4FEUA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor anthrapyrazolone sp600125
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
253
Chain Sequence
LDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
total genus 74
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4feuA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4feuA02
4EK5A 4XG7A 3POZA 4AOIA 4D2RA 3VUKA 4BBMA 2XB7A 5A4QA 2AC5A 4FGRA 4NKAA 4AFJA 2GHGA 3LXPA 4PY1A 4CMUA 1URCA 5T6KA 4L44A 4FR4A 2ZV9A 3R0TA 3F5PA 4F65A 2C6IA 2J51A 5LQFA 2P0CA 2G01A 3ZSIA 4Z55A 3GU7A 3QBNA 1ZMUA 4O7WA 1MUOA 2BTRA 3FV8A 2BAQA 4C4IA 4CV8A 4EOPA 3FBVA 3BQCA 2OFUA 3BHUA 4C3PA 5TR6A 3M11A 4RQVA 4A06A 5IH4A 3SW4A 5IPJA 5DEWA 3V5PA 4UYNA 4F09A 5CU2A 1H24A 1B39A 3BYVA 5J7HA 4W8EA 2WU7A 3D7ZA 1GNGA 5AM7A 3BV2A 4EK8A 3HKOA 3QCYA 4LRMA 4NK9A 4PV0A 4EOSA 4AA5A 1OL7A 3NUSA 4JBOA 3MY0A 3CBLA 4QMQA 2HW7A 4YNOA 1GZOA 1Y8GA 2XF0A 4FIGA 3W2QA 2GTNA 2BTSA 4YPSA 1H4LA 4D4YA 3VJOA 2RIOA 3O23A 4AW5A 4RJ7A 2VN9A 2GCDA 4X2FA 5CU6A 3AT3A 2NPQA 4BGGA 3O71A 3K3IA 4BC6A 4L3LA 5KMLA 4YSJA 1FMKA 2W4KA 4ZS0A 4A7CA 2X8DA 5KBQA 3I0QA 3ZXTA 5B7VA 2C5XA 2OI4X 2UW8A 2CGVA 3R8UA 1PXJA 3FJQE 5AMNA 2W5HA 3HMNA 4IJPA 1NVRA 3NRMA 4IZ7A 3A62A 4M68A 4OW8A 5DFPA 2UZEA 4A9UA 5J9LA 2JFLA 3Q5IA 3AGLA 4FZAB 3UG2A 4F7JA 3FLQA 5AAEA 4QMSA 2B1PA 3PYYA 5E92A 3QCQA 4E6AA 4RX5A 3QKMA 2B52A 3R73A 5CEKA 5JFVA 3IG7A 2UZDA 2XUUA 3QRTA 2ZAZA 3HP2A 4G6NA 4O7VA 4FUYA 4YBJA 3FLZA 3ROYA 5CT7A 4ZK5A 2ZM4A 5DG5A 5EDRA 2WPAA 2R64A 5CI7A 2VWIA 1H1PA 4QYGA 4QTCA 5AV1A 4DGMA 1YI4A 4MNEA 5EFQA 4IB1A 5DH3A 3QTSA 2VGPA 4ZTNA 3ATSA 4FV0A 3RPYA 4U6RA 2C47A 1XO2B 4XEYA 1YRPA 2E9VA 4YPDA 4TT7A 4ZTSA 4KINA 3DV3A 1QPEA 1Z5MA 2BHHA 1FVVA 3FI4A 4MQ1A 3A61A 3HLLA 1WVXA 2W1DA 3PVBA 1OMWA 1S9IA 4LUEA 3BGPA 5GNKA 2OF4A 3C5IA 2VWZA 3PWYA 4K33A 3VQHA 5AWMA 4FSUA 4RSSA 4GH2A 1T45A 2WQNA 5FEEA 3AMAA 5EYCA 3ZO4A 3KL8A 5DHJA 4IAIA 1Y8YA 2VGOA 1J1BA 5HIBA 3QZGA 4YTHA 3C7QA 5CENA 4F63A 4HW7A 2YZAA 4HVHA 4XV3A 2UW6A 4AGCA 3E87A 3TZ8A 3ZO1A 4APCA 4O7SA 3F3VA 2C5NA 3LFSA 4U98A 1CM8A 3D2KA 4WBBB 3G6GA 4C4JA 3H9RA 5BUIA 5ANOA 3W55A 4EONA 4L01A 5TO8A 5A9UA 2OFVA 1YXXA 1E1VA 4FKGA 5C9CA 3V3VA 2GNIA 3S95A 3QX4A 4UB7A 4V05A 2C6KA 3GU4A 3VBWA 4TYJA 4BGHA 4KABA 3DOGA 3R28A 3RP9A 2ZV7A 4M14A 5AUZA 3ZBXA 3W0QA 3FMDA 2CJMA 2E9PA 5AV2A 1MP8A 3CE3A 1ZZ2A 2BZJA 1BLXA 2NRYA 3I4BA 3QD3A 1Q61A 4I5HA 1XH6A 4IVDA 4LV5A 4BIEA 3ZLSA 5KCVA 4U94A 1YHSA 3NR9A 3QA0A 5IH6A 3GFEA 2PTKA 3GCPA 3U4WA 3R8PA 4FSQA 3CY2A 2Y6MA 3CGOA 4Q9SA 4QP6A 3NX8A 4BCQA 3BX5A 4YLJA 2NRUA 4DAWA 1YVJA 3Q6WA 3VUGA 5D10A 3QRJA 1IAHA 4J52A 3U51A 4ALWA 3OVVA 4IAZA 3W8QA 3WF9A 5HHWA 1WFCA 4EYJA 5IUIA 3QC4A 4NW6A 2R3GA 2YJRA 5F20A 4AW0A 4MXAA 1MRUA 2QOCA 4XG2A 1JVPP 3THBA 1LUFA 2B55A 1J91A 2UZUE 3QTIA 2QHMA 3DKGA 4U40A 3SC1A 4JR7A 4RQKA 3G51A 3F5XA 4BBEA 4S2ZA 3WZKA 1OECA 4H3QA 1MQBA 4I0RA 3ZONA 4UN0C 1ZY5A 4DLIA 4EBVA 3W2RA 2HAKA 5HG5A 4EH9A 5CY3A 5EHOA 1ZRZA 3HV4A 1VYWA 4OT6A 3SHEA 3ORPA 4JL9A 2OJIA 4GJ3A 5HG8A 4WRGA 4JIKA 4JBQA 5JMSA 5HICA 2V22A 4EI4A 1IEPA 5CU0A 4KAOA 5EM8A 4U0IA 5IA2A 4C61A 2VTQA 3DBDA 3MTFA 4Q5HA 3L8PA 5L2TA 4WT6A 3W0MA 2OZAA 4C38A 4H1JA 4RC3A 4WBOA 3BKBA 4EYMA 4QO9A 1XH7A 5B2KA 2CNVA 2V7AA 3GI3A 4M15A 2GTMA 3G6HA 4O7RA 2YDKA 3BWJA 2XYNA 3TWJA 1OIUA 1QMZA 4FEXA 5L3AA 3R02A 3ZUUA 4AU8A 4FOBA 3FLNC 4ZLZA 2YM8A 1M52A 2CN5A 3A99A 4H1MA 2JKMA 3DGKA 2VD5A 1I09A 4RZWA 5IA3A 3CJFA 1ZOGA 2C6OA 3KRLA 2I6LA 3QLGA 3QA8A 2XIRA 4FK3A 4HYSA 5C8MA 2WU6A 4YZBA 5EW9A 3R7OA 4AA4A 4HVIA 3O96A 4TY1A 4JDKA 4CCBA 4F1MA 4TWOA 1ZAOA 3C51A 3Q2MA 4FOCA 4MTAA 2VRXA 4ORKA 4B9DA 2CKOA 4KSQA 4FZ7A 4ZZMA 4BDEA 4UV0A 3DBQA 4CXAA 3OUKA 5GJDA 3OMVA 5CXHA 4BGQA 5CEOA 3ROCA 3PPZA 1ZXEA 1R0PA 3C4XA 3G2FA 3L9PA 3RINA 4DT9A 3PIYA 3UO4A 3LW0A 5BYYA 1UU9A 2O5KA 2X6DA 3FZSA 2B9HA 2WMTA 2JDRA 3P5KA 3UGCA 5HI2A 4K77A 2WEIA 3Q9ZA 2RG6A 4UXLA 3ZBFA 1YHWA 3UC3A 3CC6A 3EKNA 3LFQA 2BR1A 3FQEA 4LMUA 4UZHA 5AX3A 2BDJA 1WBOA 3ZM4A 4AGWA 4FMQA 5IQHA 2IZTA 3SDJA 4ZSAA 3GCUA 5JRQA 3W33A 4BN1A 3COMA 4PMSA 4X7QA 5EDQA 2C69A 3IK3A 4AF3A 2PYWA 2AYPA 2J5FA 2OWBA 2QOIA 3A8XA 3CKWA 3LFFA 4FC0A 4G9RA 5L2SA 3ZEPA 2IZUA 4NTSA 5FRIA 2VTOA 3ORNA 3RALA 4ZY5A 2R5TA 3PXRA 3R6XA 3DK7A 3U55A 3UZPA 4BF2A 3W32A 2Y6OA 4C4EA 4M67A 5ANIA 4S31A 5DGZA 3MH1A 3SD0A 3II5A 3MIAA 1XQZA 3P86A 5AP4A 3PJ2A 5G1XA 1FVRA 5AIKA 2V62A 3AC3A 5CU3A 3V5WA 3MGYA 3NYOA 5EH0A 1JKKA 3QYWA 3WIKA 4IWDA 2QONA 4F0IA 4I93A 3HP5A 4FV2A 4KBCA 3PE1A 4RJ8A 4P90A 1YXTA 3E3BX 3KU2A 3MS9A 2BIYA 3DB6A 3OG7A 4MNEB 4YJNA 4GK2A 4RFYA 2YIXA 4JDHA 2UVYA 3MPMA 4XRLA 4DE4A 5JGBA 2ITVA 2YITA 4JI9A 3RMFA 4I94A 4BRXA 2QD9A 4EWQA 2KULA 2Q83A 4Q9ZA 2R9SA 2WNTA 3VC4A 4C0TA 1OB3A 1JOWB 3D15A 5IMEA 3ZCLA 4C7TA 5JFXA 3QUPA 5E90A 4E6QA 3S0OA 4XOYA 3UJGA 4YO4A 2F7EE 3D7TB 4LL0A 1CKPA 3PVGA 4QTBA 4KRCA 2WHBA 5EM5A 1JBPE 4ZMFA 5AEPA 2FH9A 1OKZA 1XBCA 1U54A 1SNXA 2EUFB 3JY9A 3H4JA 3QYZA 1H1WA 4G1WA 3EQBA 3KN5A 4RIWA 3FC1X 4Y46A 4USFA 3VQUA 5I4NA 5E8TA 1J7IA 3DAJA 4FEQA 1OKYA 5C1QB 5J87A 4ACHA 2H8HA 