTA 5F9EA 2I0EA 3Q53A 4L67A 2NRUA 2PVHA 3DJ7A 2P0CA 4A9SA 4GVAA 4DHFA 3AD6A 2B7AA 3G5DA 3DKCA 5CVHA 4FEVA 1CSNA 4PUZA 3REPA 4CZUA 5D1JA 4PMSA 3IG7A 4IIRA 4XLVA 4EZ7A 3COIA 3KN5A 4KAOA 4FV5A 5FGKA 4AN9A 5IUGA 4E4XA 3W18A 5KE0A 3E62A 3F3VA 3VVHA 4BDCA 2JC6A 2YCSA 3QA8A 3QQHA 3F61A 5J1WA 2R3GA 1JPAA 3K2LA 1ZY4A 2QLQA 4Z55A 2RIOA 2ZM4A 3BGZA 3CJGA 5EI2A 5K4IA 2GDOA 1Q97A 4CFMA 2WMXA 1ZYSA 2WTKC 3N51A 5D12A 2BTSA 3UC4A 1IASA 4FUYA 3OEFX 3EL7A 3R0TA 4NCTC 2YIWA 4QYEA 4F7NA 4IZAA 1WBWA 4ZEGA 4BVUA 4BYJA 1NW1A 2IPXA 4KIQA 4RX9A 3FYKX 3RNIA 3RGFA 4CG9A 4YJVA 2HWOA 2BRBA 1H24A 2JKOA 4GL9A 4JDHA 5GNKA 4FGRA 5HE3A 3TI1A 3HA6A 4NUSA 5CX9A 3ZLYA 3TUCA 3R1QA 3R9DA 3EB0A 3UZTA 3LCOA 1B6CB 4U7ZA 3QXOA 2CKQA 4MBJA 4QQ5A 3KULA 4W4VA 4TYEA 3UIXA 2VU3A 1R1WA 1FGIA 4M97A 4UEUA 3QX2A 4R3CA 4IANA 2YACA 3UNJA 3UIBA 2PMIA 2HY81 2PHKA 2BILB 2G2IA 2RFDA 5M4FA 2XJ2A 1J1CA 4I1ZA 4O7OA 5C26A 2J5EA 4ZSJA 4PRJA 4OUCA 4M68A 1Y6BA 1KV2A 4M12A 4N6YA 3I5ZA 4OTIA 2Z7SA 3VBYA 3BHUA 3UIUA 3F2RA 1FVVA 4I4FA 4FEQA 2UW7A 1IA8A 5GINE 3OC1A 4FV1A 4E26A 4EK8A 2YJRA 2GNHA 4BTFA 1YXXA 5HIEA 3LMIA 5HZNA 1BLXA 2IW9A 3RAHA 4A9UA 4DBXA 1ZWSA 5H9BA 5C8NA 3GT8A 4C62A 2GSFA 3R6XA 4FTNA 4IZ5A 5AV0A 4Q9ZA 5IQFA 4FSQA 3FLQA 2G01A 3G2FA 5AX3A 3EYGA 1X8BA 4QP1A 2XNNA 4QMOA 1LEWA 2VO3A 4EH6A 1KSWA 3GOPA 3ZEWA 2IZRA 5D9HA 2ZAZA 2W1ZA 4EBWA 2V5QA 2QODA 2BZKB 2QOKA 3BU5A 4HZSA 2ZDTA 4IB3A 3LE6A 4GYIA 4QMLA 5EQEA 4BGQA 2BAKA 4D5KA 5HVKA 3HAVA 3T9IA 2E9PA 2HYYA 4D0WA 4FV3A 4JVGA 3AC3A 1UVRA 5DLSA 1K9AA 1YHWA 3EHAA 4GV1A 4O7WA 5FBOA 5L8LA 3MA6A 2X9EA 4W4XA 4D4VA 4X3FC 1P2AA 5LWNA 4TWCA 4YHJA 5EDPA 2EVAA 2QD9A 3QQFA 5CEIA 2JAVA 5KMKA 2W06A 4ITHA 3MESA 2W17A 1ZOGA 3NLBA 4JRVA 1ZYJA 3DV3A 3KRJA 3OOGA 1H27A 5EOLA 3NYXA 2JBPA 4BC6A 4DEHA 3F3UA 1PJKA 2CN8A 3CXWA 4LG4A 3RHKA 1TKIA 3DA6A 3HYHA 3S4QA 3PP0A 3U8WA 4IB5A 4G6LA 3ZO2A 5A4TA 3A8XA 3NWWA 3UMXA 3EKKA 4FKWA 3ZSHA 2CSNA 1KE9A 4I6BA 3ROCA 4Y46A 4EHGA 3IW5A 4RIXA 4FKPA 2IZUA 4XOYA 3U9CA 4I23A 3UODA 3DT1A 3QLGA 2X6EA 5FD2A 4C38A 3KVWA 1DAWA 3W0SA 2C6OA 4G16A 4YTCA 4XH6A 5ACBC 3ACKA 3ALOA 2PVJA 2ITOA 5IDPA 3GOKA 4ORKA 3KFAA 2FYSA 3NCZA 4M7IA 5FTGA 4XS2A 3TZMA 2J0KA 4BHNA 2BR1A 4E6QA 4M14A 3Q4UA 3NNWA 2YIYA 2ITZA 3L9MA 4GK3A 4RVMA 4J98A 2CNUA 3AC4A 5AM6A 4DFNA 3S00A 4EH5A 3GU5A 4FODA 4WNPA 3E88A 4AT5A 4L8MA 3FKNA 3FEGA 1WBTA 5IH5A 4YHFA 5C01A 2F9GA 4FUXA 4NIFB 4YZDA 4JT3A 5C1QB 5CAQA 3ZFYA 3VUKA 4KKHA 1FINA 2WTVA 5IUIA 4PWNA 1RQQA 4X7QA 2RG5A 3M1SA 2CGXA 3PSDA 2VN9A 1QPEA 4FV2A 4ERWA 2ITTA 4G3DA 4JQ8A 5LVLA 4DT9A 2QKRA 4IAAA 4QP2A 5EW3A 2XH5A 3P7BA 5ETFA 3SOAA 3VF8A 4EOKA 4CLJA 5L3AA 2J6MA 4EC8A 1XH7A 3P86A 4EOPA 4YHTA 1O6LA 3F2NA 5D7VA 4S2ZA 4GT3A 3QTUA 3TJCA 3NPCA 3VIDA 4HYHA 2PVRA 3KY2A 3SQQA 5DT0A 1XR1A 3K5UA 4RT7A 4DE4A 4IC7A 5M55A 3C7QA 4AF3A 4LRMA 2C1BA 1WBSA 2UZOA 3EN7A 2YAKA 5KUPA 4L45A 1B39A 4P4CA 1YI3A 2PYWA 4F0IA 3ZZEA 4XV3A 1OMWA 3I5NA 3U87A 1ZLTA 5CEPA 5C9CA 4DEGA 4DGNA 3MJ2A 3WILA 4LYNA 2GQGA 1F3MC 2YHVA 4Z16A 4G17A 2CJMA 1WBVA 4FVPA 1PW2A 5CSWA 4BTKA 4AUAA 4YURA 3WIGA 4D1SA 2ONLC 3QX4A 4Y72A 5JK3A 2YA9A 4O0XA 5L6WL 4QMYA 4J1RA 1YVJA 3DB8A 2IW8A 4K8AA 4W4YA 3R8MA 3BU6A 4J99A 2OG8A 3QD2B 1WFCA 2CDZA 5FXRA 2AUHA 2UZLA 1E1VA 3WBLA 2QI8A 3OTUA 1DS5A 4XG4A 2CKOA 4S34A 4WG3A 1AGWA 1OKZA 3C4CA 3LPBA 5I9UA 5I9ZA 3TNQB 3H10A 4IMYA 1M17A 2EXCX 3DKOA 3N4VA 2PTKA 2X9FA 3E87A 4HVSA 1VR2A 3VBVA 3R1NA 3UC3A 5I0BA 1BUHA 2BKZA 5HIDA 4EZ3A 5K5XA 3TL8A 4Q5EA 4TWOA 3MVMA 5AUTA 2H8HA 3MVHA 2GNLA 2VRXA 4PDSA 3NUUA 2XKFA 3BHVA 3TV7A 5HLWA 3RPVA 4I93A 5M4IA 4U8ZA 3R2YA 4XG6A 5CANA 2W5AA 3AD4A 4ZXTA 4MKCA 5DR2A 4ASEA 5KMLA 1KUTA 4AGDA 5CNNA 4OLIA 3VUMA 4IEBA 2A0CX 4A9YA 2BRGA 3M11A 5CXHA 2Y4IC 4E1ZA 4QMMA 5DYJA 5AUZA 4GKIA 2FO0A 3FBVA 2OIQA 2HIWA 2QCSA 5IA2A 2Z7QA 3QRJA 3HUBA 3BQCA 3HMOA 4DGLC 3ODZX 4EK5A 5ETCA 5TO8A 1ZARA 3BLRA 4AW1A 2XIRA 1KV1A 5JQ5A 4DT8A 3PIYA 2YAAA 5E9EA 2QQ7A 2VV9A 4EH9A 5BVDA 1SVHA 4QPSA 3CE3A 4ALWA 4YBJA 5DHJA 3NUAA 2PZRA 4P2KA 3HGKA 4K6ZA 3ZUVA 3C51A 3LCKA 4FE2A 4KBAA 3UYTA 2VGPA 3WZKA 4XX9A 5HD4A 3A7FA 3LFFA 4CKJA 3GUBA 3WI6A 4JDKA 4YJTA 4EOIA 3GI3A 4FSUA 3ETAA 3U4UA 4YJNA 4FTLA 4L7FA 4UXQA 1OL6A 3PXRA 4AOJA 2VUWA 2ETKA 3BYUA 4FKOA 1JSVA 3PPKA 5A4EA 4ZLZA 5CU0A 1KOAA 2XS0A 1OPLA 3QHRA 4BZDA 4JDJA 3SA0A 4RJ4A 3FXWA 4CQEA 4XV9A 2OJJA 4GK2A 2P2IA 3Q9XA 3BBTB 4IAFA 4S32A 2X7OA 3VUGA 1OB3A 1IAHA 4AZTA 3FQEA 3BWFA 4EH4A 1QPDA 3ELJA 2XBAA 4RWJA 3OFMA 3EQFA 5CNOA 4O21A 2B1PA 2Y4PA 4IZ7A 2J4ZA 2P55A 4I6HA 4NYEA 3SG9A 4TYHA 2R5TA 4QMVA 4YJOA 2YABA 2JDVA 2WMUA 3Q9ZA 3K3IA 3FI4A 2WGJA 2E9VA 4FOCA 4C4HA 2VTNA 1LEZA 2OFVA 4FKVA 4RZVA 5HE2A 2LAVA 4ZLYA 3NUNA 4IAZA 5A46A 2QU6A 3ET7A 4HVIA 2IVSA 4FBXA 4KIOA 4NM0A 4XBRA 3S95A 4D4SA 4G1WA 4EOQA 2YISA 4MVFA 1UU7A 2VO7A 3GENA 3NYNA 4OTFA 2XEYA 4EUTA 5IQAA 2VGOA 3VHKA 2J5FA 4IFGA 5E90A 4CT1A 5C8KA 5EM5A 4DH7A 2VNYA 3AD5A 1SMHA 3G90X 4FYOA 4R7IA 