5M09A

Crystal structure of mycobacterium tuberculosis pkni kinase domain, c20a_r136n double mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
246
Chain Sequence
b'MALASGVTFAGYTVVRMLGASAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHNDVNPANVVLTSQDQRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PknI
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Signaling protein
total genus 70
structure length 246
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m09A01
3ZOSA 4V04A 3W55A 4ZY5A 3A7IA 1URCA 1OKYA 2IZTA 5B2LA 3ORXA 3FUPA 3QZFA 4I0RA 4D5KA 4S33A 4PTCA 3ALNA 3TNPC 3F2RA 3OC1A 2WMVA 4FV9A 3TKIA 1WVYA 3LJ0A 3CEKA 3FEGA 3H9OA 2P0CA 5CQWA 1GIIA 5AP1A 2P2IA 4CMTA 3F9NA 3GU5A 4YZNA 5T3QA 4XMOA 5D1JA 3OD6X 4IB3A 1YI3A 2GNJA 2Z7SA 3GT8A 2G1TA 5L2TA 4O27B 4YC8A 1Z9XA 4DLJA 4IZ5A 1H25A 2G9XA 4MXXA 4L42A 4YURA 5GIOE 4JBOA 4BTMA 4EC9A 4OBPA 4RC4A 3RKBA 1PMEA 4HGTA 3HV7A 2QG7A 3QAME 4BTKA 4V05A 5D7VA 4NCTA 2BZKB 3AMAA 4FA2A 3P4KA 3U8WA 3WIGA 4PRJA 2JEDA 1WZYA 3QWKA 5LVOA 2ZDUA 3UZRA 1Q62A 3TNIA 3QQGA 4IAFA 3LM5A 2B1PA 3O8PA 4AA0A 2PMNX 2C3JA 4O2ZA 1CKIA 4JDIA 3UC4A 3HV5A 4WRGA 3R8PA 2VD5A 1REJA 1K3AA 2PE0A 3MV5A 4YHFA 2CLQA 2KULA 3OUNB 5C1QB 4KRCA 2GS6A 3H10A 4OTWA 1FBNA 4I41A 3A99A 5DPVA 2BDJA 4C7TA 3GI3A 3LKMA 1UA2A 3PFQA 4UWYA 5I9WA 3U54A 4ASDA 4QMVA 3EFKA 4KKGA 1LEWA 3KRXA 4GJ2A 4K77A 4EUUA 4XG9A 3MA6A 3ZBFA 5HICA 3ZLYA 3R63A 4IX5A 3NZ0A 3NMUF 3Q9XA 4RC2A 4DH8A 3LZBA 2WTJA 5ACKA 4MCVA 3R2BA 3D4QA 4FEWA 2IZUA 2JIIA 4X6RA 4YHTA 3ZDIA 3UPZA 2XIRA 2XJ1A 1SVGA 1YI4A 2P55A 3QQJA 4FUXA 4F9AA 2VN9A 3LCOA 3HLLA 3PY1A 3KEXA 3Q6WA 5GJGA 4Y73A 4FX3A 3NPCA 4MAOA 3ZDUA 4B4LA 1JBPE 4DBXA 4EL9A 5IUHA 3AMYA 4JG8A 2VX3A 5JFWA 4YU2A 3TCPA 3S00A 1U54A 3NGAA 2XK9A 3A7JA 2YIRA 4EQMA 3FAAA 3QLGA 4O6LA 3VBXA 3U6JA 2HCKA 2QU5A 3OY3A 4FEVA 4NL0A 2ZV7A 4E6DA 4IWDA 4BBEA 2WHBA 3FMDA 3FYJX 4LMUA 1ZMWA 5E1EA 3W18A 2ZM1A 2YDJA 2J0LA 2O63A 2X81A 4L46A 5IQBA 2WKMA 4EH3A 2JDSA 4DGGA 2PVNA 4EQUA 3LXLA 3PRFA 2R5TA 3O23A 3ZZEA 3LQ3A 3F3VA 5CU3A 4GL9A 3I0QA 4EYJA 5IZFA 1YI6A 3NYVA 3FZTA 4IDTA 2R3QA 3WF7A 5JGAA 5EI2A 5K5XA 5BVFA 