4FEUA

Crystal structure of the aminoglycoside phosphotransferase aph(3')-ia, with substrate kanamycin and small molecule inhibitor anthrapyrazolone sp600125
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
253
Chain Sequence
LDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 3'-phosphotransferase AphA1-IAB
publication title Structure-guided optimization of protein kinase inhibitors reverses aminoglycoside antibiotic resistance.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.95: Kanamycin kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4feuA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4feuA02
1HOWA 4K11A 5CANA 1Z57A 2WQNA 2GNHA 4ZS0A 1DS5A 2J9MA 2RGPA 5LVNA 1PXJA 2UVXA 1CKJA 4BCNA 4CMOA 4YHTA 1U54B 2YACA 3MVMA 3NVMB 3OROA 1REJA 3PE2A 2R3HA 5DFPA 3DAEA 3R7VA 3R9DA 4JDKA 5HZNA 4KIOA 2DUVA 4IX3A 3VBVA 2ETKA 5L2IA 2W1IA 3GCVA 3QZFA 3W8QA 4DA5A 2W1HA 3NIEA 2UW7A 1W7HA 1U46A 3OW4A 3W1FA 4QNAA 4FEXA 3HZTA 1WBSA 2WAJA 2XEZA 4FT5A 1WCCA 1M17A 3H0ZA 3DKOA 5AP0A 2WELA 4ZOGA 3S2PA 3VN9A 4EK4A 3DTCA 4FVQA 4F6SA 1RJBA 3QUEA 5BNJA 4H58A 2VTLA 2F4JA 3I79A 1UWJA 1GY3A 3C1XA 4E73A 3G33A 4GG7A 3ZU7A 3LFBA 4F70A 2HZ4A 2JFLA 4O0RA 4O82A 2KULA 2OZAA 5EOLA 2UV2A 3DBQA 4ASEA 4Z9LA 3TEIA 4AX8A 4DYMA 3HP5A 1SZMA 4RSSA 4NM5A 5JRSA 3M11A 4QOXA 3UOKA 5HU9A 3UIMA 4HCTA 4XG9A 4ALWA 1SYKA 2WOUA 5HNGA 5IA0A 3FEGA 3OOMA 3DBCA 3SVVA 4MQ1A 4ZIMA 1XKKA 4G1WA 3OCGA 4DGLC 3D0EA 4GYIA 3LFEA 4X3FB 5CVHA 5HBHA 5B7VA 3PRFA 4LUEA 5IMEA 4A7CA 4IAAA 1OL2A 3BEAA 4GVJA 2WPAA 4GU9A 1Y8YA 5EHLA 4F4PA 1BL6A 2P2HA 3A7GA 3LLAA 3ZZWA 2VO3A 2FSTX 5HVKA 4AFJA 4FKWA 4DBXA 5LMKA 4NFMA 3ZBFA 2XJ1A 1P4FA 2O3PA 5B0XA 4GVAA 3S3IA 3JY9A 4JBQA 2XNGA 2R5TA 4M67A 3HV4A 3H4JA 3MH0A 3F7WA 2W06A 5IQIA 1Q61A 2QNJA 4HZRA 4AXAA 5G6VA 2B0QA 3ZLXA 3U87A 4H3PA 4C58A 3KXGA 2XIZA 4LOPA 4P7EA 4L00A 4QMOA 4Y85A 4AF3A 4FEVA 1YHWA 4XUFA 2P4IA 2YDKA 3PZEA 2VNYA 4CT1A 3CPCA 4L44A 2JAVA 3T9IA 3VF9A 3PSCA 3QFVA 1Q97A 4XP0A 5M55A 3GU5A 3LFSA 4TPTA 4ZSAA 2DYLA 3AMAA 3I6UA 4NZWB 4J97A 3RM6A 4BYJA 3OCBA 3C5IA 2JEDA 3RPOA 3DXPA 4GJ3A 4L43A 5IA5A 4OTQA 3OZ6A 5EK7A 4F1OA 4EZ3A 2WTVA 1GJOA 3U4UA 2EB3A 4IHPA 4I6FA 3Q4ZA 4DEAA 3HMNA 3MB6A 3L9NA 2OZOA 4FV9A 3TNQB 5M4FA 2X39A 3VO3A 4WSYA 5CU3A 4AZTA 3EZRA 3UP2A 2XIRA 5GHVA 3WF9A 3ORNA 2C6TA 1WAKA 3NYOA 4K9YA 4QTDA 4TYEA 2B9FA 4APCA 3ALOA 3D7TB 3I1AA 3CQWA 4PP7A 4ZAUA 2VX0A 4NK9A 4TYGA 4R3CA 3LQ5A 3MJ1A 5HIDA 5HLWA 1BMKA 2XRWA 4IM0A 1H1PA 3V6SA 3UQCA 2UZUE 3C5UA 4AW1A 3MY5A 3TTJA 4JIAA 4X6QC 5CZHA 1W98A 2UUEA 2YDIA 2C5XA 4XNEA 5JRQA 2VTMA 1FVVA 2BZHB 4FX3A 3IKAA 2GQSA 4QTAA 3NYNA 3HYHA 3PJ2A 4Z55A 2BDWA 2PVFA 4FSQA 1YI3A 3DXQA 2WO6A 3KFAA 4GIIA 3EQCA 4JI9A 3PIZA 5BYYA 3UZPA 5BVOA 5DRDA 2OSCA 3MJ2A 1J91A 4G9CA 2BR1A 2JC6A 3M2WA 4O22A 5CZIA 4BDFA 4OGRA 4ITJA 4YLJA 2F2UA 3OTUA 1DAWA 1H07A 3LMGA 2R4BA 4U80A 3O8PA 5IQBA 5C26A 3ORMA 5DBXA 2WMBA 3OWKA 3PSBA 4ZS4A 4UZHA 4XRJA 5HESA 4JRNA 3UZTA 4GKIA 4LL0A 1Q3DA 1GZNA 4G6LA 3DZOA 4FA2A 2F7XE 1Q41A 3BELA 3F2AA 4CMUA 4AP7A 3G9NA 4P5QA 3PJ3A 2W1EA 3T3UA 3N51A 3VW8A 3C4CA 5LXMA 1J1CA 4MHAA 4D5KA 2X1NA 3FMJA 3MVJA 4GU6A 4PL3A 5I9ZA 3GGFA 3RNIA 4U45A 3LFAA 3ORXA 3QTWA 5FDXA 3RAIA 4CCBA 4YUQA 3MTFA 1CMKE 2VTOA 3EYHA 3H3CA 1OPLA 3WZUA 5CVFA 4GK3A 1O6KA 5CI7A 3LFDA 3UDBA 5EH0A 4MD9E 2ITVA 3W8LA 2IVUA 1BX6A 2R3QA 1PKGA 2XCHA 5EM6A 2HZNA 3DJ6A 3NNVA 3E3PA 3O8UA 4FGRA 4E6DA 2JDSA 4U5JA 1Q62A 3Q9WA 2WMVA 3ZM9A 5CSWA 4HNFA 2XJ2A 5IQHA 4A07A 3NCGA 3ZTXA 3AC8A 2PZRA 2QODA 2R7IA 4Y73A 4BCIA 2J4ZA 3SRVA 3MVHA 3QKLA 4E4MA 4PMPA 3CTQA 3IOPA 4JG6A 4LFIA 1WBOA 3AMBA 1UKIA 4YNEA 2X7FA 5AV4A 3GC0A 3I81A 3E5AA 3O71A 2QD9A 2A1AB 2QO7A 4N70A 5FUTA 1Q8WA 4IAKA 3IDBA 3K2LA 3PY0A 4NJ3A 4QMSA 3ZO3A 3KK9A 2OJJA 2P3GX 3ZSGA 2W9ZB 3V04A 2O2UA 3KB7A 2O65A 3C4ZA 4R1YA 3DAJA 4TYHB 4K8AA 3W2SA 3P7AA 3OW3A 4G5PA 3FZTA 4U43A 1XH4A 5ANGA 5HX8A 1IAHA 3ORPA 4AW2A 2VTQA 3VC4A 3NYVA 3JS2A 1JLUE 3D83A 1U5RA 5L2SA 2PTKA 2VTIA 3A61A 4YZMA 4EBWA 2W5HA 3RVGA 4PDPA 2BFYA 3QQLA 4GUBA 2GU8A 1SMHA 2YEXA 4JR3A 4E7WA 3GC9A 4FV0A 4IWDA 2JITA 2B53A 4FR4A 2OI4X 5E9EA 4GG5A 5BUIA 4PQNA 3UODA 4X6RA 4BGGA 4R6VA 4BI1A 3BU6A 1OM1A 3FY2A 5E4HA 3VS3A 1J7UA 2UZOA 5AUWA 4GL9A 3FKOA 1U4DA 4BTFA 4EOIA 4BDBA 3UQGA 3QGYA 2QLQA 2VGPA 4PX6A 3E8CA 2VWYA 5KO1A 2IVTA 3GI3A 4FKPA 4WOVA 5DGZA 4BF2A 1PJKA 1ZRZA 2BDJA 3GFEA 3FLSA 4W4YA 2JIIA 4X2FA 5AX3A 4BC6A 2X7GA 1ATPE 4C33A 5J5SA 5CYIA 3Q32A 4ZTLA 2G2IA 4TY1A 4ENXA 3LCOA 1B38A 3OCSA 2PL0A 3PZHA 2YM6A 2C6IA 3PVUA 4CLJA 3UO5A 3U8WA 4KKEA 4FTKA 4KAOA 2ITPA 4MK0A 5CU0A 3DKCA 4L3PA 5ANEA 4YTCA 4QPSA 4BBEA 3UC3A 5I5ZA 4JRVA 5HU3A 2QVSE 4FG8A 5CT0A 4CQEA 4EH7A 5CEOA 3TIZA 5IDPA 2PULA 3FMLA 4S33A 1URCA 2J2IB 5C1QB 5FM3A 3C0IA 2GDOA 4QMWA 5DE2A 2YM5A 1YI6A 5CSVA 3ZXZA 4A4LA 4AA0A 3MB7A 3A8XA 2CMWA 2R3PA 4QTCA 3MPMA 2YCSA 1DI9A 1OL1A 3COIA 2WMXA 1YKRA 2ZMDA 3TDVA 3HA8A 4ZSJA 4FODA 2J0MB 3GU4A 4YHFA 1RE8A 4AQCA 3UC4A 2XBJA 4O7LA 5IH5A 4CG9A 4ERKA 3AD5A 5HBJA 5AM6A 5DRBA 4FOCA 3RK7A 5K5XA 2VZ6A 3ZRLA 4FIEA 4JBVA 4JLCA 3LCKA 2VU3A 3BGQA 3MH3A 3BYMA 