4FEUA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor anthrapyrazolone sp600125
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
253
Chain Sequence
LDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4feuA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4feuA02
1K3AA 2CN8A 5ACBC 4BDHA 3QQKA 1OUKA 2OFVA 3D2IA 3ETAA 4XLVA 2OJIA 4D0XA 2XKFA 4PP7A 3D0EA 4FVRA 2IVSA 5J95A 4EOMA 4I4EA 3AC5A 2B4SB 2A0CX 2PUPA 4XG9A 4OUCA 2CGUA 4FT3A 5F4NA 4DFYA 4Y73A 5J9YA 3LOKA 3R02A 2OU7A 3MJ1A 5FTOA 2EUFB 5C8NA 5LVLA 4R78A 5DT4A 3BE2A 3SDJA 2WTCA 4GS6A 4JBOA 5E8XA 4B9DA 3P7BA 4AFEA 4YSJA 4RIWA 3V01A 4R3PA 5J1WA 2W99B 2XNBA 4DG2E 2GNIA 2EU9A 5H2UA 4X3JA 4ZSLA 4BHNA 2XMYA 3Q52A 5HVYA 3NUSA 3LKMA 4QTAA 2VGPA 2CPKE 2XJ0A 3GP0A 1KWPA 3Q6UA 4FV0A 4MNFA 2PYWA 2WTJA 5GNKA 3U4UA 3NYNA 3O71A 4FTLA 3UZRA 5IQEA 4FTMA 2R3FA 4JBPA 4GK2A 2JGZA 1R0EA 3AT3A 4IB5A 4C38A 1PHKA 2CSNA 4UV0A 4WSYA 5HG7A 5CF5A 3DBFA 4GKHA 4F6WA 4BTMA 2GU8A 3QRUA 3ZCLA 5D12A 2JKMA 3NSZA 5DOSA 3DFAA 4I0TA 2C3LA 3II5A 3CXWA 3U6IA 4YJUA 2BZIB 2W1HA 3FYJX 4FUXA 5CENA 5DRDA 2XIYA 1NVQA 1YOMA 4RFYA 1OPKA 2W1GA 2CNVA 1WBTA 4C7TA 2XYUA 2P33A 4LG4A 3QQFA 4LL0A 3ATSA 3EWHA 1YOLA 3A99A 4PRJA 4AUAA 2H9VA 4UZDA 4YHFA 3NYXA 4BBFA 2BR1A 4O0RA 4O7YA 3RWQA 1A06A 2GTNA 4IDVA 4O7ZA 5ACKA 3RVGA 2BHHA 2QNJA 3FC2A 4UXLA 2OH4A 2PMIA 4R7IA 5E9EA 5FBNC 3E92A 5CSHA 3UQCA 3V3VA 2CKQA 2FSMX 3GU4A 2B54A 3RHXA 4YTCA 3MBLA 3OBGA 4LFIA 4FX3A 3MN3A 2C5VA 4IMYA 4C61A 3PXYA 4KA3A 1J91A 1JWHA 2I40A 4JQ8A 4U44A 5H9BA 4CRSA 4ZK5A 4M68A 3FPQA 1ZOHA 2ITOA 3VS5A 2W5AA 2R3NA 3L9NA 4I6HA 1LUFA 2XBJA 5A4LA 2VO3A 3TV6A 3E7VA 4HCVA 1YXTA 4HVDA 2WZJA 4YBJA 1JNKA 2G2IA 2QOIA 3QA8A 3V6RA 4CMOA 3EN7A 3ZC5A 4RGJA 4KSPA 5GJDA 3AMAA 3SG9A 4FMQA 2FGIA 3K54A 2IW9A 4A06A 5KNJA 5L2TA 4I6QA 4M84A 4G34A 4J1RA 4W4VA 4PMTA 4BRXA 4KRCA 5HG8A 3VF8A 3S3IA 1NXKA 3BYVA 3C4ZA 4U43A 2PSQA 1YDRE 3N9XA 2RF9A 4I3ZA 3CEKA 4CGAA 2JC6A 4QP7A 4FSTA 2YIQA 3QRTA 3HUBA 4IAFA 2VWIA 4B0GA 3QD2B 3F5UA 4OTWA 4QMPA 3C0GA 1SVGA 3C50A 3NMUF 3Q96A 4K8AA 3THBA 1AD5A 4ANSA 4DFZE 2PVRA 1ZMWA 4DBXA 2DYLA 1R39A 1W0XC 4YC6A 2YAKA 1FINA 5ETIA 3BEGA 1REKA 4KIPA 4XV1A 3TKUA 3F2RA 1OI9A 3QX2A 3PVBA 3IDPA 3HDMA 4FTRA 4AG8A 4DAWA 2GQGA 3A60A 3CLYA 5AJQA 3B2WA 3GCPA 1U59A 4O0WA 4D4VA 2V0DA 1TKIA 2PULA 4BCMA 4E4XA 4WO5A 3KXXA 3G6HA 4QQTA 4AE9A 3A7IA 4AZTA 1OIRA 5FUTA 3E8NA 3F3WA 4QO9A 1E1XA 5ANKA 4EHVA 5JMSA 3P23A 3DAKA 5E91A 3F5XA 4FIFA 1MRVA 2F2CB 2XKCA 3U9CA 2JKQA 3UO6A 4ITJA 4ASEA 4BDDA 3N51A 2QONA 4K9YA 1UKHA 4RX5A 4N0SA 2OF4A 4YJNA 3R8LA 3VHEA 3QQHA 3KF4A 1E9HA 1U4DA 3L9LA 2C6MA 4JX7A 3R7YA 4BCGA 4WG3A 1DM2A 5EQEA 4D58A 4X3FB 4F99A 3SHEA 5L2WA 1H01A 2H96A 4UZHA 4MAOA 3ROYA 3WE8A 4FODA 5HE2A 4ERWA 4YNEA 5KUPA 2QLQA 4M15A 3RZBA 4BDFA 2CGXA 1H1WA 1OL5A 4HYIA 4KBCA 3LPBA 4G16A 1NY3A 1PJKA 4R3CA 3NUUA 4YPSA 2F2UA 3E62A 4P4CA 4BYIA 5IEYA 1X8BA 5M55A 3F66A 5IDNA 1OPLA 5AP6A 3UDBA 4MYGA 5IH4A 4ZMFA 5C01A 5EW3A 3H4JA 3OWPA 4DTKA 2BCJA 4PX6A 2I0EA 2B53A 3Q4TA 1ATPE 3FZOA 4YPDA 4EH3A 3NLBA 4PV0A 3NIZA 4AA4A 3HA6A 3MB6A 3NUAA 3A7HA 4HW7A 2ITPA 2G15A 3R7UA 4CG9A 1IRKA 2E9UA 4PL4A 3QHWA 4ZZMA 5M09A 3WE4A 3R2YA 3QCQA 3LM0A 3V5LA 4TPTA 4J95A 2VTAA 2CNUA 3REPA 5CU6A 3PY1A 4O7OA 3OTUA 3MA6A 4EUTA 4O7PA 4LQMA 4AWIA 3EQFA 5LMAA 1GIIA 4XG7A 4YC8A 1JSUA 3QRKA 4EHEA 4D2RA 3UQGA 4WNMA 1LEZA 2G2HA 3PIZA 1R78A 1XR1A 5HHWA 1GAGA 3AGMA 3HV7A 5EW8A 4ZTRA 3EB0A 4L44A 4PNKA 2YJSA 3SXSA 4RLKA 4C3RA 1KOAA 4V04A 4U3YA 2RFSA 4QP4A 2X8EA 2UZDA 2WNTA 3KXNA 4H05A 3W0NA 4CV8A 3VAPA 2ITTA 1WZYA 1H0WA 2UZBA 3EQDA 4BIDA 3I5ZA 1H1RA 3DQXA 3NNUA 3ZTXA 3P1AA 2C0OA 2XVDA 4FICA 2WU7A 4CCBA 3E63A 3TZ7A 1WBPA 3CTJA 3F82A 4BCHA 3U6JA 3PFQA 2UZOA 3AGLA 2J2IB 4FKOA 1JQHA 4YC3A 5FEEA 5A6NA 2W1FA 4WRGA 4EH8A 2G2FA 5CY3A 4DHFA 4FV7A 2JDOA 2W1CA 3TNHA 4LOPA 3TUBA 3U4WA 2C47A 3I1AA 3VQUA 5G1XA 5CEPA 4USFA 2V5QA 3D7TA 3VJNA 1JPAA 3KCKA 5FP5A 4AU8A 3UP2A 4A9YA 1KSWA 2I0VA 3QWJA 1UNLA 3LJ0A 3TL8A 4BICA 3KRJA 3MJ2A 4O27B 5L2IA 3OWLA 5AAGA 3E3BX 4KS8A 3EQCA 2ETKA 3HECA 4I0SA 2W9FB 3QF9A 1DAYA 4CD0A 4OTRA 5TT7A 4CT1A 4EOOA 4I5CA 2E9VA 3B2TA 3JS2A 2C5YA 2VWYA 4ALUA 3V5PA 2HIWA 1OBDA 4FOCA 4APPA 4IVDA 5ETAA 3IECA 3LFDA 1FVTA 5I9UA 5C8KA 5HD7A 1B6CB 3UGCA 1RE8A 4XP2A 2G1TA 3QZIA 4RJ4A 4FTUA 2XIZA 3NUYA 3EYGA 2WTKB 3I0OA 3R1NA 5C27A 3L8SA 5AUVA 2WMRA 2C1AA 2HXQA 4GUBA 3LW0A 4MNEA 5B2MA 2JIUA 4Q9ZA 3Q5ZA 4RX9A 4YTHA 5A4TA 2NPQA 3AC1A 5M06A 4ZLZA 2QG7A 3PIXA 4XUFA 2VWVA 3W2CA 4HNFA 2X2KA 1M7QA 3GC7A 3F88A 3LJ1A 3W10A 1RJBA 1XBBA 4JT3A 3EZRA 3HP2A 4OBOA 4F9BA 5CNNA 5C9CA 4DITA 3OC1A 3T9IA 4G3EA 5DT0A 5HO7A 5HTCA 4EH6A 5DNRA 3FYKX 5JSMA 1OMWA 3VC4A 3HMPA 3LFNA 2ESMA 5IA5A 1NA7A 3CR0A 4IIRA 4RJ6A 3P7AA 1WFCA 4TY1A 1H00A 4L42A 1H27A 3L8PA 4AN3A 1ZYJA 2C4GA 3BV2A 2YDIA 3QQGA 3ZO2A 5TO8A 4O82A 3VBVA 4U41A 3VVHA 3LCKA 3MW1A 5H8EA 3DXPA 3QRIA 3IO7A 1PYEA 2C6TA 4O91A 2YDKA 3TYKA 5CI7A 3E3PA 2C3KA 3HKOA 4QMZA 3C7QA 4O86A 5KZ0A 4WT6A 5HGIA 2O5KA 1I09A 2Z7RA 3SRVA 2RIOA 3E88A 1FOTA 2BUJA 1BLXA 5JGBA 4GU6A 