2R3JA 4TYEA 4H05A 5E8SA 2VZ6A 4M68A 1XQZA 5LJJA 4CNHA 2V22A 4FKSA 5TKDA 4XP2A 4D4RA 4RBLA 5AWMA 3CIKA 5CU6A 3C5UA 3GCUA 4FV7A 3OWPA 1BI7A 4O86A 5IDPA 4X2KA 4RX9A 4XV9A 2ITVA 3MJ1A 4B0GA 3VC4A 4EH7A 4USFA 4K9YA 4EEVA 3LFQA 3L8XA 1O6LA 1SZMA 3HKOA 3JVRA 3QTIA 5L6OA 3HDMA 2XNPA 2Y6MA 4RT7A 1QPJA 3ZS5A 4F7NA 5HVKA 3JY0A 3IW8A 3Q9ZA 5C4LA 4DFNA 2V7AA 5HD7A 5J8IA 4WNMA 3VHEA 3QD3A 3LFSA 2GTMA 3A7HA 4GS6A 3W33A 4R3RA 4XG8A 3NR9A 2CDZA 1Q3WA 2WIPA 3R71A 3ZUVA 4A06A 4ASEA 2HZ4A 1SYKA 4NFNA 4C2VA 4KS8A 4F1OA 3MH2A 4N57A 3MIAA 4IZ7A 1Q97A 3EQDA 3PXFA 2VRXA 4X21A 3VUMA 2UZEA 1JSTA 2W1CA 2AC3A 3PDTA 5A4CA 2C3LA 2ITNA 4MD8E 2QHNA 4DFBA 2RG6A 3QZIA 4CMUA 2W5BA 3ZC5A 4XRLA 5KZ0A 4ZJJA 2IW9A 4FVPA 4MXCA 4D55A 2W7XA 4FG8A 3HVCA 4O7SA 4O81A 3NW5A 4KA3A 4PL5A 4FTCA 4E7WA 4BIDA 2ZMCA 3IOKA 4FTNA 2CKPA 3DJ6A 2YM8A 2GFCA 4MHAA 1ZXEA 3EFLA 3TKHA 2W1GA 4DAWA 5HIDA 3KVWA 1YDTE 4YTHA 4G1WA 2YCSA 3CQEA 5DWRA 4BDCA 3QD0A 5LXMA 3TJCA 2G15A 2X9EA 4RWIA 4QMOA 3CSVA 4B9DA 4EH8A 3QX4A 1UU7A 3BU6A 5EH0A 4MTAA 4O6EA 4AACA 3LXKA 4BIBA 4AZWA 3FLZA 3TI1A 2XUUA 2Y7JA 3F3UA 3IW6A 2X2LA 2NO3A 3R7VA 4ZZNA 5EM6A 3NUAA 2J0IA 2X8DA 5A3XA 3A8XA 3BGQA 3NUSA 2C68A 4O7LA 3BHHA 4JG7A 1GNGA 3FMKA 3QQKA 4RIWA 3R7EA 3MFRA 1SVEA 3EQBA 5BYLA 2EWAA 4GUEA 3BPRA 3DGKA 3F5XA 4MXYA 4FSZA 3HECA 4FTUA 2OH4A 4EOJA 4ZMFA 5KMKA 2RFEA 3GEQA 3OW3A 4I94A 3UQFA 3PA5A 5AP7A 5HE0A 3UIUA 3PVWA 2W5AA 4AQCA 3KULA 4L67A 4TYJA 2C6TA 3GGFA 3NIEA 4FV3A 3T9TA 2J90A 4AW5A 4DEDA 5B7VA 2C3IB 4RFZA 5D11A 5HX6A 2HXQA 2YHVA 3I5ZA 4AA5A 2OBJA 4LQMA 1SM2A 2E9UA 3W2PA 1T45A 5BVKA 1UNHA 3DTWA 4JQ7A 4C4EA 2GNIA 4D2RA 3OW4A 4EI4A 3DFCB 4DEGA 3TZ7A 1I44A 2LAVA 1KE6A 3E7OA 3LJ2A 4IWPA 4OUCA 4L3JA 4GW8A 4S31A 4ANQA 3P08A 4GH2A 2O0UA 1PW2A 2AUHA 5E92A 4AXAA 2YACA 3PXRA 3QZHA 2W9FB 5JZJA 3IW4A 5K4IA 4CZTA 4AOTA 3B8RA 5FXSA 5AX9A 5JKGA 3DZQA 1IG1A 4YSMA 2QVSE 2BALA 3IG7A 2ITXA 4IVCA 5BMMA 3CY3A 3F6XA 5JQ5A 5KUPA 4FT0A 5HO8A 4ZSEA 3Q53A 5CEPA 2UVZA 4ORKA 1YW2A 2HY0A 1M17A 2PZ5A 3R01A 5D10A 2XK8A 5EHOA 5HORA 4CQEA 1LR4A 1FMOE 2QNJA 2G01A 5KMMA 3GU6A 3EKKA 2GQGA 3SVVA 2YABA 2C47A 4GFOA 4DG3E 3E63A 3NCGA 1YOJA 