4J96A 3MFTA 1L3RE 3WF7A 5KMMA 3H9OA 4F63A 3CKXA 1TQMA 2O8YA 3CLYA 3ZOSA 2X8DA 4M3QA 4E7WA 3VO3A 5BVKA 4H39A 4U80A 2ZMCA 3QKMA 1JBPE 2J51A 5BUEA 3OBJA 2X81A 3VN9A 4BB4A 2VTHA 3C9WA 1IA9A 4AP7A 4EKLA 5KZ0A 4C3FA 1W82A 5DA3A 4H1JA 3FSKA 1TQIA 3HV7A 4ZP5A 2X6DA 5E7RA 3NR9A 4WZYA 3DK6A 2GMXA 1YI4A 3DFCB 2XIXA 3ORIA 3Q6WA 2JIUA 2VD5A 2PE0A 3DXQA 3AMYA 3IDCA 3IKAA 3IW6A 4GG5A 4QMXA 5DVRA 4E20A 4EBVA 4N0SA 4Y83A 2HWPA 4FVQA 1WAKA 4O81A 1P5EA 3WZUA 4DFUA 2W1CA 4B7TA 1BX6A 4O91A 2UW5A 4OBQA 3DBCA 4G31A 4I20A 3GC0A 3PFQA 3TKIA 2W9FB 4F99A 3ZBXA 2B55A 1VEBA 3N9XA 2F7ZE 4IB0A 1YDSE 2QVSE 2WMSA 3FI8A 4I5CA 4G34A 3MVLA 5L2IA 2VNWA 4BTJA 2XJ1A 3SXFA 2DS1A 3VHEA 4C4JA 4DH5A 4Y8DA 2VTOA 4FZ7A 3UOLA 5I9YA 4IVCA 3TNHA 2G2FA 3MB7A 4GJ3A 1BI7A 5LCJA 3SD0A 5AIKA 1NXKA 1O6KA 4X2NA 1JKLA 3QTQA 3U4WA 5CWZA 1JSTA 3FMHA 2Z7LA 3W0PA 2PL0A 3V6SA 1AD5A 1RW8A 3T3UA 5CEMA 4IM0A 3ORXA 3C13A 2UW8A 3SAYA 3TM0A 3BHYA 3C1XA 4O0VA 3R8UA 2YCQA 1VJYA 2XUUA 4G5JA 3R22A 3PWDA 4Z7HA 3HDMA 3GCSA 3PZHA 3Q04A 2KULA 5J7HA 4QMQA 3FMNA 3IDPA 3PYYA 5M06A 4K33A 3RHXA 4BBMA 2W1DA 4NKAA 5J8IA 3VBWA 5LVPA 2JKQA 2IW6A 4WRSA 4V04A 3IW4A 3ZU7A 2ZV7A 4O6EA 4U94A 4JX7A 3PJ1A 5DBXA 2RFNA 4DLIA 2CCHA 2RFSA 5D41A 1SNXA 4C2VA 5L6OA 4IWPA 3QGYA 4XRLA 2BHHA 5FTOA 4EWHA 3AT2A 3GQIA 4CZTA 4EOMA 5I9WA 2XNBA 2GNFA 2ETMA 4JL9A 4LM5A 2VO6A 4O0YA 3G51A 4JOAA 3SHEA 5K3YA 4R6VA 4LQMA 4LUEA 3F3TA 4FL3A 4V05A 4TTHB 1BL7A 5CAOA 5M56A 3S0OA 3LQ8A 2ZM3A 4PQNA 4DEDA 3JVRA 2OI4X 4NM5A 4MXAA 5BQ0A 4YBKA 4I92A 4JR3A 4BR3A 3EQBA 4D2RA 5J5SA 1GY3A 5CU3A 4EK4A 3NZ0A 3AC1A 1YHSA 3JYAA 4RWIA 4XJ0A 4IW0A 2GU8A 5E8TA 1VZOA 2P33A 4RLLA 4GMYA 3NGAA 4JBQA 5J9YA 4IM3A 4CLIA 3RMFA 5AEPA 4GG7A 3EYHA 5AMNA 2C5NA 2UZNA 2R64A 3EOCA 4QTDA 4D5HA 5IQEA 4QMPA 3DAKA 3FI3A 4ZY5A 4ZS4A 4UYAA 3KXMA 4WHZA 3SRVA 4FTMA 2X8EA 5I9VA 1NVSA 4O0WA 4C02A 5FEEA 2JLDA 4IC8A 3E64A 5JFXA 5FDPA 3CKWA 4TL0A 4P5QA 4MWHA 2FA2A 4YPDA 3I1AA 2WQEA 3SLSA 3UOHA 4XEYA 2VWBA 5DEWA 4KS8A 2YZAA 3MA3A 3R9OA 1ZXEA 2B9JA 3GVUA 5BNJA 4XG2A 3DKGA 4AZVA 2PMOX 1YI6A 2EWAA 2V22A 2YEXA 4EH2A 4F08A 1L8TA 2BPMA 4C2WA 5HG5A 4E6AA 4QP7A 1UU9A 5HHWA 3L9PA 1GAGA 2C6DA 4FSYA 4BDFA 4GT4A 3GP0A 1OBDA 5EH0A 4I5PA 1J7UA 2OZAA 3IGOA 2QOFA 1H28A 4D0XA 3GBZA 3BI6A 2PMLX 4N6ZA 3BRBA 2XNPA 3HVCA 4EHZA 4ENXA 4F9CA 3RK5A 4F64A 3I4BA 2PUIA 3R02A 1UWHA 3THBA 1M14A 5E8SA 4EHVA 3UO5A 3UTOA 3OWPA 2VWXA 1SYKA 1Q99A 3Q4ZA 3TKHA 5E8ZA 4F09A 4PV0A 1YXVA 3BYOA 3D94A 2WNTA 4LL0A 3ZDUA 4ANLA 4YZNA 3CTJA 4WNOA 1CDKA 3MFUA 4CMUA 2E2BA 3DNDA 1M52A 2WU7A 4QMUA 2QC6A 4L3JA 3E93A 4RX7A 4EKKA 1KE6A 4KSPA 3RP9A 1V1KA 3BLHA 4RFMA 2C47A 1S9IA 4RSSA 4QMTA 4IADA 4E5BA 2BAJA 4BYIA 3BBWA 5HD7A 3ZZWA 1OIRA 4FTQA 4F6SA 4JX3A 3ZLXA 3GQLA 4EI4A 2QOCA 4FX3A 3GEQA 4NTSA 3OD6X 1HCKA 3PUPA 5BYYA 5LOHA 3MSSA 5HTBA 2Q0BA 1J7LA 4PL3A 4WUNA 2YWVA 4IDTA 2C1AA 3DDQA 4QYYA 4WT6A 3E63A 3E7OA 3WF6A 3L9LA 4FG8A 2ERZE 3SGCA 3D5UA 4H58A 3O8TA 4O7SA 4MNEB 4J97A 3ENHA 2ZV2A 3UVQA 3VC4A 3MPAA 3A2CA 2WTCA 4FV6A 1IEPA 2EUFB 1A9UA 5KMOA 2YWPA 3LLAA 2PZYA 3TNPC 1YHVA 4Y5HA 3FUPA 4EQUA 4CEGA 2VTRA 4O7RA 4EK6A 3DLZA 3QD4A 3UOKA 3CP9A 3O50A 1Y57A 2GS6A 4AN2A 3OXZA 4DFXE 3PXFA 4MX9A 5IDNA 4ACDA 5JSMA 3CY3A 3FZTA 3FAAA 1JWHA 5IH4A 3SC1A 2IO6A 3FMMA 1MRYA 4EYJA 4AW5A 5LXMA 2PVMA 1FPUA 3IO7A 3R1YA 4GS6A 3TIYA 3ULZA 4AGUA 3TYKA 5HG7A 5HI2A 4X6QC 5HE1A 1ZMWA 3Q60A 4Z7GA 4FT7A 5J9ZA 3UO6A 1Y8YA 4I6FA 2YM8A 2JDTA 2JKMA 4D1ZA 5LMKC 4BIBA 4MCVA 4DFLA 5J9LA 2SRCA 2ZM1A 3IONA 1I09A 2RKUA 3SOCA 3TACA 4DCAA 3VW6A 3NAXA 3QRUA 4O38A 4MF1A 4OBPA 5EKNA 5JQ8A 4KABA 1J3HA 3QALE 1CKPA 3IW7A 4GU9A 2WPAA 3LIJA 3NEWA 3QAME 2Q83A 4BDBA 4BDAA 1WBNA 3ZRLA 2O0UA 2R3HA 3TCPA 3W2OA 3PE2A 2VTLA 3PJ8A 4R77A 2PUNA 3V51A 2RG6A 5KMNA 1Z5MA 5BYLA 4L3PA 2G1TA 4ACHA 2Y9QA 5H8EA 3NUYA 3NUSA 4M13A 4AU8A 3OCBA 4USDA 4C59A 5CF6A 2QG5A 3RAKA 5C8MA 3A99A 3GC8A 3Q3BA 4CMTA 2Y0AA 3R01A 3I60A 3WOWA 4CGAA 4OTDA 4USFA 4I4EA 1WVYA 5B2MA 3D5XA 5HBJA 5K9IA 3N4TA 4MQ2A 5AAGA 1YOLA 4PL4A 4R7HA 3G9LX 5E8YA 4TN6A 1PMUA 3UPXA 5AWMA 3W8QA 4LOOA 3HP2A 2Z2WA 3CCNA 4DEAA 5TR6A 3BCEA 3C50A 1F5QA 2VTJA 2C69A 3KRWA 3MFSA 4FYNA 3A8WA 5KX8A 1CTPE 5K5NA 4CFFA 4DBNA 4Q5HA 4GSBA 4F9AA 4I6QA 3R7EA 1H1PA 4KSQA 5L6PA 4J71A 3QLFA 1PXKA 3VWAA 1PMVA 3OS3A 3G33A 3F7ZA 2VX0A 5BVWA 4O0SA 1R0EA 3OWLA 3PLSA 4JQEA 3JY0A 2VTAA 5JN2A 3P9JA 3DAJA 3PJ3A 4HGLA 4FTKA 1PXMA 3LCSA 3QQLA 4G5PA 4MXZA 3W0OA 3TKUA 3IGGA 2YIRA 3OXTA 4BCQA 2FSLX 4AN3A 2GHGA 4DF3A 2JKKA 5EYMA 4KD1A 4FTCA 3D4QA 4G6NA 2P3GX 5KKRC 1U5QA 4PF4A 2WOUA 4APCA 3ALNA 3UP2A 4BKJA 5CSHA 2QO9A 3ZSGA 3WF9A 5H8BA 5AX9A 5I4NA 5ANGA 2R0IA 5HNGA 2QONA 3BX5A 2GQSA 1ZZ2A 4HPUE 3HMMA 5M07A 3P7CA 1Q3WA 3FMEA 5AUWA 3Q5ZA 5AADA 1H26A 2XF0A 5LVMA 4FT0A 1IRKA 4QMZA 3V8SA 3QKLA 4MEDA 3IOKA 4HGEA 5KBQA 5CAVA 2CGVA 3FC2A 4XG3A 2ZV8A 3OHTA 4ANBA 3V6RA 1XJDA 2FSTX 1FQ1B 2W05A 3PIXA 3F82A 3R30A 4RJ5A 3HUCA 3WE4A 4WSYA 