2ZV2A 2R3PA 2XRUA 1Q8UA 3MFRA 4YTFA 3ZU7A 2PE0A 4CRSA 4FIJA 4TTHB 5J1WA 3VW6A 2BZKB 3BLQA 1Q41A 3QTQA 1VJYA 4FYOA 4RG0A 4ACMA 2W5BA 1PF8A 5EOBA 3DQXA 1OIRA 3G0FA 1Q62A 2OIBA 3E8DA 4H3BA 3E63A 2W1ZA 4FIIA 2WMWA 3FHIA 3FUPA 1W84A 2NNWB 2XEYA 3TTJA 4RMZA 4ZSJA 1SNUA 3U6JA 4O0TA 4KIPA 3R2BA 5B0XA 4FTCA 3G5DA 1V0OA 1OKVA 4BYIA 2J2IB 4ERWA 3O7LD 4EWHA 4YHFA 2RFNA 2J50A 3D5XA 5KMMA 4NW5A 3TDWA 1CDKA 3EFKA 4DFXE 4E5BA 3DY7A 3SRVA 4ZAUA 4ACGA 2PZIA 3UYTA 4AT3A 5JSMA 1KE6A 2YHVA 3D14A 4L7SA 3ET7A 1QL6A 2BRMA 2F2CB 5BUJA 3GQLA 5DOSA 4RT7A 3I81A 3N4TA 4LM5A 4YC8A 4NM3A 4F9CA 4XLIA 5I9XA 2C6EA 5HO8A 1OBDA 3AC2A 3K3JA 4F7LA 4XJ0A 3PXFA 5CAQA 3F5UA 5IH5A 3HA6A 5JFWA 3W0NA 4EQUA 2HELA 3G9LX 3BBTB 2PVKA 1YHVA 2Y0AA 3LAUA 3QU0A 4JVGA 5LARA 4QP3A 1O6LA 3ULIA 3VS6A 3BE2A 1RQQA 4A9YA 2IZSA 1JNKA 2X9EA 4J53A 3RNIA 4F08A 3PY0A 3QL8A 1M14A 3WIGA 2VO0A 5IQAA 3QZFA 4AXAA 5BVDA 2EB3A 4MYGA 3Q32A 3TT0A 3QAME 4QP9A 2XIXA 2JC6A 2B9JA 4WG5A 5EOLA 5CSXA 4FTAA 4ANBA 4AE6A 4BDCA 3TN8A 4O91A 4IADA 5LVNA 4C37A 3FQSA 5CEIA 1UU3A 3PA5A 4F0FA 1JKLA 2GNLA 2H9VA 1LR4A 3LFAA 3BBWA 4CFFA 2CKEA 2FA2A 2I0YA 4ACDA 2OBJA 2CGWA 3F7WA 4AZFA 4CTCA 4DHFA 3UIXA 3OOMA 2QO2A 4OT5A 4XG4A 2JAVA 2W1EA 5BMMA 1Y57A 1PMUA 3VUDA 3FXXA 4NYEA 4OTWA 3FL4A 4BR3A 4YJUA 1WBVA 4BCGA 1PXOA 4OTDA 3TZ7A 4Y8DA 2HENA 4ZTRA 5DIAA 4RC4A 4TWNA 4FTUA 4XCUA 2W7XA 3I6UA 1RW8A 3JS2A 2WZJA 2ITUA 3R8VA 3ALOA 4JDJA 3E88A 4RZVA 2JIIA 2VTRA 2IG7A 2VWYA 4J95A 1XBBA 2PMNX 4EZ3A 4DGOA 5M51A 2R3JA 4O0WA 5ANEA 4E8AA 4DT8A 3HEGA 4KS7A 5DRBA 4K2RA 1WAKA 4MAOA 4APPA 4QP1A 2VWVA 4FKQA 2QI8A 2XNGA 3EQDA 3MYGA 3ZFYA 4QP7A 2OF2A 4TYIA 4LYNA 5CF4A 5J5SA 3IDPA 2REIA 1JSTA 2W05A 4FT9A 3JY0A 4PL3A 4CZTA 5A4CA 4EOOA 5J9ZA 2VWBA 3HECA 3KREA 3QCXA 3ZSGA 2JLDA 3EL8A 2P2IA 4BICA 5CEMA 3MPAA 2WGJA 4EOMA 5KMJA 1NXKA 3ZEWA 4B6LA 1IG1A 5EKOA 4O22A 3DNEA 3MB6A 3ZH8A 3TEIA 2J0MB 2BKKA 2QOQA 3PWDA 4E1ZA 1NW1A 5IQGA 1WBSA 4G3CA 4UX9A 2ZMDA 2QKRA 3JYAA 4FEWA 5BVOA 2ZM3A 2Y4IC 3JVRA 3QD2B 4FV1A 2WD1A 4I21A 4U41A 3TXOA 1PMVA 1Y91A 4NTTA 5AUWA 3R7EA 3VBVA 3SAYA 5B2LA 3MFSA 2VX3A 4IH8A 2PUPA 5GJFA 3BIZA 1F3MC 4G2FA 2YCFA 3MY1A 5JN2A 1H8FA 3KMWA 1PJKA 4GFMA 3N4UA 2YM4A 1Q3DA 4MK0A 3SQQA 5JGDA 2HY81 3ZLYA 1WBNA 3LLTA 5A6OA 3GU6A 4PNIA 3E93A 4OUCA 4TKSA 1ZYCA 3ZDUA 4HYIA 1DAYA 3O8PA 3Q04A 1IRKA 3KXNA 3FDNA 5DYJA 3V8SA 1BUHA 5DVRA 4GU6A 2OJJA 4ALVA 2I7QA 2UV2A 4OTGA 3NCZA 3CCNA 2UZBA 3TNQB 1U5RA 1R0EA 2G9XA 4Y5HA 2BIKB 3DXNA 3NIZA 3OCSA 3HX4A 4O2PA 4MBLA 2WB8A 3PJ3A 2O63A 1UNLA 3OT8A 3QTUA 4KKGA 4V04A 5I9ZA 3B8QA 1YOJA 4FIFA 1H26A 3RHKA 4JLCA 4NJDA 3CS9A 3EYHA 4QTAA 3QQKA 4CMOA 4QMLA 4EJ7A 2SRCA 2WOTA 3I7BA 3KVWA 3FXWA 5DI1A 5GJGA 1ZARA 2XP2A 5EM7A 5A46A 3NNWA 4IAYA 5EYKA 4G5PA 2JDTA 4HCVA 3F5GA 4CFVA 2XEZA 4DCEA 5E1SA 2BVAA 4JR3A 3QQLA 1JSUA 1KOAA 3N51A 1G3NA 5I9UA 4EJNA 4FKIA 1B38A 2GU8A 1BL6A 2UW3A 1JWHA 4L6QA 5L2WA 1L8TA 5DPVA 1QPJA 5BYZA 4F70A 2E2BA 4EH3A 4BI1A 3GU8A 1LP4A 4B4LA 4U44A 4F99A 4QTDA 4OTQA 4LMNA 5IUHA 3P9JA 4HPTE 4QMWA 4C34A 3H9OA 4EOIA 4HCTA 2X4ZA 3Q2JA 4AGUA 3SV0A 4X2KA 3HZTA 5HE3A 4DGLC 4XNEA 2RGPA 2CNQA 3GOPA 4OGRA 2DS1A 4FL1A 2BHEA 1DI9A 3OWJA 2ZOQA 2C5VA 1EH4A 2IWIA 4PDYA 3DFAA 2VTPA 1NY3A 2H6DA 3P0MA 5E7RA 5AP1A 3EL7A 2F4JA 3NNVA 3ORZA 4Y73A 4FTOA 5D7VA 4BVUA 1UWHA 3W2SA 3ZO2A 1UA2A 4I6FA 3DB8A 4D5KA 3W2CA 4UWYA 1OL1A 2ZYBA 3C0HA 2YCSA 5JQ5A 1BMKA 3PJCA 3T9IA 5F95A 4YU2A 4J1RA 4O0VA 1Q4LA 2YAAA 4A9SA 4XG6A 5HTBA 2EB2A 3EQPA 1XR1A 4IM0A 2DWBA 2Z7LA 4C02A 2PMIA 1HOWA 2PZ5A 3PRFA 5HCYA 5TT7A 3P1AA 1UVRA 1ZOHA 2JFMA 2IVSA 4FYNA 4KS8A 4YMJA 5AA9A 3WOWA 4FICA 3MVHA 1OUKA 4C2VA 3BYUA 3A7GA 1CMKE 4IX3A 4MCVA 2XYUA 3LXLA 4XLVA 4QYHA 3I60A 4QMZA 3LE6A 3RVGA 3A7JA 1QPCA 2HWOA 3BELA 4DH8A 2HIWA 4BCNA 1G5SA 4LV8A 2I0VA 3BLRA 3IW7A 4QP4A 1UU7A 5KUPA 4GYGA 2O65A 4XBRA 3REPA 3EQGA 3ORTA 3KXMA 4M12A 2HYYA 3DKCA 3RAHA 3TACA 2ETKA 5ANGA 3R21A 3WE4A 3LZBA 4WKQA 4KB8A 4USEA 4FE2A 4PRJA 5EQYA 3QALE 1WVWA 2UZNA 2CGUA 2JBOA 3A2CA 3QGWA 4O6LA 4UEUA 3O50A 3CP9A 4JQ7A 4QOXA 4YZ9A 4AOTA 4AW2A 4BCKA 4D5HA 4E4MA 4IVCA 5CT0A 2WMXA 3TKUA 2J0JA 3MH2A 4ASDA 1O6KA 3R8ZA 3BGZA 3L8XA 2A4LA 3OS3A 4YJRA 2UZWE 3CTJA 4WHZA 3DT1A 4UZDA 5CF6A 3H9FA 4II5A 4E4LA 3DDQA 2JD5A 2Y4IB 2XKFA 3OCGA 4L52A 4TL0A 4H3PA 4E93A 3FMHA 3ZDIA 3I5NA 3NDMA 4A9RA 4AN3A 4TN6A 3TCPA 5C4LA 1JAMA 3UTOA 4AFEA 3UNKA 2Q0NA 5DBXA 1YXVA 1YWRA 1SMHA 3S4QA 4DTBA 5LMBA 4I5MA 4F9AA 3ZZEA 3WF7A 3R9OA 3FZ1A 2ITPA 1IAJA 4RVMA 5HLPA 5IQFA 1NVQA 2WTCA 4HNFA 5HX6A 1K2PA 3MFTA 3Q4ZA 4DGNA 4F0GA 2VX0A 4N6YA 4EHZA 3R22A 5HU9A 3AC8A 4PDSA 5KHWA 4EOQA 2FO0A 4ONAA 3IOPA 5EHLA 3GC9A 3W0PA 5BQ0A 2VTLA 3NYNA 2UW7A 1H0WA 1ZYSA 3BHVA 4I23A 3NWWA 5KMOA 2O64A 2XK8A 3E8NA 2VTNA 2WEVA 4HGSA 4IANA 4PTGA 2HZ4A 4Q5EA 3RCDA 1FQ1B 4YZDA 1R78A 5LCJA 4O7YA 4G3GA 3EN4A 3R1SA 4ASXA 1ZOEA 5EG3A 5M44A 1V0PA 4FKOA 4U42A 3ZUTA 5FP5A 4OTFA 4FV3A 4FT0A 4EC8A 3D2IA 3IECA 4HGEA 5KBRA 3HUBA 1YQJA 2OGVA 2X1NA 3NW5A 3POOA 4L8MA 2QNJA 4IAKA 4JX7A 5DT3A 5CVFA 3V6SA 3VS7A 3PTGA 3VUIA 3ZOSA 3CR0A 3QXOA 2VTAA 3NIEA 