4XLVA 4AGUA 4A9UA 4KAOA 4A9YA 1G5SA 3RCDA 3UZTA 4LL5A 1ZMUA 2PULA 1PXJA 5KMIA 4C4GA 4F08A 3KN6A 4BZDA 3ORKA 1GZKA 3G15A 4BGHA 2BILB 4IE9A 4IAZA 4KBKA 4Z7HA 2F49A 3SG8A 4FKIA 3FLSA 3G6HA 4RIYA 5BUIA 1FMKA 4FKRA 5ACBC 4QMQA 2OKRA 1YWRA 4FUYA 4BY9E 4BZOA 4JR7A 1PF8A 4U44A 1A06A 1PXMA 2QO2A 3FBVA 1FOTA 3GCPA 4FKPA 4RVKA 4BIEA 4F7LA 5M53A 5GIPE 4BKJA 3WZEA 1WBWA 4XV3A 3DFAA 1AGWA 2GDOA 3QA8A 2VTPA 5FBOA 5CSHA 5L8JA 4OBQA 3AT3A 4N70A 4U41A 3V8WA 4F0FA 4EJNA 3R8ZA 3G90X 4IEBA 2C6DA 1OZ1A 2WMSA 3C9WA 3LXNA 4PMTA 4ZOGA 5DEYA 5DRBA 4EC8A 4ZSAA 3HDNA 3VS5A 1U46A 3VIDA 4EOPA 3FLQA 3ZM4A 4DT9A 1O6KA 4DF3A 3BYMA 4EBVA 5J5SA 4MXZA 1EH4A 3EJ1A 4O91A 4YTIA 3ORPA 3I79A 3DU8A 2YCFA 4I1ZA 3I7BA 5DR2A 2UW3A 4MF1A 5FTGA 2UUEA 2OK1A 2C0IA 4FNXA 3PA3A 3HV4A 1ERKA 4F7SA 1YVJA 5IEVA 4CLIA 5CTPA 2B9JA 2PVRA 5EW9A 4IJ9A 4MBJA 4J98A 4JAJA 2WMTA 5TO8A 2GS7A 3U9NA 4FEUA 4XP3A 1GIJA 4M0ZA 4BVUA 3FY2A 2WELA 3IDCA 1M2QA 3PJ8A 3R83A 1J7LA 1GIHA 3HV6A 4ZXTA 3NNVA 4OTQA 2JKMA 5EQYA 5C9CA 5A54A 4G5PA 4GV1A 4IADA 1OL2A 4L7FA 2E9OA 5AP2A 3ORNA 5HHWA 2QKWB 2QKRA 3N9XA 1UKHA 4B7TA 1QCFA 4I20A 2W1ZA 2JLDA 2REIA 4U3YA 3OS3A 1NVQA 1NW1A 4BCQA 3V5TA 4PL4A 3RINA 4APCA 2UZOA 2XNMA 4YJQA 4CV8A 3H30A 3AT2A 3OCSA 3DDQA 3FL4A 3PP0A 2G2IA 3M42A 4QP8A 3ZONA 3PXQA 2JD5A 1OL1A 1JKLA 4ANSA 3F61A 3T3UA 5M4IA 3OVVA 4I5PA 2WTCA 4LYNA 3Q4TA 4TYHA 5GHVA 3SW7A 2HWPA 3DBCA 1JKSA 5CEQA 3UVPA 1YHSA 1APME 1FINA 4BDDA 3QRKA 2WTVA 5FGKA 2GNLA 3RWQA 5TOZA 4FV1A 1SNUA 4CFVA 5FBNC 1RW8A 3ANRA 3L8SA 1R0EA 1SVHA 1YDSE 3AGMA 3RAWA 3SDJA 1ZY5A 3R1SA 4QMZA 1VYZA 3MVJA 4FVRA 4EK8A 1XO2B 3W2OA 3BHTA 3P7AA 3DQWA 4AA4A 4AE9A 5IQFA 2I0HA 4G3EA 5C01A 1IAJA 1RQQA 4YBJA 1NA7A 2V62A 5CX9A 4GEOA 2ZV8A 4FNWA 2R3GA 4JDKA 4F65A 4KS7A 4FV5A 3TUDA 3S1HA 3TEIA 2I7QA 2DYLA 2DQ7X 3TZMA 4YR8A 3W2SA 3WIKA 4BTJA 3FLWA 3EOCA 4HZRA 3LCTA 3ZSGA 4DGOA 2QR7A 1W83A 4FTMA 2WQOA 4Y95A 4E8AA 4EOLA 4DH7A 4RPVA 5E9EA 4RJ8A 4R5YA 1WCCA 4M14A 3BU5A 4C34A 2ACXA 2BAKA 2F9GA 5L6WL 5FLFA 4LV5A 2F7XE 2Y8OA 3MFTA 4O0TA 4XNEA 3RAKA 4E4NA 3B2TA 3JVSA 3PSCA 5E8VA 3TDVA 5M4CA 1WBTA 5FM2A 5IMXA 3R9OA 3C4WA 4I4EA 3DLZA 1BUHA 