4YR8A 3VS6A 3QZGA 2R3KA 4J7BA 5CSXA 2X8IA 4E5AX 2R3QA 5AUUA 3RK9A 3GU4A 3QFVA 1H1RA 3F5PA 4IVBA 4NTTA 4F9YA 3C0GA 3CC6A 3FLWA 3DFAA 3O71A 3OT8A 3VF9A 3EQGA 2WMWA 5DR9A 5E8XA 3PTGA 2PK9A 4GYGA 1JVPP 5JGAA 2W96B 4L3LA 2PU8A 2WMBA 5BUIA 4FTOA 4ZSAA 1B38A 3NUXA 1XHAA 3C4XA 3F3ZA 3HA8A 4TT7A 5LMKA 5EKOA 4IDVA 1Q61A 2HY0A 2C5XA 4KRDA 4ZMEA 5EHLA 2BKKA 4JG8A 4WNMA 3PVWA 3UDBA 4G3EA 4AZSA 1UWJA 4MXOA 5B7VA 4OTWA 4XP2A 3IK3A 1WVXA 4FZFB 4WKQA 5IPJA 1WZYA 4QP8A 5DGZA 5ANIA 5HU9A 3C5UA 1FMOE 5FDXA 3PXYA 4FIFA 4OT5A 3AMBA 2ZMDA 5A6OA 3C0IA 2WU6A 4UZDA 2WMVA 1M7NA 4EONA 4ACCA 5JFVA 5GJGA 4QP9A 4EH3A 3MJ1A 1SVEA 2XJ0A 2OXDA 2B0QA 5FM3A 5M53A 2W1GA 4TWPA 4C36A 4ENYA 3ZFXA 1FOTA 4IM2A 3ZM4A 4FV4A 2UV2A 1OZ1A 2BRHA 4I41A 4UWBA 1H00A 5BPYA 4UXLA 3KEXA 1ZMVA 2B4SB 5TOZA 4A9TA 3EWHA 2BDJA 4OTGA 4WRGA 2QOLA 4XRJA 5AP0A 3TZ9A 4F0FA 5IEXA 4U5JA 5EW8A 4HYSA 1DI8A 4FKTA 4FVRA 3MH2A 5I9XA 4DGOA 4QTCA 5E8UA 2O65A 3DBFA 2XYNA 3MDYA 3R73A 4QT1A 4GU6A 2F57A 5M4UA 4AW2A 2VTMA 2FVDA 2WKMA 3S3IA 3PVBA 4I21A 1W83A 3AXWA 3O0GA 1R0PA 3FZ1A 3R7UA 4FKRA 4XLIA 2OXXA 4RC3A 3CBLA 5AUYA 1SNUA 3FHIA 2R0UA 5ICPA 3ZDIA 4FKQA 1PXIA 2R7BA 4MQ1A 4X2KA 5DWRA 3V5TA 5HCXA 3W55A 4LMNA 3WZDA 4AZFA 4C58A 3HMPA 3HP5A 2P4IA 2GNIA 2PZPA 4ZJIA 1YWRA 2FGIA 3A4OX 4BBEA 4XBUA 4DH8A 5JRQA 4WO5A 5HBEA 3E8NA 3RWPA 3QGWA 3L9NA 5HLNA 4OR5A 3QU0A 5LMBA 1P14A 2I7QA 2HZ4A 3E92A 5E1SA 2DYLA 2FSMX 3L8VA 2FSOX 2OF2A 4N4SA 3ZUTA 4RIWB 3RTPA 4XHKB 1JLUE 3MH0A 4RA5A 1NA7A 4FSWA 2C6TA 3OVVA 1DI9A 1OPJA 3HKOA 3OF0A 2ITQA 5FUTA 4CXAA 5F1ZA 3ZSIA 5G6VA 2NPQA 4DITA 5HTCA 5JGDA 3HMNA 4W8DA 5DFPA 1H25A 3LZBA 1YDTE 2WD1A 4QMSA 1GZ8A 1OVEA 2WZJA 3F3WA 3UJGA 3GU6A 4V0GB 4EL9A 5HG9A 5AV4A 1Q4LA 1ZYCA 2XK4A 4GK4A 2C3JA 5BVOA 3KC3A 4YTHA 4FIJA 2BCJA 1OUYA 2F7XE 1W7HA 5AP1A 3V5LA 4CD0A 5IQHA 2WTKB 4A7CA 2Y7JA 3W0RA 1W8CA 2W1HA 3RWQA 3AT4A 3EMGA 4FC0A 3MTFA 5A14A 5CXZA 4O7YA 3QQJA 4U42A 3B2WA 4DTKA 3PY1A 4PX6A 3FKOA 2E9OA 3PA5A 1V0BA 3KL8A 3LM0A 3MV5A 2DQ7X 3UZRA 3W0NA 3L1SA 4HNFA 1YQJA 5CU4A 4B8LA 4BDGA 4CFNA 4DEBA 3TZ7A 5EM7A 3QWJA 3RINA 3QUPA 3VS0A 4MBLA 3I0QA 5HO8A 1KE8A 4J95A 5AIRA 3QTWA 5EI8A 2WHBA 2V0DA 5HICA 4MXCA 3DPKA 3RKBA 4DA5A 4MYGA 2QHNA 4LMUA 3VUIA 4FNYA 4C3PA 5IEVA 3CSVA 4WUAA 2JAMA 3L8SA 4FV8A 5AP7A 5BX0A 3R9HA 3ZO4A 2B52A 2XIYA 3PXKA 3UVPA 3ZRMA 2QR7A 3QRIA 2XBJA 2BDWA 4WBBB 4NZWB 2ITPA 1MUOA 5ANJA 2R3FA 4U0IA 2WIPA 1SM2A 5B2LA 1E1XA 3QYWA 3NIEA 3TT0A 1GZKA 4M15A 1JOWB 4C4IA 3LFAA 4DFBA 3PJ2A 3CQEA 3D14A 5AP3A 5H8GA 1ZMUA 4XP3A 3FPQA 1QPCA 4ZTQA 3BYVA 2OLCA 2BZHB 1REJA 4RIOA 2GCDA 2WTIA 3NCGA 3OY1A 4MBIA 2OF4A 3EN6A 3QCSA 2ZB0A 4FNWA 3UOJA 4DINA 5B2KA 4K11A 4MD8E 5HLPA 5KBRA 1UU8A 3P1AA 2PVNA 4CFUA 2JFMA 2CMWA 3TNWA 4O84A 2JEDA 2YERA 4C0TA 3DJ6A 2BVAA 1MRUA 3RI1A 4D4YA 3PRIA 3FZRA 3U9NA 2QO7A 4BGGA 3FWQA 2OJ9A 2I0VA 2WB8A 3ORZA 1O9UA 3QKKA 1Q5KA 3QTSA 4YLLA 4ZTNA 3DK7A 1PXNA 3GCQA 4EORA 4M69B 4M84A 4NM7A 3ZXZA 3TTIA 2VTSA 4X3FB 1PXOA 1ZZLA 3OCGA 2KTYA 1YW2A 5LWMA 3OTVA 4Y5QA 5DT3A 4FIIA 1R39A 4HVDA 3COMA 4B8MA 4A07A 3V04A 4YJPA 1PYXA 2QO2A 3MFRA 2BFYA 1H1SA 4OT6A 4IAIA 2NP8A 2XYUA 2VO0A 3QL8A 3ZUUA 3TXOA 4PNIA 4F70A 3UG1A 2R4BA 3O2MA 1R3CA 3UIMA 2HZNA 4FL2A 4BDEA 2IN6A 4FI1A 2RL5A 3U55A 2ZYBA 2UW9A 3ZLWA 4IJ9A 3QRKA 2PVKA 4K77A 3FMDA 1PY5A 2XK9A 3LXKA 1H0VA 1XO2B 2R3LA 2XIKA 4ZTSA 3ANQA 2UZBA 1GZNA 2CKPA 2W1FA 2YM6A 3PXQA 4MHAA 4H1MA 5M57A 1H1QA 1VYWA 3B8QA 4O96A 4DTBA 3GFEA 2WAJA 3R9RA 2J0LA 3VS2A 4DGMA 3IS5A 4YSJA 4A06A 5G1XA 3HV3A 5HNBA 3VS5A 3K5VA 3IOPA 3ZM9A 3KKVA 4AA4A 2G2HA 4D58A 1J1BA 4CVAA 3OZ6A 5IUHA 3PDTA 4F9WA 4P7EA 4BDHA 4NT4A 2QG7A 1Q41A 4OBOA 3TUDA 2YM7A 4BBFA 4RX8A 2WMQA 2ZV9A 5AM7A 1YOJA 2JITA 1G5SA 2WQBA 2C5VA 1IAJA 2ESMA 4FKSA 1LUFA 4DTAA 2OIBA 3EN9A 5HIBA 3UNZA 5AAFA 4BCGA 4EJNA 5HVJA 4PMMA 3R7IA 2HOGA 2VWIA 3MS9A 3PRFA 4FICA 4Z9LA 3KREA 3R8ZA 3VRYA 2BALA 4RGJA 4AG8A 2PULA 2QOIA 3EH9A 4U45A 5M08A 4OTHA 1F0QA 2Q0NA 3NRMA 3VJNA 4PTEA 3HECA 2UUEA 3U6JA 1Q8ZA 1URCA 2IG7A 3JVSA 5DEYA 3GGFA 4AZEA 4QNYA 3VBXA 1ND4A 2BRMA 4ALVA 3K54A 5AP4A 4O27B 3Q2JA 4R5YA 4D2SA 2C4GA 3O17A 3PSBA 5E8WA 2VX1A 5IA1A 2B9HA 1KE7A 2EU9A 4O7VA 3H3CA 4O6LA 4GEOA 1JAMA 4PDOA 3NNUA 2UW6A 4G6OA 2HXQA 5E91A 3R7YA 4FV0A 3NAYA 4CKRA 1JQHA 3ORLA 3R7VA 4KUJA 2XKEA 3PE1A 3FZOA 4O0UA 2H96A 3HNGA 4R78A 4HCTA 2Z60A 3PPJA 3COKA 4HPTE 4RQKA 2WO6A 3F88A 5JT2A 2ZVAA 2XM9A 1GOLA 4PMTA 4PP9A 4BZOA 4JAJA 3UNKA 2GFCA 3L8PA 3GC9A 3HMIA 2YITA 4BDKA 4YZMA 4F7SA 4QP3A 3UBDA 2J9MA 3I0OA 5KO1A 5A3XA 1URWA 2BHEA 3AT3A 3N4UA 4WIHA 5E1EA 3W2SA 1STCE 3KN6A 3A7GA 4NJ3A 3V5WA 3Q9YA 5F94A 3LJ0A 3FLZA 2ZOQA 3DBEA 4JI9A 1QL6A 3ZFMA 3W2RA 3MIYA 3ZHPC 4JJRA 2Z02A 1ZY5A 3BYMA 5LVOA 3FYJX 3KXNA 4KBKA 4LGGA 4BCOA 1H1WA 3EZRA 4DG3E 5ANEA 1U54A 3O7LD 3P5KA 3CGOA 2J0JA 4RIYB 5DRBA 5EW9A 3V5JA 3VNTA 2X2MA 3AG9A 5CEQA 5T6KA 4AX8A 1CMKE 3ZXTA 3FSFA 2GNGA 3HEGA 5IA0A 3TNIA 4WBOA 4BRXA 2ERKA 