4L45A 3FL5A 5EKOA 3LHJA 1KV1A 2OKRA 2AYPA 2JBPA 3ERKA 3P5KA 3PJ8A 5D9HA 5EI6A 3T3VA 2JFMA 1Q3DA 4GFOA 3WF5A 2ACXA 3SVVA 4NKSA 4EQMA 4AT5A 3GBZA 3AD6A 3DV3A 2X7OA 4QMYA 1GZNA 1ZMUA 4L68A 4CZTA 2VWUA 2J7TA 3WF8A 2F7EE 1OKVA 2VN9A 4B8MA 1FGIA 1P4FA 4Y46A 4N6ZA 4C4JA 1XH5A 3A7GA 1BI7A 2ONLA 4P5QA 4KINA 4TTHB 1M7NA 2WO6A 2HXLA 3DZQA 2GS7A 3KFAA 4GUEA 5HBEA 2OK1A 3POZA 4FV4A 5HCXA 3I5NA 3ZSIA 5IISA 4J99A 3BQCA 3FI3A 4BGQA 5IDPA 3AMYA 3F3VA 3QKKA 4BCQA 3W2QA 2PVKA 2OO8X 3PA5A 4FEXA 2R3LA 1W98A 3BZ3A 3OEZA 1UKIA 1UVRA 4NUSA 3NS9A 4FKSA 3RCDA 5L2SA 2YCFA 3ALOA 4FSUA 4U80A 2R64A 4E5AX 2XJ1A 3DBQA 4G6OA 4CFFA 3CTQA 5AM7A 2OIBA 2ZMDA 4HZSA 2ZAZA 3TKHA 4CG8A 4CLIA 2PMNX 3ROCA 4NIFB 3HMIA 3WZDA 2XF0A 1UV5A 3WYXA 5C4LA 1LEWA 4FV5A 4GCJA 4IX6A 1QPJA 3SD0A 4S31A 2QKRA 3D83A 5JRSA 1UU9A 4UXQA 1Q8TA 3VUDA 4RIWB 2YIYA 3FLNC 2R7BA 4BI1A 3QD0A 4C0TA 3COKA 3O23A 4IADA 3UNZA 1HCLA 4BBMA 3ZFYA 3E8EA 4GFGA 2JIIA 5JKGA 3AMBA 2OI4X 3BLQA 1CKJA 3O8UA 4IDTA 4LGGA 4QP2A 4A7CA 3A8WA 3W0PA 3R8PA 3NAXA 4AT3A 3Q9XA 2XNOA 4DEBA 4I94A 3JVSA 2X6EA 3PSBA 2FSOX 3A7JA 4IANA 4IX4A 1ZARA 2CLXA 3ZH8A 4AQCA 4QQJA 4KABA 2GQRA 4EK3A 5BVNA 5GINE 3HRFA 4FKVA 2PUUA 4EJNA 1OIYA 4ZXTA 3A62A 3DS6A 5A9UA 4OBQA 3TT0A 1J3HA 4NKAA 3ORMA 1WCCA 1ZOGA 4HVGA 4ASXA 4GV1A 5I5ZA 2J0LA 3C4FA 4TYGA 4GK4A 5DRBA 4IAYA 4Z3VA 3CP9A 5JFXA 4MD7E 4BY9E 2C6LA 1PXKA 5F1ZA 4YJPA 2R3HA 4FA2A 4CKRA 3QZHA 3NCGA 3W1FA 4NZWB 4OTHA 1G8AA 4D4YA 5HLNA 4FTIA 2VWZA 3HZTA 4LV5A 4QMSA 4HYSA 1PW2A 4U81A 4LV8A 3R7VA 3VS6A 3POOA 3GI3A 3SGCA 3E8CA 1CKIA 2F9GA 4NFMA 5DIAA 3WOWA 4MQ2A 3QC9A 3MS9A 3TUCA 4BCKA 3BU6A 4FNYA 3TNPC 4YSMA 4E8AA 3G9LX 4RA4A 4RZWA 4TXCA 3RAIA 3R8ZA 4F9YA 2Y4IB 4C36A 3EFWA 3TJCA 4GW8A 1KE8A 4MBJA 4ZZOA 3SQQA 4XV3A 3ZBXA 5DE2A 2QU5A 3RK5A 5IEXA 1P2AA 4DT8A 4FGBA 5ANOA 2XK6A 4XP3A 5KMKA 5M08A 1O9UA 2RFDA 2YM4A 3NDMA 2XA4A 4NT4A 2R3PA 5AIRA 5HE1A 4WUAA 5JZJA 1OIUA 5CNOA 3MPAA 1TQPA 4JNWA 2ZM3A 5EW9A 3WARA 3TM0A 2YN8A 2XIKA 3VBWA 3I6UA 2WMVA 5HO8A 2X6DA 3KEXA 4QYEA 4TWPA 4M69B 3BWFA 3V8WA 3FKOA 5ANGA 4AW5A 3W2SA 2YFXA 5DR2A 4WNKA 3PSCA 5C8MA 1A9UA 4D1SA 4L3JA 1BL6A 1YHSA 1Z57A 2HENA 2PY3A 1ZMVA 3DXQA 3KU2A 4U42A 4MXOA 2GHMA 1MUOA 5EOBA 3W2RA 5EFQA 2NRUA 2YIRA 4IQ6A 5CYIA 5E8VA 2XRWA 2XK7A 3BQRA 4ZTLA 3R1SA 3HV6A 4NU1A 4LUEA 3CGOA 4JL9A 3BLRA 4QYGA 5IQIA 1GIJA 3EQPA 5HIEA 5LOHA 2PMOX 2XB7A 5DH3A 2WXVA 2BAJA 1PMEA 3KULB 2HWOA 1IA9A 2YEXA 3O8TA 3MTFA 2IVTA 5LMBA 4K2RA 1UWJA 2OJGA 3PLSA 2XNGA 1SNUA 3Q04A 2QHMA 2Y6OA 1XBCA 3QFVA 4YBKA 5EDRA 5HZNA 4EK4A 2ZDTA 4GVAA 3NVMB 4KIQA 4USEA 5BVKA 3BGZA 2A27A 1IAHA 4PQNA 4EH7A 1IA8A 4LRKA 3LXKA 4AX8A 4OBPA 4RX8A 4CNHA 4L7SA 1OZ1A 4I5MA 3IGOA 3RM6A 2JKKA 2QR8A 3IW6A 4BDAA 5IUGA 4ZLOA 5EHOA 4XOZA 5HIDA 4AF3A 4BGHA 5AUXA 4EBWA 3UIUA 2BRMA 2Y9QA 4JDIA 4KAOA 4TKSA 2BTSA 4U45A 4DEIA 5CT7A 2X81A 3HAVA 1MRYA 3MPTA 3BYUA 4GG5A 2R3RA 3G5DA 4OTGA 4O96A 2PE0A 3QKMA 4BVUA 4NK9A 4ITHA 2BKZA 2WKMA 4NM5A 3L8VA 3QKLA 4JDKA 3E8DA 3ELJA 4W4WA 3FLWA 4FEVA 5E1EA 4XV9A 5LARA 4L9IA 3G0FA 5HU3A 1CM8A 2GMXA 2XH5A 4APCA 2O2UA 1H24A 3F7WA 4U5JA 3VUHA 5M4IA 4FNWA 4YLJA 5JQ8A 3FMMA 4DINA 2WQMA 3Q2JA 4DH5A 5CSPA 3R00A 3AC8A 3FMKA 2GNFA 5A4CA 2QOBA 4FSQA 4MX9A 3H3CA 4IB3A 3RINA 4DFXE 4F7NA 4QNYA 4FVQA 4WNOA 4E5WA 4EQCA 4GH2A 3SC1A 3QYWA 4RLLA 4E20A 2UZNA 3ZO1A 5TKDA 4ZTQA 5GIOE 3VIDA 4L01A 3C0IA 3DK7A 1Q62A 4ZSAA 1U46A 4HNIA 1OB3A 1J7LA 3QXOA 2PZYA 3CE3A 2R3IA 4LRMA 3W18A 5M4CA 2QOLA 2PZRA 4USDA 4NL0A 2UW5A 2W17A 3LQ3A 5CT0A 3S2PA 3UIXA 1GZOA 1YXVA 5M4FA 3EQGA 5B2KA 4C2VA 3FY0A 3FZSA 2BILB 4A9TA 2XS0A 2YCSA 1WBOA 2C69A 4IFGA 1Q8UA 2GNJA 3NEWA 4L43A 3VF9A 4D1ZA 4IVAA 4UBAA 3FQHA 4DFBA 1JSTA 4GSBA 3FXZA 3KVXA 3W8QA 5BVFA 3MTLA 1S9IA 5KE0A 4PP9A 4RJ3A 4EI4A 1XQZA 4UX9A 1FQ1B 1W84A 3FY2A 3GU6A 3LXNA 3OEFX 4O7TA 5IG1A 5IQFA 2ERKA 5DEYA 3D94A 3DQWA 4FTKA 2B7AA 4CTBA 3BYOA 5DHJA 1WMKA 3HRCA 4I21A 3OBJA 3ZZEA 1TQIA 2GFCA 2VX3A 2WMWA 2I0HA 3JUHA 2ITZA 3LFSA 4FSMA 2C5XA 5HNBA 4A4XA 3ULIA 2VNWA 3HYHA 2R7IA 5HVJA 3ZFXA 3SXRA 3OY3A 3IOKA 4WD5A 3EYHA 4BDCA 1L8TA 4I5PA 3PG1A 2WTKC 3M42A 3PRIA 3E5AA 1YWNA 4F63A 3QQJA 3HNGA 2VTOA 4QMQA 1R1WA 1XH6A 3QGWA 4GL9A 3R30A 4IZAA 4IBMA 5CU0A 3PDTA 5CU4A 3D15A 5FG8A 4Z16A 2XBAA 1Q61A 3QCSA 3QRJA 5IA2A 4JQ7A 3D7TB 4PMMA 1KE9A 3ODZX 5FGKA 1NVRA 4QT1A 5F20A 4ZZNA 1PRYA 4O22A 3TNQB 1PXIA 2NRYA 4FV3A 1XBAA 4MBIA 5HICA 4X21A 5I9WA 1GJOA 4QQCA 4HGEA 4FUYA 4FTNA 5T6KA 5ICPA 4FK6A 3MFRA 5EQPA 4MWIA 3DT1A 3EN6A 1XWSA 4XBRA 4UALA 4FZAB 1XKKA 4IB1A 3CY3A 2QOOA 3EQIA 2QOFA 4L6QA 4QRCA 4F0IA 2A4LA 1H1PA 5GIPE 1ZOEA 3R21A 4GRBA 2QHNA 3OF0A 4IACA 4XYFA 5EI8A 3RPOA 2OGVA 2YZAA 5FTQA 4EH9A 3D7ZA 1M52A 4QTCA 5CAQA 3OWKA 3RK9A 3NUNA 5HX6A 3FJQE 3LQ5A 4QMWA 4HGTA 4MNEB 3VUGA 3NPCA 4JXFA 3UVQA 4YTFA 1U5RA 3BWJA 2J9MA 3OT8A 3DB8A 3G2FA 2YACA 1U54B 3LFAA 4G3DA 3C4CA 3Q60A 4JX3A 3SW4A 4EWHA 1UA2A 3RAHA 3MVMA 5CU2A 4O38A 3K3IA 3IQ7A 4A4OA 5BYYA 2QR7A 3R7IA 2R3JA 4MXAA 3QTXA 3PSDA 4WHZA 4XMOA 4F1MA 4XS2A 4IAZA 4HGLA 4NW5A 3UIBA 1HOWA 1G8SA 1H1SA 3KL8A 3NWWA 