4KIQA 4IADA 2FSLX 3D5UA 5EM7A 2FB8A 4IAZA 5M53A 2NPQA 3L8PA 3HRBA 5GIPE 2J0JA 1L3RE 4NUSA 4ZJJA 4IJ9A 3MYGA 4H36A 2NRUA 3E8NA 3NR9A 2YISA 4QT1A 5CNNA 1JOWB 3BHVA 4OTWA 5DEWA 2ITUA 4D2RA 4E4LA 3VS5A 4M0ZA 4C62A 4DH1A 2CPKE 4IH8A 4WNKA 2X2LA 3KMUA 1FQ1B 1PKDA 3KF4A 4XP3A 2YIXA 4YHJA 3MWUA 4RJ3A 2B9JA 3PP1A 4G9RA 4WD5A 1H8FA 3A2CA 3NAXA 4G6NA 3EB0A 2QOLA 3PTGA 2JDRA 5HTBA 3QRIA 4OTRA 4ZTQA 5CT7A 5M4CA 3C4FA 4X2KA 2CJMA 5JFVA 2EU9A 4FSZA 3TUDA 5CAQA 3QCQA 3ZEWA 2C69A 1KV1A 3B8RA 4ALVA 2GFCA 3VS1A 3TWJA 3R7YA 1J3HA 2E9UA 4PTEA 2ZOQA 2QI8A 2JKKA 4G17A 2CKPA 4BTKA 3WI6A 2O8YA 5C8MA 3FMEA 4EWQA 4U7ZA 4BDGA 2VWVA 1PW2A 3CJFA 4O0XA 4Y5QA 4F9YA 5LWMA 3Q52A 3IO7A 4XG4A 4I4FA 3AG9A 1KE5A 4TNBA 1UKHA 3UP7A 4FICA 3JR1A 4R78A 4YP8A 4P4CA 4C3FA 4O0SA 3R00A 1PYEA 3RCJA 4R5YA 3ZXTA 4BCQA 4D0XA 5A4EA 4GK4A 2Z7SA 2XKFA 4WG4A 4EYJA 4WUAA 4WA9A 4XBRA 5IMXA 4G3EA 3BHTA 2YJSA 3U55A 3ZLWA 5H8GA 3MPTA 3ROCA 3R7IA 3KKVA 4GV1A 4ZZNA 4EKLA 3PXQA 4EUUA 4G2FA 3ZUTA 4O91A 2REIA 4YJPA 4CNHA 3I5NA 3OT3A 3W32A 3BLQA 1XO2B 3R01A 1YDTE 2G01A 3IG7A 3HX4A 2C6LA 3WYXA 4RQKA 3KC3A 2ZDUA 4FV7A 4ANBA 3UMXA 4QMPA 1K9AA 2JKMA 2CHLA 4EOKA 3DK6A 2RL5A 4XX9A 3RALA 2ZM3A 4G31A 3THBA 4QMQA 5DR2A 4K6ZA 4AFEA 5AAGA 4R1VA 3TN8A 1UVRA 2PWLA 2F9GA 2X6EA 2Y4PA 4RQVA 1OB3A 5DH3A 2BKKA 5AP5A 4CMTA 2Q0BA 4MNEB 2XBAA 4GYGA 3EIDA 4JIKA 5F9EA 3TXOA 3PYYA 2A2AA 2GS7A 5AA8A 4KS7A 5BVNA 2CGWA 1ZZLA 3KU2A 3PA4A 3UTOA 1OL7A 3FKLA 4O0WA 2GSFA 3WF5A 3FBVA 1XH5A 5J9ZA 4CFFA 1O9UA 4YU2A 4C3RA 5M08A 4JAJA 4LMUA 3BPRA 3POOA 4C35A 4XP2A 3OXIA 2HENA 2OZAB 3NWWA 4P2KA 4ZXTA 4O6LA 5HIBA 3TNHA 4RIYA 1WVYA 4L45A 4BRXA 2G15A 3ITZA 1QPEA 3Q60A 2W17A 2H9VA 4I1ZA 4H3BA 3MIAA 3G0FA 4FT3A 4FL2A 1OUYA 2BAKA 3EN7A 4PNKA 5KMNA 2XM9A 4NM7A 4QMNA 3IW5A 4IWPA 5AMNA 4HVDA 4TN6A 2XK9A 1RDQE 2V7OA 3N4TA 3CE3A 3OMVA 4L53A 4BDHA 1LP4A 4AGUA 1XR1A 1Q3WA 2EXCX 3ZSHA 4AE9A 3ZYAA 2PUIA 2VWZA 1U5QA 2OJ9A 2RFEA 5BVWA 3TIYA 4IBMA 5IPJA 2X8DA 3PXZA 3PLAE 5DEYA 4C2WA 3PXRA 3E8EA 3KA0A 2OO8X 5AUYA 5IQCA 3NIZA 4E6QA 1SVGA 3ZC6A 3UNKA 2HWOA 3QBNA 5AP3A 5LMAA 4KKGA 4BKJA 3MTLA 4F08A 3OS3A 4KUJA 2YHVA 4RPVA 4BDIA 4I93A 4YGAA 4MXZA 5E91A 4BCHA 4FYNA 3PIXA 4ANLA 5CQUA 1MQ4A 3KF7A 3NZ0A 5CSPA 2LGCA 2XNEA 2YM8A 3HUBA 2CGUA 4D55A 4A9UA 4BN1A 3LZBA 1A9UA 3WZEA 5I9VA 3TT0A 3BU3A 2GQRA 3U9NA 5F95A 4Y5HA 1QL6A 3HAVA 3QALE 3BGPA 5FD2A 4APPA 3UNJA 4UYAA 5EI6A 4CFUA 4YO6A 2ITOA 5D9HA 1M7NA 4PDSA 4D58A 5AUZA 2B7AA 2VTSA 2CNUA 3C4XA 4HJOA 4ZLYA 4UEUA 4QO9A 5JZJA 2W0JA 2UZDA 1R78A 3BBWA 4FSTA 4Q2AA 4IAIA 3NUNA 4FTOA 3V8TA 4I3ZA 1PF8A 2IW6A 4LGGA 4TW9A 4UYNA 4WRSA 2C1BA 3NGAA 3AGLA 2OFUA 4MXCA 3WILA 2QONA 3EFWA 2ZV9A 3W2PA 2DWBA 2CCIA 4JQ8A 1TKIA 1H24A 3CD8A 2C3KA 2IZRA 3UBDA 4RIOA 1OECA 3MFRA 2QHNA 4ZY6A 3QA0A 2XZSA 2QU6A 4BIEA 3EZVA 3GU8A 2BZKB 4HGLA 3RPYA 2OWBA 2KTYA 3HMIA 3PUPA 3EL8A 5BVDA 1OUKA 3PVBA 4O0UA 3QTQA 5IUGA 2X9FA 2JFMA 2WTKC 3E63A 4IX6A 4DG2E 4EK3A 3GU6A 3DLSA 3EKNA 2GQGA 3FPQA 2W99B 4QYHA 4FL1A 3QTXA 3O23A 4DTKA 5KUPA 3BX5A 4EHZA 3VBTA 2OLCA 5D12A 3KVXA 3CLYA 1ZYSA 4XHKB 5AIKA 3FLQA 4OR5A 4FIGA 4DFZE 4TWNA 4G3GA 2PMNX 3D5VA 3Q5IA 4GH2A 4USFA 4DN5A 3LMIA 2RG5A 4HCVA 4EOPA 4O7YA 1XBAA 2C3JA 3NW5A 4CFVA 5L8KA 4MH7A 1QMZA 3K3JA 4ID7A 2V5QA 2PE1A 3DNDA 2OIQA 4EH8A 4TYJA 2ZVAA 1PXIA 4MBIA 4ZK5A 2IWIA 3AOXA 4HYSA 5GIOE 4C7TA 2JBPA 3ZRMA 5CALA 4DGNA 1W83A 4XG2A 4AGWA 3RKBA 5M51A 2XIKA 3IW8A 4L7SA 5ANIA 5ANKA 4FSRA 2XB7A 5HG8A 3BV3A 2WTWA 3HRFA 4XOZA 2XP2A 3SC1A 1B6CB 4WRGA 5EQYA 3EN9A 3UVRA 5IA2A 2Y7JA 4MXAA 1JPAA 1KSWA 4UZDA 1H1QA 1ZXEA 2C5YA 4WNPA 5EM5A 4BDAA 1F3MC 4FT0A 3AC1A 3BWJA 3S1HA 4KINA 1FVTA 4FKJA 3FDNA 4FKVA 3LXLA 3VUGA 3TZ8A 1P14A 2QU5A 4HVIA 3FAAA 4X3JA 3R1YA 3TJDA 3GFWA 5ETFA 3HV6A 2IJMA 4JQEA 3F5XA 1ND4A 3DV3A 4PMMA 2CNQA 2UW8A 4F7LA 2W1FA 5IU2A 4M12A 3BYUA 5L8JA 3EFKA 3P23A 4HGTA 1H1SA 2HWPA 3PJCA 1RW8A 4HYIA 4PTCA 3SRVB 3A7IA 4XS2A 3FYJX 3C7QA 4N6YA 4V05A 1G5SA 1Q4LA 3OP5A 2J50A 4RC2A 3RP9A 2HZIA 3KEXA 4ZP5A 3ZH8A 4FUYA 5FM2A 4ZEGA 4QYYA 4I22A 1XH7A 4FGBA 3NLBA 5DI1A 3TTIA 5HTCA 3KXHA 3OFMA 3DBEA 1WZYA 3IDPA 2I0EA 4FKTA 4K77A 4S31A 2W7XA 2QG7A 4DFNA 2PE0A 1A48A 5DT0A 4ZSEA 3CC6A 5TKDA 3DBDA 3JVSA 3Q04A 4MTAA 4O0VA 5DWRA 2YIRA 5AP6A 3UOHA 1LEZA 3HGKA 4F9BA 3KCKA 3M1SA 4YLLA 1H1RA 2HIWA 3R8ZA 4GK2A 4OTIA 4B4LA 3KRLA 4YJVA 3KULA 4ZY4A 3CQUA 4AN3A 3ORIA 4ZJVA 3D94A 3KN6A 4HPUE 4J99A 2BALA 3PY3A 2WZJA 1SVHA 3O51A 4LV8A 4YR8A 1JWHA 3F2RA 2VWXA 3ANRA 5HGIA 4AT4A 5I9YA 4BVUA 1CM8A 4J71A 5CTPA 3GCSA 3ZZEA 4IZYA 5IG1A 4EONA 4YJQA 3HMOA 1H1WA 4IB1A 1DM2A 1TQPA 2ZM4A 3A99A 5E8TA 4FT7A 3EQRA 3OTVA 4YO4A 4ZTRA 1FMOE 3R7UA 4YZCA 4AZVA 3BYVA 4KA3A 4FTUA 2ITZA 4IJPA 2P0CA 4CCUA 3TYKA 1E1XA 3K3IA 5EW3A 3HMMA 4J53A 4IM2A 5E8UA 4RX8A 4D5HA 4BIBA 4GJ2A 5IEXA 2C0TA 3PG1A 3S00A 3LM5A 2W4KA 4L7FA 4DEDA 3ENMA 1CSNA 5J1WA 4FTJA 5HCZA 4P90A 4RJ5A 5CQWA 5LCKA 3OWPA 3PJ1A 2R3JA 2BHEA 2E2BA 3QKMA 5B2KA 2XK3A 4FEUA 4PWNA 1GAGA 1YWRA 2GS2A 1OKWA 4O38A 5HEZA 5L2TA 4FIHA 4MCVA 2XRUA 3SXRA 4EORA 2XKDA 4OBQA 2BCJA 1ZY4A 2BZJA 3CY2A 4LRKA 3EQDA 3O7LD 4QP8A 3DK7A 5CY3A 