3NW5A 3F5UA 3F2AA 3P0MA 4ZJJA 3B8RA 4H3BA 2ITNA 1IG1A 4FV7A 4D28A 4KKGA 3PVUA 5LVNA 2C6IA 5FQDC 5HKMA 4FV9A 4TPTA 3DGKA 3VUDA 4ACMA 5J95A 3ORTA 4NW6A 5AUVA 4Y95A 3C4FA 5T68A 3D5VA 1H08A 4YNEA 4F6UA 3RK7A 2C6LA 4BDJA 3ZYAA 2QKWB 4AA5A 3DDPA 2JD5A 3ORMA 2X7GA 3A4PA 3FMJA 4EK3A 2Y4IB 3BQRA 3CEKA 4O7NA 5EDRA 1U46A 1UNGA 3JY9A 3V8TA 4BIDA 5A4QA 4ALUA 2VTIA 2IVTA 3F66A 4X21A 2BIKB 3DBQA 1PMEA 3VQUA 4S33A 2W5HA 5EOBA 4EWQA 4ITJA 4AT3A 3VQHA 3LMHA 2NNWB 4MAOA 2G9XA 4YO4A 4BICA 4O7PA 4D9UA 3DNEA 4NK9A 5JKGA 2R3JA 1XQZA 4IB1A 4JR7A 1A06A 2BAQA 1XBAA 5DT4A 2VTPA 5LJJA 4CFVA 4C33A 2J50A 3F6XA 3E3BX 4QTBA 4YZBA 2EXMA 3JR1A 3AGMA 5C03A 2CCIA 4O83A 3R8VA 4FK6A 4MK0A 1M2QA 3HRCA 2QOOA 2FUMA 4MNEA 4I3ZA 4B6LA 4E73A 4YMJA 4U41A 5CASA 4CRLA 3VULA 3UZPA 1ATPE 5BVEA 4EOOA 5CENA 2J0MB 3KRLA 4FNZA 2QOQA 5JEBA 3Q6UA 4IX5A 4R3RA 5FRIA 4XV1A 4FT5A 1XKKA 4E6CA 3KCFA 3F5XA 4K9YA 4L68A 4I24A 3ATSA 3R28A 2UZUE 2REIA 3BV3A 1Q8YA 4TNBA 3D7TB 2VX3A 1HOWA 4LI5A 3CJFA 3UPZA 2F49A 3DY7A 4FKJA 4JIAA 4JS8A 3VUHA 4D9TA 1FMKA 3PY3A 5FEDA 2A27A 3LJ2A 4I5HA 3C4WA 3KB7A 3LHJA 4QYHA 4HVHA 4RC2A 3FL5A 4EZ5A 1H07A 4IBMA 1PKDA 3D2IA 3VS7A 4ZZOA 2OJFE 4K0YA 3I81A 2OJGA 1WBPA 4YC6A 4RG0A 4M8TA 4AE6A 4ZZNA 4KBCA 2YJSA 3OOMA 4C61A 2O5KA 2VAGA 2Z7RA 4QYGA 3H9FA 3LXNA 3TN8A 3OW3A 3LFQA 4E5WA 3BPRA 3BGPA 3W0QA 1OIUA 2GS2A 2R3MA 4FSTA 4IX4A 3ZO3A 5IF1A 2BUJA 5LMAA 1DM2A 3PVGA 1K2PA 3BE2A 1JNKA 2IZTA 3W1FA 5CAUA 3QYZA 5D7AA 3JXWA 4DGGA 4FZDB 4KIPA 4H05A 3VRZA 5CF5A 4WNKA 2B53A 3HX4A 4GUEA 3F5GA 1XH4A 4FIEA 5JZNA 3O23A 1NY3A 1PYEA 3QQGA 5CEKA 2JGZA 1ZYDA 2HCKA 2UW3A 4G2FA 1PMNA 3AOXA 3R1SA 2C6KA 3EN5A 2HELA 3D15A 2C0IA 2OFUA 3PP1A 4ANSA 3DLSA 1EH4A 5HO7A 4C35A 2BDFA 2BROA 2I0YA 3VS1A 1OPKA 5C4LA 2EB3A 2XNMA 4ZK5A 4HYIA 4FEUA 4X2FA 1OKYA 4GH2A 4QTAA 5D10A 4WOVA 3PA3A 3Q32A 3QTIA 3W2QA 2PVFA 4L43A 3PSCA 1GNGA 3NDMA 3QCXA 4NM3A 4AFJA 3S2PA 3EIDA 3EQPA 4J8NA 4E4LA 4YZ9A 5LCKA 3MY0A 3QF9A 4BDIA 3VS3A 4ITIA 4CT2A 1Z9XA 2ETRA 3CS9A 1GJOA 4AFEA 4DFYA 3O8UA 2YM3A 2ACXA 2HW7A 3A7JA 3PG1A 3IQ7A 3BEAA 1BMKA 3D2KA 3FPMA 3LAUA 4HCUA 4WG4A 4I0SA 3W32A 3JPVA 3ZONA 4RJ7A 3SG8A 5M09A 5DI1A 5CT0A 4BCPA 5CSVA 3W8LA 5AP2A 4ZSEA 3UYSA 4BF2A 4PL5A 4RWKA 3AC8A 3G0FA 4F7LA 3EQHA 1OL7A 4PTCA 1WBOA 3BE9A 5HEZA 4YTIA 3ODYX 2OXYA 4FG9A 5IMXA 1FVRA 2NRYA 4EH7A 1OL1A 2X7FA 2XMYA 3DBDA 4JIKA 3UMWA 4CMOA 4E4NA 3CPBA 4AGCA 1PXLA 3AGLA 2VWVA 4FG7A 4RWLA 1Y8GA 4RMZA 1UA2A 3NW6A 3T8OA 4C34A 5CALA 5I5ZA 3LOKA 3DOGA 5CVGA 4I5MA 4JDIA 5L8KA 2C5OA 1PRYA 4KS7A 1O6YA 3AQVA 3QTZA 3BWJA 3BIZA 5IQDA 3CD3A 3DQXA 3QC4A 1YRPA 5KZIA 5HGIA 4BCHA 3QUEA 4I22A 3TZ8A 2HK5A 2W4KA 1SZMA 4AW0A 3H9RA 4H3QA 2UVXA 5JFWA 1Q8UA 1YKRA 2I1MA 3KXXA 4NU1A 3QA0A 3MW1A 4FT3A 2WFYA 4EOSA 2XRUA 3OT3A 3EN4A 4ONAA 4QOXA 1MQ4A 3PPZA 3KVXA 5DN3A 5AV2A 3FC1X 4B9DA 5BMMA 5BYZA 4BTMA 2UZEA 3WYYA 4QP6A 4RJ8A 2A1AB 4BCFA 2XP2A 4C4GA 3GXLA 3QTXA 3E7VA 4CCUA 2W5BA 4KNBA 3ZCLA 5DH3A 5L2WA 4MD7E 4F0GA 2W4JA 3C4ZA 4LV8A 4DLJA 1OUKA 1XH9A 3QHWA 4YC3A 1SVGA 4EEVA 2IVUA 4O7ZA 5CEOA 4ZLOA 4EQCA 3LFBA 5ANKA 4A4OA 1M2RA 3BGQA 3E8EA 3H0YA 3KA0A 3GU8A 3RPOA 4HJOA 4QO9A 2GFSA 3MPTA 3GNIB 3R7OA 3ZH8A 3ID6C 3FLNC 4FKUA 4TZRA 2WTDA 1Y91A 3DJ5A 3HAMA 3MIAA 2C6EA 5M51A 5JMSA 3I79A 5DNRA 4ASXA 4HVGA 3O96A 3CQWA 4F1MA 1ERKA 5HX8A 1RE8A 3MY1A 4GW8A 2PWLA 4K2RA 4MTAA 3ROYA 4CV8A 4TRLA 1PXJA 4DFZE 4E6DA 2PSQA 3CPCA 4DH1A 2X4FA 3EQRA 2DUVA 3QWKA 4W8EA 1J91A 5IQIA 3TJDA 2XKDA 4L00A 3PLAE 4GIIA 5EYDA 5FM2A 4G9CA 5L8JA 3LQ3A 4RRVA 3KXGA 3A7HA 5HG8A 3ZC6A 4AGWA 5BUJA 1AQ1A 3KK9A 4FKGA 2XK3A 1QPJA 5GJFA 2H34A 1PF8A 4N57A 3RCDA 3SX9A 3ZMMA 2UVZA 2XB7A 5H2UA 3A61A 4A4LA 2RGPA 3Q96A 1XH8A 3FMKA 4WD5A 3OUKA 4L7SA 1ZOEA 3WZJA 2QR8A 4OTQA 4YGAA 1KWPA 3I7CA 4HYUA 2CGWA 4U40A 3MVJA 3R00A 3W10A 2VWZA 4ZTMA 2UZTA 3POZA 4LGHA 2AC5A 2WOTA 4F1OA 3T3VA 3ANRA 3GCPA 4QNAA 2HXLA 2ITXA 3BU3A 1Q3DA 2HW6A 4J52A 5EYKA 4TYJA 5CYIA 3R21A 4ZS0A 4ZSGA 4ZTLA 3DTCA 3E8DA 3EZVA 2C68A 2R3OA 4HGTA 4X6RA 4BGHA 3R2BA 4O2ZA 3KULB 3EQIA 4AT4A 3DCVA 1CKJA 5LARA 4NWMA 3K3JA 1Z57A 4IZYA 5GIOE 4LRKA 4NKSA 2F7EE 4H36A 4EC9A 5H3QA 4KA3A 3V5QA 1REKA 3LMGA 5HE0A 1K3AA 3QC9A 4AACA 4WG5A 4RFZA 4BZNA 3KXHA 3TDVA 2WTWA 3ULIA 4DEIA 3ZS5A 4S30A 2PY3A 5L2TA 3VJOA 1YWVA 4RFYA 4GIHA 4XYFA 4HNIA 4ZY4A 3MB6A 2Y6OA 3A62A 4C3RA 5JFSA 1OGUA 2XK6A 4IVDA 4RZWA 3QCQA 1XH6A 4L53A 4RIWA 4O0TA 5IEYA 4IX6A 2CNQA 2YM4A 4JQ7A 4APPA 4XP0A 3U54A 5CF8A 3RALA 1A48A 3IDBA 3TUBA 1JKSA 3Q4CA 4R3PA 3KRRA 4LFIA 3O7LB 4KINA 2OW3A 5M4CA 4R1VA 3F9NA 2GTMA 3KU2A 1VYZA 4CFXA 3LJ1A 4CTCA 2PVLA 3EQDA 4EJ7A 4IWOA 4V0GA 4MD9E 3I6UA 3PIZA 3QD0A 4LV5A 4MWIA 3DXPA 1YOMA 4ZOGA 4ZIMA 3ZRKA 1OIQA 5EG3A 1PXPA 4QYFA 4ZSLA 4BCMA 3LFCA 4UWCA 4DCEA 5FXQA 3OCTA 4E4MA 3F69A 3BV2A 3HV6A 4JBVA 2JFLA 5EDQA 4L44A 5AFVA 4EOLA 4NCTA 2EB2A 3NYVA 3P4KA 4BCIA 4PP7A 5DR6A 2JDRA 4YJSA 4PTGA 5HORA 2WQNA 4HGSA 1H4LA 3FLSA 3CIKA 5CAPA 