3CD8A 5DVRA 3BCEA 4YHTA 5BUJA 1P14A 2PVHA 3E93A 4DTAA 2XIXA 3KXHA 4LYNA 1KUTA 3V04A 2I0YA 2A2AA 2REIA 3GOKA 4MWHA 3EFJA 5JQ5A 1Y8YA 1J7UA 2FSLX 3HRBA 4AZSA 4ZY6A 3UVRA 4O81A 4FEUA 5E90A 4H39A 1OIQA 1AGWA 3P4KA 1GZKA 4BTKA 2QO9A 2E9NA 4RVTA 1GNGA 4L67A 5CVGA 2PPQA 2G01A 3BEAA 3MVJA 4XBUA 3TIYA 5HNIX 1K2PA 2J4ZA 3L8XA 3GXLA 1Q24A 3QLFA 2ITXA 4XJ0A 4ZTNA 4QP9A 2JIVA 4PL5A 3MIAA 2IVUA 4G5PA 3VS3A 4RC3A 4LOOA 3I6WA 4BF2A 4E4MA 3PRFA 5BUIA 4GG7A 2IG7A 2ITQA 4I1ZA 2BAKA 4DLIA 3FWQA 4U6RA 5IH5A 5HESA 1JSVA 2R5TA 3OMVA 4QP6A 3VHKA 1PXNA 2QD9A 4FTOA 4F6SA 3DTWA 1PY5A 4EHZA 4AN9A 2J5FA 5AV3A 1YW2A 1PMNA 3JY0A 3OCSA 5EOLA 4R1VA 5M07A 4MBLA 4IM3A 3ENHA 5AP4A 2YA9A 4JR3A 3HVCA 3S0OA 4OW8A 1O6YA 2Y7JA 4EQUA 4JOAA 4DCEA 2PVMA 3PJCA 4Z9LA 4RIYA 3RPYA 5D11A 4A9UA 4FEWA 2X7FA 4PF4A 5AX3A 2O65A 2VD5A 3TJDA 4C4GA 2W1EA 5AA9A 3C13A 5K5XA 2PMLX 4BGGA 4ZP5A 5AMNA 4RWIA 5AFVA 2X0GA 3ZXZA 5CX9A 5A3XA 5JFSA 4HPUE 5L6WL 1W83A 2O64A 3VN9A 2CKOA 4GYGA 4IHPA 4IVCA 4NWMA 3ID6C 4FTQA 5E8UA 3PG3A 1E1VA 3QUEA 4UY9A 5L8KA 1SYKA 1SNXA 4QYFA 3EMGA 3V5WA 2YISA 4MKCA 5KMNA 3CKXA 5CQWA 2GHLA 3H9OA 3UZTA 3DBCA 3QD4A 1DAWA 1VZOA 2YM3A 4L53A 4DC2A 4BCJA 4TWNA 4RG0A 4ZAUA 4EOKA 2RG5A 3P0MA 2FUMA 3G9NA 4Q5HA 3ZONA 3PVWA 4QMOA 5IQHA 4ENYA 4JDHA 1MRUA 1NT2A 4GMYA 5DEWA 2EXMA 3ORNA 1DS5A 4E4NA 4MQ1A 3PTGA 3NW7A 4E6DA 3S4QA 3KXMA 4M67A 4YZDA 2BRBA 2EB2A 3MY5A 2Y4IC 4RFZA 3QQLA 4U9AA 5CTPA 1L3RE 5CZHA 1H4LA 3P7CA 5HORA 1DI8A 2C0IA 3ALNA 4EOLA 3BV3A 3IW7A 3PPJA 4LOQA 5EHLA 2VTPA 4G3FA 4ZJJA 3DB6A 3I60A 2DWBA 4DH8A 2WAJA 2UVYA 3ZM4A 3KN5A 4X6QC 4BI0A 3PP0A 5A54A 5DLSA 3MY1A 4I93A 4O83A 5H8BA 3KMUA 1TQMA 2ERZE 5H3QA 5A14A 3KXGA 4FKGA 3BHUA 4MXCA 5AV1A 4JG8A 3F9NA 2GFSA 5CAPA 3F6XA 4R3RA 4MD8E 3R1QA 5AV2A 3ZRKA 3NUXA 3I7CA 2GTMA 2GCDA 2IJMA 4X2NA 3NIEA 1KE7A 3F5PA 4D5KA 3AT2A 3PE1A 5I9VA 2DUVA 3LFFA 4I5HA 4AT4A 5KCVA 4BC6A 2PZIA 3F2NA 2WMAA 3K5VA 4U79A 4XG3A 2HZNA 5LMKA 1CKPA 3CS9A 3O50A 5FD2A 2YJRA 4DT9A 5AUUA 2CGVA 3ZBFA 5FRIA 5CI6A 5K4JA 3Q9ZA 4R1YA 1Z9XA 4DGNA 3OCBA 4N57A 4GJ3A 4AA0A 4A9SA 1KE5A 2B9HA 2FVDA 3DOGA 3QXPA 4RWLA 4DGOA 4HGSA 4O84A 3WI6A 2VGOA 5M56A 3G90X 5FXRA 4XLIA 5CVFA 2B1PA 2PVNA 2YM7A 3MB7A 1Y6BA 5CSVA 1VYZA 4OGRA 4QMXA 4RQVA 3DKGA 5E8YA 4CLJA 4JR7A 3FMLA 4UWCA 3UNKA 2PU8A 2VTIA 3GVUA 3BBWA 3FMEA 3RKBA 3PXRA 4ZOGA 1URCA 4ZSJA 4ZY5A 2BKKA 4OT5A 5B0XA 5E92A 1YKRA 2H6DA 2ZB1A 3KRXA 3Q4UA 4GIHA 3FLYA 3ZLYA 4S32A 3TTIA 3PIYA 3TDVA 4W4XA 4EK6A 2XCHA 3GU5A 5CSWA 2CKEA 3NNWA 2XKDA 4EK8A 1MQBA 4XG4A 5DR6A 3V5QA 3AC2A 3KK8A 2RGPA 3AXWA 3EHAA 3MH3A 2UV2A 3QCXA 4NM7A 3R8MA 4E6QA 5EM8A 3RAWA 3COMA 2P2HA 4LI5A 4J71A 4Q2AA 5CZIA 4EOSA 4Z55A 3RPRA 2OZOA 4YJRA 2ZV9A 2EXCX 3U9NA 5KO1A 1Q8WA 2QCSA 3CQEA 4FNXA 4NSTA 1BKXA 4QNAA 2X2MA 3R6XA 4JDJA 4Q9SA 2IZTA 4XX9A 5CQUA 3FI4A 4HZRA 4RVKA 1ZAOA 3TEIA 1YWRA 3ZLXA 4CFXA 4EZ5A 4UYNA 4QTEA 3HV3A 1Q8YA 5D1JA 4XHKB 3FE3A 4YMJA 2C0TA 4IZ5A 4XV2A 3I4BA 1Q99A 2CN5A 2ZV2A 3OCTA 4AS0A 4JQEA 3SV0A 2YZLA 3A4OX 4BIEA 4S33A 2W96B 2OJFE 3G6GA 2WTDA 5CLPA 4PMPA 4XEYA 1J7IA 3CKWA 2GHGA 4F6UA 4YJOA 2Y6MA 4IJ9A 1EH4A 4D4SA 5K4IA 4C4EA 2NP8A 5F94A 1PYXA 3R2BA 4P90A 4RVLA 3MIYA 5EDPA 3Q3BA 3EIDA 3F61A 4S30A 3F3ZA 4IWPA 3MA3A 4WKQA 3P08A 4X2KA 3A8XA 2BPMA 2YCRA 1OECA 3D5UA 2YWPA 3QZFA 5EM5A 3VRYA 2O0UA 1K9AA 3ORLA 3TNIA 1ZY4A 1H25A 4FGRA 3OD6X 1XH4A 5AUWA 3CSVA 5JN2A 3TNWA 5IQCA 5EYMA 4YUQA 3R9OA 3NUPA 2OIDA 2OJJA 4EOPA 5HCZA 3QTSA 1XHAA 2BTRA 3Q4ZA 4ZTSA 2W4OA 3GT8A 4NCTC 2Q0NA 4V0GA 1Q8ZA 3IW4A 4U8ZA 5IQAA 4BDIA 5IPJA 2CCHA 3R8UA 5IUIA 3EFKA 4FVPA 1ZYCA 4ASZA 2ZM4A 5HLPA 1YXXA 4ONAA 5HU9A 5IA4A 3RK7A 3HLLA 5LVNA 1FMKA 2C5OA 3GC9A 4C34A 4EORA 4E1ZA 4X7QA 5JH6A 5HE3A 2BDWA 4I24A 1Y91A 2EWAA 2OXXA 3B8RA 3OXIA 3EZVA 3DJ6A 2RL5A 3DAEA 3L9MA 4HPTE 2HWPA 3R22A 4YZMA 1FVVA 3T9TA 3CPBA 3UODA 4E7WA 5ANEA 3IGGA 3MFTA 2PZPA 5HTBA 2B52A 1J1CA 2R3QA 3D5WA 4E6AA 3NRMA 3UOJA 5CAVA 3DBDA 5TR6A 4RPVA 3GCSA 4S2ZA 4DEAA 4MHAA 3O0GA 4H1MA 2NNWB 4QP3A 3GB2A 4DN5A 5I9XA 3LMGA 1JKSA 5HD4A 2XJ2A 5H8GA 4DF3A 4U97A 3BHTA 4GEOA 3MESA 4CT2A 1NW1A 3MV5A 3QTWA 3ZEWA 3TZ8A 3WYYA 3ZRLA 4FKQA 3ZHPC 2ZVAA 4OT6A 4DLJA 2HZ0A 1Q97A 1ZZ2A 2F7XE 3HP5A 2C1BA 2J0JA 2OW3A 3IOPA 5FEDA 4UYAA 2OJ9A 4IZ7A 4JRVA 1JAMA 4DFLA 2A19B 3EL8A 4BB4A 3PLAE 4B7TA 4F65A 3OY1A 4X0MA 1ZYSA 4RWJA 4R77A 5JZNA 3F2AA 4QPSA 4ACCA 2X1NA 3QC4A 2ETMA 2EVAA 4MCVA 5FDXA 3QD3A 1OL7A 4W8EA 5IUHA 2VX1A 4XG6A 4FKTA 4Y72A 3ACJA 5HKMA 1URWA 2W7XA 4F08A 3GCQA 3HA8A 3R28A 4H1JA 4EOIA 2WEVA 3NW6A 5DR9A 5J87A 2ZM1A 3R8VA 4XNEA 4AOIA 5C4KA 1QPEA 1YI6A 2LGCA 4F1TA 4EH2A 1BI8A 4QMUA 1ZLTA 2AC5A 2YERA 3VBQA 3C4WA 4CMTA 3LIJA 3HX4A 2B0QA 4BHZA 3LZBA 2GPHA 3N4UA 3PE2A 2C6IA 2QVSE 4NH1A 5HNGA 1UU8A 5A6OA 3KRRA 4FKLA 5I9ZA 5I0BA 4WZYA 3LVPA 4AE6A 5M44A 5E8WA 4ANLA 1Y6AA 4I6BA 4O0YA 5JT2A 3VWAA 4DG3E 5LVOA 4OLIA 1R3CA 2VV9A 4C4IA 4JAJA 5FLFA 3IDBA 3VW6A 2WD1A 3ZUVA 5HI2A 4C02A 1YOJA 3Q4CA 5E8TA 3OW4A 5K3YA 4D9TA 4ZJVA 1QPDA 4H3PA 4ANQA 5CF4A 4PUZA 4K77A 3IG7A 4GFMA 4RWKA 5J9ZA 2UW8A 3GEQA 3OFMA 5EM7A 5IA3A 