1JSUA 4BTMA 4FKQA 3II5A 4YBKA 2Y9QA 4OBPA 2VRXA 4RIWA 4BYIA 5A6OA 4FI1A 4RA4A 5DPVA 4ACMA 1AQ1A 4O21A 2JDVA 1L8TA 4WBOA 4C4IA 3VNTA 4EKKA 3CS9A 4DFUA 4Q5EA 4DTBA 3NNUA 3ZSIA 2OG8A 1OITA 4L67A 4AUAA 4LYNA 4WNMA 4DEGA 4X3FC 3MI9A 3D2IA 2ITQA 4DF3A 2Z7LA 5HE1A 1V1KA 2R9SA 2I0VA 1FGKA 4OTGA 4QYEA 3A62A 2UW4A 5EKOA 3LJ2A 2X0GA 4G3FA 3C50A 3L8XA 3BWFA 3TV4A 3QCXA 5KMMA 3PY1A 3DK3A 4EQUA 2OICA 4DFBA 1ZOHA 4ZJIA 3F6XA 2YDJA 2PVJA 3FSFA 2VWWA 2E9OA 2YM7A 1V0PA 4GFOA 3UOJA 4ANMA 2QR8A 3ZO1A 3TKIA 1PXKA 3VS2A 3UYTA 1ERKA 2PVNA 5TO8A 4DT9A 5GJFA 4TWOA 2C5OA 3FC1X 5T3QA 2IPXA 3IS5A 2Z02A 3H9FA 3SW7A 4PTGA 3VQUA 4E26A 2IW8A 4ZTMA 4CZUA 2WEIA 5CEKA 5AP2A 3KRWA 3V5JA 2GFSA 4FZ7A 4L9IA 2PYWA 1PY5A 4CZTA 1Q8YA 3BLRA 2C5VA 3G5DA 3OY3A 4O84A 4RZVA 3ZBXA 5AADA 2BRHA 5AV2A 5HE0A 4MNFA 2AYPA 5EQPA 5BVKA 1JVPP 1YXVA 2WKMA 4LQMA 2ZV7A 5EG3A 3KMMA 3Q4UA 3VBWA 3C9WA 1SM2A 4QQTA 2WTCA 4OTDA 4A06A 4L68A 4YZBA 1JKKA 1PXLA 2OBJA 4IDTA 1SVEA 4NCTC 4F6UA 5IA1A 3CP9A 4RWLA 5CU6A 2GHLA 3SXFA 1LUFA 3F88A 5AUVA 4MWHA 1JSVA 4F7JA 2P33A 4JBOA 4AOIA 4XG7A 1I44A 5L8LA 1JNKA 3OWLA 4J7BA 5C03A 4UB7A 2UZWE 4AWIA 4D28A 1OKZA 2OKRA 3LE6A 5ETIA 2C6MA 1KE9A 2E9PA 5AM7A 2BUJA 4FTTA 3JY0A 5KE0A 3H30A 2QOCA 3GOPA 4MBLA 4JQ7A 4QYFA 3F3UA 1M2QA 3ACKA 4RVMA 1Q8ZA 3FXZA 4F9WA 4RX7A 5EOBA 1UV5A 4OTHA 1JKLA 4AA5A 3R73A 4JG7A 5AUXA 3KGAA 3P7CA 4M0YA 2XIYA 3RK9A 4DE4A 3TZ7A 2R3LA 3U6JA 4TYIA 2BRGA 1OPJA 3DDPA 2GHGA 3EQFA 3KVWA 4CT2A 1OVEA 3MSSA 4TL0A 2PVRA 2OU7A 5CASA 2JDOA 3U6IA 3TM0A 4QMTA 3V8SA 3H9OA 2YCFA 2ONLA 2VTPA 4QTEA 5AV0A 5CAOA 3SKCA 4XG6A 5BPYA 2C4GA 3OC1A 5AUUA 3R8UA 5D7VA 3I5ZA 4EOLA 2ITTA 4TKSA 4XCUA 3LPBA 5HVJA 4H1MA 4Z7HA 5JQ8A 4AZEA 4U41A 4CFMA 4MBJA 3L8SA 4AE6A 4FNXA 4Q9SA 5DIAA 1URWA 5E8ZA 5FTOA 2I0YA 2YITA 5BYZA 3UOLA 3VJOA 4DHFA 2J7TA 2F57A 4G3CA 2WTIA 4DG0E 2ZM1A 3GNIB 4F63A 4W4VA 3R8VA 3LVPA 5HORA 5C8NA 4EUTA 2R0UA 4GUEA 4O83A 5BUJA 4NH1A 1HCKA 2YIQA 3ACJA 4CD0A 4L42A 5LJJA 5ANDA 3GUBA 3ZO4A 4RIYB 2GPHA 4GS6A 4CFNA 3O8TA 2UZEA 4CKJA 4ITHA 1KUTA 3FI3A 4EOQA 3RK5A 3OBJA 3ZMMA 4F64A 3NUSA 3D5WA 4FV2A 1J1BA 1OKVA 4F65A 4G3DA 3V8WA 1XH8A 3EFLA 3PWYA 4C2VA 4FTNA 3GCQA 3FC2A 4OUCA 5DN3A 3R04A 1IASA 3OXTA 2YFXA 1S9IA 5FQDC 4JX3A 3ZO2A 4ASXA 5D10A 5IQDA 3DB6A 3FZRA 3G51A 3VBYA 1CKPA 2GNLA 4NT4A 3R63A 3VRZA 3CY3A 3R71A 4JDJA 4NWMA 5J87A 2B9HA 5CX9A 4GCJA 5D7AA 2RG6A 3RPSA 4PMTA 5L3AA 3HP2A 3TUBA 4BCKA 4EZ7A 3FXWA 4FV5A 2AC5A 3DQWA 5C9CA 2Y6OA 3AQVA 4JDIA 4G16A 4L3LA 3ZFXA 4CGAA 2P55A 3UG1A 3R1QA 3PP0A 2AUHA 4LRJA 4MXYA 5FP6A 4EWHA 1T45A 2IZSA 3R9HA 1UU9A 3GXLA 3D5XA 3ZLSA 3FMKA 1OBGA 3VWAA 2ZV2A 4EOJA 4O7VA 1FBNA 2X8IA 3GU7A 1W0XC 2Z8CA 1H4LA 3IOKA 2QOIA 1YHSA 2BAJA 1IEPA 3SA0A 4UXQA 2NO3A 2QG5A 3FSKA 3HVCA 3W2QA 3QD2B 4OW8A 3B2WA 3QX4A 1E9HA 4O2ZA 3LM0A 1PMNA 2ZYBA 4EEVA 2PVYA 4U81A 3CGOA 4TNDA 1QPDA 3COHA 3EQIA 5E8WA 5BQ0A 2PVKA 1IG1A 3FMHA 3TKHA 3N9XA 3RMFA 3DAKA 2IVVA 4AZWA 5AJQA 3NEWA 3BV2A 3HEGA 3PXKA 3QHWA 4QQJA 4D1SA 2UZNA 4L52A 3SG9A 4HOKA 4OLIA 1R3CA 2G9XA 4G34A 4U9AA 5LOHA 1XBBA 3F82A 4YLKA 2PZ5A 2OGVA 3C0HA 5M44A 1UNGA 2FH9A 2XKCA 4QQ5A 4J52A 3WARA 2Y6MA 4XV9A 5CEIA 2WMUA 3QX2A 2JLDA 2WQBA 4AG8A 2XKEA 1G8AA 5DNRA 3F5UA 4C38A 3E8DA 4S2ZA 1KE7A 2XF0A 4IANA 5E1EA 5HCYA 1MQBA 5D11A 5H9BA 4Y83A 3CEKA 4QP4A 3DJ5A 2EVAA 2XA4A 4NFNA 2CKOA 3Q6UA 2PMLX 2XNMA 3GBZA 4KRDA 3ZFMA 5HVYA 4IX4A 1Y6BA 1J7LA 3ORLA 3P78A 4Y72A 4KBKA 4PF4A 3SAYA 5KX8A 3MW1A 2UW9A 3ALNA 2WEVA 3SDJA 2QHMA 4AAAA 2F2CB 1XH9A 5CSXA 5LMBA 2QO9A 4C59A 5E8VA 3DJ7A 2PK9A 2X8EA 1FOTA 1KOAA 4J95A 4IFGA 3TL8A 4CG8A 3TI1A 3NMUF 3LIJA 4JX7A 5CEPA 2ITXA 3MH2A 2O64A 4RWKA 4U79A 4RG0A 4RFYA 2HY81 3E64A 4UX9A 3LFFA 4YC8A 2UZBA 1SNXA 3S95A 4FSMA 3WZJA 4FEWA 5I9UA 2VWIA 4ZTSA 3QZGA 5TR6A 3CIKA 4U0IA 4I23A 3D4QA 4PY1A 3QC4A 4KKHA 2XIXA 2R3NA 4IAFA 3Q2JA 4EH2A 3MGYA 3DS6A 4K2RA 5BX0A 3G9LX 4MWIA 2EB2A 4CRLA 2R3OA 2VTHA 4UV0A 2BRNA 3N4UA 5J9YA 4AA4A 4XBUA 5HE2A 4DH3A 3OCTA 3CKWA 3OVVA 3PA5A 4YTIA 3MIYA 1M52A 3RINA 3FI2A 3LKMA 4DG3E 4NTTA 4OT5A 3D7TA 4FKUA 4FVPA 4Y8DA 2Y4IB 4YZDA 4K0YA 3W0NA 3KRJA 4NW5A 3IGGA 5H8BA 1YW2A 3R2BA 5JGDA 2JKOA 2ERZE 4A9RA 2UVZA 4FTIA 4EYMA 5HG5A 5JK3A 3UJGA 3CTHA 3UG2A 1RQQA 4RLKA 1BUHA 3DB8A 1LEWA 3GENA 3AD4A 2FUMA 2WQOA 4MD8E 3R8PA 3VUKA 2CNVA 3E7OA 3PVWA 4FE2A 3QXPA 3C0GA 3S4QA 2PMOX 4A9YA 5JZNA 3UYSA 4HVHA 3JYAA 4GFMA 4BIDA 1PRYA 2WU7A 3WYYA 5C4KA 1R39A 3MY0A 4O2PA 4DFLA 2RKUA 2P2IA 1K2PA 3A60A 4WO5A 3W10A 5DOSA 4QP1A 3KXNA 3KULB 4BGHA 3PE1A 1X8BA 4DT8A 1SNUA 1JQHA 3DFAA 5JEBA 2WU6A 2WMSA 3RHKA 4BZDA 5I4NA 2X9EA 5DR6A 1NT2A 5KZIA 4FKOA 4FUXA 3G0EA 4CVAA 4FIIA 4ENYA 3PXYA 4AOJA 1YI4A 3Q6WA 1H28A 4AZSA 3KXXA 3PLSA 4FTAA 4BDEA 3GT8A 2NP8A 5EDPA 4O7SA 3U4WA 3BQCA 5ACKA 4C36A 5EI8A 3G6GA 3E62A 4M15A 4A9SA 3TNWA 4JG8A 4UBAA 3ZRKA 3QRUA 4AT5A 1H0WA 3NNXA 1TQIA 3WOWA 2C6OA 2UW5A 3FY0A 4TT7A 4V0GA 5K4IA 2WQEA 3HDNA 4CKIA 3U51A 4MEDA 4I0RA 1OKYA 4BCMA 3IW6A 3A8WA 4BHNA 1NVSA 4R77A 3W0PA 3EH9A 1PXOA 4LMNA 3G2FA 2F7EE 2PZPA 3TCPA 4EK5A 3EJ1A 4YURA 5A4TA 3UZRA 4RJ8A 1J7IA 4FT9A 4M69B 3QTZA 4USEA 3KL8A 3BE9A 