1FPUA 3CJGA 3M1SA 5K3YA 3C7QA 4RJ6A 1WBVA 4AE6A 3RP9A 5EKNA 3EWHA 1WVWA 4I6QA 5F4NA 1W84A 2BZJA 2XIZA 4HVDA 5M4FA 3QUDA 5AUYA 2WMRA 4ITHA 3VS7A 1L8TA 5EM5A 2WEIA 5CS6A 3IS5A 4FIFA 4H1JA 3BIZA 3QQFA 3QTRA 3LFEA 3E92A 4MNFA 2Y9QA 1CMKE 5CF8A 4CFNA 4M8TA 1BMKA 3EQRA 5CNOA 2OG8A 3DAEA 4IX4A 2IG7A 3AG9A 3M11A 3TUCA 3DBEA 2FA2A 2QOKA 3O96A 4LL0A 2CGXA 4XV1A 5E91A 4GUBA 4DTBA 2YM6A 3FSKA 3GOPA 3IOPA 4FTIA 4IANA 2YFXA 4ACHA 2GSFA 3KK9A 1PJKA 3KU2A 5CU0A 2RKUA 1XKKA 1ZAOA 4OGRA 2WOTA 3EQPA 1YRPA 2XJ2A 4KNBA 4A4XA 1TQPA 1ZY4A 2WAJA 2XBAA 3BKBA 3W32A 1H1QA 3BV3A 1E9HA 4BCNA 2WQEA 4NKAA 4C33A 5DFPA 4PMPA 4U0IA 3VRYA 3Q5ZA 4DHFA 4FBXA 2W5HA 1Q4LA 3R1YA 4TT7A 4AW0A 4BDKA 4EUTA 3OZ6A 4FV2A 4YJPA 3Q4ZA 3UNKA 4BI1A 4BF2A 1KE9A 2YZLA 5D41A 3LE6A 4IBMA 2OIQA 3IW5A 5GINE 4BCHA 4N4SA 1PKGA 1OPKA 1WBNA 5AP0A 3ROYA 2YWPA 2C6EA 5E4HA 4BDGA 5IA4A 4KKEA 1PYEA 4CKRA 5JRSA 4QMWA 3LOKA 3K54A 5HE1A 3F66A 3HYHA 3TTIA 2CJMA 2OJ9A 2PVFA 3NCZA 4WSYA 3SAYA 2G2HA 1H0VA 2WMUA 3EYHA 2NP8A 3AMBA 5L8LA 5DHJA 2BUJA 4U45A 4YBKA 3VF8A 2HAKA 2VWBA 2WTIA 5IMEA 2QOBA 4RQVA 2NRYA 3BYSA 4YTFA 4ZJIA 1XJDA 4AGDA 4BB4A 2ETRA 4HNFA 5D9HA 4PNKA 3FPMA 1YDRE 2J51A 3ATTA 3TIZA 4MNEA 2VTLA 3ZO2A 4CFUA 2Z02A 4HNIA 2CMWA 4NJDA 3T9IA 3WYXA 1J7UA 1GZNA 3KCKA 3QCYA 4PF4A 3SQQA 5EYMA 5C4KA 4TY1A 2YWVA 4D9UA 3DBQA 4HGLA 4HYUA 2OICA 3E64A 5HU3A 2BAQA 3BGZA 5DVRA 4BCJA 4Z3VA 2Y4IB 5LQFA 4O7NA 4XHKB 2GU8A 2HK5A 1BYGA 5EQEA 4ZTHA 2BFYA 5IUIA 3ATSA 3V8TA 5CNNA 4ZTRA 4XCUA 4WG4A 3TKUA 4FOCA 3ORTA 4CGAA 4ALUA 3SHEA 2HENA 3ZTXA 2W0JA 2X9FA 3FI4A 3O17A 4F09A 2JIUA 3HL7A 4PDSA 3OMVA 5A6OA 2F7ZE 4J1RA 2PE2A 1WBOA 3CQWA 3BHVA 4PDYA 3PY3A 4CKJA 3ZO3A 3SGCA 5CEIA 3ZO1A 3AT4A 4HZSA 2JGZA 1OVEA 4IJPA 3UOHA 2W4JA 3OT3A 2BRNA 3O0GA 4GKHA 4I93A 3HZTA 4ZZMA 1PY5A 4H3QA 3F2AA 2Z7QA 4GMYA 4YNOA 2F4JA 2CNVA 3EMGA 5HCZA 5IA5A 5GJFA 4QP7A 2J7TA 3TNWA 4BTFA 1JAMA 2QOIA 5HVYA 3DNDA 3G2FA 2YM4A 5DT3A 2Y6OA 4AT3A 5M09A 4E93A 3E88A 3VJOA 3QD4A 4ARKA 4NM7A 4GJ3A 4X2GA 2C6KA 4D58A 3HNGA 3R7YA 1B39A 2QQ7A 3B2WA 3ZLSA 2JDRA 2OJFE 5AEPA 3TV6A 2JBOA 3COHA 3KRJA 3PJ2A 3IDPA 2Y0AA 5BVWA 1MUOA 3LPBA 5M56A 