5KBQA 3C4XA 5DA3A 2PZ5A 5BQ0A 1WAKA 3H30A 3V5JA 1H8FA 3MI9A 2WELA 4EBVA 4HYUA 5FM3A 3UC3A 4JS8A 3ZDIA 5AX9A 4E26A 4F1OA 3AG9A 1A48A 2XEZA 4PL3A 5FQDC 3EKKA 2JDVA 2BALA 1OPJA 3C5UA 2ONLC 3SXFA 3P79A 4BDBA 3DPKA 1F0QA 3D14A 1STCE 5EYKA 3ZUTA 3IKAA 5IQBA 3SA0A 3EH9A 4CKJA 3OTVA 4LM5A 1V0BA 4E5BA 2UW6A 2X2LA 2QQ7A 4DG0E 3GFWA 2BROA 5F9EA 3DNEA 1F5QA 3FI8A 4M14A 4FZ6A 3EQBA 5AUYA 5L6PA 5FTGA 4GT5A 5BPYA 2VO7A 4DGMA 3MYGA 3V51A 4KIOA 1ZRZA 5GJGA 3ZZWA 4M8TA 5FXSA 3RHKA 3ZYAA 2ZOQA 3MGYA 3ZC6A 4BIBA 3UZPA 1ERKA 1JKTA 4U3ZA 5IQDA 5IA0A 4JG7A 4IM2A 5AAEA 3PYYA 3Q6WA 4Y5QA 4MD9E 2PTKA 3WIKA 3LFQA 4G5JA 1RW8A 5CEIA 4O0TA 4AZEA 2XNMA 4A4LA 2Z2WA 3KMWA 4NFNA 4DBNA 4TZRA 5IZFA 2W1DA 4IC8A 1PXPA 2Z8CA 4LRJA 5KMMA 5FM2A 4O7VA 3GU8A 3MSSA 2VO0A 5KMLA 2CGWA 2X39A 5CEOA 5EH0A 3VUIA 1BMKA 2VTLA 3C9WA 2C5NA 4X3FC 3G15A 2BIKB 1H28A 2RFNA 3R9RA 2CDZA 2UVXA 2UW9A 4RC4A 5BNJA 3SKCA 1B39A 4B4LA 4W8DA 3KA0A 1I44A 5DYJA 3U54A 4RVMA 2RKUA 2GNLA 1M2RA 3DLZA 3Q9WA 4ZSGA 4B99A 2HAKA 3KQ7A 2UZWE 2UZTA 2XNNA 5GHVA 3UIMA 4Z7GA 1PXOA 4AA5A 3UNJA 3C1XA 1OKZA 2HY81 3TZ9A 3IDCA 3KVWA 3ORIA 3L1SA 5JFVA 2FH9A 3P9JA 2WQNA 4JRNA 3OCGA 4J53A 1OL2A 1YQJA 5CANA 4TYJA 1P5EA 3ZSGA 1W7HA 4J98A 4M7IA 4JIKA 4RQKA 2Y0AA 2BDFA 4CRLA 1OL1A 5AV4A 1WBSA 2XYNA 4HYHA 1J1BA 3DCVA 5E8SA 4M0ZA 4FIHA 2HK5A 2C6OA 3FLSA 3OHTA 4F7SA 3EQHA 4J8MA 2P55A 2XM8A 3QTRA 4GJ2A 4PTEA 1BL7A 5M53A 3LE6A 3BU3A 2YCQA 2ITYA 3OXZA 4IE9A 3RALA 3MH0A 3VO3A 4EKLA 5LCJA 4FKPA 5EI2A 3B8QA 4IH8A 3G33A 5E4HA 1XO2B 4WOVA 4R7BA 2PVYA 1PF8A 3GCUA 3LJ2A 2I6LA 3UVPA 3BELA 3IW8A 2VWXA 3PY0A 2O8YA 4YJQA 5KX8A 1LP4A 2E2BA 3FKNA 2IPXA 5CXHA 4DTBA 5LVMA 4G2FA 3RPVA 4BZOA 4KS7A 4RSSA 3PZHA 3ZSHA 2BDJA 5HLWA 2J0IA 1CMKE 4I92A 4DGGA 4EWQA 4TYEA 4G17A 4TWCA 2JDRA 2YHVA 5D10A 4HVIA 3OW3A 2O3PA 4ACGA 4D9UA 3NX8A 3LAUA 4KBKA 1IG1A 2BRHA 4AN2A 4QTDA 2ZMCA 2X4FA 1JKLA 1Q41A 1GOLA 3HV4A 3GFEA 4CV9A 2VX0A 5KBRA 4FEQA 3KRLA 2YM6A 1WBVA 2WQBA 3R63A 4FTCA 3ZEPA 2VRXA 5C26A 4J7BA 1QCFA 5A4QA 5DBXA 2JAVA 5DI1A 2WTWA 2XP2A 3KY2A 4QMMA 1AQ1A 4TNDA 5AAFA 4M3QA 3IPHA 5CEKA 5EQYA 3S1HA 1YWVA 4DCAA 2C68A 1OL6A 3R04A 2YIWA 4IZYA 3WF6A 4IX5A 3UG1A 5J9LA 3FSFA 2HZIA 4YU2A 4FT0A 2WMUA 2WU6A 4YO6A 2XNEA 3KRWA 4UN0C 3TV4A 4DH7A 4QP8A 5FDPA 3CGFA 2QURA 3MFUA 2FSTX 2WGJA 3FL4A 3W0RA 4ERKA 1ZYDA 4I22A 5CVHA 1GIHA 3GUBA 4AXAA 3OOMA 4DEDA 3KF7A 2C3IB 4IAKA 5M57A 3SG8A 2FA2A 4ALWA 2WPAA 3VRZA 2C6KA 4I41A 4D28A 3FMNA 5BVEA 4FL1A 1T45A 2R3KA 3PXFA 2XM9A 4YTIA 3R9HA 3EL7A 3UYTA 3SOAA 4B6LA 4GKIA 4FV2A 4F70A 2R4BA 4FC0A 5KMOA 3H9FA 4PDPA 3KXZA 1OBGA 3D5VA 4C2WA 5M51A 3O8PA 4BCNA 3DA6A 4DEHA 5J7HA 2PE1A 4FYNA 2W1IA 5FXQA 3ANQA 2R3OA 4L52A 2ZV8A 3N4TA 3PXZA 4J97A 3I7BA 5CU3A 5L8LA 1QMZA 2OH0E 2RG6A 1UU3A 2R3GA 3O7LD 4QP1A 3O17A 3PA3A 2GS2A 3P78A 4K18A 2HY0A 4Y85A 2X8DA 1B38A 4E6CA 2HOGA 3HMOA 1Y8GA 3JR1A 3IK3A 4FV1A 4EL9A 3RM7A 3BGQA 4FG8A 5AP1A 3CY2A 4NJDA 4DEEA 2GQSA 4F0GA 5B2LA 2V7OA 3LLAA 3HL7A 2JEDA 5AP3A 2GNGA 2W0JA 3W0QA 3OZ6A 3BU5A 4LMUA 3W8LA 3LCTA 4EEVA 3PXQA 1M2QA 2JBOA 1V1KA 3R83A 1V0PA 3UE4A 2OZAA 4B8LA 4TN6A 1OKYA 2UZEA 4TT7A 3D5XA 3NR9A 1FMOE 4TW9A 4BCFA 1KE6A 3HDNA 1NVSA 5D7AA 3ZDUA 3V5TA 3DDQA 4JVGA 4I0RA 4BDEA 5E1SA 2IN6A 5KHXA 2J6MA 4PDSA 4H3BA 1Q3WA 4JI9A 5KKRB 2VTHA 1H08A 4FTTA 2KULA 3LFEA 2VNYA 2IW6A 1LR4A 4YZBA 4DFNA 1UNHA 4KWPA 3WZJA 2WTIA 5HQ0A 1OKWA 1ZWSA 2PUIA 2PWLA 1M17A 4AGUA 1SMHA 4QYYA 3TCPA 3DZOA 1H26A 3OG7A 4FKRA 3AC3A 4FZDB 4XOYA 4RZVA 5EYDA 4TYHA 1REJA 2WMQA 2ZJWA 3BYMA 3R7OA 3BI6A 2UUEA 4IAAA 4EHGA 3FHRA 4FZ7A 4FKJA 1OUYA 3DY7A 3ORPA 4H58A 3H0YA 4IX3A 4J96A 4CKIA 3KGAA 2WFYA 3WZEA 3AOXA 4XRLA 4ZS0A 4C59A 3U87A 2R0IA 3ZO3A 2UZVA 2BRNA 5AV0A 4D2SA 4O6LA 4QMLA 3VBYA 3UPXA 4HJOA 5ETCA 2G9XA 4V0GB 4N6YA 4ZIMA 5JGAA 4X2FA 3DBEA 4L3PA 3D4QA 3NYOA 4BR3A 3GGFA 3W32A 1WVWA 3EQRA 2C3JA 4D55A 4E73A 3NVKI 5A4EA 2ZYBA 4OTIA 5LJJA 4FTAA 4UB7A 4HVHA 3SRVB 2W05A 3WBLA 4IWDA 5IH6A 4WNPA 2CNQA 3EN5A 4O0UA 4O7LA 5T3QA 4FR4A 3DJ7A 3FLQA 3SAYA 1YI3A 3DTCA 3GCVA 3ITZA 5CS6A 4XP0A 2B9JA 4C33A 5ETFA 5JFWA 3BIZA 3PVUA 3BRBA 3W0SA 1W8CA 3ORKA 4OR5A 3OS3A 3O96A 4RJ7A 3V8TA 3H10A 1F3MC 3O7LB 3UTOA 1WBNA 3QL8A 4RA5A 2CCIA 1VYWA 3ODYX 4KB8A 2PHKA 4A9RA 3HAMA 3R01A 4I4FA 2ZB0A 3PUPA 3RAKA 2XZSA 5JEBA 4XH6A 5DT3A 4BKJA 1RDQE 5AUTA 2XRUA 2IWIA 4WG4A 3GQIA 1OM1A 1YHVA 4CSVA 5BMMA 4ACHA 3AC4A 1XH7A 3W55A 3BLHA 4JBQA 4BI2A 3AQVA 4R5YA 4C4HA 4O0VA 4YLKA 2IZRA 4PDOA 2XK8A 2UVZA 4G9CA 4NM3A 4KBAA 4OTDA 4WA9A 5LXMA 3GU7A 4TWOA 4YO4A 3ACKA 4YGAA 4AGWA 5D41A 3LMHA 4DEGA 5L8JA 2PUNA 4DGLC 3QHRA 4EZ7A 4ZTHA 2A1AB 3TV7A 3FDNA 2X9FA 3UPZA 5AP5A 1YDTE 2QOQA 1PMVA 2JD5A 3FXXA 3TWJA 4UWYA 3DAJA 1ZZLA 4KSQA 2PK9A 3F7ZA 4QOXA 4R6VA 3ZU7A 4ZLYA 3OROA 2HZ4A 2J0KA 3EN4A 4FZFB 5J8IA 4CXAA 3UQFA 4O0XA 4NW6A 3KULA 4BYJA 3IONA 2C6EA 3NCZA 5KMJA 3MVHA 5HG5A 2R9SA 3PJ2A 1CDKA 2WOUA 3R0TA 1PKDA 4J52A 1G3NA 3RWPA 3W0MA 3DKCA 3UBDA 3OT3A 2JDSA 3VBTA 4ZSEA 2E9PA 2VTSA 2ITNA 2HCKA 2C6DA 2W1ZA 1OITA 5TOZA 1Q5KA 5HBHA 1MQ4A 3DKOA 1VEBA 3MWUA 3NW5A 3EFLA 4CFMA 