3LAUA 4IZ5A 4QMZA 4FV4A 4YJRA 4AS0A 5E7RA 3GEQA 4IB3A 1GNGA 4B8LA 4DINA 4FTQA 2X4ZA 4EHGA 5IDNA 3VQHA 4C37A 2XEYA 3ENHA 3I60A 3HDMA 5CXHA 3QCYA 4M84A 2JDTA 5GINE 4IX5A 3VW6A 5B2MA 4PP9A 3VJNA 4QQCA 3R22A 5FTGA 3RJCA 1VR2A 4AZFA 1W8CA 3CKXA 3EQBA 4FSWA 3QYWA 3U9CA 4QMUA 3G15A 4U94A 1OIUA 4O7PA 3LMHA 5HO8A 2RFSA 3GCPA 2GNFA 3P79A 4B6LA 2R2PA 4GFGA 3ATTA 4RIWB 5EHOA 5HLPA 1BL7A 2QOHA 4DGGA 5AAEA 5A9UA 3C13A 3Q3BA 3CXWA 2B9IA 1E1VA 3I6WA 3P86A 4HGEA 3A7HA 4FMQA 4YBJA 4QMLA 1ZYDA 2G2HA 3QQKA 2C6DA 2GS6A 2PSQA 3U6HA 3I7BA 3AC4A 3N4VA 2OW3A 2VUWA 2V55A 3NW7A 3PDTA 5ETCA 5C4LA 2IVSA 2FVDA 2WFYA 4RGJA 5DVRA 3QU0A 4I5MA 4EOMA 1H26A 4Q9ZA 5C8KA 1OPKA 3B8QA 1DAYA 4BB4A 5LQFA 4XOYA 3IECA 4ARKA 1FPUA 5HO7A 1LPUA 5J1VA 1A06A 2WMWA 3H9RA 3QZHA 3KK8A 5JQ5A 3DNEA 4Y46A 5TOZA 3C51A 3WE4A 4C34A 5HHWA 1YHVA 2PZYA 1PXNA 4DGOA 4HGSA 5M57A 3JPVA 5ANJA 1OIQA 2ITNA 4X21A 3U54A 2WMQA 2VO7A 5KMLA 3ZDUA 4P5ZA 5LVMA 1EH4A 3V5TA 4XLIA 4NIFB 1KE6A 5KKRB 4NKAA 2YAKA 5HQ0A 3QTSA 1JAMA 3C4WA 3JXWA 5KBRA 2YAAA 3KXMA 2X4FA 4EHVA 1YOLA 1I09A 2BTSA 3DGKA 4L3JA 5CNOA 2OIDA 5DA3A 3QA8A 1M2RA 3KRRA 5BMSA 2I7QA 3FMNA 1MRYA 4EJ7A 5IA4A 5T6KA 3OOGA 4CEGA 2WB8A 3NS9A 4QP7A 1YOJA 3R1SA 1MP8A 2I1MA 1DI8A 2QC6A 4YJUA 3K54A 4JDHA 1H01A 5AWMA 4WZYA 1G8SA 4YPDA 1O6YA 1QPCA 4I94A 1BLXA 4NKSA 4QMMA 4E5BA 5KMJA 5L2WA 4BZOA 4RLLA 2JIUA 4KBCA 5AUTA 1YWNA 3POZA 2V7AA 4H3QA 3E7VA 1O6LA 3PVGA 5ICPA 3Q4CA 4YC6A 2Z7RA 4DC2A 5HCXA 3SG8A 3IW4A 4I21A 4UY9A 4IVBA 3LCTA 5EW8A 3EQPA 5JN2A 4G5JA 4KABA 2W9FB 4UN0C 5FXSA 3MPAA 1R0PA 3ULIA 4D4RA 4D2SA 4MVFA 4PNIA 5IQEA 4FSYA 5M09A 2Z2WA 4E6CA 5CU2A 2A0CX 4W4WA 4O96A 1R0EA 3ELJA 4RMZA 5AV1A 4HPTE 4PDYA 4FTRA 2OXXA 3Q2MA 2J0IA 4I5CA 4R3RA 3VUIA 4Z7GA 5EYCA 4DGMA 3DXNA 1IAJA 4GKHA 4CKRA 4GT4A 4WNOA 3R8LA 4UXLA 2QOQA 3PFQA 2CDZA 3QQHA 2WOTA 4FG9A 2BKZA 2Y0AA 3A7FA 3EN4A 4FV1A 4GW8A 4R7HA 4F1TA 3LXKA 5DT4A 2V62A 5CEMA 3NNWA 4NU1A 2W5AA 4U3ZA 3IK3A 2CKEA 5FEDA 3FZOA 3ULZA 4JAIA 4RIXA 5IISA 5BMMA 2R3GA 4H39A 3P9JA 5HD7A 3RM7A 2JAMA 4DEIA 3UMWA 2C30A 3AGMA 5AP7A 3FV8A 4F0IA 3ZM4A 4M68A 4EQCA 5IQAA 3QUDA 3TUCA 4IEBA 4I41A 3EN5A 4JS8A 3HAMA 5KNJA 4F1MA 1XQZA 4IVDA 4HW7A 5F94A 2BRBA 4KNBA 4XLVA 4WUNA 1PMUA 2VWUA 3W55A 4E4NA 4FZFB 4QP2A 5KHWA 4AOTA 4ZZOA 1NW1A 4U40A 4YTFA 3SLSA 4ZTNA 4BCJA 5K4JA 4IQ6A 1YRPA 3VS7A 4B9DA 1VZOA 2C1AA 4XH6A 5A6NA 1NVQA 5I0BA 1ZYJA 3F61A 2F49A 4ORKA 4XJ0A 2JBOA 3HECA 3FMMA 3QWJA 2UZTA 3KREA 3QKKA 4X0MA 3V5PA 4FIJA 4GIHA 4FTMA 5TF9A 3VBQA 2XJ0A 3IGOA 2UW6A 3NUAA 1TQMA 4IW0A 4ALUA 4NJDA 4M8TA 4BCPA 2VTJA 3BHYA 4WHZA 4MXOA 4PV0A 5JSMA 3OG7A 3RPRA 1JKSA 3LQ8A 3NAYA 2FYSA 4YC3A 3ZC5A 5KMIA 1F0QA 5BYLA 2PU8A 4GSBA 2CGXA 4FVRA 4O86A 2GTMA 1WBWA 3P4KA 4EZ5A 2H6DA 3ANQA 2YM4A 5F1ZA 4FOBA 4BICA 2Q0NA 3FHIA 3VF8A 4BBFA 5EHYA 3DKFA 1UWHA 2ITWA 3F3VA 2HELA 5F20A 4FZ6A 3HV7A 5EFQA 4AT3A 3EQHA 2VNWA 3CTJA 3ORTA 3DKGA 2HW6A 4ACCA 3CPBA 1AGWA 1W82A 4NSTA 4MNEA 5EDQA 3C4EA 3I7CA 4ZSGA 3QL8A 1HCLA 3FQHA 2HY0A 3R0TA 3KCFA 4FZAB 3F3ZA 4IZAA 2OJIA 3V01A 3PPZA 2UW3A 3EFJA 3ODZX 4XV2A 1NVRA 2WGJA 1XJDA 2X2MA 5EM8A 5IA3A 3W0SA 1UNLA 2YCRA 1K3AA 2NNWB 3OUKA 5AFVA 5LVLA 5A46A 1ZYCA 1ZMVA 4R3PA 4JVGA 1ZMUA 5A3XA 3R9OA 4DCEA 2OJFE 3IW7A 2IZTA 5JMSA 5M4UA 2R64A 3FQSA 3O50A 4II5A 2G1TA 4OTFA 5LCJA 4AW0A 2VTRA 5LVPA 4BI0A 2QO2A 3EMGA 2PVLA 5EYMA 3LJ1A 3ETAA 2YIYA 4ITIA 5IEYA 3CCNA 3F5GA 4BDCA 4S30A 2J5FA 4DLIA 1JKTA 4BBMA 5KMOA 2O63A 4TTHB 1FINA 4RJ7A 3P08A 1UU7A 3LQ3A 4IVAA 1YDSE 2WD1A 4O0TA 4OBOA 4IB5A 4B8MA 2QURA 2FO0A 3H10A 4PMSA 5CF5A 5EYDA 2BVAA 5I9XA 2OF2A 3MH1A 3VUMA 3OWJA 4K18A 1BI7A 5CSHA 3QHRA 4JBPA 3D2KA 3HRCA 3BHHA 1GZKA 4XG8A 4EOSA 2YJRA 4O0YA 2PVHA 4FKRA 4CSVA 4F9AA 4IE9A 5L6PA 2I40A 5LARA 3UE4A 4N0SA 4NM3A 4YZ9A 3AT4A 3OHTA 1ZOEA 4FNZA 4J98A 2W1GA 2ZDTA 3VRYA 4EH6A 1OZ1A 4ZMFA 2W1DA 4WT6A 5GJGA 2VTTA 3RWQA 4I5PA 3PXFA 5CEQA 1AD5A 1GZ8A 2IG7A 3WBLA 2WTJA 3VHKA 4QPAA 4KS8A 3Q9YA 4M3QA 2XYUA 2R3IA 5IEVA 4R7BA 4CV9A 1H0VA 4IZ7A 3FL5A 2H8HA 4ACDA 3JVRA 5GJDA 4CTCA 5KBQA 1CDKA 2X81A 4CTBA 3WF7A 1Q24A 4Y95A 5HE3A 3ZUUA 3IQ7A 5HBEA 1OIRA 1PXMA 2A27A 2C3IB 4RZWA 2WTDA 3BBTB 4G6OA 4WG3A 2PZIA 3DA6A 3F66A 4QP9A 4D4SA 4B99A 3FHRA 4MQ2A 2PMIA 3NDMA 5A4CA 2RFNA 3SGCA 2QLUA 4BDDA 1REKA 3QQJA 1M14A 5HI2A 1GZOA 1GOLA 4I4EA 2R3RA 3O17A 3QCSA 5TT7A 4I0TA 3V51A 2HAKA 4ACHA 1FMKA 1Y91A 5HICA 3MFUA 3AC5A 4MF1A 4TRLA 3UGCA 3I4BA 3SW4A 3ERKA 2YA9A 3ZONA 4C4HA 3W2OA 2I6LA 3R02A 4GMYA 4LG4A 1NY3A 2FSOX 3E88A 3ID6C 4CFWA 3RTPA 2OJGA 3HLLA 5BVEA 5FXRA 4L46A 2YWPA 4ONAA 4LUDA 5IUIA 3L9MA 4MXXA 4DLJA 3QD3A 4YSJA 5FEEA 2ZMCA 2XCKA 4ZZMA 3SOAA 4QRCA 3R28A 3W0QA 5IUHA 4X2GA 3BCEA 3OXZA 1WBPA 3DBFA 5JH6A 4EH5A 4ASZA 2ETMA 3NUUA 3HV3A 3DTWA 5AAFA 4EOOA 4H1JA 2W96B 2JKQA 4EHEA 1Y6AA 3UIUA 3R2YA 2XK8A 4OT6A 4NL0A 4DH8A 3EYGA 5FBNC 5J7HA 3AC3A 1VYWA 3VS4A 2UZLA 3FWQA 2JIVA 4J8NA 4AGDA 3W33A 4O7RA 2UZVA 5EQEA 3VULA 1H27A 3G90X 3PPJA 1GIJA 3VVHA 5CAVA 4BY9E 3ZLYA 5CF8A 5E92A 3L8VA 4IMYA 2ZB0A 3DDQA 4CLIA 5KMKA 4X2NA 4YZNA 2C0OA 1OL5A 4TWPA 2RIOA 1UA2A 4C4JA 5K5NA 3O2MA 3PSDA 1STCE 2EUFB 2A4LA 