3HP2A 2YZAA 5K4JA 1R1WA 3LFAA 4QQTA 4NTSA 3LIJA 1KUTA 4H58A 1IAHA 3MGYA 5ETAA 2XK4A 1KV2A 3C0HA 2JFMA 2UZNA 4IAKA 2GPHA 4IX6A 4DH3A 4ZP5A 5M06A 2NNWB 1QL6A 3DBFA 3II5A 3NNUA 2YDKA 4RVLA 4RX8A 4NM3A 5M55A 5CAPA 3V3VA 5IF1A 2WU6A 3ORMA 1OBDA 3HMOA 4OTRA 4ID7A 4RIXB 3G9LX 3I1AA 3QX2A 4XG2A 2YM5A 3D83A 5L8KA 1H24A 3KGAA 4O7TA 4U9AA 2C5XA 5IDNA 1ZYCA 3QTWA 3TTJA 4R77A 2XM8A 2ZM3A 3WZKA 4ZSLA 4ZS4A 4LRMA 3VBQA 2B52A 2ESMA 5F9EA 4I21A 3LVPA 4BCKA 3ENHA 3DS6A 5KE0A 3RVGA 3WI6A 4E6AA 2OXYA 2CCHA 3VS3A 4V0GA 5E8XA 4E4LA 2XMYA 3OF0A 4QMMA 3HV3A 2GCDA 3CPBA 3MA3A 4KIPA 2UW8A 1ZOEA 2PMIA 5KKRB 3UIMA 3I6WA 4G16A 3UMXA 3QFVA 3RI1A 5M07A 4ACCA 5JGBA 4DEHA 4DGMA 1L3RE 2VWZA 4FKTA 4JDJA 1JSUA 4RG0A 5BYZA 4N6ZA 3G0EA 4A9RA 3TXOA 1YXSA 4R6VA 3U55A 1Q61A 4OBOA 3VVHA 2YM3A 3L8PA 4NWMA 2RIOA 2W05A 3GCQA 3BYVA 3CTQA 3EN4A 3FZ1A 4BDJA 1FVVA 1Z5MA 4QQCA 1UNLA 3FWQA 3WZJA 4O22A 1LPUA 3IK3A 3HRFA 4TL0A 3H3CA 3ZO4A 2RFDA 4G3CA 4QP3A 5JZNA 4O82A 4AN2A 4MWHA 4HVHA 3DXPA 2UVYA 2H6DA 3MWUA 4OLIA 3LMHA 5HEZA 4DN5A 2ERZE 1R3CA 3EN9A 5M44A 3VULA 2WQMA 4MVFA 4FT7A 3G33A 1HOWA 2OJIA 3RPVA 3ACJA 2X2KA 3CGFA 4B6LA 4ENYA 3OWKA 4FSYA 4FZFB 3ULZA 3DKGA 3UC3A 2EXCX 3OROA 4FTTA 4QMNA 5K5NA 3PYYA 4I5MA 3D9VA 4Q5EA 5CT7A 3TIYA 4CTCA 3JYAA 2ETKA 4QNAA 4EYMA 3NVKI 3SC1A 2CKQA 2FVDA 3FHIA 3P79A 1OPLA 4FSMA 1ND4A 3ITZA 4F6UA 1NT2A 5AA8A 1P4OA 1Z57A 3NAYA 4PDPA 3K3JA 3Q04A 4QOXA 3BWFA 2E2BA 3E8DA 4NM0A 5IQEA 3EH9A 3F5GA 1PXNA 3IW7A 1OBGA 3TL8A 4K18A 5CU4A 3VS0A 4QP6A 3ELJA 4JOAA 4FSUA 3O50A 4J99A 4ITJA 3GNIB 4TWNA 1XR1A 3HA6A 4MBLA 4RIWB 5ETFA 4B99A 2C6LA 5ANEA 1YOMA 2JDOA 5EW8A 3V5WA 2B0QA 4TNBA 2IVTA 3TV4A 2QCSA 3GU4A 3EN6A 3MESA 4BCIA 3OHTA 5EM8A 2YISA 3V6RA 1KOAA 2YN8A 3LXPA 2IO6A 2WIHA 3P7CA 3ZCLA 4CMOA 4QQJA 4EH2A 5AM7A 3P78A 4ZTNA 3G5DA 3NAXA 2X7FA 5DR9A 3VW6A 4UZHA 4TXCA 1FGKA 2XA4A 3NUNA 5C8KA 2PVYA 3OT8A 4X7QA 1LP4A 5M57A 4P90A 1Q8ZA 3FKNA 1UU3A 2A0CX 3RM6A 4PWNA 3COKA 3UIXA 5BYYA 3CTJA 2EUFB 3U9CA 2W99B 4PV0A 4APPA 1U4DA 3N4VA 5HE2A 3W1FA 4Z16A 5ANOA 4RA5A 2CNUA 5LCKA 4AWIA 3AD5A 4R7HA 1KE5A 5JFXA 4I0TA 4C38A 2BRHA 2QOHA 4MWIA 3QCSA 1XBBA 4D9TA 5J1WA 