5GIPE 1OITA 5TF9A 1XH5A 2WEVA 4G3GA 1XWSA 2W0JA 2WTJA 4C37A 2YFXA 3VW8A 2F2CB 1BL6A 2W99B 4O82A 2OICA 3KQ7A 4O0RA 3OWKA 2P2HA 4GJ2A 1ZOHA 5HCZA 4NFMA 4CV9A 3BLQA 4ACGA 2C5YA 1HCLA 1FBNA 4JG7A 4XMOA 3G0EA 2OH0E 4C7TA 1QCFA 4L46A 3IW8A 3R04A 3GCUA 5E92A 4Z3VA 2XNEA 2O64A 4IQ6A 4RIXB 4RC4A 3FL4A 4YO6A 3P23A 3MY5A 3TIZA 2XEZA 4F4PA 4NJDA 4XCUA 3WARA 1H0WA 4IFCA 5CQWA 3WF8A 3I7BA 4AS0A 2GTNA 3MTLA 3D5WA 3FI2A 4GFGA 4UN0C 2PPQA 3MGYA 5CLPA 3TV4A 2W4OA 3Q5IA 2X1NA 2JIVA 5FBNC 4K1BA 3KF4A 2OK1A 5CQUA 3TEIA 4FR4A 1OECA 3BEGA 1WVWA 2B9FA 2R9SA 2V62A 1U4DA 4MXXA 4X2JA 4ZTHA 2OWBA 2V7AA 4XOZA 3LFEA 2I40A 5A54A 1OL5A 4QTEA 4E8AA 4F7JA 5TT7A 4UYNA 5DRDA 3P7AA 4UX9A 3FE3A 4ZMFA 3GFWA 1V0OA 3FY0A 4GVJA 2XRWA 5T3QA 2PZIA 2IVVA 3QXPA 5K4JA 4G3CA 2R3PA 4IVAA 2YZLA 3GCVA 5E4HA 4ZAUA 1MRVA 1XBCA 1E9HA 2HAKA 3H4JA 4FIGA 1FVTA 4TKSA 1TVOA 2XNOA 1BKXA 4O86A 3LCDA 2GQRA 4X3FA 2X2LA 3II5A 1M7QA 2QOBA 5JRSA 3SDJA 2ZDUA 4NH1A 2C0TA 5BVFA 1ZAOA 5KKRB 2Y6MA 4CKIA 3LCTA 4BN1A 3I6WA 4FT9A 1R78A 2UW4A 3BHHA 4UBAA 4YP8A 2OBJA 5IG1A 4AQCA 2H9VA 3FY2A 3WF5A 4X3JA 5HESA 3D7ZA 3ORNA 3RM7A 4B0GA 3R83A 4ANQA 5CF4A 4EYMA 3GB2A 5F20A 2WEIA 4B99A 2HZ0A 4MXYA 2PZ5A 4ERKA 4B4LA 2C3KA 2XVDA 4XUFA 4TY1A 5EQYA 3ZLSA 4DH3A 3LFSA 2O2UA 3OP5A 1OM1A 3OWJA 5CZIA 3TG1A 3HL7A 4Q2AA 4QP4A 4U43A 4A9RA 4BI2A 3LFNA 4P5ZA 4CCBA 2A19B 2OZOA 2WXVA 3RM6A 4FK3A 5A6NA 2XK8A 3FDNA 5DOSA 5AV1A 5D11A 1H01A 5KMJA 4X2GA 4IE9A 2B54A 3ATTA 5F95A 4EH8A 4II5A 1KE5A 4QMWA 1Y6AA 4PNKA 5J1VA 4D1XA 4USEA 2E9NA 1P4OA 2ZJWA 5FLFA 5A9UA 5CU2A 3NUPA 4K18A 4AXAA 2UZVA 4DG2E 3NW7A 3FXXA 4EUUA 3HRFA 3UQCA 2C0OA 4N70A 1NT2A 2IWIA 4FOBA 4FKLA 2VWWA 2JDOA 1UU3A 3RAWA 1WMKA 3DZOA 3FHRA 5HCYA 2DWBA 4XG9A 5EM6A 2HENA 3TDWA 1XBBA 4CG8A 3FLYA 4OGRA 1I44A 3EL8A 5AP6A 2JIIA 3GU7A 3OY3A 4O22A 5CT7A 3OBGA 4KB8A 4JXFA 3PZEA 2YDIA 3LFDA 4J8MA 3W2PA 1LPUA 2ZB1A 5CI6A 5LQFA 3VS4A 5ETIA 3FZPA 3CTHA 5AAEA 4UALA 5FTQA 2O3PA 3FQSA 4LOQA 3W16A 4GKHA 3ZBFA 3PA4A 2CKEA 3FZSA 3ENMA 4PDPA 5ANOA 4D55A 3O51A 3WZEA 2BRNA 3G15A 2R3IA 4BHZA 3HV5A 1OBGA 1DAYA 5CTPA 3R9NA 2WELA 4XG7A 5HX6A 3SVVA 2XIZA 4P90A 4PMPA 3SXSA 2CN5A 1NVQA 4IWDA 3RCJA 4YU2A 1OIYA 2JBOA 4F6WA 4YZCA 4UY9A 3RAIA 4FEWA 4ZJVA 5KHXA 2XZSA 3WYXA 1W98A 3CTQA 4RJ6A 3QQKA 1RDQE 4AOTA 3RJCA 3MH3A 3KK8A 5DG5A 5HQ0A 2O63A 3UQGA 3FXZA 2A2AA 2J0IA 2QURA 2PUPA 2V7OA 3EFWA 2YM5A 4NW5A 4QQJA 1CM8A 3QUDA 4RJ3A 2ONLA 1W0XC 2R2PA 5AV3A 3WIKA 4CRSA 4FKIA 4JLCA 3U51A 4EQMA 5EM8A 5CY3A 3T9TA 1UKIA 2OIDA 4TNDA 3KGAA 3IPHA 3QRTA 2PUUA 5CU6A 3BZ3A 5AUXA 1OL2A 4BI0A 2PE1A 2V55A 1LP4A 5TKDA 4DEEA 5BMSA 4R1YA 1JKTA 3ITZA 4U9AA 3SW4A 4MH7A 2BZIB 4L6QA 1UKHA 3V5PA 3LVPA 4NFNA 4R7BA 5IA4A 3NVKI 2W1EA 3DTWA 3MBLA 3UO4A 5IA3A 2GPHA 1OI9A 5CVFA 2Z8CA 1OKVA 3D83A 4RIYA 4CNHA 3C5IA 1YXUA 2XCHA 4FSNA 4IWQA 4HW7A 5KHWA 2VZ6A 3IECA 4ZTRA 1G8SA 3NNXA 3P08A 4FTJA 4O7LA 5IQGA 3NYOA 5HNIX 3ZTXA 5M44A 3OCSA 3OG7A 2ITWA 2IJMA 2VWUA 4L9IA 2X4ZA 3EFJA 4UZHA 1UNLA 3ZC5A 2PE2A 3E3PA 3QQUA 4GFOA 4TYHB 4I0RA 3S1HA 4CSVA 1BYGA 1Q24A 3PY0A 3DZQA 3DB6A 3KCKA 3MYGA 4FTAA 4M67A 1H8FA 4YJRA 3LKMA 4U98A 2HZIA 3UQFA 4FSRA 4RQVA 4F1TA 2BFXA 2OH4A 3EFKA 5FG8A 2AC3A 2YIQA 4O2PA 3BELA 4M0ZA 5EHOA 4JNWA 4BY9E 4YC8A 4I94A 4ZZMA 2FB8A 2PVYA 5EYCA 3BYSA 1GIIA 3FV8A 4QRCA 4UWYA 3E5AA 2WQMA 3B2TA 4RLKA 1QMZA 4EOJA 2OSCA 4FNXA 5HBHA 4AWIA 2R3NA 3DS6A 2CHLA 2J2IB 3HZTA 3KMWA 4C4FA 2CLQA 5DIAA 4LUDA 3HLLA 2RFEA 1U59A 3POOA 4LRJA 4LOPA 5AJQA 3W2CA 4CFWA 2PMNX 2W1IA 2YIXA 3EQCA 2YDKA 3A60A 3U6HA 2C6MA 1YXSA 3UVRA 2GHLA 2J7TA 3MPMA 4YJQA 2I6LA 2OJIA 4U97A 2R7IA 5C4KA 2XA4A 3NVMB 3COHA 4FTRA 2QU5A 2E9UA 5FP6A 3RVGA 1ZRZA 2WIHA 2UVYA 2JDSA 4U6RA 4FA2A 3PG3A 4DN5A 1UV5A 4CTBA 1WCCA 3UP7A 4JBPA 4XV2A 4GRBA 4IAKA 5EK7A 3AMAA 1U5RA 4IACA 3ACJA 4U3YA 4R5SA 4JAIA 2G15A 4U3ZA 5CS6A 5EHYA 4W4WA 4YNOA 3LW0A 5CSPA 4XG8A 4YJUA 3D7TA 5A4LA 4RVTA 5EQPA 3M2WA 3W0MA 1JKKA 2X0GA 1Q62A 3BHTA 4HZRA 4IH8A 3FQHA 4HOKA 4L01A 3ZEPA 3AC5A 2QNJA 4Q9SA 3V8WA 1J7IA 4JBOA 4ZY6A 3UG2A 1M2PA 4XNEA 2X39A 5FEQA 5IISA 2BIYA 3QTRA 4YLKA 3SV0A 3QZIA 4OTRA 3KMUA 4X0MA 4RX5A 3DAEA 3NSZA 4YUQA 2H6DA 1APME 2R3RA 1MQBA 1PKGA 3ORPA 4E93A 3Q52A 3DQWA 4FTIA 4QPAA 4FTTA 1CKIA 3R63A 3UGCA 2FH9A 4GCJA 4PDYA 3C4EA 4J53A 3R71A 5ETAA 3NNVA 1KOBA 4KWPA 5ITAA 3Q2MA 1RJBA 4AAAA 1YWNA 4BDDA 4LL5A 3KMMA 3NS9A 1Q8WA 4AZWA 3BKBA 4FSMA 4MNFA 2OU7A 3HDNA 4JG6A 5AA8A 3LXPA 4ANMA 4G9RA 1YDRE 2WMTA 3G6GA 2YN8A 3VBTA 3R8PA 1YXTA 4O7TA 4QQCA 4F65A 5JZJA 2RF9A 4PY1A 5F4NA 2GNJA 3RPYA 5EI6A 4YSMA 5B0XA 3P78A 3NIZA 3RZBA 3O8PA 2XK7A 4YPSA 1U54B 2ITYA 3JS2A 4DAWA 2A4LA 1OKWA 3NX8A 2XKCA 1P4FA 4GT5A 4FZAB 2VTTA 4FSZA 4TW9A 2F2UA 2B9IA 2OO8X 3D0EA 3HV4A 4BCJA 2UZWE 3LM5A 4L52A 4DG0E 2YCFA 3CQUA 4TWNA 3ZO1A 4AOIA 3LXLA 4RBLA 1T46A 4UV0A 5IMEA 2CLXA 2W7XA 5J87A 3CY2A 4NL0A 3C0HA 5IH6A 4TYGA 3EKNA 3F7WA 2VWYA 4U44A 4EHEA 5GHVA 1Q8TA 4S31A 3CD8A 3KF7A 2OKRA 3VAPA 4HCVA 4DC2A 1TQPA 2C3LA 3WE8A 3OXIA 3M42A 3Q4TA 1S9JA 1GIJA 3QZHA 5FXSA 5HU3A 3P79A 2XCKA 2Y8OA 3A7IA 3QD3A 4WA9A 4QMNA 3QZFA 1G8AA 4JRNA 3CR0A 2X2KA 2BZJA 4BCKA 5JGBA 3SKCA 5CZHA 4NSTA 3G6HA 3QBNA 3ORKA 5L2SA 3SW7A 4TXCA 4ID7A 3OW4A 4U79A 3SRVB 2XNGA 3FMLA 5DPVA 5E8VA 5C27A 5A4CA 3RPRA 4ASZA 3OMVA 3L8XA 4FEXA 5IA5A 1W84A 2W9ZB 4FMQA 2I0HA 4FTUA 3V01A 4Y85A 2OGVA 4FIHA 5GJDA 2XM8A 3NMUF 4YTFA 3TV6A 3KXZA 5AA9A 5IU2A 3TTJA 4FGBA 3PWYA 2QOHA 3KRXA 4RVKA 5EFQA 2ITVA 1FGKA 4F9BA 4FZ6A 4IX3A 2BTRA 3HRBA 3TWJA 4GUBA 2WMRA 3PXZA