3PZEA 3FMNA 3WZEA 3Q4CA 4B99A 4YNEA 4BBFA 4R5SA 2ZVAA 3VIDA 4IACA 1OITA 4FKRA 4BCHA 2O3PA 3BGQA 3DCVA 4CEGA 4AGDA 2QOHA 2QLUA 3MVMA 4WSYA 3S3IA 4C4GA 5CALA 4RPVA 1O9UA 4AAAA 1Q8WA 1O6YA 1A48A 2C68A 2R3LA 4MBJA 4TWCA 2B54A 4E4XA 2CLQA 2AUHA 3UOJA 4FX3A 4QYEA 1UV5A 3F9NA 3NAXA 2QU6A 5CU4A 4C36A 2QVSE 3UIMA 4EZ7A 4FT3A 4KIOA 3NS9A 5KNJA 4IWQA 5FGKA 1OM1A 4I4EA 2X2KA 4S33A 2JIVA 2UVZA 3Q9XA 2BAKA 1A06A 4X2NA 4M84A 3NZ0A 4AG8A 4DA5A 2R2PA 1TQIA 3BCEA 3LLAA 5F94A 4I6QA 4Q2AA 2X6EA 5LCKA 3VNTA 4DBXA 4EKKA 4GEOA 4HVDA 2PZPA 3MI9A 5GHVA 3NUXA 4AWIA 5M57A 3L9MA 5DEYA 4CV9A 3ZRKA 4FK6A 3MN3A 5EYDA 4RVTA 4WNOA 2CSNA 2QR8A 4PDPA 1U59A 3MSSA 4I0TA 3IONA 3KFAA 3FSFA 2Z60A 4KA3A 1M2QA 2PZRA 3OC1A 3UZRA 5A4EA 2XKDA 4FTRA 1PHKA 3BWFA 4FG9A 2FYSA 1QPDA 3LCTA 3FHRA 3PVUA 4FTMA 3ULZA 4JAJA 2A27A 4M0ZA 2QOOA 4CQEA 4BYJA 4GK4A 4DTAA 2H96A 3D0EA 4BDAA 1OGUA 1YOLA 1KE7A 3DAEA 3F3ZA 5BPYA 3SA0A 4AQCA 4R3PA 4HGTA 3L9NA 3FKLA 3F2NA 2VAGA 4H36A 3V5JA 2PVLA 2BDFA 2OZOA 3MDYA 5FXSA 4IM3A 5G6VA 4DG2E 5FEQA 3ELJA 3NSZA 4PL5A 4RJ3A 3HV5A 3I1AA 3E8EA 4AT5A 4NM7A 3O0GA 1PMNA 4RIYA 4CNHA 4GT4A 4BDIA 3IDBA 2AC3A 2C6LA 2YIWA 4YBKA 3FXZA 4R78A 2HXQA 2WTDA 3RI1A 5L8KA 3R2YA 4FTLA 4YLKA 3R8LA 4D2SA 2O8YA 3O17A 4D1ZA 4ZTMA 4XP0A 4D4SA 2C1BA 4FTTA 3U87A 4HYHA 2WO6A 3GP0A 4B8LA 4F9WA 3SRVB 4CKRA 5HEZA 1FPUA 3ACKA 3BHHA 3R7UA 1XKKA 2VTIA 2BFXA 2YM6A 3CQUA 3DBEA 3NUYA 4F6WA 5HO7A 1A9UA 3BYOA 3O51A 3U54A 3T9TA 2IJMA 3ORIA 2Z02A 3NNUA 4JRNA 2X7FA 3GGFA 3ITZA 3E92A 3HV3A 4CVAA 3F2RA 4FSTA 4MWHA 4EQMA 3MESA 5IA1A 3QRIA 5CAPA 5IEXA 2QR7A 1TQMA 1H07A 1GAGA 4BTJA 1JQHA 4KKHA 3D4QA 3KMUA 4Z7HA 5CSVA 4I41A 2CMWA 4DTKA 3EYGA 3PVWA 2CDZA 2XIYA 4O7OA 3PFQA 5I0BA 3LXNA 5HCZA 4AE9A 5AJQA 3PY3A 4JNWA 2QO7A 3GVUA 2E9NA 2IVTA 4FZDB 5C27A 3HUCA 3CY3A 5JFSA 5GIPE 2PMLX 2JGZA 1ZY4A 4ALUA 4HZRA 2UZTA 4WNPA 3GNIB 2PVYA 3GC8A 2WTJA 4FI1A 1CKIA 3OCTA 4ZZNA 1YWVA 3HV7A 5DLSA 4A4LA 4QTEA 3QCSA 3SW7A 3Q60A 3VUHA 4O21A 4O7NA 3U6IA 3KXZA 4F6SA 4IB0A 4USDA 5AUXA 4EUUA 3OW3A 3U9CA 4N57A 3KCFA 2BUJA 2PVFA 3F3WA 5AP7A 5EW8A 2ONLC 3TNPC 5CSPA 1J3HA 4L9IA 5FP6A 5HVKA 5HD4A 2YM3A 3KF4A 1H0VA 5F4NA 3DLSA 3OZ6A 4JQ8A 4ZEGA 2RL5A 3VBQA 2R3HA 4M69B 4MD9E 1Q24A 2XM9A 3BHTA 4L46A 2WIHA 1OBGA 1PXLA 4U5JA 2WOUA 3LFNA 5FG8A 4JBPA 1GOLA 2YN8A 4M13A 5EDPA 3D5UA 2G1TA 5DWRA 4MXYA 4AS0A 4G3FA 3RJCA 4R5YA 4KBKA 1YW2A 3C4EA 4YJPA 3DBFA 5CSWA 3VF8A 4D4VA 4MX9A 3C4WA 2P55A 4MF1A 2V7OA 1YOMA 4RWJA 5A54A 4CMTA 1YXUA 3DK3A 3HA8A 3WYYA 4F7SA 2CHLA 5HIEA 2GFCA 2UW9A 3N9XA 1UWJA 3P4KA 4L67A 1X8BA 2ZMCA 4FNXA 4C3FA 2UZLA 2GHMA 4GG7A 1CKJA 2A0CX 3FLYA 3NEWA 4CFWA 4JQEA 4DBNA 3DTCA 1HCKA 3ANQA 3BQRA 3ZFXA 2WELA 3KMMA 4FTQA 4U45A 3RWPA 1IA9A 1PKDA 2W9ZB 3NW6A 1R1WA 4EH5A 3RM7A 3OWLA 4JRVA 5L6WL 4CT1A 4GFOA 5CANA 4X6RA 2VNWA 2GDOA 3JR1A 2C30A 3TV7A 2YWVA 5K4IA 2O0UA 5M53A 1ZYDA 5IDNA 3VHEA 3ETAA 3HMOA 3I79A 4O7PA 3LFEA 3L9LA 3W16A 1OIYA 4AA0A 4PP7A 4B7TA 4RBLA 5KMKA 5D9HA 3ZLXA 5HE2A 1APME 4X2JA 3OOGA 4FTIA 3KXXA 4DEEA 3CEKA 3OTVA 4DFBA 1U46A 4BDDA 3OROA 3PXZA 2X39A 4KRDA 2OJGA 2OJFE 4OR5A 5H9BA 2Z7SA 4YGAA 4JG7A 4PMPA 1JLUE 4GKIA 4BCFA 2WAJA 4YC3A 2I1MA 2W9FB 3F3TA 4RJ6A 4YTIA 2IVUA 4QMVA 2QOLA 4TRLA 3OW4A 2CPKE 1OKWA 4WOVA 5HCXA 2WIPA 2XMYA 4ANMA 3F88A 3UQCA 2F7XE 2P3GX 2YEXA 1IASA 5H8GA 3PUPA 3W8LA 5FUTA 4C2WA 3H30A 3W10A 2RG5A 3DTWA 3EOCA 4IAAA 3E64A 2YIYA 5HE0A 3A4OX 5E4HA 1ZYJA 4F6UA 5JZNA 3RAWA 3ZC5A 5AADA 4NCTA 3NVKI 4LOQA 1W0XC 4AUAA 2EU9A 5CZHA 4O0XA 3Q6UA 2BZIB 1Q99A 2PK9A 4P5ZA 4RWLA 3QTRA 4W4XA 3UDBA 4NZWB 2B53A 4JAIA 4YZNA 2W17A 4EK4A 5EM6A 3GXLA 4ITHA 4AN9A 1PXKA 1ATPE 4WD5A 3W2PA 4CFMA 1H28A 2YIQA 1GJOA 3CTHA 1XHAA 2XNOA 3LFDA 3IW4A 4E73A 5AA8A 2G2HA 4IBMA 4U3YA 4ZIMA 2V55A 3QXPA 4JG6A 3QKLA 5IG1A 1UNGA 4B0GA 3S00A 4MH7A 5C8NA 2ONLA 3F7ZA 4WRSA 5IQDA 4EHGA 5CS6A 4R7HA 3ZMMA 4RIOA 3MTLA 2IPXA 1BYGA 2X2MA 3C4FA 3NGAA 4F4PA 3P79A 2G2IA 5IISA 5IQEA 3PPKA 3FZOA 2CGXA 5ETCA 1BKXA 2QODA 3P7BA 4K1BA 4XMOA 2YDJA 4HPUE 4L3PA 4K6ZA 2I0HA 3KXGA 3PG3A 4CG8A 4IX4A 2CCHA 3QD0A 4RX7A 5FD2A 3NPCA 2OJ9A 3QZHA 4IIRA 4QMMA 1W7HA 3PRIA 4WG3A 3QUDA 3WYXA 2XIZA 4XV9A 2W1CA 3PIXA 1LEZA 2WMAA 5HBHA 3UVQA 4AZTA 2PY3A 4MXXA 5TKDA 1W98A 4I3ZA 3BHYA 3FSKA 1SYKA 3NYXA 2QCSA 4ID7A 4ZY6A 3GUBA 4I22A 1Q8TA 3F2AA 5TOZA 5CF5A 4FV9A 2I40A 3CLYA 4IX6A 4GCJA 3ZLWA 3KXHA 4IHPA 4LGGA 3DBCA 2ITNA 3KVXA 1Z57A 4R1YA 4FSZA 1Y6AA 4RWIA 2PZYA 5FXQA 4DEDA 2BRHA 2FB8A 5AFVA 3F66A 3BU5A 3LQ5A 3VJNA 5CF8A 3ZFMA 3BU3A 3T3UA 3TG1A 4A4XA 4C33A 4O0YA 1PXMA 1KOBA 1UU8A 3QHRA 3ODZX 3C0IA 5AUYA 1H25A 3HRFA 4WG4A 4RIXB 3CIKA 5HGIA 2BRNA 5TF9A 1FGKA 3Q96A 4C4FA 4D28A 3EB0A 1SVHA 2X0GA 5BMSA 3D7TA 5KZIA 2GMXA 3LMHA 2FSMX 2HW6A 3NLBA 4MNFA 5FQDC 5IA5A 4D0WA 4Y5QA 1ND4A 4P4CA 1WVYA 3LCOA 2DUVA 4FNWA 4L7FA 4LUDA 2Z7QA 3UMXA 3MH0A 3FAAA 4X3FB 3C4CA 2O2UA 2P33A 2QOBA 2YJSA 3HMMA 3KQ7A 4V0GA 4MQ2A 5ITAA 3GCSA 4QQCA 2J4ZA 4TPTA 1REJA 4KD1A 4W4VA 5KHXA 3PXYA 4QPAA 4RIXA 3RPOA 3TYKA 1YDSE 2XCKA 5KE0A 2W1GA 4U3ZA 2HWPA 3SG9A 3QQUA 3PXKA 2XNMA 4BHNA 3DKOA 4TNDA 