1M7QA 3HAMA 4YJSA 5I9ZA 1TQIA 3D7TA 4GYIA 2XYUA 2VTJA 4CRLA 4QMUA 3UO6A 4C4IA 4EHVA 5AV0A 3W2QA 2X6DA 3KF7A 4RLKA 3H9RA 5E7RA 2C1AA 5AAFA 1UWJA 4CCBA 4O0SA 4BDIA 1ZOHA 4RQKA 3EN5A 3FZSA 3MS9A 4RRVA 4YO6A 3QTZA 4FTRA 3UNJA 3PVGA 3AC1A 3SKCA 4RIOA 3GC9A 2VTRA 3VS1A 4K2RA 3I0OA 1OUYA 3FMJA 4KSQA 2X2MA 3TG1A 4G2FA 3CP9A 2YIYA 3SRVA 1IASA 4M3QA 3ZH8A 3PLSA 3JY9A 4YMJA 4X3FB 4CT2A 2W1HA 1JWHA 3OEFX 2PVKA 2VO3A 2XKEA 4FZ6A 5BX0A 3E3BX 3EQHA 5HE3A 3G6GA 3MYGA 3SD0A 3VNTA 4EOIA 2FUMA 5CT0A 1HCKA 5E90A 4NM5A 2ZB1A 3VBVA 4YJTA 2H8HA 2FGIA 3R22A 4NJ3A 4FTLA 2WNTA 4BBMA 4ZJVA 3C1XA 3HRBA 1X8BA 1MP8A 4PMMA 5EYDA 3C51A 2QO7A 3OTVA 4AUAA 1TKIA 2CGUA 3VO3A 3FKOA 5DN3A 2VNWA 1I09A 4ALVA 1H28A 2BDFA 4JVGA 4LOOA 4TWOA 5G1XA 3G0FA 3OUKA 1M2RA 4FICA 1GOLA 4IMYA 4LMNA 3EKNA 3MY0A 4FTAA 4TYGA 4AX8A 3MY1A 5CASA 4G5JA 4IM2A 5JRQA 4JQ8A 4JLCA 4F64A 3JUHA 3KXMA 2CN5A 1QPDA 3UODA 3OXIA 1YXTA 5EM7A 1OL6A 2JFLA 4FK6A 5AIRA 4USEA 2B9IA 4JIKA 4O0XA 1H1SA 2W96B 5BNJA 5AMNA 3U6HA 3Q4UA 4J97A 2PVJA 4ANBA 1YOLA 1WBPA 4IB0A 5HCXA 5FTQA 5J9LA 5FP6A 1OKZA 2UZTA 4W8EA 4EZ7A 2BPMA 4O21A 4RWJA 5LVLA 4DBNA 4UV0A 4BCPA 3FJQE 3MH0A 3H0YA 1PXKA 3ZYAA 4FSRA 3ZBXA 3BQRA 3PWDA 4YJOA 4QPAA 4FGBA 4RGJA 1E1XA 4BN1A 2BRBA 2PVMA 2IJMA 3PWYA 3BYUA 3CGOA 1WAKA 3AC3A 3QWJA 4AT4A 1JKTA 3AC8A 3Q52A 3FQHA 5EHYA 3A4PA 5KMOA 4QYYA 4AW1A 3P1AA 3Q3BA 2F2UA 4PTGA 4W4WA 3KK8A 2VGOA 3UJGA 3DK7A 3SOAA 2Y4IC 4PY1A 4L8MA 2X6EA 1H0WA 2BVAA 2WXVA 3FZOA 2CNQA 2IVUA 2W1EA 1URWA 3BCEA 3OBJA 4K0YA 3IPHA 4J52A 3BLHA 4NT4A 5GJDA 3V5LA 4IAYA 3VQHA 5HIEA 4JG6A 2OIDA 5A4EA 3KY2A 3RHKA 1OI9A 2BTSA 3NW7A 4MEDA 4TNDA 4BR3A 2R3RA 5HVJA 4GFMA 4C0TA 1GZ8A 3ZRMA 1RE8A 4W8DA 2R64A 3EHAA 3ULIA 2OSCA 2VTQA 4FL3A 4IC8A 3HRCA 5LCJA 4YZCA 5B0XA 4Q5HA 3RPSA 3NS9A 2XH5A 4S34A 3UPXA 3WF6A 3LLTA 3DK3A 1OL7A 2CCIA 2W4KA 3QL8A 4M7IA 2OZAB 2VTOA 4K8AA 4CD0A 4EK5A 3ID6C 4FV4A 4FKVA 4JIAA 4TW9A 5HO7A 2P4IA 5LVNA 4ZS0A 4MXOA 4CZUA 5FG8A 3MJ2A 3R00A 3FPQA 4C3RA 5IQGA 1K2PA 5L2SA 5EHLA 3DA6A 4YTCA 3QA0A 5CEKA 2C1BA 2PPQA 5FEQA 3WBLA 4ZY6A 2QOOA 3QZGA 3G51A 1E1VA 1IA9A 3FSFA 4GFGA 4ZK5A 4BDBA 4DFZE 1GJOA 2R3NA 