4F0FA 2V7AA 4XRJA 4L00A 4CZUA 3QZGA 3DGKA 4O7WA 3UMWA 5CASA 5HX8A 3R9NA 4BN1A 2QOKA 4CFNA 1U5QA 2V62A 2WTVA 4DYMA 2F49A 1V0OA 4ORKA 2V22A 3F69A 2EB3A 3LCSA 5AP7A 4KKHA 5LCKA 3RNIA 3FQEA 4D1XA 2AUHA 4KRDA 4F7JA 3M1SA 2XK3A 2DS1A 4S34A 3ZO4A 3UO4A 1QL6A 3S00A 4WIHA 1PXMA 2VTQA 3QA0A 3ZLWA 4CFUA 4IJPA 1YVJA 5L6OA 2J0MB 3JY9A 4V01A 5BYLA 3A61A 4IW0A 2JAMA 4H3QA 3R7EA 4JG6A 5FBOA 3VS4A 5DN3A 3IW5A 3FKLA 4RFMA 5GJFA 4TL0A 5IU2A 1JVPP 4Z7HA 2QC6A 2HW6A 4FKIA 2Z7QA 3PY3A 2WQEA 1KOBA 4F9AA 1JLUE 2OFUA 4HVSA 5LWNA 3FC1X 2OLCA 3L9PA 1DI9A 2IZUA 3PWDA 2BZHB 2ITUA 4OTQA 3PZEA 2PE2A 4D0WA 2ZV7A 4CQEA 3TIZA 4FT9A 4QMTA 4AP7A 1FGKA 4RRVA 3IS5A 4FL2A 2V55A 3N4VA 3LLTA 3CQUA 3JXWA 3CCNA 3CJGA 4BCPA 4FV6A 4FG9A 5IMEA 3VS1A 5IMXA 4FSYA 3ZMMA 3ET7A 4MH7A 2JDTA 3FLZA 3NYVA 4YJVA 2X8IA 2WQOA 5KMIA 3VS2A 5LVPA 3QCYA 3Q53A 1PXLA 2JLDA 4WRSA 4XCUA 4QTBA 2Y4PA 4UEUA 4NYEA 2C30A 3CJFA 4RIXA 2CLQA 2Z02A 4EUUA 1T46A 4G3CA 4U94A 2ITVA 3TACA 5EK7A 4Y83A 3NZ0A 3OUKA 4M97A 4G6LA 3D2KA 3PPKA 4FT7A 1SVHA 2QO7A 3T3UA 4E4LA 4CEGA 3ZLSA 4QYHA 5AIKA 5B7VA 4ITIA 5K9IA 1TVOA 4IAIA 4RX7A 4PDYA 3TKIA 4FKWA 3QAME 4X6RA 3E64A 2QI8A 4FKUA 4JIAA 2OWBA 2J5EA 4NCTA 4YZNA 4ARKA 3GENA 4TRLA 4DA5A 3KB7A 4ZEGA 1ZXEA 3VS0A 4OTFA 2J90A 4TNBA 3QALE 4ALVA 1YRPA 3LXPA 3DNDA 4DH1A 4MEDA 5AWMA 4Y8DA 1MP8A 3TN8A 3K2LA 3DFCB 4RMZA 1WVYA 3F3UA 2W4JA 2IW8A 1W82A 4EK5A 5ANDA 2FO0A 5EYCA 5IQGA 4BDGA 3CC6A 4P2KA 5F95A 5HBJA 4EONA 4L8MA 1YXUA 4IM0A 2W5BA 5C1QB 4FV9A 4K33A 3MH1A 3PVGA 4PTGA 3WF7A 3PA4A 4RBLA 3FUPA 2Z7LA 2XK9A 3A7FA 3OWJA 2XUUA 3PWYA 4ZS4A 3TI1A 3I79A 2YIXA 4MF1A 5AP0A 5JK3A 3QWKA 4PNIA 2UW3A 1ZY5A 1XH8A 2WOTA 2BRGA 2Z60A 3ZRMA 3BX5A 4FIJA 4HCUA 4P5ZA 3LCDA 4R5SA 5AP2A 3RJCA 2O63A 2DQ7X 3QTIA 4F09A 5JRQA 2W4KA 3CIKA 3W16A 5LMKC 2HELA 1PKGA 4YP8A 4IVBA 3M2WA 5M4UA 2F7ZE 5BYZA 5HEZA 4M12A 3A2CA 1BX6A 2YDJA 4GIIA 4CTCA 4EYMA 2ETRA 1U54A 4C58A 4F9WA 4IC7A 4DH3A 4EOQA 4Q5EA 4GYIA 5TF9A 4XG2A 1RQQA 5LWMA 2QODA 1R0PA 5E7RA 5BUEA 4AGDA 5CAOA 3NNVA 2UW4A 4C37A 4C3FA 3GNIB 1GY3A 4GK3A 2CMWA 5CSXA 3VBXA 1BUHA 1SVEA 5EDQA 2YAAA 5EM6A 4O2ZA 3LXLA 3OUNB 3WZKA 3QU0A 3VULA 3BHVA 2W9ZB 4HCTA 4ID7A 2H34A 4RC2A 2HW7A 5I9YA 2R0UA 3Q9YA 3LMIA 1APME 4K6ZA 4KKEA 5ANIA 3UC4A 3FZ1A 2Z7SA 4HOKA 3UMXA 5LQFA 1IAJA 2GSFA 2IO6A 5CXZA 4J8NA 3AT4A 3RPSA 4C4FA 3VS7A 2XEYA 4X2GA 2GNHA 3M11A 5AEPA 1UWHA 3ZUUA 4P7EA 3R9DA 3JYAA 1Z5MA 2IZSA 2NO3A 3MH2A 3ZS5A 1YXSA 2B55A 3MVLA 3VNTA 4FBXA 3UOKA 3W2PA 2SRCA 3SOCA 4F64A 1IR3A 3A4PA 2QOCA 3EKNA 4LL5A 3HMMA 2P2IA 3RTPA 4DFUA 3ZXTA 3QTZA 3QBNA 3FMJA 2W5HA 4YZCA 4MXZA 3DXNA 5E8ZA 1KV2A 4WBOA 4CCUA 1ND4A 4FL3A 4AOTA 3LCOA 4ENXA 4AW1A 4IB0A 4LGHA 5AADA 3E87A 3HGKA 1VJYA 3U6HA 4U0IA 4ANMA 2BFXA 4ZTMA 3DLSA 3LQ8A 3KC3A 3QYZA 5IEVA 5KHWA 3Q32A 4FYOA 5CWZA 3C0HA 4FNZA 2Y8OA 5DWRA 1S9JA 4FTJA 4CFVA 1WBWA 4YJSA 1H0VA 5ITAA 4AW0A 1O6LA 3CD3A 4XG8A 4RJ5A 5KKRC 2BIYA 2AC3A 5T68A 3ANRA 2I1MA 2W06A 4FG7A 3FEGA 2J50A 2UW7A 4ZMEA 2ZDUA 2VAGA 4RJ8A 3RCJA 3FBVA 3UJGA 4KD1A 2ITWA 1G5SA 2B9IA 4GU9A 2YITA 3RMFA 5A46A 4TYIA 1WVXA 4G31A 4L3LA 5EG3A 3KREA 2BFYA 5FP6A 3UG2A 3CPCA 4D4RA 3UO5A 3TZMA 3FZRA 2E9OA 2JFLA 3PJ1A 3EJ1A 3PJ3A 3QGYA 4FSWA 4K1BA 4QPAA 5DG5A 3F5GA 3UOLA 2PVJA 4EH4A 3FMDA 4FK3A 4MTAA 2YWVA 4N70A 3U8WA 5BMSA 2OZAB 3W33A 4G1WA 4CVAA 2WMSA 5JGDA 2LAVA 1JOWB 5BVWA 3FPMA 1CSNA 4BDKA 4MVFA 4JBVA 3LFCA 3ZOSA 3PPZA 4FIIA 3VQHA 4EC8A 4BCIA 2WMXA 3GQLA 3WZUA 4M0YA 5AUZA 1XJDA 1HCKA 2X7GA 4ANBA 5CEMA 4JAIA 4KNBA 4O6EA 1YDSE 5BVOA 2OBJA 1FVRA 4X3FA 4AOJA 4LMNA 2YABA 5C03A 3QTUA 2PL0A 2F4JA 1UU7A 4YHJA 2OICA 2QOHA 2WIHA 2X4ZA 3KCFA 3UOHA 3FAAA 3MFSA 1JBPE 2YM5A 4II5A 4AW2A 3W0OA 4TYHB 1OGUA 2QLUA 4M13A 2F57A 5CF6A 2QKWB 1FPUA 2BMCA 5K5NA 1Y57A 2IVVA 2CJMA 5HCYA 4FT5A 3VW8A 4IWOA 2VZ6A 2XK4A 4UWBA 4G6NA 3R1YA 3H9RA 3O2MA 5AA8A 3SX9A 4YZ9A 4C62A 4EYJA 3DK3A 2VTTA 2GDOA 4PY1A 5FEQA 3HEGA 2P4IA 4FIEA 4Y5HA 3LM5A 3KKVA 5DGZA 1YI4A 2VTRA 3BPRA 2FB8A 4JLCA 3G0EA 1M14A 1YHWA 3O51A 2XCKA 4IEBA 4O2PA 3FZPA 4GT3A 5J1VA 2VWWA 3UYSA 2OSCA 4FI1A 4GVJA 4IFCA 2VU3A 3TUDA 3RGFA 5HG9A 1SZMA 2WHBA 2R2PA 3OXTA 2WEIA 4FSNA 4MXYA 4YR8A 3WILA 4GT4A 4O7RA 4FOBA 3E7OA 3T8OA 5IF1A 2HYYA 4D5HA 3ORXA 2RFEA 3ZFMA 3FQSA 4C35A 5HVKA 2BAQA 4BCOA 4QMNA 2PVFA 4IWQA 1OVEA 4RIOA 4ASDA 3CTHA 3P86A 2KTYA 3VJOA 3CBLA 4RIYB 5EKNA 1P4OA 3F3TA 4I23A 3SW7A 4ZJIA 3C5IA 4EJ7A 4CFWA 4O7SA 3MDYA 4BTFA 4BZNA 2B9FA 3PXKA 3C51A 1Q4LA 4R7HA 1FBNA 4FSZA 4WBBB 4YLLA 3HMNA 2BZKB 3FZTA 3ZM9A 3COIA 2VWBA 3EOCA 3EN9A 2XKEA 4JJRA 2OF2A 4N4SA 4V05A 4F4PA 2I7QA 3K3JA 4U7ZA 4AFJA 3DJ5A 3D9VA 1M2PA 3KN6A 3R71A 4I20A 3ULZA 4ZY4A 3TDWA 3S95A 2P3GX 3V6SA 5CAUA 2VO6A 2BZJA 3OOGA 3BYSA 2R3MA 3U51A 2JKOA 4EOJA 3MPMA 4QMVA 5BVDA 4NTTA 3TTJA 2UZUE 4PTCA 4O0SA 3Q5IA 4MXXA 4ACDA 4BZDA 4PWNA 3I81A 2OIQA 3QTQA 3HV5A 5ANJA 3BKBA 2Q0BA 3BHHA 1O6KA 2J51A 2QO2A 3OP5A 3WIGA 3GC8A 4AACA 3JVRA 3U55A 3QLGA 2X9EA 4YNOA 2WMTA 4AAAA 2BHEA 1BYGA 3TG1A 4NJ3A 4EH5A 1IASA 2VTMA 1SM2A 3ORZA 3NAYA 4X2JA 3UP7A 2JITA 3BGPA 3DKFA 3FHIA 4FIGA 