4HYUA 3TKHA 4QQTA 1XH4A 3B2WA 3R8MA 1NT2A 1XH9A 2EXCX 2ZV8A 2CLXA 2PU8A 3MIYA 3NUPA 5FBNC 2W06A 4IDVA 5HESA 5E8WA 3LM5A 3KK8A 4YJOA 4PP9A 4AN2A 4E6DA 5I9YA 3D9VA 5EI6A 4R7BA 2ZB0A 3U6HA 1KSWA 4GRBA 4QMOA 2DQ7X 5EQPA 4YC6A 2CKPA 4R77A 2QOFA 5F1ZA 4YR8A 4GVJA 3SXRA 5FXRA 4K9YA 1S9JA 2XJ1A 3LHJA 3D83A 3EQFA 4PMMA 5FTQA 2XA4A 3G0EA 3ID6C 3LCKA 4O7ZA 5LVLA 2IW8A 2XNPA 4BCIA 5LXMA 2BAJA 4X2GA 3FMLA 3BLHA 4QMNA 3UZTA 3DKFA 4FTNA 3I0OA 2OH4A 5I5ZA 1E9HA 5K5XA 3PDTA 4UWBA 5LMKA 1M2RA 1PXNA 4I6HA 2C5OA 2YCRA 5CZIA 2XS0A 4HOKA 2G2FA 4FKVA 5J1VA 3Q5ZA 4DFNA 5ETIA 1ZZLA 2IW9A 4N70A 2IN6A 5CXZA 5CVGA 5BVFA 3W0OA 5CWZA 4MWIA 3P08A 1IR3A 1H1RA 2XH5A 3HDMA 4O7TA 4CTBA 5B2MA 5HX8A 5L6OA 1NVSA 4XBUA 5IA4A 4HNIA 5CEPA 1YDRE 3R83A 5IEVA 3LQ3A 4XOZA 2EXMA 2GNFA 3IW8A 3NUNA 2B7AA 4CFXA 3NUUA 4E20A 2VTSA 2VO3A 2XJ2A 1YI3A 4FZFB 4MXZA 4ARKA 4QMTA 5ETFA 4FV5A 3SX9A 4B8MA 5E8SA 3HNGA 3WZUA 3ERKA 3UMWA 1YWNA 3HMIA 1FMOE 3R9RA 3UVPA 3L8SA 1F5QA 4C4HA 3H10A 1WCCA 3CQWA 2I0EA 2WMVA 1PY5A 2ESMA 3K2LA 3OY3A 2YACA 1TVOA 4OTHA 1SM2A 2C3LA 3C9WA 1U5QA 2B0QA 3CGFA 3IW6A 3LMIA 3Q9WA 2IW6A 5C03A 2VO6A 3UYSA 4BCJA 4IJ9A 2HOGA 3R00A 4GYIA 4O82A 4EHVA 4ZXTA 3O8TA 1H27A 4BDFA 3RPSA 2YISA 1OL5A 3AQVA 4P7EA 3VS0A 5K9IA 2WMQA 3OF0A 3FPMA 2XVDA 4DEGA 3ORLA 2HXLA 2JIUA 3KRWA 3FMMA 2UW4A 4ZTQA 4MKCA 4ZZOA 2VX1A 2PVMA 3C0GA 2QURA 4FKWA 3R01A 4V01A 4X3JA 2F57A 4XX9A 4FKSA 3EFLA 1KV1A 5IDPA 2E9OA 4A07A 5C4KA 2YA9A 3R04A 2FGIA 2F9GA 3BI6A 2WXVA 2OG8A 2Y4PA 3ORXA 1AQ1A 4WA9A 2FSOX 5J9YA 2GNHA 2V0DA 4PWNA 3O7LB 2EWAA 4ZY4A 1XH5A 3VS1A 4PMTA 2GNJA 4IE9A 4G6LA 3AT4A 3LMGA 2GQSA 5HVJA 1F0QA 3FI8A 1DAWA 3E5AA 2QU5A 3QC9A 2X4FA 2WKMA 4O6EA 3A7IA 1W8CA 3QZIA 1MQ4A 2YDIA 4X21A 4RX8A 5EKNA 3PLAE 3LJ1A 1K3AA 4BDKA 2OZAB 2YAKA 3GC0A 3ZO3A 3DQWA 1BI7A 3FY0A 4U9AA 1PMEA 1H1SA 5JZJA 4DGGA 4MHAA 5BX0A 5JRSA 5HBJA 2OKRA 3CQEA 3MPTA 4FKUA 4DYMA 4X6QC 3NNXA 4FEUA 4GK3A 4G9CA 4NM5A 4XV2A 5LMAA 2VU3A 5FBOA 4O0RA 2YIRA 3EQIA 3OXZA 2W4OA 3DDPA 5JGAA 4QNYA 3F3UA 3ZSHA 4A4OA 4IQ6A 4O84A 3ORMA 2YWPA 2BROA 2C1AA 2ITZA 2OH0E 5ANDA 2B9IA 5BVKA 4PNKA 3SGCA 3FZPA 4J96A 2OLCA 3FI2A 4O2ZA 4BB4A 3BYMA 4QRCA 3QTWA 2CCIA 5EYMA 4QMXA 1PXIA 2W99B 2OW3A 5HG9A 4TW9A 2X7GA 3QLFA 5I9WA 2XK7A 2ETMA 1H1QA 2WQMA 3ENMA 3MJ1A 3P7CA 4DEBA 4DCAA 2XBJA 4M0YA 4D58A 3OY1A 4R1VA 4RWKA 3TNHA 1DI8A 4FG8A 5LJJA 1UKIA 1Y6BA 2CKQA 4TYEA 4BDBA 3FMEA 4HVSA 3DJ7A 4EKLA 3EWHA 3V5TA 3OUNB 4PL4A 3P78A 4JJRA 3VS3A 3ORKA 4IB3A 3HAMA 5L8LA 5K5NA 5JK3A 5HKMA 2IVVA 2UUEA 4MD7E 3FC2A 3ZHPC 1OL6A 3UO5A 4QMUA 4I4FA 2J0IA 4GT5A 3ZUVA 5IQIA 5T3QA 5HQ0A 2JDVA 3BZ3A 3V8TA 3EQHA 4HZSA 2PUNA 3UNJA 2PUUA 2YZLA 4YHJA 4L43A 4U81A 5CAVA 4AT4A 1CSNA 2UW5A 5E8VA 4ERKA 5AP3A 2PPQA 2GQRA 3A7HA 3HVCA 4CGAA 4DFUA 4CZUA 1W83A 2YABA 4LQMA 3P7AA 2A19B 4QNAA 4UALA 4L68A 4IZ5A 4D1XA 3V5QA 3UPZA 2YM5A 5CNOA 5CAUA 4RVKA 3QWKA 3HRCA 2VUWA 4FTJA 5M08A 4NL0A 4CSVA 5JKGA 3QQGA 2VO7A 5D1JA 4QQ5A 4BI0A 2VWXA 4EOJA 3FYJX 1VZOA 3Q52A 5BNJA 2VWUA 5GINE 4J8NA 4GSBA 4KNBA 4V0GB 2ITWA 4JG8A 4X3FC 4XP3A 5CNNA 3UQFA 2BCJA 5BUEA 3AD6A 5FM2A 1GZNA 2NP8A 5HNBA 1R39A 2R3RA 2ZJWA 3BE9A 4IFCA 4RRVA 5KKRC 3COHA 3VRYA 3R9NA 4FT5A 4S34A 4WUAA 2BALA 4U43A 4NT4A 3NMUF 3LIJA 3MB7A 4EC9A 2BRGA 3FZTA 3MH3A 2WMSA 4D55A 4EH8A 1PKGA 4F7NA 3NVMB 1TQPA 4CCUA 4GVAA 2W5AA 1H01A 1W82A 3TV6A 3Q4TA 2A2AA 5AX9A 5CI6A 2R0UA 4E6CA 4DFLA 4N6ZA 3GCQA 4QT1A 3MVLA 2X8IA 2XRWA 4BDGA 3IOKA 2R3FA 3BU6A 3RGFA 1XH8A 4NKSA 5AAFA 4RFZA 3R1QA 3FLWA 3M1SA 4MD8E 5T68A 1MRYA 3EFWA 3NCGA 4RC2A 3PY1A 3TUDA 1V0BA 2YM7A 4UXQA 3QUEA 3Q9YA 5IU2A 1ZWSA 2W96B 2DYLA 2LGCA 2VTJA 4GL9A 4TYHB 3TUBA 4FV7A 4MXCA 4LI5A 2Z8CA 4RA5A 1I44A 4E26A 4IWPA 2ITOA 4IB5A 3W2OA 1XBAA 5HE1A 5HORA 2E9UA 2C4GA 3WZJA 3RWQA 1P5EA 5LMKC 3DXQA 4IC7A 3HDNA 2ACXA 4FSYA 4U80A 2J7TA 3GENA 3L8VA 2VV9A 2PVJA 3KKVA 3QGYA 2WTKC 3GQIA 2XNNA 4O86A 5BVWA 3AD4A 4PTCA 3M2WA 5DT4A 3SOCA 1FOTA 3IGOA 3PIZA 4TYHA 2ITTA 1Q3WA 3OD6X 1M2PA 4I5PA 4Z3VA 4R7IA 4ZSGA 1NA7A 2PL0A 3BEGA 3K5UA 3B2TA 3RTPA 4JX3A 4QMPA 2PULA 2C6TA 4J99A 4O96A 2XM8A 1L3RE 1Q8YA 4FNZA 5CYIA 1SVEA 1LPUA 1WBPA 3H0YA 5HNGA 2WMRA 2P2HA 3P23A 3TDVA 2XZSA 4KBAA 4C62A 4EOLA 3QTXA 4ENYA 3UNZA 4R3CA 4D9UA 3CTQA 3LCSA 2B9FA 4DH3A 3KULA 3QQFA 4W8DA 3EZVA 3DAKA 3WARA 5HLWA 3KF7A 2R3OA 5IMXA 4R3RA 4NJ3A 4RVLA 3FZRA 5A4TA 2WQEA 2JKKA 3GB2A 3WF8A 3QRKA 3WF5A 3WILA 3VAPA 5IQBA 2ITQA 3AMBA 3R1NA 4EHEA 2RFSA 2GSFA 3ZXZA 1VYZA 2YCQA 1G8SA 1BX6A 3F61A 3PA3A 4GV1A 4HGLA 4JT3A 5E9EA 4CD0A 2BDWA 3KCKA 2OIDA 4FIHA 4ZP5A 4AX8A 3IW5A 4FG7A 3TJDA 3ZC6A 2BRBA 2ERKA 2GS7A 4GKHA 3UE4A 4DG3E 1H00A 1U54B 5M56A 4GU9A 2KTYA 4GUBA 3BPRA 2X81A 3QWJA 4O0UA 3DZQA 4E4NA 5JEBA 3Q3BA 2GNGA 4BTKA 4LL5A 3NAYA 3EQRA 4EUTA 4NU1A 3I5ZA 4ANQA 3ODYX 5F9EA 1WBTA 4FEVA 5H8BA 3C5UA 3FKOA 2B4SB 3MVJA 4FVQA 4Y72A 4CRLA 3OBJA 4DLJA 4ZLOA 5JQ8A 5KMIA 3GCVA 2WMBA 3DU8A 2UVXA 4FVRA 5A3XA 5AAGA 2CN8A 3AD5A 4RJ5A 4NFMA 3ACJA 4F1TA 4XG9A 3TNIA 5AP6A 4J7BA 1UNHA 3ZRLA 2HZNA 2PUIA 2Y7JA 2OK1A 4UWCA 4K8AA 5ANKA 3UPXA 3I7CA 1YI6A 4FGBA 4GIIA 