chains in the Genus database with same CATH superfamily
3MN3A 3SXRA 3H30A 3Q9WA 1G3NA 4DYMA 2WMAA 1PHKA 3QCYA 2GS7A 5KMIA 4KKEA 3AC2A 3DK3A 2OZAB 2CPKE 2C30A 2WQOA 3OEZA 4UB7A 3LLTA 4V01A 4BCNA 3H0ZA 3LQ5A 4M0YA 3D9VA 3EFLA 5FP5A 4OW8A 1MP8A 3FJQE 4IAYA 5ACKA 2F4JA 3UE4A 3MH1A 2UZDA 2CGUA 1BI8A 4KRCA 4TYIA 5HVYA 4IHPA 2QHMA 3G9NA 3CGFA 3V3VA 3OUNB 1JSUA 3RPSA 5KNJA 2GHMA 4BI1A 3R8LA 4I0TA 3EJ1A 4ARKA 5CI7A 3OROA 2VTQA 4U81A 2LGCA 2J90A 4RA4A 4YLJA 3FKLA 2QLUA 5ANDA 4ASDA 4C4EA 3MI9A 5JH6A 2YCRA 1UNHA 3DXNA 3VBQA 1GZOA 4RPVA 5KCVA 3W33A 5DE2A 3MWUA 3GC7A 2BMCA 2ITUA 3ERKA 3PJCA 4IJPA 1LR4A 4G3FA 1GIHA 3DKFA 4AE9A 1T45A 4RVLA 4FL1A 4BIEA 4Y73A 3E8CA 5BVNA 2IZSA 3DU8A 5IZFA 1V0PA 4L42A 3JUHA 3U6IA 2CNVA 5IQCA 1NVRA 2AYPA 2NO3A 4D4RA 2UW0A 2YDJA 2C3IB 4H3PA 4A4XA 1IR3A 4AA0A 5AP5A 5IQBA 4GFMA 4QQTA 5F9EA 2I0EA 3Q53A 4L67A 2NRUA 2PVHA 3DJ7A 2P0CA 3PUFC 4A9SA 3P5JC 4GVAA 4DHFA 3AD6A 2B7AA 3G5DA 3DKCA 5CVHA 4FEVA 1CSNA 4PUZA 3REPA 4CZUA 5D1JA 4PMSA 3TMOA 3IG7A 4IIRA 4XLVA 4EZ7A 3COIA 3KN5A 4KAOA 4FV5A 5FGKA 4AN9A 5IUGA 4E4XA 3W18A 5KE0A 3E62A 3F3VA 3VVHA 4BDCA 2JC6A 2YCSA 3QA8A 3QQHA 3F61A 5J1WA 2R3GA 1JPAA 3K2LA 1ZY4A 2QLQA 4Z55A 2RIOA 2ZM4A 3BGZA 3CJGA 5EI2A 5K4IA 2GDOA 1Q97A 4CFMA 2WMXA 1ZYSA 2WTKC 3N51A 5D12A 2BTSA 3UC4A 1IASA 4FUYA 3OEFX 3EL7A 3R0TA 4NCTC 2YIWA 4QYEA 4F7NA 4IZAA 1WBWA 4ZEGA 4BVUA 4BYJA 1NW1A 2IPXA 4KIQA 4RX9A 3FYKX 3RNIA 3RGFA 4CG9A 4YJVA 2HWOA 2BRBA 1H24A 2JKOA 4GL9A 4JDHA 5GNKA 4FGRA 5HE3A 3TI1A 3HA6A 4NUSA 5CX9A 3ZLYA 3TUCA 3R1QA 3R9DA 3EB0A 3UZTA 3LCOA 1B6CB 4U7ZA 3QXOA 2CKQA 4MBJA 4QQ5A 3KULA 4W4VA 4TYEA 3UIXA 2VU3A 4AAYA 1R1WA 1FGIA 4M97A 4UEUA 3QX2A 4R3CA 4IANA 2YACA 3UNJA 3UIBA 2PMIA 2HY81 2PHKA 2BILB 2G2IA 2RFDA 5M4FA 2XJ2A 1J1CA 4I1ZA 4O7OA 5C26A 2J5EA 4ZSJA 4PRJA 4OUCA 4M68A 1Y6BA 1KV2A 4M12A 4N6YA 3I5ZA 4OTIA 2Z7SA 3VBYA 3BHUA 3UIUA 3F2RA 1FVVA 4I4FA 4FEQA 2UW7A 1IA8A 5GINE 3OC1A 4FV1A 4E26A 4EK8A 2YJRA 2GNHA 4BTFA 1YXXA 5HIEA 3LMIA 5HZNA 1BLXA 2IW9A 3RAHA 4A9UA 4DBXA 1ZWSA 5H9BA 5C8NA 3GT8A 4C62A 2GSFA 3R6XA 4FTNA 4IZ5A 5AV0A 4Q9ZA 5IQFA 4FSQA 3FLQA 2G01A 3G2FA 5AX3A 3EYGA 1X8BA 4QP1A 2XNNA 4QMOA 1LEWA 2VO3A 4EH6A 1KSWA 3GOPA 3ZEWA 2IZRA 5D9HA 2ZAZA 2W1ZA 4EBWA 2V5QA 2QODA 2BZKB 2QOKA 3BU5A 4HZSA 2ZDTA 4IB3A 3LE6A 4GYIA 4QMLA 5EQEA 4BGQA 2BAKA 4D5KA 5HVKA 3HAVA 3T9IA 2E9PA 2HYYA 4D0WA 4FV3A 4JVGA 3AC3A 1UVRA 5DLSA 1K9AA 1YHWA 3EHAA 4GV1A 4O7WA 5FBOA 5L8LA 3MA6A 2X9EA 4W4XA 3VONA 4D4VA 4X3FC 1P2AA 5LWNA 4TWCA 4YHJA 5EDPA 2EVAA 2QD9A 3QQFA 5CEIA 2JAVA 5KMKA 2W06A 4ITHA 3MESA 2W17A 1ZOGA 3NLBA 4JRVA 1ZYJA 3DV3A 3KRJA 3OOGA 1H27A 5EOLA 3NYXA 2JBPA 4BC6A 4DEHA 3F3UA 1PJKA 1OGYA 2CN8A 3CXWA 4LG4A 3RHKA 1TKIA 3DA6A 3HYHA 3S4QA 3PP0A 3U8WA 4IB5A 4G6LA 3ZO2A 5A4TA 3A8XA 3NWWA 3UMXA 3EKKA 4FKWA 3ZSHA 2CSNA 1KE9A 4I6BA 3ROCA 4Y46A 4EHGA 3IW5A 4RIXA 4FKPA 2IZUA 4XOYA 3U9CA 4I23A 3UODA 3DT1A 3QLGA 2X6EA 5FD2A 4C38A 3KVWA 1DAWA 3W0SA 2C6OA 4G16A 4YTCA 4XH6A 5ACBC 3ACKA 3ALOA 2PVJA 3NFFB 2ITOA 5IDPA 3GOKA 4ORKA 3KFAA 2FYSA 3NCZA 4M7IA 5FTGA 4XS2A 3TZMA 2J0KA 4BHNA 2BR1A 4E6QA 4M14A 3Q4UA 3NNWA 2YIYA 2ITZA 3L9MA 4GK3A 4RVMA 4J98A 2CNUA 3AC4A 5AM6A 4DFNA 3S00A 4EH5A 3GU5A 4FODA 4WNPA 3E88A 4AT5A 4L8MA 3FKNA 3FEGA 1WBTA 5IH5A 4YHFA 5C01A 2F9GA 4FUXA 4NIFB 4YZDA 4JT3A 5C1QB 5CAQA 3ZFYA 3VUKA 4KKHA 1FINA 2WTVA 5IUIA 4PWNA 1RQQA 4X7QA 2RG5A 3M1SA 2CGXA 3PSDA 2VN9A 1QPEA 4FV2A 4ERWA 2ITTA 4G3DA 4JQ8A 5LVLA 4DT9A 2QKRA 4IAAA 4QP2A 5EW3A 2XH5A 3P7BA 5ETFA 3SOAA 3VF8A 4EOKA 4CLJA 5L3AA 2J6MA 4EC8A 1XH7A 3P86A 4EOPA 4YHTA 1O6LA 3F2NA 5D7VA 4S2ZA 4GT3A 3QTUA 3TJCA 3NPCA 3VIDA 4HYHA 2PVRA 3KY2A 3SQQA 5DT0A 1XR1A 3K5UA 4RT7A 4DE4A 4IC7A 5M55A 3C7QA 4AF3A 4LRMA 2C1BA 1WBSA 2UZOA 3EN7A 2YAKA 5KUPA 4L45A 1B39A 4P4CA 1YI3A 2PYWA 4F0IA 3ZZEA 4XV3A 1OMWA 3I5NA 3U87A 1ZLTA 5CEPA 5C9CA 4DEGA 4DGNA 3MJ2A 3WILA 4LYNA 2GQGA 1F3MC 2YHVA 4Z16A 4G17A 2CJMA 1WBVA 4FVPA 1PW2A 5CSWA 4BTKA 4AUAA 4YURA 3WIGA 4D1SA 2ONLC 3QX4A 4Y72A 5JK3A 2YA9A 4O0XA 5L6WL 4QMYA 4J1RA 1YVJA 3DB8A 2IW8A 4K8AA 4W4YA 3R8MA 3BU6A 4J99A 2OG8A 3QD2B 1WFCA 2CDZA 5FXRA 2AUHA 2UZLA 1E1VA 3WBLA 2QI8A 3OTUA 1DS5A 4XG4A 2CKOA 4S34A 4WG3A 1AGWA 1OKZA 3C4CA 3LPBA 5I9UA 5I9ZA 3TNQB 3H10A 4IMYA 1M17A 2EXCX 3DKOA 3N4VA 2PTKA 2X9FA 3E87A 4HVSA 1VR2A 3VBVA 3R1NA 3UC3A 5I0BA 1BUHA 2BKZA 5HIDA 