3H0ZA 3G51A 3QQUA 2OXYA 4F7LA 5J5SA 4AZFA 2YM8A 3FV8A 4BTJA 3PP1A 2XIRA 4I6FA 3ENMA 4NTSA 3VUKA 4U98A 2BVAA 3KK9A 2QU6A 5KZIA 1PXJA 3HUCA 4BDJA 3FMHA 5HIBA 5L3AA 2QG5A 4K11A 1JKKA 3BBTB 4RT7A 1UNGA 4U40A 3DK6A 5HE0A 5CF8A 4W4YA 3QUDA 3NGAA 2H8HA 2PVLA 4FE2A 4K0YA 3MY0A 4WUNA 2CKPA 3R73A 2UZLA 1LPUA 4L7FA 3OVVA 3NNXA 4C3PA 4G9RA 3KMMA 4KKGA 4Y95A 4KUJA 2VTJA 5G6VA 4DE4A 4YURA 2Q83A 3COHA 5D7VA 3RI1A 3RP9A 4H36A 3JPVA 5AM6A 3QX4A 4MK0A 3DU8A 4EKKA 4CMUA 2P0CA 4ACMA 1PMUA 3AD5A 4AZVA 1XH9A 4NM0A 3BHYA 1H07A 5EHYA 4FV8A 4L46A 3TXOA 3ORTA 4G3GA 1H1QA 1CTPE 4LUDA 5DPVA 4E93A 5CEQA 5DFPA 5IA1A 3I0QA 5CALA 4AZWA 2UW0A 2OG8A 3BE9A 3W2OA 4PMSA 3FI2A 1VR2A 3C4EA 3GOPA 4BBEA 2FYSA 4RIXB 4A07A 2CHLA 3DDPA 2WIPA 3AD4A 3ATTA 4O7NA 3V8SA 1GZ8A 3VUMA 4O21A 4F9CA 4QQ5A 2GS6A 4YJTA 4FSRA 2VTNA 2XNPA 3QUPA 1QPCA 2WMBA 3GC0A 5BX0A 4EZ3A 2WB8A 3Q2MA 2VUWA 1IEPA 4WG5A 3CQWA 3K5UA 3FXWA 4AGCA 2OXDA 3FSKA 3LFBA 3SLSA 4EC9A 3WF9A 5I4NA
chains in the Genus database with same CATH superfamily
1K3AA 2CN8A 5ACBC 4BDHA 3QQKA 1OUKA 2OFVA 3D2IA 3ETAA 4XLVA 2OJIA 4D0XA 2XKFA 4PP7A 3D0EA 4FVRA 2IVSA 5J95A 4EOMA 4I4EA 3AC5A 2B4SB 2A0CX 2PUPA 4XG9A 4OUCA 2CGUA 4FT3A 5F4NA 4DFYA 4Y73A 5J9YA 3LOKA 3R02A 2OU7A 3MJ1A 5FTOA 2EUFB 5C8NA 5LVLA 4R78A 5DT4A 3BE2A 3SDJA 2WTCA 3AKLA 4GS6A 4JBOA 5E8XA 3P7BA 4B9DA 4AFEA 4YSJA 4RIWA 3V01A 4R3PA 5J1WA 2W99B 2XNBA 4DG2E 2GNIA 2EU9A 5H2UA 4X3JA 4ZSLA 4BHNA 2XMYA 3Q52A 5HVYA 3NUSA 3LKMA 4QTAA 2VGPA 2CPKE 2XJ0A 3GP0A 1KWPA 3Q6UA 4FV0A 4MNFA 2PYWA 2WTJA 5GNKA 3U4UA 3NYNA 3O71A 4FTLA 3UZRA 5IQEA 4FTMA 2R3FA 4JBPA 4GK2A 2JGZA 1R0EA 3AT3A 4IB5A 4C38A 1PHKA 2CSNA 4UV0A 4WSYA 5HG7A 5CF5A 3DBFA 4GKHA 4F6WA 4BTMA 2GU8A 3QRUA 3ZCLA 5D12A 2JKMA 3NSZA 5DOSA 3DFAA 4I0TA 2C3LA 3II5A 3CXWA 3U6IA 4YJUA 2BZIB 2W1HA 3FYJX 4FUXA 5CENA 5DRDA 2XIYA 1NVQA 1YOMA 4RFYA 1OPKA 2W1GA 2CNVA 1WBTA 4C7TA 2XYUA 2P33A 4LG4A 3QQFA 4LL0A 3ATSA 3EWHA 1YOLA 3A99A 4PRJA 4AUAA 2H9VA 4UZDA 4YHFA 3NYXA 4BBFA 2BR1A 4O0RA 4O7YA 3RWQA 1A06A 2GTNA 4IDVA 4O7ZA 5ACKA 3RVGA 2BHHA 2QNJA 3FC2A 4UXLA 2OH4A 2PMIA 4R7IA 5E9EA 5FBNC 3E92A 5CSHA 3UQCA 3V3VA 2CKQA 2FSMX 3GU4A 2B54A 3RHXA 4YTCA 3MBLA 3OBGA 4LFIA 4FX3A 3MN3A 2C5VA 4IMYA 4C61A 3PXYA 4KA3A 1J91A 1JWHA 2I40A 4JQ8A 4U44A 5H9BA 4CRSA 4ZK5A 4M68A 3FPQA 1ZOHA 2ITOA 3VS5A 2W5AA 2R3NA 3L9NA 4I6HA 1LUFA 2XBJA 5A4LA 2VO3A 3TV6A 3E7VA 4HCVA 1YXTA 4HVDA 2WZJA 4YBJA 1JNKA 2G2IA 2QOIA 3QA8A 3V6RA 4CMOA 3EN7A 3ZC5A 4RGJA 4KSPA 5GJDA 3AMAA 3SG9A 4FMQA 2FGIA 3K54A 2IW9A 4A06A 5KNJA 5L2TA 4I6QA 4M84A 4G34A 4J1RA 4W4VA 4PMTA 4BRXA 4KRCA 5HG8A 3VF8A 3S3IA 1NXKA 3BYVA 3C4ZA 4U43A 2PSQA 1YDRE 3N9XA 2RF9A 4I3ZA 3CEKA 4CGAA 2JC6A 4QP7A 4FSTA 2YIQA 3QRTA 3HUBA 4IAFA 2VWIA 4B0GA 3QD2B 3F5UA 4OTWA 4QMPA 3C0GA 1SVGA 3C50A 3NMUF 3Q96A 4K8AA 3THBA 1AD5A 4ANSA 4DFZE 2PVRA 1ZMWA 3PUFC 4DBXA 2DYLA 1R39A 1W0XC 4YC6A 2YAKA 1FINA 5ETIA 3BEGA 1REKA 4KIPA 4XV1A 3TKUA 3F2RA 1OI9A 3QX2A 3PVBA 3IDPA 3HDMA 4FTRA 4AG8A 4DAWA 2GQGA 3A60A 3CLYA 5AJQA 3B2WA 3GCPA 1U59A 4O0WA 4D4VA 2V0DA 1TKIA 2PULA 4BCMA 4E4XA 4WO5A 3KXXA 3G6HA 4QQTA 4AE9A 3A7IA 4AZTA 1OIRA 5FUTA 3E8NA 3F3WA 4QO9A 1E1XA 5ANKA 4EHVA 5JMSA 3P23A 3DAKA 5E91A 3F5XA 4FIFA 1MRVA 2F2CB 2XKCA 3U9CA 2JKQA 3UO6A 4ITJA 4ASEA 4BDDA 3N51A 2QONA 4K9YA 1UKHA 4RX5A 1VLRA 4N0SA 2OF4A 4YJNA 3R8LA 3VHEA 3QQHA 3KF4A 1E9HA 1U4DA 3L9LA 2C6MA 4JX7A 3R7YA 4BCGA 4WG3A 1DM2A 5EQEA 4D58A 4X3FB 4F99A 3SHEA 5L2WA 1H01A 2H96A 4UZHA 4MAOA 3ROYA 3WE8A 4FODA 5HE2A 4ERWA 4YNEA 5KUPA 2QLQA 4M15A 3RZBA 4BDFA 2CGXA 1H1WA 1OL5A 4HYIA 4KBCA 3LPBA 4G16A 1NY3A 1PJKA 4R3CA 3NUUA 4YPSA 2F2UA 3E62A 4P4CA 4BYIA 5IEYA 1X8BA 5M55A 3F66A 5IDNA 1OPLA 5AP6A 3UDBA 4MYGA 5IH4A 4ZMFA 5C01A 5EW3A 3H4JA 3OWPA 4DTKA 2BCJA 4PX6A 2I0EA 2B53A 3Q4TA 1ATPE 3FZOA 4YPDA 4LDTA 4EH3A 3NLBA 4PV0A 3NIZA 4AA4A 3HA6A 3MB6A 3NUAA 3A7HA 4HW7A 2ITPA 2G15A 3R7UA 4CG9A 1IRKA 2E9UA 4PL4A 3QHWA 4ZZMA 5M09A 3WE4A 3R2YA 3QCQA 3LM0A 3V5LA 4TPTA 4J95A 2VTAA 2CNUA 3REPA 5CU6A 3PY1A 4O7OA 3OTUA 3MA6A 4EUTA 4O7PA 4LQMA 4AWIA 3EQFA 5LMAA 1GIIA 4XG7A 4YC8A 1JSUA 3QRKA 4QEBA 4D2RA 4EHEA 3UQGA 4WNMA 1LEZA 2G2HA 3PIZA 1R78A 1XR1A 5HHWA 1GAGA 3AGMA 3HV7A 5EW8A 4ZTRA 3EB0A 4L44A 4PNKA 2YJSA 3SXSA 4RLKA 4C3RA 1KOAA 4V04A 4U3YA 2RFSA 4QP4A 2X8EA 2UZDA 2WNTA 3KXNA 4H05A 2ZFYA 3W0NA 4CV8A 3VAPA 2ITTA 1WZYA 1H0WA 2UZBA 3EQDA 4BIDA 3I5ZA 1H1RA 3DQXA 3NNUA 3ZTXA 3P1AA 2C0OA 2XVDA 4FICA 2WU7A 4CCBA 3E63A 3TZ7A 1WBPA 3CTJA 3F82A 4BCHA 3U6JA 3PFQA 2UZOA 3AGLA 2J2IB 4FKOA 1JQHA 4YC3A 5FEEA 5A6NA 2W1FA 4WRGA 4EH8A 2G2FA 5CY3A 4DHFA 4FV7A 2JDOA 2W1CA 3TNHA 4LOPA 3TUBA 3U4WA 2C47A 3I1AA 3VQUA 5G1XA 5CEPA 4USFA 2V5QA 3D7TA 3VJNA 1JPAA 3KCKA 5FP5A 4AU8A 3UP2A 4A9YA 1KSWA 2I0VA 3QWJA 1UNLA 3LJ0A 3TL8A 4BICA 3KRJA 3MJ2A 4O27B 5L2IA 3OWLA 5AAGA 3E3BX 4KS8A 3EQCA 2ETKA 3HECA 4I0SA 2W9FB 3QF9A 1DAYA 4CD0A 4OTRA 5TT7A 4CT1A 4EOOA 4I5CA 2E9VA 3B2TA 3JS2A 2C5YA 2VWYA 4ALUA 3V5PA 2HIWA 1OBDA 4FOCA 4APPA 4IVDA 5ETAA 3IECA 3LFDA 1FVTA 5I9UA 5C8KA 5HD7A 1B6CB 3UGCA 3VONA 1RE8A 4XP2A 