4EH7A 5FDPA 1OIQA 5HD7A 5LVMA 3E8CA 4IM2A 4DEIA 1URWA 4YZMA 2W0JA 3WF6A 4IMYA 4U79A 3SVVA 1FBNA 3C50A 3G90X 3MY5A 3DS6A 4FKTA 4U8ZA 3RPVA 2JDOA 3UOHA 3CPCA 4PQNA 4L53A 4EL9A 5IUGA 5LWNA 1OPKA 4RIWB 5AP2A 5EQEA 3BYSA 4YJQA 3U4UA 3KC3A 4KUJA 3SOAA 1AD5A 2QOKA 3FI3A 3CD8A 4LG4A 1RJBA 5E8ZA 3LKMA 3C1XA 3JPVA 3FY2A 2QKWB 3I6WA 2OIQA 4G31A 4AACA 3TUCA 4DH7A 3W1FA 4W4WA 3WZDA 2QG7A 1V1KA 3MFUA 3PPJA 2C3IB 5CVHA 4ENXA 4UYAA 5AV3A 3EFJA 1LEWA 2BMCA 3EN9A 3PXQA 3ZS5A 4EH6A 3AGMA 2CNUA 4FKLA 1J1CA 5D12A 1OI9A 3GFWA 4ZJIA 4ZS4A 3KA0A 4N4SA 4LRJA 2HZ0A 2YERA 1PYEA 3VBTA 2OSCA 3A4PA 1Q97A 3EN7A 5C01A 5A4LA 3RCJA 1VEBA 4N0SA 3ALNA 4U97A 5CSHA 3RZBA 4BI2A 4FA2A 4DH5A 4FVPA 4OBOA 4MEDA 2WTWA 3CXWA 4FL3A 4O38A 3RKBA 3V04A 3PJ8A 5K3YA 3OTUA 4CFUA 4O81A 1CTPE 1M7QA 5LOHA 3RAKA 3QFVA 3KY2A 3OXIA 2PVRA 3V6RA 1GZ8A 3IPHA 2P4IA 4EK6A 4YUQA 4E7WA 4ZTLA 2Z2WA 1GIIA 2PE1A 5L8JA 3TL8A 1QCFA 2VTTA 4OTRA 5LVOA 4FSNA 5JH6A 3UIUA 4DF3A 4XG3A 1SVGA 4PUZA 3U9NA 4EH2A 1J7UA 3C13A 5AV0A 4DN5A 4IW0A 5EI2A 4EOKA 2WTKB 2W4JA 5CASA 4BZNA 2PE2A 2W1FA 3HYHA 4I5CA 1HCLA 4W4YA 3V51A 4XS2A 3IO7A 4QP2A 3LCDA 4FV6A 4H39A 3VS4A 2IO6A 3E7OA 3EN5A 1DM2A 2R7BA 2OO8X 5CTPA 4AZWA 4G34A 3EIDA 2J5EA 5DR2A 3TNWA 3VHKA 4DINA 5DR9A 4ACCA 4I0SA 3UIBA 3DA6A 4BTMA 4C59A 5C26A 2QLQA 1GY3A 1SZMA 2FUMA 2R3IA 1BI8A 4XP2A 4YTCA 5D7AA 1T46A 4IVBA 1GZKA 3IQ7A 1AGWA 3TIYA 2PVHA 3A7FA 2F49A 5DE2A 4E5WA 3F82A 2OICA 4G5JA 3QD4A 3TZ9A 4ITJA 3KRRA 4UY9A 4FBXA 3FLSA 4Y85A 4QMYA 3FE3A 2GS2A 4GJ2A 5DRDA 3TI1A 3IDCA 3R7IA 4CG9A 4NH1A 3DLZA 5D41A 5H8EA 3COIA 5HLNA 4FKJA 1P2AA 4WUNA 2J9MA 3CJGA 5HG7A 3E62A 4D9TA 1DS5A 5DR6A 2FVDA 3DNDA 3VWAA 5HNIX 3EH9A 1ZMVA 1JSVA 3D5WA 4UBAA 3TZMA 1YKRA 3HV6A 2UZOA 3KB7A 3PSCA 4YJVA 3DK6A 4ANLA 4QP8A 5E8YA 3PG1A 4IFGA 3GEQA 3UODA 4J98A 4OLIA 4M7IA 4IDTA 4K18A 2XBAA 3SKCA 3W0RA 5LVPA 4O7LA 2BZHB 5IZFA 4GS6A 5ACBC 4K0YA 4OBPA 3BRBA 4CLIA 1RDQE 2XNEA 3FYKX 4NIFB 4KSPA 3CSVA 1OPLA 1K9AA 2C6MA 4ZSEA 1BL7A 5CQUA 3V8WA 3LXKA 3LPBA 4D1SA 4LOPA 4DEHA 1KE8A 5AP5A 4Z16A 4GMYA 4ZSLA 5KKRB 4WO5A 5ANJA 4ANSA 2XKEA 4AZVA 3S2PA 3UP7A 5M4FA 3QQHA 3KULB 4TWPA 2QHNA 4YHTA 1XWSA 2XK9A 2RFEA 5CX9A 2EVAA 1P14A 4I24A 4BIBA 5J95A 4EH4A 4L00A 2XIKA 4GIHA 5I9VA 3OEFX 4Z9LA 2HCKA 2BFYA 3W18A 4C35A 3ATTA 1Z9XA 3FKNA 2C0IA 1YDTE 2RFDA 4XYFA 3L1SA 4G17A 3RPRA 5A14A 4KWPA 3ENHA 2VTMA 3H0ZA 4JIAA 3T3VA 2X8EA 2A1AB 3LM0A 2ITXA 2X2LA 3PP1A 4G16A 3TJCA 5M4IA 3MA6A 4PTEA 4JS8A 2OXDA 1P4OA 5M06A 2VTHA 3DFCB 4WNMA 4YJSA 2ZB1A 4YO6A 1FGIA 4I20A 3UVRA 4FUXA 4PX6A 4YSMA 3SLSA 3FQHA 4MXOA 3CD3A 5IA0A 1UKHA 4DITA 3VN9A 3VO3A 1MRVA 2OXXA 3SXSA 2RKUA 3R9HA 3TTIA 4XG8A 4JBVA 1XJDA 4NUSA 4G3EA 1JKSA 2UW0A 5AP0A 2WMUA 5K4JA 3VUMA 1TKIA 1REKA 4GUEA 2JAMA 4XRJA 5CQWA 5HVYA 4G3DA 2GFSA 3DXPA 4WZYA 3MWUA 2PMOX 2HK5A 1FINA 1H08A 2C3JA 4CKIA 4HJOA 2JKQA 3W0SA 1R3CA 2NO3A 4J71A 3DZOA 5AUUA 2PHKA 4I6BA 2WQOA 3C4ZA 4TXCA 3FMKA 3WE8A 4DC2A 4Y95A 2ITYA 2BPMA 2XJ0A 1PRYA 3B8RA 4M97A 3HMPA 3CPBA 2J90A 3BV3A 4YJTA 3EMGA 3LQ8A 4LRKA 4OTIA 1OZ1A 4S30A 3UP2A 5M55A 3VBYA 4A9TA 4BZDA 5E91A 2XK4A 4IVAA 2V5QA 3GC7A 3R7VA 4G6OA 4AP7A 2OXYA 5FLFA 5HTCA 2IZRA 3R30A 1VR2A 2ZM1A 3DJ6A 4FTKA 3EJ1A 3R9DA 5C8KA 4EZ5A 1PYXA 3EHAA 3EZRA 3HL7A 2FSTX 2WTVA 5HIDA 3OXTA 4BZOA 3CKXA 5E1EA 2RF9A 1STCE 4ZJJA 3VULA 2X7OA 3SXFA 4BCOA 2F2UA 3NYVA 4ZTHA 2OU7A 3UC4A 1OL2A 1P4FA 3LOKA 4M8TA 4ZLYA 5IF1A 5E8XA 5M09A 3BEAA 4YLLA 2LAVA 1JPAA 2C3KA 1ERKA 3Q53A 4BHZA 3QX2A 5ICPA 4OBQA 4RLKA 2R3QA 4S32A 2Z7RA 3JVSA 3TM0A 4JOAA 4QQJA 3OWPA 4JDIA 4J97A 5H3QA 4MVFA 4RLLA 3GT8A 4Y83A 1IA8A 5CEQA 4YURA 4X0MA 3JXWA 2QQ7A 4DG0E 3PJ1A 3PP0A 5EI8A 3LFCA 4KKEA 4ASZA 3MBLA 3MW1A 2GPHA 3OHTA 4FIEA 4D4RA 4HCUA 2GS6A 5IQCA 4BY9E 1OPJA 4Z7GA 4RFMA 3FWQA 1ZLTA 5EK7A 3RM6A 3PSDA 3WBLA 3OBGA 4EEVA 4FV8A 3QKKA 1U4DA 4XUFA 4DFZE 1KE9A 2C0OA 2PWLA 4P2KA 3AXWA 5CAOA 3EN6A 3LJ0A 3AC5A 2GHLA 3R7YA 1OUYA 3OT3A 4FT7A 2YFXA 3E7VA 2ERZE 5KX8A 4ZJVA 4FKPA 5DNRA 2ZDTA 1J7LA 1M17A 4L3JA 4MBIA 4C3RA 4BDJA 4L45A 3ZTXA 3N4VA 2UZVA 3MV5A 4F9YA 5JT2A 4O27B 3QF9A 2Q0BA 3HAVA 3S1HA 4WIHA 4DEAA 4DFYA 4RJ4A 3UBDA 2R0IA 3O2MA 5BVEA 2JDSA 4RA4A 2PSQA 3WI6A 4GFGA 2J0KA 4RX9A 5GIOE 3KEXA 4LOOA 3EQCA 2XNBA 4RIYB 3LVPA 4FODA 3H3CA 5KZ0A 1ZMWA 4I1ZA 3KN6A 2G15A 4GG5A 4ITIA 4P5QA 2XK3A 5BYLA 3ZM9A 4EBWA 4BKJA 2C5YA 4CLJA 1Q5KA 4IZAA 5DA3A 3T8OA 5HU3A 2Y9QA 3QRUA 1OVEA 5A6NA 4CT2A 5KO1A 1RE8A 1WMKA 2W1IA 2R7IA 3G33A 1B6CB 3M42A 3DPKA 2Y8OA 4M3QA 3RHXA 5L6PA 2VWWA 4TNBA 4ASEA 5KMNA 3QTZA 4EQCA 4F9BA 4IEBA 4NCTC 4NFNA 3OWKA 2H34A 4LGHA 2JKOA 5CLPA 1GIJA 3AC4A 3FEGA 3AOXA 4O0SA 3HGKA 3HRBA 3JUHA 3GU5A 3KRXA 3ANRA 5EHYA 3ZZWA 3FMJA 2WQBA 2BKZA 4BIDA 5M4UA 2ZDUA 3RK5A 2R3MA 3MJ2A 4YZCA 1KV2A 3V5LA 4ZMEA 2XCHA 4NM0A 4E5AX 4F64A 5D11A 4NWMA 4RGJA 4I92A 5E8UA 3O8UA 3LJ2A 3AMYA 4FNYA 1PXPA 5IEYA 2R4BA 3IGGA 2HY0A 3TKIA 3EKKA 3OP5A 3DJ5A 2QG5A 5ETAA 4EK3A 5HZNA 5LWMA 4BTFA 4KIQA 5AM6A 1JKTA 2ETRA 3VF9A 4IWOA 2R3NA 5FDXA 3PA4A 5AUTA 2JEDA 2GQGA 2WTIA 4FV4A 4IC8A 4ZOGA 4AOJA 4DH1A 3OCBA 5L2IA 5M4CA 