2X4FA 3CCNA 3H4JA 3NUPA 4G3GA 5T6KA 5M08A 4X2JA 2I6LA 1VZOA 2W4OA 3V01A 4A4LA 4E5AX 2WOUA 2OF4A 4WA9A 5CENA 4CG9A 4L68A 3ZUTA 1CDKA 4FVQA 2HY81 4BDFA 4GIIA 4IFGA 2NRUA 1WVXA 4UBAA 2WMQA 4ZLZA 5CWZA 2J0KA 3FMLA 3R7IA 3R04A 4H3BA 5BVDA 4CFXA 5CVFA 3VJNA 4GYGA 3UTOA 3PXKA 3ZC6A 4CLJA 4Q9SA 4RJ3A 3R8UA 1TQMA 3RPRA 4YLKA 4R5SA 2VWXA 4L7SA 3BHUA 1P2AA 4N6YA 5E8UA 5AUVA 3VBTA 4DEIA 4E4XA 3KXXA 5AUZA 4EH6A 4GVAA 3MTLA 5FTOA 4YJNA 2QI8A 3O2MA 4C35A 2GHGA 5I9XA 3QRIA 5L2WA 1G8AA 4MD9E 3JXWA 2OWBA 3IKAA 5CSXA 2C0TA 4R1VA 4F0GA 2WEVA 3WILA 2GNHA 1F3MC 3QTXA 4RVMA 5HBHA 3ZM9A 2XKCA 4F99A 4L44A 5CZHA 4QQ5A 4YP8A 2EU9A 3POZA 4PL3A 3VF9A 5KKRC 5AX3A 4PQNA 1Y6BA 4WG5A 4XRJA 1CSNA 1R78A 4HGEA 3ZRLA 4QMTA 3GCSA 2VWWA 4FT9A 5E8ZA 3TZ8A 3UO5A 1OM1A 3PJ3A 2WMWA 2KTYA 3DXQA 4BCOA 4C58A 3OTUA 2IWIA 1NXKA 3Q9YA 1VEBA 2FSLX 4O84A 2QD9A 4XG7A 4I5HA 4DG0E 4BCMA 4KUJA 3CE3A 2E9VA 4FKWA 3IDBA 2ZMDA 2ZDTA 3V6SA 5AADA 4EWHA 3MB7A 5A4QA 4AZEA 2J5FA 2RL5A 4FNYA 2FSTX 3IONA 4EOSA 4II5A 3LCKA 4PNIA 2HW6A 4J71A 1YWNA 1ZOGA 3U51A 3KXHA 4DYMA 4J96A 4U97A 3FLNC 2YDIA 1WBSA 4DTKA 4RJ7A 4XP0A 4FL1A 3VS4A 2C5YA 2IVVA 3FZPA 4NYEA 4AGWA 5AJQA 4FE2A 4F7JA 2WMAA 2UW5A 2WQBA 2H96A 4E4MA 2B4SB 2CN8A 3Q6UA 3P0MA 4UB7A 5HBEA 2ONLC 5CZIA 3LAUA 3DKOA 3FQEA 3PIYA 4YLJA 3O7LB 4ZTQA 5HG5A 3VUKA 2WTKB 5A9UA 2VX0A 5EKOA 2Z7RA 4S2ZA 5IA1A 4C4JA 3FXXA 3VUIA 4UX9A 2BCJA 4DCEA 3I6UA 4D1XA 4AU8A 4FIJA 3BI6A 4L00A 3FI2A 3FKLA 5KX8A 4EWQA 3QF9A 3KREA 4UN0C 2R0IA 3NSZA 4DITA 2OW3A 3D94A 4D1ZA 2CKEA 2O8YA 4H36A 4OTGA 1A9UA 4J7BA 2ZAZA 5AP3A 4DFXE 3NX8A 3LW0A 5BVEA 4CTBA 3R9HA 4Z7GA 4XG4A 3KC3A 5KMNA 1U5RA 4XJ0A 4AF3A 3BX5A 3HMMA 1H8FA 1YHWA 4PTEA 3E5AA 2VTHA 3KRWA 5IA0A 5HG7A 5AAGA 3GUBA 5LMKC 2OH0E 2PVHA 3UQGA 5CVGA 4D2SA 1OUKA 5CAVA 5DE2A 4S32A 1UWHA 3E3PA 3LQ5A 4F4PA 2GS2A 2PZIA 3R30A 3RK5A 5HLWA 4HPTE 3MW1A 3GFWA 4TWPA 4D5HA 4FODA 4YNEA 5IISA 4E26A 1OIQA 3A7FA 3BQCA 3PG1A 3O71A 5D12A 5EI6A 4A4OA 5KCVA 2X0GA 2PVLA 3FYKX 5BVOA 1XH6A 4HCVA 4C3FA 1Q3DA 3T8OA 1W7HA 2B9HA 4F6WA 4KB8A 2B7AA 3PJ1A 4Q2AA 4ZEGA 2R3HA 3AC2A 2BIKB 2JITA 3IO7A 2YAKA 4XV2A 3QBNA 3L8VA 2X7GA 2WTWA 5FDPA 