4EZ3A 5K5XA 3TL8A 4Q5EA 4TWOA 3MVMA 5AUTA 2H8HA 3MVHA 2GNLA 2VRXA 4PDSA 3NUUA 2XKFA 3BHVA 3TV7A 5HLWA 3RPVA 4I93A 5M4IA 4U8ZA 3R2YA 4XG6A 5CANA 2W5AA 3AD4A 4ZXTA 4MKCA 5DR2A 4ASEA 5KMLA 1KUTA 4AGDA 1G8KA 5CNNA 4OLIA 3VUMA 4IEBA 2A0CX 4A9YA 2BRGA 3M11A 5CXHA 2Y4IC 4E1ZA 4QMMA 5DYJA 5AUZA 4GKIA 2FO0A 3FBVA 2OIQA 2HIWA 2QCSA 5IA2A 2Z7QA 3QRJA 3HUBA 3BQCA 3HMOA 4DGLC 3ODZX 1TFFA 4EK5A 5ETCA 5TO8A 1ZARA 3BLRA 4AW1A 2XIRA 1KV1A 5JQ5A 4DT8A 3PIYA 2YAAA 5E9EA 2QQ7A 2VV9A 4EH9A 5BVDA 1SVHA 4QPSA 3CE3A 4ALWA 4YBJA 5DHJA 3NUAA 2PZRA 4P2KA 3HGKA 4K6ZA 3ZUVA 3C51A 3LCKA 4FE2A 4KBAA 3UYTA 2VGPA 3WZKA 4XX9A 5HD4A 3A7FA 3LFFA 4CKJA 3GUBA 3WI6A 4JDKA 4YJTA 4EOIA 3GI3A 4FSUA 3ETAA 3U4UA 4YJNA 4FTLA 4L7FA 4UXQA 1OL6A 3PXRA 4AOJA 2VUWA 2ETKA 3BYUA 4FKOA 1JSVA 3PPKA 5A4EA 4ZLZA 5CU0A 1KOAA 4AXDA 2XS0A 1OPLA 3QHRA 3BL7A 4BZDA 4JDJA 3SA0A 4RJ4A 3FXWA 4CQEA 4XV9A 2OJJA 4GK2A 2P2IA 3Q9XA 3BBTB 4IAFA 4S32A 2X7OA 3VUGA 1OB3A 1IAHA 4AZTA 3FQEA 3BWFA 4EH4A 1QPDA 3ELJA 2XBAA 4RWJA 3OFMA 3EQFA 5CNOA 4O21A 2B1PA 2Y4PA 4IZ7A 2J4ZA 2P55A 4I6HA 4NYEA 3SG9A 4TYHA 2R5TA 4QMVA 4YJOA 2YABA 2JDVA 2WMUA 3Q9ZA 3K3IA 3FI4A 2WGJA 2E9VA 4FOCA 4C4HA 2VTNA 1LEZA 2OFVA 4FKVA 4RZVA 5HE2A 2LAVA 4ZLYA 3NUNA 4IAZA 5A46A 2QU6A 3ET7A 4HVIA 2IVSA 4FBXA 4KIOA 4NM0A 4XBRA 3AKKA 3S95A 4G1WA 4D4SA 4EOQA 4QEBA 2YISA 4MVFA 1UU7A 2VO7A 3GENA 3NYNA 4OTFA 2XEYA 4EUTA 5IQAA 2VGOA 3VHKA 2J5FA 4IFGA 5E90A 4CT1A 5C8KA 4AXEA 5EM5A 4DH7A 2VNYA 3AD5A 1SMHA 3G90X 4FYOA 4R7IA 4J96A 3MFTA 1L3RE 3WF7A 5KMMA 3H9OA 4F63A 3CKXA 1TQMA 2O8YA 3CLYA 3ZOSA 3O5AA 2X8DA 2AEGA 4M3QA 3VO3A 4E7WA 5BVKA 4H39A 4U80A 2ZMCA 3QKMA 1JBPE 2J51A 5BUEA 3OBJA 2X81A 3VN9A 4BB4A 2VTHA 3C9WA 1IA9A 4AP7A 4EKLA 5KZ0A 4C3FA 1W82A 5DA3A 4H1JA 3FSKA 1TQIA 3HV7A 4ZP5A 2X6DA 5E7RA 3NR9A 4WZYA 3DK6A 2GMXA 1YI4A 3DFCB 2XIXA 3ORIA 3Q6WA 2JIUA 2VD5A 2PE0A 3DXQA 3AMYA 3IDCA 3IKAA 3IW6A 4GG5A 4QMXA 5DVRA 4E20A 4EBVA 4N0SA 4Y83A 2HWPA 4FVQA 4DHIB 1WAKA 4O81A 1P5EA 3WZUA 4DFUA 2W1CA 4B7TA 1BX6A 4O91A 2UW5A 4OBQA 3DBCA 4G31A 4I20A 3GC0A 3PFQA 3TKIA 2W9FB 4F99A 3ZBXA 2B55A 1VEBA 3N9XA 2F7ZE 4IB0A 1YDSE 2QVSE 2WMSA 3FI8A 4I5CA 4G34A 3MVLA 5L2IA 2VNWA 4BTJA 2XJ1A 3SXFA 2DS1A 3VHEA 4C4JA 4DH5A 4Y8DA 2VTOA 4FZ7A 3UOLA 5I9YA 4IVCA 3TNHA 2G2FA 3MB7A 4GJ3A 1BI7A 5LCJA 3SD0A 5AIKA 1NXKA 1O6KA 4X2NA 1JKLA 3QTQA 3U4WA 5CWZA 1JSTA 3FMHA 2Z7LA 3W0PA 2PL0A 3V6SA 1AD5A 1RW8A 3T3UA 5CEMA 4IM0A 3ORXA 3C13A 2UW8A 3SAYA 3TM0A 3BHYA 3C1XA 4O0VA 3R8UA 2YCQA 1VJYA 2XUUA 4G5JA 3R22A 3PWDA 4Z7HA 3UDTA 3HDMA 3GCSA 3PZHA 3Q04A 2KULA 5J7HA 4QMQA 3FMNA 3IDPA 3PYYA 5M06A 4K33A 3RHXA 4BBMA 2W1DA 4NKAA 5J8IA 3VBWA 5LVPA 2JKQA 2IW6A 4WRSA 4V04A 3IW4A 3ZU7A 2ZV7A 4O6EA 4U94A 4JX7A 3PJ1A 5DBXA 2RFNA 4DLIA 2CCHA 2RFSA 5D41A 1SNXA 4C2VA 5L6OA 4IWPA 3QGYA 4XRLA 2BHHA 5FTOA 4EWHA 3AT2A 3GQIA 4CZTA 4EOMA 5I9WA 2XNBA 2GNFA 2ETMA 4JL9A 4LM5A 2VO6A 4O0YA 3G51A 4JOAA 3SHEA 5K3YA 4R6VA 4LQMA 4LUEA 3F3TA 4FL3A 4V05A 4TTHB 1BL7A 5CAOA 5M56A 3S0OA 3LQ8A 2ZM3A 4PQNA 4DEDA 3JVRA 2OI4X 4NM5A 4MXAA 5BQ0A 4QDEA 4YBKA 4I92A 4JR3A 4BR3A 3EQBA 4D2RA 5J5SA 1GY3A 5CU3A 4EK4A 3NZ0A 3AC1A 1YHSA 3JYAA 4RWIA 4XJ0A 3KIOC 4IW0A 2GU8A 5E8TA 1VZOA 2P33A 4RLLA 4GMYA 3NGAA 4JBQA 5J9YA 4IM3A 4CLIA 3RMFA 5AEPA 4GG7A 3EYHA 5AMNA 2C5NA 2UZNA 2R64A 3EOCA 4QTDA 4D5HA 5IQEA 4QMPA 3DAKA 3FI3A 4ZY5A 4ZS4A 4UYAA 3KXMA 4WHZA 3SRVA 4FTMA 2X8EA 5I9VA 1NVSA 4O0WA 4C02A 5FEEA 2JLDA 4IC8A 3E64A 5JFXA 5FDPA 3CKWA 4QDVA 4TL0A 4P5QA 4MWHA 2FA2A 4YPDA 3I1AA 2WQEA 3SLSA 3UOHA 4XEYA 2VWBA 5DEWA 4KS8A 2YZAA 3MA3A 3R9OA 1ZXEA 2B9JA 3GVUA 5BNJA 4XG2A 3DKGA 4AZVA 2PMOX 1YI6A 2EWAA 2V22A 2YEXA 4EH2A 4F08A 1L8TA 2BPMA 4C2WA 5HG5A 4E6AA 4QP7A 1UU9A 5HHWA 3L9PA 1GAGA 2C6DA 4FSYA 4BDFA 4GT4A 3GP0A 1OBDA 5EH0A 4I5PA 1J7UA 2OZAA 3IGOA 2QOFA 1H28A 4D0XA 3GBZA 3BI6A 2PMLX 4JMQA 4N6ZA 3BRBA 2XNPA 3HVCA 4EHZA 4ENXA 4F9CA 3RK5A 4F64A 3I4BA 2PUIA 3R02A 1UWHA 3THBA 1M14A 5E8SA 4EHVA 3UO5A 3UTOA 3OWPA 2VWXA 1SYKA 1Q99A 3Q4ZA 3TKHA 5E8ZA 4F09A 4PV0A 1YXVA 3BYOA 3D94A 2WNTA 4LL0A 3ZDUA 4ANLA 4YZNA 3CTJA 4WNOA 1CDKA 3MFUA 4CMUA 2E2BA 3DNDA 1M52A 2WU7A 4QMUA 2QC6A 4L3JA 3E93A 4RX7A 4EKKA 1KE6A 4KSPA 3RP9A 1V1KA 3BLHA 4RFMA 2C47A 1S9IA 4RSSA 4QMTA 4IADA 4E5BA 2BAJA 4BYIA 3BBWA 5HD7A 3ZZWA 1OIRA 4FTQA 4F6SA 4JX3A 3ZLXA 3GQLA 4EI4A 2QOCA 4FX3A 3GEQA 4NTSA 3OD6X 1HCKA 3PUPA 5BYYA 5LOHA 3MSSA 5HTBA 2Q0BA 1J7LA 4PL3A 4WUNA 2YWVA 4IDTA 2C1AA 3DDQA 4QYYA 4WT6A 3E63A 3E7OA 3WF6A 3L9LA 4FG8A 2ERZE 3SGCA 3D5UA 4H58A 3O8TA 4O7SA 4MNEB 4J97A 3ENHA 2ZV2A 3UVQA 3VC4A 3MPAA 3A2CA 2WTCA 4FV6A 3UDZA 1IEPA 4AXFA 2EUFB 1A9UA 5KMOA 2YWPA 3LLAA 2PZYA 3TNPC 1YHVA 4Y5HA 3FUPA 4EQUA 4CEGA 2VTRA 4O7RA 4EK6A 3DLZA 3QD4A 3UOKA 3CP9A 3O50A 1Y57A 2GS6A 4AN2A 3OXZA 4DFXE 3PXFA 4MX9A 5IDNA 4ACDA 5JSMA 3CY3A 3FZTA 3FAAA 1JWHA 5IH4A 3SC1A 2IO6A 3FMMA 1MRYA 4EYJA 4AW5A 5LXMA 2PVMA 1FPUA 3IO7A 3R1YA 4GS6A 3TIYA 3TYKA 3ULZA 4AGUA 