3NW7A 2X9FA 2XK6A 2WFYA 4QPSA 3VS2A 2JBPA 3FL5A 3VVHA 1WZYA 4CKJA 3D5VA 3PLSA 3RK7A 3ZYAA 3KRJA 4U7ZA 1KUTA 3TV4A 4O83A 3IS5A 4FSMA 4X3FA 5AUVA 3AT2A 3VW8A 3MA3A 5AIRA 4AZSA 3RAIA 1GIHA 2JITA 2J6MA 3AC1A 5EW3A 4IX5A 2C0TA 5FTGA 2XKCA 4IZYA 3RK9A 5M07A 3K5VA 1M7NA 4R6VA 5HBEA 3K54A 3R63A 4TZRA 1PW2A 4FZ6A 2J0LA 2QO9A 4YP8A 1KE5A 3A8WA 4K11A 3UOKA 1G8AA 4XHKB 3F6XA 3COKA 3KK9A 3UOLA 1FVTA 2W1HA 4PDOA 4HVGA 4C58A 3E3PA 3FPQA 3GOKA 4FSWA 4BCPA 3VS5A 4QYFA 2QC6A 4GT3A 2BILB 2C6DA 4NSTA 4XV1A 5ACKA 3TIZA 4D0XA 3IKAA 3OFMA 4F1OA 4BCMA 2PVNA 3OEZA 4GW8A 4AZEA 5AV4A 1Q8ZA 4QYYA 3NUAA 3D94A 5BVNA 1E1XA 2FSLX 4CFNA 3PSBA 2R3KA 3QQJA 4XH6A 3R1YA 1YXSA 2F7ZE 3KGAA 4TYGA 5FEDA 3LFBA 4BDHA 3SG8A 3G15A 2VNYA 4LFIA 5J8IA 3PE2A 4WNKA 4IAFA 4L42A 4FL2A 5DN3A 1WBWA 3Q4UA 3ZRMA 5FM3A 4FSRA 3VBXA 3GBZA 3V01A 2HZIA 5H2UA 5DT0A 3UQGA 4H05A 3VRZA 4J8MA 3A60A 4PF4A 3PZHA 3QHWA 3AG9A 4AW1A 4JXFA 3G9NA 3U8WA 3R71A 3UO6A 3F69A 3UG1A 2VZ6A 4EORA 4H58A 5FTOA 1KWPA
chains in the Genus database with same CATH superfamily
4EK5A 4XG7A 3POZA 4AOIA 4D2RA 3VUKA 4BBMA 2XB7A 5A4QA 2AC5A 4FGRA 4NKAA 4AFJA 2GHGA 3LXPA 4PY1A 4CMUA 1URCA 5T6KA 4L44A 4FR4A 2ZV9A 3R0TA 3F5PA 4F65A 2C6IA 2J51A 5LQFA 2P0CA 2G01A 3ZSIA 4Z55A 3GU7A 3QBNA 1ZMUA 4O7WA 1MUOA 2BTRA 3FV8A 2BAQA 4C4IA 4CV8A 4EOPA 3FBVA 3BQCA 2OFUA 3BHUA 4C3PA 5TR6A 3M11A 4RQVA 4A06A 4F78A 5IH4A 3SW4A 5IPJA 5DEWA 3V5PA 4UYNA 4F09A 5CU2A 1H24A 1B39A 3BYVA 5J7HA 4W8EA 2WU7A 3D7ZA 1GNGA 5AM7A 3BV2A 4EK8A 3HKOA 3QCYA 4LRMA 4NK9A 4PV0A 4EOSA 4AA5A 1OL7A 3NUSA 4JBOA 3MY0A 3CBLA 4QMQA 2HW7A 4YNOA 1GZOA 1Y8GA 2XF0A 4FIGA 3W2QA 2GTNA 2BTSA 4YPSA 4JMQA 1H4LA 4D4YA 3VJOA 2RIOA 3O23A 4AW5A 4RJ7A 2VN9A 2GCDA 4X2FA 5CU6A 3AT3A 2NPQA 4BGGA 3O71A 3K3IA 4BC6A 4L3LA 5KMLA 4YSJA 1FMKA 2W4KA 4ZS0A 4A7CA 2X8DA 5KBQA 3I0QA 3ZXTA 5B7VA 2C5XA 2OI4X 2UW8A 2CGVA 3R8UA 1PXJA 3FJQE 5AMNA 2W5HA 3HMNA 4IJPA 1NVRA 3NRMA 4IZ7A 3A62A 4M68A 4OW8A 5DFPA 2UZEA 4A9UA 5J9LA 2JFLA 3Q5IA 3AGLA 4FZAB 3UG2A 4F7JA 3FLQA 5AAEA 4QMSA 2B1PA 3PYYA 5E92A 3QCQA 4E6AA 4RX5A 3QKMA 2B52A 3R73A 5CEKA 5JFVA 3IG7A 2UZDA 2XUUA 3QRTA 2ZAZA 3HP2A 4G6NA 4O7VA 4FUYA 4YBJA 3FLZA 3ROYA 5CT7A 4ZK5A 2ZM4A 5DG5A 5EDRA 4DDIA 2WPAA 2R64A 5CI7A 2VWIA 1H1PA 4QYGA 4QTCA 5AV1A 4DGMA 1YI4A 4I6LA 4MNEA 5EFQA 4IB1A 4LV7A 5DH3A 3QTSA 2VGPA 4ZTNA 3ATSA 4FV0A 3RPYA 4U6RA 2C47A 1XO2B 4XEYA 1YRPA 2E9VA 4YPDA 4TT7A 4ZTSA 4KINA 3DV3A 1QPEA 1Z5MA 2BHHA 1FVVA 3FI4A 4MQ1A 3A61A 3HLLA 1WVXA 2W1DA 3PVBA 1OMWA 1S9IA 4LUEA 3BGPA 5GNKA 2OF4A 3C5IA 2VWZA 3PWYA 4K33A 3VQHA 5AWMA 4FSUA 4AXFA 4RSSA 4GH2A 1T45A 2WQNA 5FEEA 3AMAA 5EYCA 3ZO4A 3KL8A 5DHJA 4IAIA 1Y8YA 2VGOA 1J1BA 5HIBA 3QZGA 4YTHA 3C7QA 5CENA 4F63A 4HW7A 2YZAA 4HVHA 4XV3A 2UW6A 4AGCA 3E87A 3TZ8A 3ZO1A 4APCA 4O7SA 3F3VA 2C5NA 3LFSA 4U98A 1CM8A 3D2KA 4WBBB 3G6GA 4C4JA 3H9RA 5BUIA 3NFGB 5ANOA 3W55A 4EONA 4L01A 5TO8A 5A9UA 2OFVA 1YXXA 1E1VA 4FKGA 5C9CA 3V3VA 2GNIA 3S95A 3QX4A 4UB7A 4V05A 2C6KA 3GU4A 3VBWA 4TYJA 4BGHA 4KABA 3DOGA 3R28A 3RP9A 2ZV7A 4M14A 5AUZA 3W0QA 3ZBXA 3FMDA 2CJMA 2E9PA 5AV2A 1MP8A 3CE3A 1ZZ2A 2BZJA 1BLXA 2NRYA 3I4BA 3QD3A 1Q61A 4I5HA 1XH6A 4IVDA 4LV5A 4BIEA 3ZLSA 5KCVA 4U94A 1YHSA 3NR9A 3QA0A 5IH6A 3GFEA 2PTKA 3GCPA 3U4WA 3R8PA 4FSQA 3CY2A 2Y6MA 3CGOA 4Q9SA 4QP6A 3NX8A 4BCQA 3BX5A 4YLJA 2NRUA 4DAWA 1YVJA 3Q6WA 3VUGA 5D10A 3QRJA 1IAHA 4J52A 3U51A 4ALWA 3OVVA 4IAZA 3W8QA 3WF9A 5HHWA 1WFCA 4EYJA 5IUIA 3QC4A 4NW6A 2R3GA 2YJRA 5F20A 4AW0A 4MXAA 1MRUA 2QOCA 4XG2A 1JVPP 3THBA 1LUFA 2B55A 1J91A 2UZUE 3QTIA 2QHMA 3DKGA 4U40A 3SC1A 4JR7A 4RQKA 3G51A 3F5XA 4BBEA 4S2ZA 3WZKA 1OECA 4H3QA 1MQBA 4I0RA 3ZONA 4UN0C 1ZY5A 4DLIA 4EBVA 3W2RA 2HAKA 5HG5A 4EH9A 5CY3A 5EHOA 1ZRZA 3HV4A 1VYWA 4OT6A 3SHEA 4DHJA 3ORPA 4JL9A 2OJIA 4GJ3A 5HG8A 4WRGA 4JIKA 4JBQA 5JMSA 5HICA 2V22A 4EI4A 1IEPA 5CU0A 4KAOA 5EM8A 4U0IA 5IA2A 4C61A 2VTQA 3DBDA 3MTFA 4Q5HA 3L8PA 5L2TA 4WT6A 3W0MA 2OZAA 4C38A 4H1JA 4RC3A 4WBOA 3BKBA 4EYMA 4QO9A 1XH7A 5B2KA 2CNVA 2V7AA 3GI3A 4M15A 2GTMA 3G6HA 4O7RA 2YDKA 3BWJA 2XYNA 3TWJA 1OIUA 1QMZA 4FEXA 5L3AA 3R02A 3ZUUA 4AU8A 4FOBA 3FLNC 4ZLZA 2YM8A 1M52A 2NYAA 2CN5A 3A99A 4H1MA 2JKMA 3DGKA 2VD5A 1I09A 4RZWA 5IA3A 3CJFA 1ZOGA 2C6OA 3KRLA 2I6LA 3QLGA 3QA8A 2XIRA 4FK3A 4HYSA 5C8MA 2WU6A 4YZBA 5EW9A 3R7OA 4AA4A 4HVIA 3O96A 4TY1A 4JDKA 4CCBA 4F1MA 4TWOA 1ZAOA 3C51A 3Q2MA 4FOCA 4MTAA 2VRXA 4ORKA 4B9DA 2CKOA 4KSQA 4FZ7A 4ZZMA 4BDEA 4UV0A 3DBQA 4CXAA 3OUKA 5GJDA 3OMVA 5CXHA 4BGQA 5CEOA 3ROCA 3PPZA 1ZXEA 1R0PA 3C4XA 3G2FA 3L9PA 3RINA 4DT9A 3PIYA 3UO4A 3LW0A 5BYYA 1UU9A 2O5KA 2X6DA 3FZSA 2B9HA 2WMTA 2JDRA 3P5KA 3UGCA 5HI2A 4K77A 2WEIA 3Q9ZA 2RG6A 4UXLA 3ZBFA 1YHWA 3UC3A 3CC6A 3EKNA 3LFQA 2BR1A 3FQEA 4LMUA 4UZHA 5AX3A 2BDJA 1WBOA 3ZM4A 4AGWA 4FMQA 5IQHA 2IZTA 3SDJA 4ZSAA 3GCUA 5JRQA 3W33A 4BN1A 3COMA 4PMSA 4X7QA 5EDQA 2C69A 3IK3A 4AF3A 2PYWA 2AYPA 2J5FA 2OWBA 2QOIA 3A8XA 3CKWA 3LFFA 4FC0A 4G9RA 5L2SA 3ZEPA 2IZUA 4NTSA 5FRIA 2VTOA 3ORNA 3RALA 4ZY5A 2R5TA 3PXRA 3R6XA 3DK7A 3U55A 3UZPA 4BF2A 3W32A 2AEGA 2Y6OA 4C4EA 4M67A 5ANIA 4S31A 