2G1TA 3QZIA 4RJ4A 4FTUA 2XIZA 3NUYA 3EYGA 2WTKB 3I0OA 3R1NA 5C27A 3L8SA 5AUVA 2WMRA 2C1AA 2HXQA 4GUBA 3LW0A 4MNEA 5B2MA 2JIUA 4Q9ZA 3Q5ZA 4RX9A 4YTHA 5A4TA 2NPQA 3AC1A 5M06A 4ZLZA 2QG7A 3PIXA 4XUFA 2VWVA 3ML1A 3W2CA 4HNFA 2X2KA 1M7QA 3GC7A 3F88A 3LJ1A 3W10A 1RJBA 1XBBA 4JT3A 3EZRA 3HP2A 4OBOA 4F9BA 5CNNA 5C9CA 4DITA 3OC1A 3T9IA 4G3EA 5DT0A 5HO7A 5HTCA 4EH6A 5DNRA 3FYKX 5JSMA 1OMWA 3VC4A 3HMPA 3LFNA 2ESMA 5IA5A 1NA7A 3CR0A 4IIRA 4RJ6A 3P7AA 1WFCA 4TY1A 1H00A 4L42A 1H27A 3L8PA 4AN3A 1ZYJA 2C4GA 3BV2A 2YDIA 3QQGA 3ZO2A 5TO8A 4O82A 3VBVA 4U41A 3VVHA 3LCKA 3MW1A 5H8EA 3DXPA 3QRIA 3IO7A 1PYEA 2C6TA 4O91A 2YDKA 3TYKA 5CI7A 3E3PA 2C3KA 3HKOA 4AQKA 4QMZA 3C7QA 4O86A 5KZ0A 4WT6A 5HGIA 2O5KA 1I09A 2Z7RA 3SRVA 2RIOA 3E88A 1FOTA 2BUJA 1BLXA 5JGBA 4GU6A 4L45A 3FL5A 5EKOA 3LHJA 1KV1A 2OKRA 2AYPA 2JBPA 3ERKA 3P5KA 3PJ8A 5D9HA 5EI6A 3T3VA 2JFMA 1Q3DA 4GFOA 3WF5A 2ACXA 3SVVA 4NKSA 4EQMA 4AT5A 3GBZA 3AD6A 3DV3A 2X7OA 4QMYA 1GZNA 1ZMUA 4L68A 4CZTA 2VWUA 2J7TA 3WF8A 2F7EE 1OKVA 2VN9A 4B8MA 1FGIA 1P4FA 4Y46A 4N6ZA 4C4JA 1XH5A 3A7GA 1BI7A 2ONLA 4P5QA 4KINA 4TTHB 1M7NA 2WO6A 2HXLA 3DZQA 2GS7A 3KFAA 4GUEA 5HBEA 2OK1A 3POZA 4FV4A 5HCXA 3I5NA 3ZSIA 5IISA 4J99A 3BQCA 3FI3A 4BGQA 5IDPA 3AMYA 3F3VA 3QKKA 4BCQA 3W2QA 2PVKA 2OO8X 3PA5A 4FEXA 2R3LA 1W98A 3BZ3A 3OEZA 1UKIA 1UVRA 4NUSA 3NS9A 4FKSA 3RCDA 5L2SA 2YCFA 3ALOA 4FSUA 4U80A 2R64A 4E5AX 2XJ1A 3DBQA 4G6OA 4CFFA 3CTQA 5AM7A 2OIBA 2ZMDA 4HZSA 2ZAZA 3TKHA 4CG8A 4CLIA 2PMNX 3ROCA 4NIFB 3HMIA 3WZDA 2XF0A 1UV5A 3WYXA 5C4LA 1LEWA 4FV5A 3BLAA 4GCJA 4IX6A 1QPJA 3SD0A 4S31A 2QKRA 3D83A 5JRSA 1UU9A 4UXQA 1Q8TA 3VUDA 4RIWB 2YIYA 3FLNC 2R7BA 4BI1A 3QD0A 4C0TA 3COKA 3O23A 4IADA 3UNZA 1HCLA 4BBMA 3ZFYA 3E8EA 4GFGA 2JIIA 5JKGA 3AMBA 2OI4X 3BLQA 1CKJA 3O8UA 4IDTA 4LGGA 4QP2A 4A7CA 3A8WA 3W0PA 3R8PA 3NAXA 4AT3A 3Q9XA 2XNOA 4DEBA 4I94A 3JVSA 2X6EA 3PSBA 2FSOX 3A7JA 4IANA 4IX4A 1ZARA 2CLXA 3ZH8A 4AQCA 4QQJA 4KABA 2GQRA 4EK3A 5BVNA 5GINE 3HRFA 4FKVA 2PUUA 4EJNA 1OIYA 4ZXTA 3A62A 3DS6A 4DHIB 4OBQA 3TT0A 1J3HA 4NKAA 5A9UA 3ORMA 1WCCA 1ZOGA 4HVGA 4ASXA 4GV1A 5I5ZA 2J0LA 3C4FA 4TYGA 4GK4A 5DRBA 4IAYA 4Z3VA 2XARA 3CP9A 5JFXA 4MD7E 4BY9E 2C6LA 1PXKA 5F1ZA 4YJPA 2R3HA 4FA2A 4CKRA 3QZHA 3NCGA 3W1FA 4NZWB 4OTHA 1G8AA 4D4YA 5HLNA 4FTIA 2VWZA 3HZTA 4LV5A 4QMSA 4HYSA 1PW2A 4U81A 4LV8A 3R7VA 3VS6A 3POOA 3GI3A 2XAMA 3E8CA 1CKIA 2F9GA 4NFMA 5DIAA 3SGCA 4MQ2A 3WOWA 3QC9A 3MS9A 3TUCA 4BCKA 3BU6A 4FNYA 3TNPC 4YSMA 4E8AA 3G9LX 4RA4A 4RZWA 4AXDA 4TXCA 3RAIA 3R8ZA 4F9YA 2Y4IB 4C36A 3EFWA 3TJCA 4GW8A 1KE8A 4MBJA 4ZZOA 3SQQA 4XV3A 3ZBXA 5DE2A 2QU5A 3RK5A 5IEXA 1P2AA 4DT8A 4FGBA 5ANOA 2XK6A 4XP3A 5KMKA 5M08A 1O9UA 2RFDA 2YM4A 3NDMA 2XA4A 4NT4A 2R3PA 5AIRA 5HE1A 4WUAA 5JZJA 1OIUA 5CNOA 3MPAA 1TQPA 4JNWA 2ZM3A 5EW9A 3WARA 3TM0A 2YN8A 2XIKA 3VBWA 3I6UA 2WMVA 5HO8A 2X6DA 3KEXA 2AEGA 4QYEA 4M69B 4TWPA 3BWFA 3FKOA 3V8WA 5ANGA 4AW5A 3W2SA 2YFXA 5DR2A 4WNKA 3PSCA 5C8MA 1A9UA 4D1SA 4L3JA 1BL6A 1YHSA 1Z57A 2HENA 2PY3A 1ZMVA 3DXQA 3KU2A 4U42A 4MXOA 2GHMA 1MUOA 5EOBA 3W2RA 5EFQA 2NRUA 2YIRA 4IQ6A 5CYIA 5E8VA 2XRWA 2XK7A 3BQRA 4ZTLA 3R1SA 3HV6A 4NU1A 4LUEA 3CGOA 4JL9A 3BLRA 4QYGA 5IQIA 1GIJA 3EQPA 5HIEA 5LOHA 2PMOX 2XB7A 5DH3A 2WXVA 2BAJA 1PMEA 3KULB 2HWOA 1IA9A 2YEXA 3O8TA 3MTFA 2IVTA 5LMBA 4K2RA 1UWJA 2OJGA 3PLSA 2XNGA 1SNUA 3Q04A 2QHMA 2Y6OA 1XBCA 3QFVA 4YBKA 5EDRA 5HZNA 4EK4A 2ZDTA 4GVAA 3NVMB 4KIQA 4USEA 5BVKA 3BGZA 2A27A 1IAHA 4PQNA 4EH7A 1IA8A 4LRKA 3LXKA 4AX8A 4OBPA 4RX8A 4CNHA 4L7SA 1OZ1A 4I5MA 3IGOA 3RM6A 2JKKA 2QR8A 3IW6A 4BDAA 4QDVA 5IUGA 4ZLOA 5EHOA 4XOZA 5HIDA 4AF3A 4BGHA 5AUXA 4EBWA 3UIUA 2BRMA 2Y9QA 4JDIA 1ZYLA 4KAOA 2BTSA 4TKSA 4U45A 5CT7A 4DEIA 2X81A 3HAVA 1MRYA 3MPTA 3BYUA 4GG5A 2R3RA 3G5DA 4OTGA 4O96A 2PE0A 3QKMA 4BVUA 4NK9A 4DDIA 4ITHA 2BKZA 2WKMA 4NM5A 3L8VA 3QKLA 4JDKA 3E8DA 3ELJA 4W4WA 3FLWA 4FEVA 5E1EA 4XV9A 5LARA 4L9IA 3G0FA 5HU3A 1CM8A 2GMXA 2XH5A 4APCA 2O2UA 1H24A 3F7WA 4U5JA 3VUHA 5M4IA 4FNWA 4YLJA 5JQ8A 3FMMA 4DINA 2WQMA 3Q2JA 4DH5A 5CSPA 3R00A 3AC8A 3FMKA 2GNFA 5A4CA 2QOBA 4FSQA 4MX9A 3H3CA 4IB3A 3RINA 4DFXE 4F7NA 4QNYA 4FVQA 4WNOA 4E5WA 4EQCA 4GH2A 3SC1A 3QYWA 4RLLA 4E20A 2UZNA 3ZO1A 5TKDA 4ZTQA 5GIOE 3VIDA 4L01A 3C0IA 3DK7A 1Q62A 4ZSAA 1U46A 4HNIA 1OB3A 1J7LA 3QXOA 2PZYA 3CE3A 2R3IA 4LRMA 3W18A 5M4CA 2QOLA 3BL7A 2PZRA 4USDA 4NL0A 2UW5A 2W17A 3LQ3A 5CT0A 3S2PA 3UIXA 1GZOA 1YXVA 5M4FA 3EQGA 5B2KA 4C2VA 3FY0A 3FZSA 2BILB 4A9TA 2XS0A 2YCSA 1WBOA 2C69A 4IFGA 1Q8UA 2GNJA 3NEWA 4L43A 3VF9A 4D1ZA 4IVAA 4UBAA 3FQHA 4DFBA 1JSTA 4GSBA 3FXZA 3KVXA 3W8QA 5BVFA 3MTLA 1S9IA 5KE0A 4PP9A 4RJ3A 4EI4A 1XQZA 4UX9A 1FQ1B 1W84A 3FY2A 3GU6A 3LXNA 3OEFX 4O7TA 5IG1A 5IQFA 2ERKA 5DEYA 3D94A 3DQWA 4FTKA 2B7AA 4CTBA 3BYOA 5DHJA 1WMKA 3HRCA 4I21A 3OBJA 3ZZEA 1TQIA 2GFCA 2VX3A 2WMWA 2I0HA 3JUHA 2ITZA 3LFSA 4FSMA 2C5XA 5HNBA 4A4XA 3ULIA 2VNWA 3HYHA 2R7IA 5HVJA 3ZFXA 3SXRA 3OY3A 3IOKA 4WD5A 3EYHA 4BDCA 1L8TA 4I5PA 3PG1A 2WTKC 3M42A 3PRIA 3E5AA 1YWNA 4F63A 3QQJA 3HNGA 2VTOA 4QMQA 1R1WA 1XH6A 3QGWA 4GL9A 3R30A 4IZAA 4IBMA 