2ESMA 2X7OA 3O7LB 4X7QA 3AXWA 2B4SB 2GCDA 1IRKA 1OL6A 3F69A 5JGAA 5C01A 4IC7A 3L1SA 4KWPA 2YABA 3REPA 2QQ7A 3HL7A 3QD4A 5FLFA 3FI4A 5FXQA 4EK8A 4YNOA 1Z5MA 4AW5A 2LAVA 4YJSA 3E92A 2IO6A 4QP3A 3MDYA 2CKQA 1YXUA 3F5PA 4V0GB 3W0OA 3GC7A 4KSPA 5J9LA 4E5WA 2XYNA 1APME 3W2CA 2ERKA 1WBVA 4D9UA 3R9NA 3HUCA 1F5QA 2XM8A 4FKLA 3TG1A 2HZ0A 5H8EA 5JFXA 4W8EA 5JGBA 3GCUA 4HNIA 1U59A 4J96A 4RBLA 3K5VA 4FG7A 5IF1A 3UQFA 4GT5A 4FZDB 3Q5ZA 3NUPA 4KRCA 1CKIA 5A14A 2IN6A 3F3WA 4EH9A 4JOAA 5HLNA 3LHJA 1VEBA 4IIRA 4RJ4A 4CXAA 3RZBA 3ZUVA 1H25A 5AIRA 3KY2A 4JL9A 1Y57A 1NA7A 4TXCA 4F0FA 4HZSA 5KHXA 2YM3A 3E93A 3MA3A 2DS1A 1LR4A 5M4IA 4E4XA 4YPSA 2VGOA 4IM3A 3RI1A 4U8ZA 3EHAA 5H2UA 3WZKA 2JGZA 3T9TA 4BCOA 3QF9A 1UU8A 4BHZA 4E8AA 2YIWA 1B39A 4RRVA 2OF4A 2GNIA 3SHEA 3D15A 1YQJA 4M97A 4IACA 1U54A 3R21A 3EWHA 3VHEA 2ZAZA 1JSTA 5CU4A 4U42A 3DZQA 4XYFA 5H3QA 5M56A 4E93A 3DY7A 4ASDA 3PG3A 5A4QA 3LFNA 3AMYA 3QQGA 2PUNA 5BUEA 2C3LA 2AC3A 2J90A 2W4JA 3H0YA 3QQFA 3UPZA 3LXPA 5ITAA 2OH0E 1WBNA 1YOMA 4L01A 2V22A 2C47A 4C0TA 4BR3A 4R5SA 2QOKA 3FZSA 4IC8A 3F9NA 5CF6A 3MFSA 4RX5A 5EI2A 5EW9A 3TKUA 5IQGA 3R7EA 3UVPA 4FK3A 3F3TA 3KN5A 1XHAA 3FL4A 2O5KA 4B0GA 3T3VA 2CSNA 2OIBA 3Q4TA 4JT3A 3DLZA 5M07A 3QLGA 4HVGA 4N6ZA 5DR9A 1PXPA 3R8MA 3EL7A 4FKSA 3GOKA 5JKGA 1BI8A 3HNGA 3NUYA 3A4PA 2E9VA 2NRYA 3LCDA 4KD1A 3TV6A 4DEEA 1XH6A 3LXNA 1PYXA 2ITYA 3FPMA 3TZMA 5IH6A 1CTPE 5ETAA 4D4YA 5IH4A 2C6KA 4FYOA 3TNPC 2QKWB 4D0WA 4ZLOA 4PL5A 4QMXA 1OBDA 3RAHA 2ACXA 4EI4A 2HK5A 4IVCA 4R7IA 4LL5A 3PIYA 4C02A 3LOKA 2XH5A 2VTAA 4EL9A 3DT1A 4NTSA 4O27B 3F2NA 5EYKA 3BIZA 4USDA 3ZOSA 4E6AA 5HNBA 4F0GA 2R3MA 3MN3A 3RAWA 4AACA 2E9NA 2ZB1A 3GQIA 4AU8A 3IDCA 1FVRA 3SOCA 5CAUA 3FLWA 1TVOA 3NYXA 3SXSA 3MV5A 1ZOGA 2OH4A 1ZARA 2BROA 4HVSA 4BTJA 4X3FA 1BKXA 4FBXA 5I9WA 4FSUA 4C4FA 3P7BA 2PUPA 5FP5A 4O7NA 4FNWA 4WBBB 4RFZA 3SX9A 4LRMA 1XWSA 5IZFA 4PRJA 3D7ZA 3OD6X 2EXMA 5IQFA 4FTCA 5DYJA 3BRBA 3AC2A 5FTQA 3NUXA 3UIXA 5HNIX 4RC3A 4I20A 3QZIA 3EKKA 2XNBA 3QWKA 2O0UA 4S34A 2G2FA 3BGZA 4NW6A 3W18A 3ZHPC 4CV8A 4CFXA 4C4GA 3HMPA 3RGFA 3UIBA 4FK6A 3W16A 3CGFA 2BAQA 4I0SA 4BZNA 4FEQA 1ZLTA 4I6BA 3FYKX 3FZ1A 5E1SA 4NM0A 5JT2A 4O7WA 4UWBA 4DITA 3LW0A 5JFSA 1H08A 2B1PA 2CN8A 2PE2A 4RIXB 3UVQA 3V3VA 4YTHA 3W0MA 4FTLA 3EOCA 3COMA 3GB2A 3NX8A 3Q9XA 4IDVA 4J8MA 3BI6A 1YXTA 5C27A 4B7TA 4NCTA 3LLTA 3PRIA 2OFVA 3RPVA 1JBPE 4FV3A 1VJYA 3V5WA 4KSQA 3VBXA 2GMXA 5AX9A 2Q83A 3MVLA 1YWVA 3BE2A 3CD3A 3QRTA 5D41A 2FA2A 2VO6A 2GTNA 2CN5A 2CLXA 2R3FA 5A54A 1WBTA 4RA5A 5JFWA 2JD5A 2WIPA 1Q5KA 2QOBA 3IPHA 2QCSA 5CENA 3I0OA 2UVYA 1Y8GA 3BU5A 4EC9A 3RWPA 3KXZA 1OI9A 3TJCA 4K33A 1PMEA 3TZ9A 4GRBA 4LM5A 3AT2A 1P2AA 1V0BA 2IZUA 4LGHA 4LOOA 3HKOA 2VV9A 4QYGA 2CLQA 3GVUA 2VN9A 4ANQA 3OEFX 5GNKA 5CXZA 2Y4IC 4FIFA 4F6WA 3SQQA 4E1ZA 3R30A 3TACA 4ERWA 5FDPA 3PJ8A 3ZDIA 3ET7A 4YJOA 3TDWA 4C61A 3R6XA 5DLSA 4O6EA 5J8IA 4M7IA 3VIDA 4D1XA 2VTNA 3MS9A 4HYHA 3EQGA 3M42A 4IB0A 4MX9A 3UO6A 4U44A 2VX1A 4DH7A 3FLNC 2GNJA 2Z7QA 4U3YA 3HV5A 5DT3A 3Q9ZA 2W1ZA 4L6QA 4XV3A 4EH4A 4M13A 5J95A 4NYEA 1MRVA 3QC9A 2F7ZE 1WFCA 1ZMWA 3FKNA 4MYGA 2W5BA 3V5QA 2R7BA 5E8XA 3ZEPA 4KIPA 2RF9A 2HOGA 2Z60A 1FGIA 4U98A 2H34A 2HXLA 2QOOA 3OF0A 2YZLA 3QRKA 4IAYA 4W8DA 5FGKA 1PHKA 3WZDA 4BI2A 2UW0A 3P1AA 2B54A 2XNPA 3BEGA 2J51A 3RAKA 3OT8A 2W1CA 3KRXA 2DQ7X 4M14A 3DOGA 5CS6A 4QMYA 3WIKA 3FE3A 1H00A 3RCDA 2C0IA 2GHMA 4LI5A 5CWZA 3NCZA 3T8OA 3VUDA 3WE8A 4DEBA 4BDKA 5E90A 3FZPA 3FQEA 3D14A 4D4VA 1OGUA 2A19B 3LJ0A 5AEPA 3S0OA 4D1ZA 1Z9XA 4H05A 3AT3A 5KZ0A 1VYZA 3K5UA 2BMCA 4JXFA 5HG9A 3R7OA 2I0HA 2X6DA 3FLYA 4ZY5A 2IW9A 5AP4A 4ZTHA 2C5NA 3SD0A 1P4OA 4CRSA 4JR7A 4AN2A 3IONA 3QTIA 2B52A 2WXVA 3FLZA 3A7JA 3OUNB 4HCUA 3ZS5A 1T46A 4I6QA 4DCAA 2FSMX 4X2JA 2BIKB 5DG5A 3NW6A 2SRCA 1P5EA 1WVXA 2WMRA 3BZ3A 5EDRA 4TZRA 4Z3VA 4WIHA 4RJ6A 2XK7A 2J6MA 1G3NA 2XNOA 3BKBA 4FKIA 4KB8A 4XMOA 2EWAA 4QNYA 5FEQA 2QOFA 2BIYA 4RC4A 5CLPA 3AD6A 3W2RA 4Z16A 3UO4A 3QQUA 4RVTA 2BHHA 4TYHA 4FC0A 4RX9A 3QGWA 2CGVA 2HCKA 3DQXA 3FI8A 3P5KA 5HIEA 3E3BX 3WF6A 3KMWA 2PUUA 3NSZA 1OIYA 5CF4A 3FJQE 4XEYA 1BYGA 2BILB 4U97A 4N4SA 4W4XA 2XMYA 4K1BA 3QAME 4RWJA 2Y8OA 4YSMA 2J0LA 4BCFA 5HD4A 1YVJA 4V01A 5E8SA 2XK6A 4TWCA 4ANSA 4E20A 2YERA 3I0QA 1OMWA 4DAWA 4F9CA 5LMKC 2VWBA 1XBCA 3CQEA 4XG3A 2YWVA 4BGQA 4A4XA 3QUPA 5F4NA 2HXQA 3SV0A 2W05A 2QKRA 1ZZ2A 4XRLA 4F09A 2OXYA 2WIHA 3DPKA 4L8MA 2HYYA 4F7SA 3R1NA 3TV7A 5A4LA 3F7ZA 1WMKA 3CSVA 3BHUA 4HYUA 2VO0A 4I92A 3QD0A 3G6HA 2PHKA 2X2KA 4JJRA 3ODYX 4QP6A 3V6RA 2ETRA 4YJNA 2WQMA 2B55A 2BTRA 1M7QA 3CR0A 1NXKA 2OK1A 4GEOA 5EKNA 4BCGA 2CCHA 1IA9A 2J0KA 3TNIA 4BDJA 2C68A 1Q8TA 4PUZA 4C3PA 4EC8A 4ZMEA 4MKCA 4N57A 2R3KA 1UU3A 4XV1A 4O7TA 5ANOA 3VAPA 3QTUA 5K3YA 3ZFYA 4EK6A 5BVFA 4PL4A 4UWYA 2BDFA 4DEHA 2QR7A 2WTKB 4DH5A 5AA9A 3BYSA 2BZIB 1Q99A 1QPJA 2ZJWA 5KKRC 3MESA 3UNZA 2BRMA 3MBLA 1KOBA 3ROYA 5T68A 2HW7A 4IWOA 3DFCB 4YMJA 1ZAOA 4PDOA 2J5EA 3VUHA 3OEZA 5KCVA 3A4OX 4LOQA 2BFXA 2PY3A 4YJTA 5LWNA 4RWIA 2VX3A 3VS0A 3QLFA 3NRMA 3MFTA 4LV5A 1QCFA 5D1JA 4F7NA 1ZWSA 3LFQA 1PMVA 3BYOA 4RFMA 4S32A 