5DGZA 3MH1A 3SD0A 3II5A 3MIAA 1XQZA 3P86A 5AP4A 3PJ2A 5G1XA 1FVRA 5AIKA 2V62A 3AC3A 5CU3A 3V5WA 3MGYA 3NYOA 5EH0A 1JKKA 3QYWA 3WIKA 4IWDA 2QONA 4F0IA 4I93A 3HP5A 4FV2A 4KBCA 1OGYA 3PE1A 4RJ8A 4P90A 1YXTA 3E3BX 3KU2A 3MS9A 2BIYA 3DB6A 3OG7A 4MNEB 4YJNA 4GK2A 4RFYA 2YIXA 4JDHA 2UVYA 3MPMA 4XRLA 4DE4A 5JGBA 2ITVA 2YITA 4JI9A 3RMFA 4I94A 4BRXA 2QD9A 4EWQA 2KULA 2Q83A 4Q9ZA 2R9SA 2WNTA 3VC4A 4C0TA 1OB3A 1JOWB 3D15A 5IMEA 3ZCLA 4C7TA 5JFXA 3QUPA 5E90A 4E6QA 3S0OA 4XOYA 3UJGA 4YO4A 2F7EE 3D7TB 4LL0A 1CKPA 3PVGA 4QTBA 4KRCA 2WHBA 5EM5A 1JBPE 4ZMFA 5AEPA 2FH9A 1OKZA 1XBCA 1U54A 1SNXA 2EUFB 3JY9A 3H4JA 3QYZA 1H1WA 4G1WA 3EQBA 3KN5A 4RIWA 3FC1X 4Y46A 4USFA 3VQUA 5I4NA 5E8TA 1J7IA 3DAJA 4FEQA 1OKYA 5C1QB 5J87A 4ACHA 2H8HA 2ZV2A 2R3PA 2XRUA 1Q8UA 3MFRA 4YTFA 3ZU7A 2PE0A 4CRSA 4FIJA 4TTHB 5J1WA 3VW6A 2BZKB 3BLQA 1Q41A 3QTQA 1VJYA 4FYOA 4RG0A 4ACMA 2W5BA 1PF8A 5EOBA 3DQXA 1OIRA 3G0FA 1Q62A 2OIBA 2XAOA 3E8DA 4H3BA 3E63A 2W1ZA 4FIIA 2WMWA 3FHIA 3FUPA 1W84A 2NNWB 2XEYA 3TTJA 4RMZA 4ZSJA 1SNUA 3U6JA 4O0TA 4KIPA 3R2BA 5B0XA 4FTCA 3G5DA 1V0OA 1OKVA 4BYIA 2J2IB 4ERWA 3O7LD 4EWHA 4YHFA 2RFNA 2J50A 3D5XA 5KMMA 4NW5A 3TDWA 1CDKA 3EFKA 4DFXE 4E5BA 3DY7A 3SRVA 4ZAUA 4ACGA 2PZIA 3UYTA 4AT3A 5JSMA 1KE6A 2YHVA 3D14A 4L7SA 3ET7A 1QL6A 2BRMA 2F2CB 5BUJA 3GQLA 2XAMA 5DOSA 4RT7A 3I81A 3N4TA 4LM5A 4YC8A 4NM3A 4F9CA 4XLIA 5I9XA 2C6EA 5HO8A 1OBDA 3AC2A 3K3JA 3W0NA 4XJ0A 3PXFA 4F7LA 3F5UA 5CAQA 3HA6A 5IH5A 5JFWA 4EQUA 2HELA 3G9LX 3BBTB 2PVKA 1YHVA 2Y0AA 3LAUA 3QU0A 4JVGA 5LARA 4QP3A 1O6LA 3ULIA 3VS6A 3BE2A 1RQQA 4A9YA 2IZSA 1JNKA 2X9EA 4J53A 3RNIA 4F08A 3PY0A 3QL8A 1M14A 3WIGA 2VO0A 5IQAA 3QZFA 4AXAA 5BVDA 2EB3A 4MYGA 3Q32A 3TT0A 3QAME 4QP9A 2XIXA 2JC6A 2B9JA 4WG5A 5EOLA 5CSXA 4FTAA 4ANBA 4AE6A 4BDCA 3TN8A 4O91A 4IADA 5LVNA 4C37A 3FQSA 5CEIA 1UU3A 3PA5A 4F0FA 1JKLA 2GNLA 2H9VA 1XMLA 1LR4A 3LFAA 3BBWA 4CFFA 2CKEA 2FA2A 2I0YA 4ACDA 2OBJA 2CGWA 3F7WA 4AZFA 4CTCA 4DHFA 3UIXA 3OOMA 2QO2A 4OT5A 4XG4A 2JAVA 2W1EA 5BMMA 1Y57A 1PMUA 3VUDA 3FXXA 4NYEA 4OTWA 3FL4A 4BR3A 4YJUA 1WBVA 4BCGA 1PXOA 4OTDA 3TZ7A 4Y8DA 2HENA 4ZTRA 5DIAA 4RC4A 4TWNA 4FTUA 4XCUA 2W7XA 3I6UA 1RW8A 3JS2A 2WZJA 2ITUA 3R8VA 3ALOA 4JDJA 3E88A 4RZVA 2JIIA 2VTRA 2IG7A 2VWYA 4J95A 1XBBA 2PMNX 4EZ3A 4DGOA 5M51A 2R3JA 4O0WA 5ANEA 4E8AA 4DT8A 3HEGA 4KS7A 5DRBA 4K2RA 1WAKA 4MAOA 4APPA 4QP1A 2VWVA 4FKQA 2QI8A 2XNGA 3EQDA 3MYGA 3ZFYA 4QP7A 2OF2A 4TYIA 4LYNA 5CF4A 5J5SA 3IDPA 2REIA 1JSTA 2W05A 4FT9A 3JY0A 4PL3A 4CZTA 5A4CA 4EOOA 5J9ZA 2VWBA 3HECA 3KREA 3QCXA 3ZSGA 2JLDA 3EL8A 2P2IA 4BICA 5CEMA 3MPAA 2WGJA 4EOMA 5KMJA 1NXKA 3ZEWA 4B6LA 1IG1A 5EKOA 4O22A 3DNEA 3MB6A 3ZH8A 3TEIA 2J0MB 2BKKA 2QOQA 3PWDA 4E1ZA 1NW1A 5IQGA 3BLAA 1WBSA 4G3CA 4UX9A 2ZMDA 2QKRA 3JYAA 4FEWA 5BVOA 2ZM3A 2Y4IC 3JVRA 3QD2B 4FV1A 2WD1A 4I21A 4U41A 3TXOA 1PMVA 1Y91A 4NTTA 5AUWA 3R7EA 3VBVA 3SAYA 5B2LA 3MFSA 2VX3A 4IH8A 2PUPA 5GJFA 3BIZA 1F3MC 4G2FA 2YCFA 3MY1A 5JN2A 1H8FA 3KMWA 1PJKA 4GFMA 3N4UA 2YM4A 1Q3DA 4MK0A 3SQQA 5JGDA 2HY81 3ZLYA 1WBNA 3LLTA 5A6OA 3GU6A 4PNIA 3E93A 4OUCA 4TKSA 1ZYCA 3ZDUA 4HYIA 1DAYA 3O8PA 3Q04A 1IRKA 3KXNA 3FDNA 5DYJA 3V8SA 1BUHA 5DVRA 4GU6A 2OJJA 4ALVA 2I7QA 2UV2A 4OTGA 3NCZA 3CCNA 2UZBA 3TNQB 1U5RA 1R0EA 2G9XA 4Y5HA 2BIKB 3DXNA 3NIZA 3OCSA 3HX4A 4O2PA 4MBLA 2WB8A 3PJ3A 2O63A 1UNLA 3OT8A 3QTUA 4KKGA 4V04A 5I9ZA 3B8QA 1YOJA 4FIFA 1H26A 3RHKA 4JLCA 4NJDA 3CS9A 3EYHA 4QTAA 3QQKA 4CMOA 4QMLA 4DHZA 4EJ7A 2SRCA 2WOTA 3I7BA 3KVWA 3FXWA 5DI1A 5GJGA 1ZARA 2XP2A 5EM7A 5A46A 3NNWA 4IAYA 5EYKA 4G5PA 2JDTA 4HCVA 3F5GA 4CFVA 2XEZA 4DCEA 5E1SA 2BVAA 4JR3A 3QQLA 1JSUA 1KOAA 3N51A 1G3NA 5I9UA 4EJNA 4FKIA 1B38A 2GU8A 1BL6A 2UW3A 1JWHA 4L6QA 5L2WA 1L8TA 5DPVA 1QPJA 5BYZA 4F70A 2E2BA 4EH3A 4BI1A 3GU8A 1LP4A 4B4LA 4U44A 4F99A 4QTDA 2XALA 4OTQA 4LMNA 5IUHA 3P9JA 4HPTE 4QMWA 4C34A 3H9OA 4EOIA 4HCTA 2X4ZA 3Q2JA 4AGUA 3SV0A 4X2KA 3HZTA 5HE3A 4DGLC 4XNEA 2RGPA 2CNQA 3GOPA 4OGRA 2DS1A 4FL1A 2BHEA 1DI9A 3OWJA 2ZOQA 2C5VA 1EH4A 2IWIA 4PDYA 3DFAA 2VTPA 1NY3A 2H6DA 3P0MA 5E7RA 5AP1A 3EL7A 2F4JA 3NNVA 3ORZA 4Y73A 4FTOA 5D7VA 4BVUA 1UWHA 3W2SA 3ZO2A 1UA2A 4I6FA 3DB8A 4D5KA 3W2CA 4UWYA 1OL1A 2ZYBA 3C0HA 2YCSA 5JQ5A 1BMKA 3PJCA 3T9IA 5F95A 4YU2A 4J1RA 4O0VA 1Q4LA 2YAAA 4A9SA 4XG6A 5HTBA 2EB2A 3EQPA 1XR1A 4IM0A 2DWBA 2Z7LA 4C02A 2PMIA 1HOWA 2PZ5A 3PRFA 5HCYA 5TT7A 3P1AA 1UVRA 1ZOHA 3NFFB 2JFMA 2IVSA 4FYNA 4KS8A 4YMJA 5AA9A 3WOWA 4FICA 3MVHA 1OUKA 4C2VA 3BYUA 3A7GA 1CMKE 4IX3A 4MCVA 2XYUA 3LXLA 4XLVA 4QYHA 3I60A 4QMZA 3LE6A 3RVGA 3A7JA 1QPCA 2HWOA 3BELA 4DH8A 2HIWA 4BCNA 1G5SA 4LV8A 2I0VA 3BLRA 3IW7A 4QP4A 1UU7A 5KUPA 4GYGA 2O65A 4XBRA 3REPA 3EQGA 3ORTA 3KXMA 4M12A 2HYYA 3DKCA 3RAHA 3TACA 2ETKA 5ANGA 3R21A 3WE4A 3LZBA 4WKQA 4KB8A 4USEA 4FE2A 4PRJA 5EQYA 3QALE 1WVWA 2UZNA 2CGUA 2JBOA 3A2CA 3QGWA 4O6LA 4UEUA 3O50A 3CP9A 4JQ7A 4QOXA 4YZ9A 4AOTA 4AW2A 4BCKA 4D5HA 4E4MA 4IVCA 5CT0A 2WMXA 3TKUA 2J0JA 3MH2A 4ASDA 1O6KA 3R8ZA 3BGZA 3L8XA 2A4LA 3OS3A 4YJRA 2UZWE 3CTJA 4WHZA 3DT1A 4UZDA 5CF6A 3H9FA 4II5A 4E4LA 3DDQA 2JD5A 2Y4IB 2XKFA 3OCGA 