5HG7A 5HI2A 4X6QC 5HE1A 1ZMWA 3Q60A 4Z7GA 4FT7A 5J9ZA 3UO6A 1Y8YA 4I6FA 2YM8A 2JDTA 2JKMA 4D1ZA 5LMKC 4BIBA 4MCVA 4DFLA 5J9LA 2SRCA 2ZM1A 3IONA 1I09A 2RKUA 3SOCA 3TACA 4DCAA 3VW6A 3NAXA 3QRUA 4O38A 4MF1A 4OBPA 5EKNA 5JQ8A 4KABA 1J3HA 3QALE 1CKPA 3IW7A 4GU9A 2WPAA 3LIJA 3NEWA 3QAME 2Q83A 4BDBA 4BDAA 1WBNA 3ZRLA 2O0UA 2R3HA 3TCPA 3W2OA 3PE2A 2VTLA 3PJ8A 4R77A 2PUNA 3V51A 2RG6A 5KMNA 1Z5MA 5BYLA 4L3PA 2G1TA 4ACHA 2Y9QA 5H8EA 3NUYA 3NUSA 4M13A 4AU8A 3OCBA 4USDA 4C59A 5CF6A 2QG5A 3RAKA 5C8MA 3A99A 3GC8A 3Q3BA 4CMTA 2Y0AA 3R01A 3I60A 3WOWA 4CGAA 4OTDA 4USFA 4I4EA 1WVYA 5B2MA 3D5XA 5HBJA 5K9IA 3N4TA 4MQ2A 5AAGA 1YOLA 4PL4A 4R7HA 3G9LX 5E8YA 4TN6A 1PMUA 3UPXA 5AWMA 3W8QA 4LOOA 3HP2A 2Z2WA 3CCNA 4DEAA 5TR6A 3BCEA 3C50A 1F5QA 2VTJA 2C69A 3KRWA 3MFSA 4FYNA 1ZYLA 3A8WA 5KX8A 1CTPE 5K5NA 4CFFA 4DBNA 4Q5HA 4GSBA 4F9AA 4I6QA 3R7EA 1H1PA 4KSQA 5L6PA 4J71A 3QLFA 1PXKA 3VWAA 1PMVA 3OS3A 3G33A 3F7ZA 2VX0A 5BVWA 4O0SA 1R0EA 3OWLA 3PLSA 4JQEA 3JY0A 2VTAA 5JN2A 3P9JA 3DAJA 3PJ3A 4HGLA 4FTKA 1PXMA 3LCSA 3QQLA 4G5PA 4MXZA 3W0OA 3TKUA 3IGGA 4DDGA 2YIRA 3OXTA 4BCQA 2FSLX 4AN3A 2GHGA 4DF3A 2JKKA 5EYMA 4KD1A 4FTCA 3D4QA 4G6NA 2P3GX 5KKRC 1U5QA 4PF4A 2WOUA 4APCA 3ALNA 3UP2A 4BKJA 5CSHA 2QO9A 3ZSGA 3WF9A 5H8BA 5AX9A 5I4NA 5ANGA 2R0IA 5HNGA 2QONA 3BX5A 2GQSA 1ZZ2A 4HPUE 3HMMA 5M07A 3P7CA 1Q3WA 3FMEA 3BL9A 3Q5ZA 5AUWA 5AADA 1H26A 2XF0A 5LVMA 4FT0A 1IRKA 4QMZA 3V8SA 3QKLA 4MEDA 3IOKA 4HGEA 5KBQA 5CAVA 2CGVA 3FC2A 4XG3A 2ZV8A 3OHTA 4ANBA 3V6RA 1XJDA 2FSTX 1FQ1B 2W05A 3PIXA 3F82A 3R30A 4RJ5A 3HUCA 3WE4A 4WSYA 4YR8A 3VS6A 3QZGA 2R3KA 4J7BA 5CSXA 2X8IA 4E5AX 2R3QA 5AUUA 3RK9A 3GU4A 3QFVA 1H1RA 3F5PA 4IVBA 4NTTA 4F9YA 3C0GA 3CC6A 3FLWA 3DFAA 3O71A 3OT8A 3VF9A 3EQGA 2WMWA 5DR9A 5E8XA 3PTGA 2PK9A 4GYGA 1JVPP 5JGAA 2W96B 4L3LA 2PU8A 2WMBA 5BUIA 4FTOA 4ZSAA 1B38A 3NUXA 1XHAA 3C4XA 3F3ZA 3HA8A 4TT7A 5LMKA 5EKOA 4IDVA 1Q61A 2HY0A 2C5XA 4KRDA 4ZMEA 5EHLA 2BKKA 4JG8A 4WNMA 3PVWA 3UDBA 4G3EA 4AZSA 1UWJA 4MXOA 5B7VA 4OTWA 4XP2A 3IK3A 1WVXA 4FZFB 4WKQA 5IPJA 1WZYA 4QP8A 5DGZA 5ANIA 5HU9A 3C5UA 1FMOE 5FDXA 3PXYA 4FIFA 4OT5A 3AMBA 2ZMDA 5A6OA 3C0IA 2WU6A 4UZDA 2WMVA 1M7NA 4EONA 4ACCA 5JFVA 5GJGA 4QP9A 4EH3A 3MJ1A 1SVEA 2XJ0A 2OXDA 2B0QA 5FM3A 5M53A 2W1GA 4TWPA 4C36A 4ENYA 3ZFXA 1FOTA 4IM2A 3ZM4A 4FV4A 1ST0A 1OZ1A 2BRHA 2UV2A 4I41A 1H00A 4UWBA 5BPYA 4UXLA 3KEXA 1ZMVA 2B4SB 5TOZA 4A9TA 3EWHA 2BDJA 4OTGA 4WRGA 2QOLA 4XRJA 5AP0A 3TZ9A 4F0FA 5IEXA 4U5JA 5EW8A 4HYSA 1DI8A 4FKTA 4FVRA 3MH2A 5I9XA 4DGOA 4QTCA 5E8UA 2O65A 3DBFA 2XYNA 3MDYA 3R73A 4QT1A 4GU6A 2F57A 5M4UA 4AW2A 2VTMA 2FVDA 2WKMA 3S3IA 3PVBA 4I21A 1W83A 2XANA 3AXWA 3O0GA 1R0PA 3FZ1A 3R7UA 4FKRA 4XLIA 2OXXA 4RC3A 3CBLA 5AUYA 4DHJA 1SNUA 3FHIA 2R0UA 5ICPA 3ZDIA 4FKQA 1PXIA 2R7BA 4MQ1A 4X2KA 5DWRA 3V5TA 5HCXA 3W55A 4LMNA 3WZDA 4AZFA 4C58A 3HMPA 3HP5A 2P4IA 2GNIA 2PZPA 4ZJIA 1YWRA 2FGIA 3A4OX 4BBEA 4XBUA 4DH8A 5JRQA 4WO5A 5HBEA 3E8NA 3RWPA 3QGWA 3L9NA 5HLNA 4OR5A 3QU0A 5LMBA 1P14A 2I7QA 2HZ4A 3E92A 5E1SA 2DYLA 2FSMX 3L8VA 2FSOX 2OF2A 4N4SA 3ZUTA 4RIWB 3RTPA 4XHKB 1JLUE 3MH0A 4RA5A 1NA7A 4FSWA 2C6TA 3OVVA 1DI9A 1OPJA 3HKOA 3OF0A 2ITQA 5FUTA 4CXAA 5F1ZA 3ZSIA 5G6VA 2NPQA 4DITA 5HTCA 5JGDA 3HMNA 4W8DA 5DFPA 1H25A 3LZBA 1YDTE 2WD1A 4QMSA 1GZ8A 1OVEA 2WZJA 3F3WA 3UJGA 3GU6A 4V0GB 3UDSA 4EL9A 5HG9A 5AV4A 1Q4LA 1ZYCA 2XK4A 4GK4A 2C3JA 5BVOA 3KC3A 4YTHA 4FIJA 2BCJA 1OUYA 2F7XE 1W7HA 5AP1A 3V5LA 4CD0A 5IQHA 2WTKB 4A7CA 2Y7JA 3W0RA 1W8CA 2W1HA 3RWQA 3AT4A 3EMGA 4FC0A 3MTFA 5A14A 5CXZA 4O7YA 3QQJA 4U42A 3B2WA 4DTKA 3PY1A 4PX6A 3FKOA 2E9OA 3PA5A 1V0BA 3KL8A 3LM0A 3MV5A 2DQ7X 3PFYA 3UZRA 3L1SA 4HNFA 1YQJA 5CU4A 3W0NA 4B8LA 4BDGA 4CFNA 3TZ7A 5EM7A 3QWJA 4DEBA 3RINA 3QUPA 3VS0A 4MBLA 3I0QA 5HO8A 1KE8A 4J95A 5AIRA 3QTWA 5EI8A 2WHBA 2V0DA 5HICA 4MXCA 3DPKA 3RKBA 4DA5A 4MYGA 2QHNA 4LMUA 3VUIA 4FNYA 4C3PA 5IEVA 3CSVA 4WUAA 2JAMA 3L8SA 4FV8A 5AP7A 5BX0A 3R9HA 3ZO4A 2B52A 2XIYA 3PXKA 3UVPA 3ZRMA 2QR7A 3QRIA 2XBJA 2BDWA 4WBBB 4NZWB 2ITPA 1MUOA 5ANJA 2R3FA 4U0IA 2WIPA 1SM2A 5B2LA 1E1XA 3QYWA 3NIEA 3TT0A 1GZKA 4M15A 1JOWB 4C4IA 3LFAA 4DFBA 3PJ2A 3CQEA 3D14A 5AP3A 5H8GA 1ZMUA 4FJVA 4XP3A 3FPQA 1QPCA 4ZTQA 3BYVA 2OLCA 2BZHB 1REJA 4RIOA 2GCDA 2WTIA 3NCGA 3OY1A 4MBIA 2OF4A 3EN6A 3QCSA 2ZB0A 4FNWA 3UOJA 4DINA 5B2KA 4K11A 4MD8E 5HLPA 5KBRA 1UU8A 3P1AA 2PVNA 4CFUA 2JFMA 2CMWA 3TNWA 4O84A 2JEDA 2YERA 4C0TA 3DJ6A 2BVAA 1MRUA 3RI1A 4D4YA 3PRIA 3FZRA 3U9NA 2QO7A 4BGGA 3FWQA 2OJ9A 2I0VA 2WB8A 3ORZA 1O9UA 3QKKA 1Q5KA 3QTSA 4YLLA 4ZTNA 3DK7A 1PXNA 3GCQA 4EORA 4M69B 4M84A 4NM7A 3ZXZA 3TTIA 2VTSA 4X3FB 1PXOA 1ZZLA 3OCGA 2KTYA 1YW2A 5LWMA 3OTVA 4Y5QA 5DT3A 4FIIA 1R39A 4HVDA 3COMA 4B8MA 4A07A 3V04A 4YJPA 1PYXA 2QO2A 3MFRA 2BFYA 1H1SA 4OT6A 4IAIA 2NP8A 2XYUA 2VO0A 3QL8A 3ZUUA 3TXOA 4PNIA 4F70A 3UG1A 2R4BA 3O2MA 1R3CA 3UIMA 2HZNA 4FL2A 4BDEA 2IN6A 4FI1A 2RL5A 3U55A 2ZYBA 2UW9A 3ZLWA 4IJ9A 3QRKA 2PVKA 4K77A