5CU0A 3PDTA 5CU4A 3D15A 5FG8A 4Z16A 2XBAA 1Q61A 3QCSA 3QRJA 5IA2A 4JQ7A 3D7TB 4PMMA 1KE9A 3ODZX 5FGKA 1NVRA 4QT1A 5F20A 4ZZNA 1PRYA 4O22A 3TNQB 1PXIA 2NRYA 4FV3A 1XBAA 4MBIA 5HICA 4X21A 5I9WA 1GJOA 4QQCA 4HGEA 4FUYA 4FTNA 5T6KA 5ICPA 4FK6A 3MFRA 5EQPA 4MWIA 3DT1A 3EN6A 1XWSA 4XBRA 4UALA 4FZAB 1XKKA 4IB1A 3CY3A 2QOOA 3EQIA 2QOFA 4L6QA 4QRCA 4F0IA 2A4LA 1H1PA 5GIPE 1ZOEA 3R21A 4GRBA 2QHNA 3OF0A 4IACA 4XYFA 5EI8A 3RPOA 2OGVA 2YZAA 5FTQA 4EH9A 3D7ZA 1M52A 4QTCA 5CAQA 3OWKA 3RK9A 3NUNA 5HX6A 3FJQE 3LQ5A 4QMWA 4HGTA 4MNEB 3VUGA 3NPCA 4JXFA 3UVQA 4YTFA 1U5RA 3BWJA 2J9MA 3OT8A 3DB8A 3G2FA 2YACA 1U54B 3LFAA 4G3DA 3C4CA 3Q60A 4JX3A 3SW4A 4EWHA 1UA2A 3RAHA 3MVMA 5CU2A 4O38A 3K3IA 3IQ7A 4A4OA 5BYYA 2QR7A 3R7IA 2R3JA 4MXAA 3QTXA 3PSDA 4WHZA 4XMOA 4F1MA 4XS2A 4IAZA 4HGLA 4NW5A 3UIBA 1HOWA 1G8SA 1H1SA 3KL8A 3NWWA 3CD8A 5DVRA 3BCEA 4YHTA 5BUJA 1P14A 2PVHA 3E93A 4DTAA 2XIXA 3KXHA 4LYNA 1KUTA 3V04A 2I0YA 2A2AA 2REIA 3GOKA 4MWHA 3EFJA 5JQ5A 1Y8YA 1J7UA 2FSLX 3HRBA 4AZSA 4ZY6A 3UVRA 4O81A 4FEUA 5E90A 4H39A 1OIQA 1AGWA 3P4KA 3PFYA 1GZKA 4BTKA 2QO9A 2E9NA 4RVTA 1GNGA 4L67A 5CVGA 2PPQA 2G01A 3BEAA 3MVJA 4XBUA 3TIYA 5HNIX 1K2PA 2J4ZA 3L8XA 3GXLA 1Q24A 3QLFA 2ITXA 4XJ0A 4ZTNA 4QP9A 2JIVA 4PL5A 3MIAA 2IVUA 4G5PA 3VS3A 4RC3A 4LOOA 3I6WA 4BF2A 4E4MA 3PRFA 5BUIA 4GG7A 2IG7A 2ITQA 4I1ZA 2BAKA 4DLIA 3FWQA 4U6RA 5IH5A 5HESA 1JSVA 2R5TA 3OMVA 4QP6A 3VHKA 1PXNA 2QD9A 4FTOA 4F6SA 3DTWA 1PY5A 4EHZA 4AN9A 2J5FA 5AV3A 1YW2A 1PMNA 3JY0A 3OCSA 5EOLA 4R1VA 5M07A 4MBLA 1XMMA 4IM3A 3ENHA 5AP4A 1G8JA 2YA9A 3HVCA 4JR3A 3S0OA 4OW8A 1O6YA 2Y7JA 4EQUA 4JOAA 4DCEA 2PVMA 3PJCA 4Z9LA 4RIYA 3RPYA 5D11A 4A9UA 4FEWA 2X7FA 4MUQA 4PF4A 5AX3A 2O65A 2VD5A 3TJDA 4C4GA 2W1EA 5AA9A 3C13A 5K5XA 2PMLX 4BGGA 4ZP5A 5AMNA 4RWIA 5AFVA 2X0GA 3ZXZA 5CX9A 5A3XA 5JFSA 4HPUE 5L6WL 1W83A 2O64A 3VN9A 2CKOA 4GYGA 4IHPA 4IVCA 4NWMA 3ID6C 4FTQA 5E8UA 3PG3A 1E1VA 3QUEA 4UY9A 5L8KA 1SYKA 1SNXA 4QYFA 3EMGA 3V5WA 2YISA 4MKCA 5KMNA 3CKXA 5CQWA 4FJVA 2GHLA 3H9OA 3UZTA 3DBCA 3QD4A 1DAWA 1VZOA 2YM3A 4L53A 4DC2A 4BCJA 4TWNA 4RG0A 4ZAUA 4EOKA 2RG5A 3P0MA 2FUMA 3G9NA 4Q5HA 3ZONA 3PVWA 4QMOA 5IQHA 4ENYA 4JDHA 1MRUA 1NT2A 4GMYA 5DEWA 2EXMA 3ORNA 1DS5A 4E4NA 4MQ1A 3PTGA 3NW7A 4E6DA 3S4QA 3KXMA 4M67A 4YZDA 2BRBA 2EB2A 3MY5A 2Y4IC 4RFZA 3QQLA 4U9AA 5CTPA 1L3RE 5CZHA 1H4LA 3P7CA 5HORA 1DI8A 2C0IA 3ALNA 4EOLA 3BV3A 3IW7A 3PPJA 4LOQA 5EHLA 2VTPA 4G3FA 4ZJJA 3DB6A 3I60A 2DWBA 4DH8A 2WAJA 2UVYA 3ZM4A 3KN5A 4X6QC 4BI0A 3PP0A 5A54A 5DLSA 3MY1A 4I93A 4O83A 5H8BA 3KMUA 1TQMA 2ERZE 5H3QA 5A14A 3KXGA 4FKGA 3BHUA 4MXCA 5AV1A 4JG8A 3F9NA 2GFSA 5CAPA 3F6XA 4R3RA 4MD8E 3R1QA 5AV2A 3ZRKA 3NUXA 3I7CA 2GTMA 2GCDA 2IJMA 4X2NA 3NIEA 1KE7A 3F5PA 4D5KA 3AT2A 3PE1A 5I9VA 2DUVA 3LFFA 4I5HA 4AT4A 5KCVA 4BC6A 2PZIA 3F2NA 2WMAA 3K5VA 4U79A 4XG3A 2HZNA 5LMKA 1CKPA 3CS9A 3O50A 5FD2A 2YJRA 4DT9A 5AUUA 2CGVA 3ZBFA 5FRIA 5CI6A 5K4JA 3Q9ZA 4R1YA 1Z9XA 4DGNA 3OCBA 4N57A 4GJ3A 4AA0A 4A9SA 1KE5A 2B9HA 2FVDA 3DOGA 3QXPA 4RWLA 4DGOA 4HGSA 4O84A 3WI6A 2VGOA 5M56A 3G90X 5FXRA 4XLIA 5CVFA 2B1PA 2PVNA 2YM7A 3MB7A 1Y6BA 5CSVA 1VYZA 4OGRA 4QMXA 4RQVA 3DKGA 5E8YA 4LV7A 4CLJA 4JR7A 3FMLA 4UWCA 3UNKA 2PU8A 2VTIA 3GVUA 3BBWA 3FMEA 4DDGA 3RKBA 3PXRA 4ZOGA 1URCA 4ZSJA 4ZY5A 2BKKA 4OT5A 5B0XA 5E92A 1YKRA 2H6DA 2ZB1A 3KRXA 3Q4UA 4GIHA 3FLYA 3ZLYA 4S32A 3TTIA 3PIYA 3TDVA 4W4XA 4EK6A 2XCHA 3GU5A 5CSWA 2CKEA 3NNWA 2XKDA 4EK8A 1MQBA 4XG4A 5DR6A 3V5QA 3AC2A 3KK8A 2RGPA 3AXWA 3EHAA 3MH3A 2UV2A 3QCXA 4NM7A 3R8MA 4E6QA 5EM8A 3RAWA 3COMA 2P2HA 4LI5A 4J71A 4Q2AA 5CZIA 4EOSA 4Z55A 3RPRA 2OZOA 4YJRA 2ZV9A 2EXCX 3U9NA 5KO1A 1Q8WA 2QCSA 3CQEA 4FNXA 4NSTA 1BKXA 4QNAA 2X2MA 3R6XA 4JDJA 4Q9SA 2IZTA 4XX9A 5CQUA 3FI4A 4HZRA 4RVKA 1ZAOA 3TEIA 1YWRA 3ZLXA 4CFXA 4EZ5A 4UYNA 4QTEA 3HV3A 1Q8YA 5D1JA 4XHKB 3FE3A 4YMJA 2C0TA 4IZ5A 4XV2A 3I4BA 1Q99A 2CN5A 2ZV2A 3OCTA 4AS0A 4JQEA 3SV0A 2YZLA 3A4OX 4BIEA 4S33A 2W96B 2OJFE 3G6GA 2WTDA 5CLPA 4PMPA 4XEYA 1J7IA 3CKWA 2GHGA 4F6UA 4YJOA 2Y6MA 4IJ9A 1EH4A 4D4SA 5K4IA 4C4EA 2NP8A 5F94A 1PYXA 3R2BA 4P90A 4RVLA 3MIYA 5EDPA 3Q3BA 3EIDA 3F61A 4S30A 3BL9A 3F3ZA 4IWPA 3MA3A 4WKQA 3P08A 4X2KA 3A8XA 2BPMA 2YCRA 1OECA 3D5UA 2YWPA 3QZFA 5EM5A 3VRYA 2O0UA 1K9AA 3ORLA 3TNIA 1ZY4A 1H25A 4FGRA 3OD6X 1XH4A 5AUWA 3CSVA 5JN2A 3TNWA 5IQCA 5EYMA 4YUQA 3R9OA 3NUPA 2OIDA 2OJJA 4EOPA 5HCZA 3QTSA 1XHAA 2BTRA 3Q4ZA 4ZTSA 2W4OA 3GT8A 4NCTC 2Q0NA 4V0GA 1Q8ZA 3IW4A 4U8ZA 5IQAA 4BDIA 5IPJA 2CCHA 3R8UA 5IUIA 3EFKA 4FVPA 1ZYCA 4ASZA 2ZM4A 5HLPA 1YXXA 4ONAA 5HU9A 5IA4A 3RK7A 3HLLA 5LVNA 1FMKA 2C5OA 3GC9A 4C34A 4EORA 4E1ZA 4X7QA 5JH6A 5HE3A 2BDWA 4I24A 1Y91A 2EWAA 2OXXA 3B8RA 3OXIA 3EZVA 3DJ6A 2RL5A 3DAEA 3L9MA 4HPTE 2HWPA 3R22A 4YZMA 1FVVA 3T9TA 3CPBA 3UODA 4E7WA 5ANEA 3IGGA 3MFTA 2PZPA 5HTBA 2B52A 1J1CA 2R3QA 3D5WA 4E6AA 3NRMA 3UOJA 5CAVA 3DBDA 5TR6A 4RPVA 3GCSA 4S2ZA 4DEAA 4MHAA 3O0GA 4H1MA 2NNWB 4QP3A 3GB2A 4DN5A 5I9XA 3LMGA 1JKSA 5HD4A 2XJ2A 5H8GA 4DF3A 4U97A 3BHTA 4GEOA 3MESA 4CT2A 1NW1A 3MV5A 3QTWA 3ZEWA 3TZ8A 3KIOC 1OGYA 3WYYA 4FKQA 3ZHPC 2ZVAA