4L52A 4TL0A 4H3PA 4E93A 3FMHA 3ZDIA 3I5NA 3NDMA 4A9RA 4AN3A 4TN6A 3TCPA 5C4LA 1JAMA 3UTOA 4AFEA 3UNKA 2Q0NA 5DBXA 1YXVA 1YWRA 1SMHA 3S4QA 4DTBA 5LMBA 4I5MA 4F9AA 3ZZEA 3WF7A 3R9OA 3FZ1A 2ITPA 1IAJA 4RVMA 5HLPA 5IQFA 1NVQA 2WTCA 4HNFA 5HX6A 1K2PA 3MFTA 3Q4ZA 4DGNA 4F0GA 2VX0A 4N6YA 4EHZA 3R22A 5HU9A 3AC8A 4PDSA 5KHWA 4EOQA 2FO0A 4ONAA 3IOPA 5EHLA 3GC9A 3W0PA 5BQ0A 2VTLA 3NYNA 2UW7A 1H0WA 1ZYSA 3BHVA 4I23A 3NWWA 5KMOA 2O64A 2XK8A 3E8NA 2VTNA 2WEVA 4HGSA 4IANA 4PTGA 2HZ4A 4Q5EA 3RCDA 1FQ1B 4YZDA 1R78A 5LCJA 4O7YA 4G3GA 3EN4A 3R1SA 4ASXA 1ZOEA 5EG3A 5M44A 1V0PA 4FKOA 4U42A 3ZUTA 5FP5A 4OTFA 4FV3A 4FT0A 4EC8A 3D2IA 3IECA 3O5AA 4HGEA 5KBRA 3HUBA 1YQJA 2OGVA 2X1NA 3NW5A 3POOA 4L8MA 2QNJA 4IAKA 4JX7A 5DT3A 5CVFA 3V6SA 3VS7A 3PTGA 3VUIA 3ZOSA 3CR0A 3QXOA 2VTAA 3NIEA 3PZEA 3FMNA 3WZEA 3Q4CA 4B99A 4YNEA 4BBFA 4R5SA 2ZVAA 3VIDA 4IACA 1OITA 4FKRA 4BCHA 2O3PA 3BGQA 3DCVA 4CEGA 4AGDA 2QOHA 2QLUA 3MVMA 4WSYA 3S3IA 4C4GA 5CALA 4RPVA 1O9UA 4AAAA 1Q8WA 1O6YA 1A48A 2C68A 2R3LA 4MBJA 4TWCA 2B54A 4E4XA 2CLQA 2AUHA 3UOJA 4FX3A 4QYEA 1UV5A 3F9NA 3NAXA 2QU6A 5CU4A 4C36A 2QVSE 3UIMA 4EZ7A 4FT3A 4KIOA 3NS9A 5KNJA 4IWQA 5FGKA 1OM1A 4I4EA 2X2KA 4S33A 2JIVA 2UVZA 3Q9XA 2BAKA 1A06A 4X2NA 4M84A 3NZ0A 4AG8A 4DA5A 2R2PA 1TQIA 3BCEA 3LLAA 5F94A 4I6QA 4Q2AA 2X6EA 5LCKA 3VNTA 4DBXA 4EKKA 4GEOA 4HVDA 2PZPA 3MI9A 5GHVA 3NUXA 4AWIA 5M57A 3L9MA 5DEYA 4CV9A 3ZRKA 4FK6A 3AKLA 3MN3A 5EYDA 4RVTA 4WNOA 2CSNA 2QR8A 4PDPA 1U59A 3MSSA 4I0TA 3IONA 3KFAA 3FSFA 2Z60A 4KA3A 1M2QA 2PZRA 3OC1A 3UZRA 5A4EA 2XKDA 4FTRA 1PHKA 3BWFA 4FG9A 2FYSA 1QPDA 3LCTA 3FHRA 3PVUA 4FTMA 3ULZA 4JAJA 2A27A 4M0ZA 2QOOA 4CQEA 3UDSA 4BYJA 4GK4A 4DTAA 2H96A 3D0EA 4BDAA 1OGUA 1YOLA 1KE7A 3DAEA 3F3ZA 5BPYA 3SA0A 4AQCA 4R3PA 4HGTA 3L9NA 3FKLA 3F2NA 2VAGA 4H36A 3V5JA 2PVLA 2BDFA 2OZOA 3MDYA 5FXSA 4IM3A 5G6VA 4DG2E 5FEQA 3ELJA 3NSZA 4PL5A 4RJ3A 3HV5A 3I1AA 3E8EA 4AT5A 4NM7A 3O0GA 1PMNA 4RIYA 4CNHA 4GT4A 4BDIA 3IDBA 2AC3A 2C6LA 2YIWA 4YBKA 3FXZA 4R78A 4DHIB 2HXQA 2WTDA 3RI1A 2XARA 5L8KA 3R2YA 4FTLA 4YLKA 3R8LA 4D2SA 2O8YA 3O17A 4D1ZA 4ZTMA 4XP0A 4D4SA 2C1BA 4FTTA 3U87A 4HYHA 2WO6A 3GP0A 4B8LA 4F9WA 3SRVB 4CKRA 5HEZA 1FPUA 3ACKA 3BHHA 3R7UA 1XKKA 2VTIA 2BFXA 2YM6A 3CQUA 3DBEA 3NUYA 4F6WA 5HO7A 1A9UA 3BYOA 3O51A 3U54A 3T9TA 2IJMA 3ORIA 2Z02A 3NNUA 4JRNA 2X7FA 3GGFA 3ITZA 3E92A 3HV3A 4CVAA 3F2RA 4FSTA 4MWHA 4EQMA 3MESA 5IA1A 3QRIA 5CAPA 5IEXA 2QR7A 1TQMA 1H07A 1GAGA 4FJVA 4BTJA 1JQHA 4KKHA 3D4QA 3KMUA 4Z7HA 5CSVA 4I41A 2CMWA 4DTKA 3EYGA 3PVWA 2CDZA 2XIYA 4O7OA 3PFQA 5I0BA 3LXNA 5HCZA 4AE9A 5AJQA 3PY3A 4JNWA 2QO7A 3GVUA 2E9NA 2IVTA 4FZDB 5C27A 3HUCA 3CY3A 5JFSA 5GIPE 2PMLX 2JGZA 1ZY4A 4ALUA 4HZRA 2UZTA 4WNPA 3GNIB 2PVYA 3GC8A 2WTJA 4FI1A 1CKIA 3OCTA 4ZZNA 1YWVA 3HV7A 5DLSA 4A4LA 4QTEA 3QCSA 3SW7A 3Q60A 3VUHA 4O21A 4O7NA 3U6IA 3KXZA 4F6SA 4IB0A 4USDA 5AUXA 4EUUA 3OW3A 3U9CA 4N57A 3KCFA 2BUJA 2PVFA 3F3WA 5AP7A 5EW8A 2ONLC 3TNPC 5CSPA 1J3HA 4L9IA 5FP6A 5HVKA 5HD4A 2YM3A 3KF4A 1H0VA 5F4NA 3DLSA 3OZ6A 4JQ8A 4ZEGA 2RL5A 3VBQA 2R3HA 4M69B 4MD9E 1Q24A 2XM9A 3BHTA 4L46A 2WIHA 1OBGA 1PXLA 4U5JA 2WOUA 3LFNA 5FG8A 4JBPA 1GOLA 2YN8A 4M13A 5EDPA 3D5UA 2G1TA 5DWRA 4MXYA 4AS0A 4G3FA 3RJCA 4R5YA 4KBKA 1YW2A 3C4EA 4YJPA 3DBFA 5CSWA 3VF8A 4D4VA 4MX9A 3C4WA 2P55A 4MF1A 2V7OA 1YOMA 4RWJA 5A54A 4CMTA 1YXUA 3DK3A 3HA8A 3WYYA 4F7SA 2CHLA 5HIEA 2GFCA 2UW9A 3N9XA 1UWJA 3P4KA 4L67A 1X8BA 2ZMCA 4FNXA 4C3FA 2UZLA 2GHMA 4GG7A 1CKJA 2A0CX 3FLYA 3NEWA 4CFWA 4JQEA 4DBNA 3DTCA 1HCKA 3BQRA 3ANQA 3ZFXA 2WELA 3KMMA 4FTQA 4U45A 3RWPA 1IA9A 1PKDA 2W9ZB 3NW6A 1R1WA 4EH5A 3RM7A 3OWLA 4JRVA 5L6WL 4CT1A 4GFOA 5CANA 4X6RA 2VNWA 2GDOA 3JR1A 2C30A 3TV7A 2YWVA 5K4IA 2O0UA 5M53A 1ZYDA 3TMOA 5IDNA 3VHEA 3ETAA 3HMOA 3I79A 4O7PA 3LFEA 3L9LA 3W16A 1OIYA 4AA0A 4PP7A 4B7TA 4RBLA 5KMKA 5D9HA 3ZLXA 5HE2A 1APME 4X2JA 3OOGA 4FTIA 3KXXA 4DEEA 3CEKA 3OTVA 4DFBA 1U46A 4BDDA 3OROA 3PXZA 2X39A 4KRDA 2OJGA 2OJFE 4OR5A 5H9BA 2Z7SA 4YGAA 4JG7A 4PMPA 1JLUE 4GKIA 4BCFA 4BJJB 2WAJA 4YC3A 2I1MA 2W9FB 3F3TA 4RJ6A 4YTIA 2IVUA 4QMVA 2QOLA 4TRLA 3OW4A 2CPKE 1OKWA 4WOVA 5HCXA 2WIPA 2XMYA 4ANMA 3F88A 3UQCA 2F7XE 2P3GX 2YEXA 1IASA 5H8GA 3PUPA 3W8LA 5FUTA 4C2WA 3H30A 3W10A 2RG5A 3DTWA 3EOCA 4IAAA 3E64A 2YIYA 5HE0A 3A4OX 5E4HA 1ZYJA 4F6UA 5JZNA 3RAWA 3ZC5A 5AADA 4NCTA 3NVKI 4LOQA 1W0XC 4AUAA 2EU9A 5CZHA 4O0XA 3Q6UA 2BZIB 1Q99A 2PK9A 4P5ZA 4RWLA 3QTRA 4W4XA 3UDBA 4NZWB 2B53A 4JAIA 4YZNA 2W17A 4EK4A 5EM6A 3GXLA 4ITHA 4AN9A 1PXKA 1ATPE 4WD5A 3W2PA 4CFMA 1H28A 2YIQA 1GJOA 3CTHA 1XHAA 2XNOA 3LFDA 3IW4A 4E73A 5AA8A 2G2HA 4IBMA 4U3YA 4ZIMA 2V55A 3QXPA 4JG6A 3QKLA 5IG1A 1UNGA 4B0GA 3S00A 4MH7A 5C8NA 2ONLA 3F7ZA 4WRSA 5IQDA 4EHGA 5CS6A 4R7HA 3ZMMA 4RIOA 3MTLA 2IPXA 1BYGA 2X2MA 3C4FA 3NGAA 4F4PA 3P79A 2G2IA 5IISA 5IQEA 3PPKA 3FZOA 2CGXA 5ETCA 1BKXA 2QODA 3P7BA 4K1BA 4XMOA 2YDJA 3VONA 4HPUE 4L3PA 4K6ZA 2I0HA 3KXGA 3PG3A 4CG8A 4IX4A 2CCHA 3QD0A 4RX7A 5FD2A 3NPCA 2OJ9A 3QZHA 4IIRA 4QMMA 1W7HA 3PRIA 4WG3A 3QUDA 3WYXA 2XIZA 4XV9A 2W1CA 3PIXA 1LEZA 2WMAA 5HBHA 3UVQA 4AZTA 2PY3A <