1WVWA 4DFYA 3LCSA 2VD5A 4U6RA 4UWCA 4UALA 3HA6A 4WKQA 3L9PA 1YXXA 4AGCA 2R0IA 2XS0A 1YDRE 3B2TA 2FGIA 3GQLA 3O0GA 4ACGA 3OY1A 3BLHA 3NPCA 4QTBA 2PPQA 1M2PA 1R1WA 4I6HA 3R9RA 4DTAA 5G1XA 5HG7A 3CBLA 2H96A 2YCQA 5CI6A 4EBVA 4D9TA 1IA8A 1Q8UA 1MUOA 4RT7A 3R83A 3FXXA 4RVKA 3WF8A 4WG5A 2WMAA 4A4OA 2ZV8A 4ZLZA 5M06A 4FNYA 4IFCA 4RVLA 5FRIA 4EH3A 5L6OA 4Q5HA 3UPXA 2BPMA 1GIHA 1ZY5A 3EN6A 3PPKA 3E87A 4I5HA 3L9LA 3DCVA 2PVMA 4FKGA 1S9JA 3ZCLA 5B2LA 4F99A 5HX6A 1W84A 4E5AX 2W4OA 1UNHA 4JNWA 2XK4A 1IR3A 2XNNA 5L6WL 4EJNA 1KWPA 2OXDA 3D9VA 3PWDA 4MD7E 4I24A 3FUPA 5LVOA 2WHBA 4DBNA 1YXSA 2ONLC 1MRUA 4FV8A 5AP1A 3WIGA 5FBOA 4QMVA 4MAOA 4AN9A 4EQMA 4V04A 3V5LA 2RFDA 3KQ7A 4GT3A 3QTRA 3QYZA 4FSNA 4J1RA 3W0RA 3Q53A 5FG8A 4O7ZA 2XUUA 1KE8A 3RHXA 3MA6A 2WMTA 1V0OA 5AV3A 3DU8A 3FMDA 3COKA 3Q96A 2YZAA 5K9IA 3PA3A 4IWQA 4DFXE 3ORKA 2WNTA 4ZSLA 5CAPA 3ATSA 3CJGA 3O96A 3P0MA 1GIIA 3QRJA 1KV2A 5HKMA 3GP0A 2V0DA 3GC8A 3QXOA 4O81A 5E8YA 5CVGA 4O7OA 5ACBC 5DHJA 3OBGA 2YN8A 4C4EA 4FV6A 2GNGA 3NVKI 2VAGA 4FL3A 3JUHA 4A9TA 3LFCA 3ORZA 3VS6A 3MY1A 3BQRA 4KBAA 2XVDA 2C6EA
chains in the Genus database with same CATH superfamily
1HOWA 4K11A 5CANA 1Z57A 2WQNA 2GNHA 4ZS0A 1DS5A 2J9MA 2RGPA 5LVNA 1PXJA 2UVXA 1CKJA 4BCNA 4CMOA 4YHTA 1U54B 2YACA 3MVMA 3NVMB 3OROA 1REJA 3PE2A 2R3HA 5DFPA 3DAEA 3R7VA 3R9DA 4JDKA 5HZNA 4KIOA 2DUVA 4IX3A 3VBVA 2ETKA 5L2IA 2W1IA 3GCVA 3QZFA 3W8QA 4DA5A 2W1HA 3NIEA 2UW7A 1W7HA 1U46A 3OW4A 3W1FA 4QNAA 4FEXA 3HZTA 1WBSA 2WAJA 2XEZA 4FT5A 1WCCA 1M17A 3H0ZA 3DKOA 5AP0A 2WELA 4ZOGA 3S2PA 3VN9A 4EK4A 3DTCA 4FVQA 4F6SA 1RJBA 3QUEA 5BNJA 4H58A 2VTLA 2F4JA 3I79A 1UWJA 1GY3A 3C1XA 4E73A 3G33A 4GG7A 3ZU7A 3LFBA 4F70A 2HZ4A 2JFLA 4O0RA 4O82A 2KULA 2OZAA 5EOLA 2UV2A 3DBQA 4ASEA 4Z9LA 3TEIA 4AX8A 4DYMA 3HP5A 1SZMA 4RSSA 4NM5A 5JRSA 3M11A 4QOXA 3UOKA 5HU9A 3UIMA 4HCTA 4XG9A 4ALWA 1SYKA 2WOUA 5HNGA 5IA0A 3FEGA 3OOMA 3DBCA 3SVVA 4MQ1A 4ZIMA 1XKKA 4G1WA 3OCGA 4DGLC 3D0EA 4GYIA 3LFEA 4LV7A 4X3FB 5CVHA 5HBHA 5B7VA 3PRFA 4LUEA 5IMEA 4A7CA 4IAAA 1OL2A 3BEAA 4GVJA 2WPAA 4GU9A 1Y8YA 5EHLA 4F4PA 1BL6A 2P2HA 3A7GA 3LLAA 3ZZWA 2VO3A 2FSTX 5HVKA 4AFJA 4FKWA 4DBXA 5LMKA 4NFMA 3ZBFA 2XJ1A 1P4FA 2O3PA 5B0XA 4GVAA 3S3IA 3JY9A 4JBQA 2XNGA 2R5TA 4M67A 3HV4A 3H4JA 3MH0A 3F7WA 2W06A 5IQIA 1Q61A 2QNJA 4HZRA 4AXAA 5G6VA 2B0QA 3ZLXA 3U87A 4H3PA 4C58A 3KXGA 2XIZA 4LOPA 4P7EA 4L00A 4QMOA 4Y85A 4AF3A 4FEVA 1YHWA 4XUFA 2P4IA 2YDKA 3PZEA 2VNYA 4CT1A 3CPCA 4L44A 2JAVA 3T9IA 3VF9A 3PSCA 3QFVA 1Q97A 4XP0A 5M55A 3GU5A 3LFSA 4TPTA 3NFGB 4ZSAA 2DYLA 3AMAA 3I6UA 4NZWB 4J97A 3RM6A 4BYJA 3OCBA 3C5IA 2JEDA 3RPOA 3DXPA 4GJ3A 4L43A 5IA5A 4OTQA 3OZ6A 5EK7A 4F1OA 4EZ3A 2WTVA 1GJOA 3U4UA 2EB3A 4IHPA 4I6FA 3Q4ZA 4DEAA 3HMNA 3MB6A 3L9NA 2OZOA 4FV9A 3TNQB 5M4FA 2X39A 3VO3A 4WSYA 5CU3A 4AZTA 3EZRA 3UP2A 2XIRA 5GHVA 3WF9A 3ORNA 2C6TA 1WAKA 3NYOA 4K9YA 4QTDA 4TYEA 2B9FA 4APCA 3ALOA 3D7TB 3I1AA 3CQWA 4PP7A 4ZAUA 2VX0A 4NK9A 4TYGA 4R3CA 3LQ5A 3MJ1A 5HIDA 5HLWA 1BMKA 2XRWA 4IM0A 1H1PA 3V6SA 3UQCA 2UZUE 3C5UA 4AW1A 3MY5A 3TTJA 4JIAA 4X6QC 5CZHA 1W98A 2UUEA 2YDIA 2C5XA 4XNEA 4F78A 5JRQA 2VTMA 1FVVA 2BZHB 4FX3A 3IKAA 2GQSA 4QTAA 3NYNA 3HYHA 3PJ2A 4Z55A 2BDWA 2PVFA 4FSQA 1YI3A 3DXQA 2WO6A 3KFAA 4GIIA 3EQCA 4JI9A 3PIZA 5BYYA 3UZPA 5BVOA 5DRDA 2OSCA 3MJ2A 1J91A 4G9CA 2BR1A 2JC6A 3M2WA 4O22A 5CZIA 4BDFA 4OGRA 4ITJA 4YLJA 2F2UA 3OTUA 1DAWA 1H07A 3LMGA 2R4BA 4U80A 3O8PA 5IQBA 5C26A 3ORMA 5DBXA 2WMBA 3OWKA 3PSBA 4ZS4A 4UZHA 4XRJA 5HESA 4JRNA 3UZTA 4GKIA 4LL0A 1Q3DA 1GZNA 4G6LA 3DZOA 4FA2A 2F7XE 1Q41A 3BELA 3F2AA 4CMUA 4AP7A 3G9NA 4P5QA 3PJ3A 2W1EA 3T3UA 3N51A 3VW8A 3C4CA 5LXMA 1J1CA 4MHAA 4D5KA 2X1NA 3FMJA 3MVJA 4GU6A 4PL3A 5I9ZA 3GGFA 3RNIA 4U45A 3LFAA 3ORXA 3QTWA 5FDXA 3RAIA 4CCBA 4YUQA 3MTFA 1CMKE 2VTOA 3EYHA 3H3CA 1OPLA 3WZUA 5CVFA 4GK3A 1O6KA 5CI7A 3LFDA 3UDBA 5EH0A 4MD9E 2ITVA 3W8LA 2IVUA 1BX6A 2R3QA 1PKGA 2XCHA 5EM6A 2HZNA 3DJ6A 3NNVA 3E3PA 3O8UA 4FGRA 4E6DA 2JDSA 4U5JA 1Q62A 3Q9WA 2WMVA 3ZM9A 5CSWA 4HNFA 2XJ2A 5IQHA 4A07A 3NCGA 3ZTXA 4AXFA 3AC8A 2PZRA 2QODA 2R7IA 4Y73A 4BCIA 2J4ZA 3SRVA 3MVHA 3QKLA 4E4MA 4PMPA 3CTQA 3IOPA 4JG6A 4LFIA 1WBOA 3AMBA 1UKIA 4YNEA 2X7FA 5AV4A 3GC0A 3I81A 3E5AA 3O71A 2QD9A 2A1AB 2QO7A 4N70A 5FUTA 1Q8WA 4IAKA 3IDBA 3K2LA 3PY0A 4NJ3A 4QMSA 3ZO3A 3KK9A 2OJJA 2P3GX 3ZSGA 2W9ZB 3V04A 2O2UA 3KB7A 2O65A 3C4ZA 4R1YA 3DAJA 4TYHB 4K8AA 3W2SA 3P7AA 3OW3A 4G5PA 3FZTA 4U43A 1XH4A 5ANGA 5HX8A 1IAHA 3ORPA 4AW2A 2VTQA 3VC4A 3NYVA 3JS2A 1JLUE 3D83A 1U5RA 5L2SA 2PTKA 4AAYA 2VTIA 3A61A 4YZMA 4EBWA 2W5HA 3RVGA 4PDPA 2BFYA 3QQLA 4DHIB 4GUBA 2GU8A 1SMHA 2YEXA 4JR3A 4E7WA 3GC9A 4FV0A 4IWDA 2JITA 2B53A 4FR4A 2OI4X 5E9EA 4GG5A 5BUIA 4PQNA 3UODA 4X6RA 4BGGA 4R6VA 4BI1A 3BU6A 1OM1A 3FY2A 5E4HA 3VS3A 1J7UA 2UZOA 5AUWA 4GL9A 3FKOA 1U4DA 4BTFA 4EOIA 4BDBA 3UQGA 3QGYA 2QLQA 2VGPA 4PX6A 3E8CA 2VWYA 5KO1A 2IVTA 3GI3A 4FKPA 4WOVA 5DGZA 4BF2A 1PJKA 1ZRZA 2BDJA 3GFEA 3FLSA 4W4YA 2JIIA 4X2FA 5AX3A 4BC6A 2X7GA 1ATPE 4C33A 5J5SA 5CYIA 3Q32A 4ZTLA 2G2IA 4TY1A 4ENXA 3LCOA 1B38A 3OCSA 2PL0A 3PZHA 2YM6A 2C6IA 3PVUA 4CLJA 3UO5A 3U8WA 4KKEA 4FTKA 4KAOA 2ITPA 4MK0A 5CU0A 3DKCA 4L3PA 5ANEA 4YTCA 4QPSA 4BBEA 3UC3A 5I5ZA 4JRVA 5HU3A 2QVSE 4FG8A 5CT0A 4CQEA 4EH7A 5CEOA 3TIZA 5IDPA 2PULA 3FMLA 4S33A 1URCA 2J2IB 5C1QB 5FM3A 3C0IA 2GDOA 4QMWA 5DE2A 2YM5A 1YI6A 5CSVA 3ZXZA 4A4LA 4AA0A 3MB7A 3A8XA 2CMWA 2R3PA 4QTCA 3MPMA 2YCSA 2XAMA 1DI9A 1OL1A 3COIA 2WMXA 1YKRA 2ZMDA 3TDVA 3HA8A 4ZSJA 4FODA 2J0MB 3GU4A 4YHFA 1RE8A 4AQCA 3UC4A 2XBJA 4O7LA 5IH5A 4CG9A 4ERKA 3AD5A 5HBJA 5AM6A 5DRBA 4FOCA 3RK7A 5K5XA 2VZ6A 3ZRLA 4FIEA 1XMMA 4JBVA 4JLCA 3LCKA 2VU3A 3BGQA 3MH3A 3BYMA 4KIQA 4IADA 2FSLX 3D5UA 5EM7A 2FB8A 4IAZA 5M53A 2NPQA 3L8PA 3HRBA 5GIPE 2J0JA 1L3RE 4NUSA 4ZJJA 4IJ9A 3MYGA 4H36A 2NRUA 3E8NA 3NR9A 2YISA 4QT1A 5CNNA 1JOWB 3BHVA 4OTWA 5DEWA 2ITUA 4D2RA 4E4LA 3VS5A 4M0ZA 4C62A 4DH1A 2CPKE 4IH8A 4WNKA 2X2LA 3KMUA 1FQ1B 1PKDA 3KF4A 4XP3A 2YIXA 4YHJA 3MWUA 4RJ3A 2B9JA 3PP1A 4G9RA 4WD5A 1H8FA 3A2CA 3NAXA 4G6NA 3EB0A 2QOLA 3PTGA 2JDRA 5HTBA 3QRIA 4OTRA 4ZTQA 5CT7A 5M4CA 3C4FA 3PUFC 4X2KA 2CJMA 5JFVA 2EU9A 4FSZA 3TUDA 5CAQA 3QCQA 3ZEWA 2C69A 1KV1A 3B8RA 4ALVA 2GFCA 3VS1A 3TWJA 3R7YA 1J3HA 2E9UA 4PTEA 2ZOQA 2QI8A 2JKKA 4G17A 2CKPA 4BTKA 3WI6A 2O8YA 5C8MA 3FMEA 4EWQA 4U7ZA 4BDGA 2VWVA 1PW2A 3CJFA 4O0XA 4Y5QA 4F9YA 5LWMA 3Q52A 3IO7A 4XG4A 4I4FA 3AG9A 1KE5A 4TNBA 1G8KA 1UKHA 3UP7A 4FICA 3JR1A 4R78A 4YP8A 4P4CA 4C3FA 4O0SA 3R00A 1PYEA 3RCJA 4R5YA 3ZXTA 4BCQA 4D0XA 5A4EA 4GK4A 2Z7SA 2XKFA 4WG4A 4EYJA 4WUAA 4WA9A 4XBRA 5IMXA 4G3EA 3BHTA 2YJSA 3U55A 3ZLWA 5H8GA 3MPTA 3ROCA 3R7IA 3KKVA 4GV1A 4ZZNA 4EKLA 3PXQA 4EUUA 4G2FA 3ZUTA 4O91A 2REIA 4YJPA 4CNHA 3I5NA 3OT3A 3W32A 3BLQA 1XO2B 3R01A 1YDTE 2G01A 3IG7A 3HX4A 2C6LA 3WYXA 4RQKA 3KC3A 2ZDUA 4FV7A 4ANBA 3UMXA 4QMPA 1K9AA 2JKMA 2CHLA 4EOKA 3DK6A 2RL5A 4XX9A 3RALA 2ZM3A 4G31A 3THBA 4QMQA 5DR2A 4K6ZA 4AFEA 5AAGA 4R1VA 3TN8A 1UVRA 2PWLA 2F9GA 2X6EA 2Y4PA 4RQVA 1OB3A 5DH3A 2BKKA 5AP5A 4CMTA 2Q0BA 4MNEB 2XBAA 4GYGA 3EIDA 4JIKA 5F9EA 3TXOA 3PYYA 2A2AA 2GS7A 5AA8A 4KS7A 5BVNA 2CGWA 1ZZLA 3KU2A 3PA4A 3UTOA 1OL7A 3FKLA 4O0WA 2GSFA 3WF5A 3FBVA 1XH5A 5J9ZA 4CFFA 1O9UA 3KIOC 4YU2A 4C3RA 5M08A 4JAJA 4LMUA 3BPRA 3POOA 4C35A 4XP2A 3OXIA 2HENA 2OZAB 3NWWA 4P2KA 4ZXTA 4O6LA 5HIBA 3TNHA 4RIYA 1WVYA 4L45A 4BRXA 2G15A 3ITZA 1QPEA 3Q60A 2W17A 2H9VA 4I1ZA 4H3BA 3MIAA 3G0FA 4FT3A 4FL2A 1OUYA 2BAKA 3EN7A 4PNKA 5KMNA 2XM9A 4NM7A 4QMNA 3IW5A 4IWPA 5AMNA 4HVDA 4TN6A 2XK9A 1RDQE 2V7OA 3N4TA 3CE3A 3OMVA 4L53A 4BDHA 1LP4A 4AGUA 1XR1A 1Q3WA 2EXCX 3ZSHA 4AE9A 3ZYAA 2PUIA 2VWZA 1U5QA 2OJ9A 2RFEA 5BVWA 3TIYA 4IBMA 5IPJA 2X8DA 3PXZA 3PLAE 5DEYA 4C2WA 3PXRA 3E8EA 3KA0A 2OO8X 5AUYA 5IQCA 3NIZA 4E6QA 1SVGA 3ZC6A 3UNKA 2HWOA 3QBNA 5AP3A 5LMAA 4KKGA 4BKJA 3MTLA 4F08A 3OS3A 4KUJA 2YHVA 4RPVA 4BDIA 4I93A 4YGAA 4MXZA 5E91A 4BCHA 4FYNA 3PIXA 4ANLA 5CQUA 1MQ4A 3KF7A 3NZ0A 5CSPA 2LGCA 2XNEA 2YM8A 3HUBA 2CGUA 4D55A 4A9UA 4BN1A 3LZBA 1A9UA 3WZEA 5I9VA 3TT0A 3BU3A 2GQRA 3U9NA 4LDTA 4Y5HA 5F95A 1QL6A 3HAVA 3QALE 3BGPA 5FD2A 4APPA 3UNJA 4UYAA 5EI6A 4CFUA 4YO6A 2ITOA 5D9HA 1TFFA 1M7NA 4PDSA 4D58A 5AUZA 2B7AA 2VTSA 2CNUA 3C4XA 4HJOA 4ZLYA 4UEUA 4QO9A 5JZJA 2W0JA 2UZDA 1R78A 3BBWA 4FSTA 4Q2AA 4QDVA 4IAIA 3NUNA 4FTOA 3V8TA 4I3ZA 1PF8A 2IW6A 4LGGA 4TW9A 4UYNA 4WRSA 2C1BA 3NGAA 3AGLA 2OFUA 4MXCA 3WILA 2QONA 3EFWA 2ZV9A 3W2PA 2DWBA 2CCIA 4JQ8A 1TKIA 1H24A 3CD8A 2C3KA 2IZRA 3UBDA 4RIOA 1OECA 3MFRA 2QHNA 4ZY6A 3QA0A 2XZSA 2QU6A 4BIEA 3EZVA 3GU8A 2BZKB 4HGLA 3RPYA 2OWBA 2KTYA 3HMIA 3PUPA 3EL8A 5BVDA 1OUKA 3PVBA 4O0UA 3QTQA 5IUGA 2X9FA 2JFMA 2WTKC 3E63A 4IX6A 4DG2E 4EK3A 3GU6A 3DLSA 3EKNA 2GQGA 3FPQA 2W99B 4QYHA 4FL1A 3QTXA 3O23A 4DTKA 5KUPA 3BX5A 4EHZA 3VBTA 2OLCA 5D12A 3KVXA 3CLYA 1ZYSA 4XHKB 5AIKA 3FLQA 4OR5A 4FIGA 4DFZE 4TWNA 4G3GA 2PMNX 3D5VA 3Q5IA 4GH2A 4USFA 4DN5A 3LMIA 2RG5A 3VONA 4HCVA 4EOPA 4O7YA 1XBAA 2C3JA 3NW5A 4CFVA 5L8KA 4QDEA 4MH7A 1QMZA 3K3JA 4ID7A 2V5QA 2PE1A 3DNDA 2OIQA 4EH8A 4TYJA 2ZVAA 1PXIA 4MBIA 4ZK5A 2IWIA 3AOXA 4HYSA 5GIOE 4C7TA 2JBPA 3ZRMA 5CALA 4DGNA 1W83A 4XG2A 4AGWA 3RKBA 5M51A 2XIKA 3IW8A 4L7SA 5ANIA 5ANKA 4FSRA 2XB7A 5HG8A 4DDIA 3BV3A 2WTWA 3HRFA 4XOZA 2XP2A 3SC1A 1B6CB 4WRGA 5EQYA 3EN9A 3UVRA 5IA2A 2Y7JA 4MXAA 3R7OA 1JPAA 1KSWA 4UZDA 1H1QA 1ZXEA 2C5YA 4WNPA 5EM5A 4BDAA 1F3MC 4FT0A 3AC1A 3BWJA 3S1HA 4KINA 1FVTA 4FKJA 3FDNA 4FKVA 3LXLA 3VUGA 3TZ8A 1P14A 3UDZA 2QU5A 4HVIA 3FAAA 4X3JA 3R1YA 3TJDA 3GFWA 5ETFA 3HV6A 2IJMA 4JQEA 3F5XA 1ND4A 3DV3A 4PMMA 2CNQA 2UW8A 4F7LA 2W1FA 5IU2A 4M12A 3BYUA 5L8JA 3EFKA 3P23A 4HGTA 1H1SA 2HWPA 3PJCA 1RW8A 4HYIA 4PTCA 3SRVB 3A7IA 4XS2A 3FYJX 3C7QA 4N6YA 4V05A 1G5SA 1Q4LA 3OP5A 2J50A 4RC2A 3RP9A 2HZIA 3KEXA 4ZP5A 3ZH8A 4FUYA 5FM2A 4ZEGA 4QYYA 4I22A 1XH7A 4FGBA 3NLBA 5DI1A 3TTIA 5HTCA 3KXHA 3OFMA 3DBEA 1WZYA 3IDPA 2I0EA 4FKTA 4K77A 4S31A 2W7XA 2QG7A 4DFNA 2PE0A 1A48A 5DT0A 4ZSEA 3CC6A 5TKDA 3DBDA 3JVSA 3Q04A 4MTAA 4O0VA 5DWRA 2YIRA 5AP6A 3UOHA 1LEZA 3HGKA 4F9BA 3KCKA 3M1SA 4YLLA 1H1RA 2HIWA 3R8ZA 4GK2A 4OTIA 4B4LA 3KRLA 3AKKA 4YJVA 3KULA 4ZY4A 3CQUA 4AN3A 3ORIA 4ZJVA 3D94A 3KN6A 4HPUE 4J99A 2BALA 3PY3A 2WZJA 1SVHA 3O51A 4LV8A 4YR8A 1JWHA 3F2RA 2VWXA 3ANRA 5HGIA 4AT4A 5I9YA 4BVUA 1CM8A 4J71A 5CTPA 3GCSA 3ZZEA 4IZYA 5IG1A 4EONA 4YJQA 3HMOA 1H1WA 4IB1A 1DM2A 1TQPA 2ZM4A 3A99A 5E8TA 4FT7A 3EQRA 3OTVA 4YO4A 4ZTRA 1FMOE 3R7UA 4YZCA 4AZVA 3BYVA 4KA3A 4FTUA 2ITZA 4IJPA 2P0CA 3TYKA 4CCUA 1E1XA 3K3IA 5EW3A 3HMMA 4J53A 4IM2A 5E8UA 4RX8A 4D5HA 4BIBA 4GJ2A 5IEXA 2C0TA 3PG1A 3S00A 3LM5A 2W4KA 4L7FA 4DEDA 3ENMA 1CSNA 5J1WA 4FTJA 5HCZA 4P90A 4RJ5A 5CQWA 5LCKA 3OWPA 3PJ1A 2R3JA 2BHEA 2E2BA 3QKMA 5B2KA 2XK3A 4FEUA 4PWNA 1GAGA 1YWRA 2GS2A 1OKWA 4O38A 5HEZA 5L2TA 4FIHA 4MCVA 2XRUA 3SXRA 4EORA 2XKDA 4OBQA 2BCJA 1ZY4A 2BZJA 3CY2A 4LRKA 3EQDA 3O7LD 4QP8A 3DK7A 5CY3A 1JSUA 4BTMA 4FKQA 3II5A 4YBKA 2Y9QA 4OBPA 2VRXA 4RIWA 4BYIA 5A6OA 4FI1A 4RA4A 5DPVA 4ACMA 1AQ1A 4O21A 2JDVA 1L8TA 4WBOA 4C4IA 3VNTA 4EKKA 3CS9A 4DFUA 3TMOA 4Q5EA 4DTBA 3NNUA 3ZSIA 2OG8A 1OITA 4L67A 4AUAA 4LYNA 4WNMA 4DEGA 4X3FC 3MI9A 3D2IA 2ITQA 4DF3A 2Z7LA 5HE1A 1V1KA 2R9SA 2I0VA 3P5JC 1FGKA 4OTGA 4QYEA 3A62A 2UW4A 5EKOA 3LJ2A 2X0GA 4G3FA 3C50A 3L8XA 3BWFA 3TV4A 3QCXA 5KMMA 3PY1A 3DK3A 4EQUA 2OICA 4DFBA 1ZOHA 4ZJIA 3F6XA 2YDJA 2PVJA 3FSFA 2VWWA 2E9OA 2YM7A 1V0PA 4GFOA 3UOJA 4ANMA 2QR8A 3ZO1A 3TKIA 1PXKA 3VS2A 3UYTA 1ERKA 2PVNA 5TO8A 4DT9A 5GJFA 4TWOA 2C5OA 3FC1X 5T3QA 2IPXA 3IS5A 2Z02A 3H9FA 3SW7A 4PTGA 3VQUA 4E26A 2IW8A 4ZTMA 4CZUA 2WEIA 5CEKA 5AP2A 3KRWA 3V5JA 2GFSA 4FZ7A 4L9IA 2PYWA 1PY5A 4CZTA 1Q8YA 3BLRA 2C5VA 3G5DA 3OY3A 4O84A 4RZVA 3ZBXA 5AADA 2BRHA 5AV2A 5HE0A 4MNFA 2AYPA 5EQPA 4BJJA 5BVKA 1JVPP 1YXVA 2WKMA 4LQMA 2ZV7A 3O5AA 5EG3A 3KMMA 3Q4UA 3VBWA 4DHJA 3C9WA 1SM2A 4QQTA 2WTCA 4OTDA 4A06A 4L68A 1XMLA 4YZBA 1JKKA 1PXLA 2OBJA 4IDTA 1SVEA 4NCTC 4F6UA 5IA1A 3CP9A 4RWLA 5CU6A 2GHLA 3SXFA 1LUFA 3F88A 5AUVA 4MWHA 1JSVA 4F7JA 2P33A 4JBOA 4AOIA 4XG7A 1I44A 5L8LA 1JNKA 3OWLA 4J7BA 5C03A 4UB7A 2UZWE 4AWIA 4D28A 1OKZA 2OKRA 3LE6A 5ETIA 2C6MA 1KE9A 2E9PA 5AM7A 2BUJA 4FTTA 3JY0A 5KE0A 3H30A 2QOCA 3GOPA 4MBLA 4JQ7A 4QYFA 3F3UA 1M2QA 3ACKA 4RVMA 1Q8ZA 3FXZA 4F9WA 4RX7A 5EOBA 1UV5A 4OTHA 1JKLA 4AA5A 3R73A 4JG7A 5AUXA 3KGAA 3P7CA 4M0YA 2XIYA 3RK9A 4DE4A 3TZ7A 2R3LA 3U6JA 4TYIA 2BRGA 1OPJA 3DDPA 2GHGA 3EQFA 3KVWA 4CT2A 1OVEA 3MSSA 4TL0A 2PVRA 2OU7A 5CASA 2JDOA 3U6IA 3TM0A 4QMTA 3V8SA 3H9OA 2YCFA 2ONLA 2VTPA 4QTEA 5AV0A 5CAOA 3SKCA 4XG6A 5BPYA 2C4GA 3OC1A 5AUUA 3R8UA 5D7VA 3I5ZA 4EOLA 2ITTA 4TKSA 4XCUA 3LPBA 5HVJA 4H1MA 4Z7HA 5JQ8A 4AZEA 4U41A 4CFMA 4MBJA 3L8SA 4AE6A 4FNXA 4Q9SA 5DIAA 1URWA 5E8ZA 5FTOA 2I0YA 2YITA 5BYZA 3UOLA 3VJOA 4DHFA 2J7TA 3UDTA 2F57A 4G3CA 2WTIA 4DG0E 2ZM1A 3GNIB 4F63A 4W4VA 3R8VA 3LVPA 5HORA 5C8NA 4EUTA 2R0UA 4GUEA 4O83A 5BUJA 2ZFYA 4NH1A 1HCKA 2YIQA 3ACJA 4CD0A 4L42A 5LJJA 5ANDA 3GUBA 3ZO4A 4RIYB 2GPHA 4GS6A 4CFNA 3O8TA 2UZEA 4CKJA 4ITHA 1KUTA 3FI3A 4EOQA 3RK5A 3OBJA 3ZMMA 4F64A 3NUSA 3D5WA 4FV2A 1J1BA 1OKVA 4F65A 4G3DA 3V8WA 4I6LA 1XH8A 3EFLA 3PWYA 4C2VA 4FTNA 3GCQA 3FC2A 4OUCA 5DN3A 3R04A 1IASA 3OXTA 2YFXA 1S9IA 5FQDC 4JX3A 3ZO2A 4ASXA 5D10A 5IQDA 3DB6A 3FZRA 3G51A 3VBYA 1CKPA 2GNLA 4NT4A 3R63A 3VRZA 3CY3A 3R71A 4JDJA 4NWMA 5J87A 2B9HA 5CX9A 4GCJA 5D7AA 2RG6A 3RPSA 4PMTA 5L3AA 3HP2A 3TUBA 4BCKA 4EZ7A 3FXWA 3PFYA 4FV5A 2AC5A 3DQWA 5C9CA 2Y6OA 3AQVA 4JDIA 4G16A 4L3LA 3ZFXA 4CGAA 2P55A 3UG1A 3R1QA 3PP0A 2AUHA 4LRJA 4MXYA 5FP6A 4EWHA 1T45A 2IZSA 3R9HA 1UU9A 3GXLA 3D5XA 3ZLSA 3FMKA 1OBGA 3VWAA 2ZV2A 4EOJA 4O7VA 1FBNA 2X8IA 3GU7A 1W0XC 2Z8CA 1H4LA 3IOKA 2QOIA 1YHSA 2BAJA 1IEPA 3SA0A 4UXQA 2NO3A 2QG5A 3FSKA 3HVCA 3NFFB 3AKLA 3W2QA 3QD2B 4OW8A 3B2WA 3QX4A 1E9HA 4O2ZA 3LM0A 1PMNA 2ZYBA 4EEVA 2PVYA 4U81A 3CGOA 4TNDA 1QPDA 3COHA 3EQIA 5E8WA 5BQ0A 2PVKA 1IG1A 3FMHA 3TKHA 3N9XA 3RMFA 3DAKA 2IVVA 4AZWA 5AJQA 3NEWA 3BV2A 4FJVA 3HEGA 3PXKA 3QHWA 4QQJA 4D1SA 2UZNA 4L52A 3SG9A 4HOKA 4OLIA 1R3CA 2G9XA 4G34A 4U9AA 5LOHA 1XBBA 3F82A 4YLKA 2PZ5A 2OGVA 3C0HA 5M44A 1UNGA 2FH9A 2XKCA 4QQ5A 4J52A 3BLAA 3WARA 2Y6MA 4XV9A 5CEIA 2WMUA 3QX2A 2JLDA 2WQBA 4AG8A 2XKEA 1G8AA 5DNRA 3F5UA 4C38A 3E8DA 4S2ZA 1KE7A 2XF0A 4IANA 5E1EA 5HCYA 1MQBA 5D11A 5H9BA 4Y83A 3CEKA 4QP4A 3DJ5A 2EVAA 2XA4A 4NFNA 2CKOA 3Q6UA 2PMLX 2XNMA 3GBZA 4KRDA 3ZFMA 5HVYA 4IX4A 1Y6BA 1J7LA 3ORLA 3P78A 4Y72A 4KBKA 4PF4A 3SAYA 5KX8A 3MW1A 2UW9A 3ALNA 2WEVA 3SDJA 2QHMA 4AAAA 2F2CB 1XH9A 5CSXA 5LMBA 2QO9A 4C59A 5E8VA 3DJ7A 2PK9A 2X8EA 1FOTA 1KOAA 4J95A 4IFGA 3TL8A 4CG8A 3BL9A 3TI1A 3LIJA 4JX7A 5CEPA 3NMUF 2ITXA 3MH2A 2O64A 4RWKA 4U79A 4RG0A 4RFYA 2HY81 3E64A 4UX9A 3LFFA 4YC8A 2UZBA 1SNXA 3S95A 4FSMA 3WZJA 4FEWA 5I9UA 2VWIA 4ZTSA 3QZGA 5TR6A 3CIKA 4U0IA 4I23A 3D4QA 4PY1A 3QC4A 4KKHA 2XIXA 2R3NA 4IAFA 3Q2JA 4EH2A 3MGYA 3DS6A 4K2RA 5BX0A 3G9LX 4MWIA 1G8JA 2EB2A 4CRLA 2R3OA 2VTHA 4UV0A 2BRNA 3N4UA 5J9YA 4AA4A 4XBUA 5HE2A 4DH3A 3OCTA 3CKWA 3OVVA 3PA5A 4YTIA 3MIYA 1M52A 3RINA 3FI2A 3LKMA 4DG3E 4NTTA 4OT5A 3D7TA 4FKUA 4FVPA 4Y8DA 2Y4IB 4YZDA 4K0YA 3W0NA 3KRJA 4NW5A 3IGGA 2NYAA 5H8BA 1YW2A 3R2BA 5JGDA 2JKOA 2ERZE 4A9RA 2UVZA 4FTIA 4EYMA 5HG5A 5JK3A 3UJGA 3CTHA 3UG2A 1RQQA 4RLKA 1BUHA 3DB8A 1LEWA 3GENA 3AD4A 2FUMA 2WQOA 4MD8E 1ZYLA 3R8PA 3VUKA 2CNVA 3E7OA 3PVWA 4FE2A 3QXPA 3C0GA 3S4QA 2PMOX 4A9YA 5JZNA 3UYSA