1XH8A 2CGWA 4I22A 5FEDA 4FEXA 4GIHA 4J95A 2UZUE 1QPEA 3PA4A 5M4UA 4RSSA 4GK2A 4UXQA 3QGWA 4YO4A 2PU8A 4UY9A 4X2FA 3F5PA 3C4EA 4F1TA 5CF6A 3R7OA 4FC0A 2HOGA 3HUBA 4GRBA 3SLSA 3TUBA 2BKZA 1HCLA 2YJRA 3PPKA 4QP9A 5FRIA 3FZRA 5HCYA 3ZEPA 1Q24A 2I40A 3PPJA 4RX7A 4AT5A 3POOA 5HZNA 2AC5A 5JFVA 3PY0A 4C61A 3N51A 4GG5A 4G6OA 4X6QC 2NPQA 2H34A 2UW9A 2FB8A 4FSNA 3ZFXA 1NVRA 5H9BA 2SRCA 3P86A 2C6OA 4K11A 3GP0A 3VQUA 4AZVA 2HZ0A 2F57A 2WU7A 5I4NA 3F69A 1MQ4A 2VWVA 5ANGA 4ZSGA 4P4CA 3CC6A 2FSOX 5HESA 4AN3A 4JNWA 5ANKA 4X3FC 1G3NA 3NW6A 3K3IA 4KIOA 2C6MA 4O96A 2PY3A 3ETAA 2I1MA 4XG6A 1H27A 4Y5HA 3KCFA 2LGCA 3QUPA 4XBRA 5CXZA 4YZ9A 4QO9A 1DI8A 3I5NA 1M7NA 4GU9A 5J7HA 2O3PA 3CTHA 5AUUA 4NIFB 3VRZA 4FKQA 4UZDA 2ITUA 2GHLA 5DH3A 3UOLA 2ERKA 2C3KA 2GHMA 4IVAA 3F3TA 3O51A 4U43A 4D0WA 5IA3A 5I9UA 1BL7A 3QC9A 4HYHA 3GU7A 3ZLXA 4CFWA 2BRMA 2R3MA 5IQHA 3A62A 3QTUA 3E62A 4CVAA 5IH4A 3NYXA 4MD7E 4FTKA 3WARA 3EZVA 5TF9A 2XRUA 2FYSA 4U80A 5E8WA 5FDXA 3WF9A 1J1BA 1UU9A 2O64A 3Q32A 5CI6A 3WZUA 3KVXA 3PPZA 5IQCA 2HELA 5LOHA 2HWOA 5BPYA 4G31A 1NVSA 3LCSA 4IQ6A 4O0RA 1REKA 3OFMA 4CSVA 5IA2A 1NY3A 1XBAA 2W06A 4IFCA 5HQ0A 2UZDA 3DJ5A 4OT5A 1ZWSA 3GC0A 2OXXA 4DGLC 2BFXA 4HGSA 4O38A 4X2NA 1PHKA 4QYEA 2PZYA 3ACKA 5CU2A 5IQDA 3UGCA 4NUSA 3IECA 2XF0A 2YIXA 1H01A 3MI9A 2C4GA 1B6CB 2XCKA 1OL5A 3PP1A 3FY0A 2ITZA 5J87A 5LWNA 4E6QA 2HZNA 4K33A 2RFNA 3DAKA 4M84A 4FG9A 4WIHA 2PUNA 3ODZX 4NK9A 3N4UA 4FTQA 4NTTA 4IDVA 5DG5A 2XIKA 1FVTA 4KBAA 5CYIA 5CLPA 3OCTA 4HCTA 4YZMA 5HNIX 5KO1A 4D4YA 2WB8A 3LFBA 4U6RA 3HP5A 4GG7A 3V5PA 4XBUA 3RMFA 4AZTA 3KRRA 2OF2A 1UV5A 3HMNA 4OW8A 3BHYA 5DOSA 3VW8A 5F94A 2X39A 5C26A 5EOLA 2X1NA 2WFYA 3BBTB 4MXAA 3PIXA 3ERKA 4TRLA 4DG2E 4M15A 3IGGA 4ERWA 4GT4A 3L9NA 3A7GA 4L43A 3BU3A 3IGOA 1VYWA 5LWMA 2RG5A 3R0TA 2J6MA 3AQVA 2BDWA 3RNIA 2QOCA 3CJFA 5KBRA 3C0GA 2JC6A 1ZARA 2XNNA 1QPCA 1U54B 3BELA 2JAVA 5JN2A 3QQHA 4Y72A 2XKFA 5HKMA 2B54A 2EB3A 3R21A 3NYOA 3D7ZA 3TN8A 3FC1X 4CRSA 5I9VA 3S95A 5LVMA 4QRCA 5M51A 4ASZA 3OWLA 4IC7A 3A8WA 2ZOQA 3AD4A 4O0WA 3RZBA 3UBDA 3VS2A 5CALA 4AW2A 3GB2A 2J4ZA 5EDQA 3FXWA 1H4LA 3NUXA 3BE9A 3FDNA 5FQDC 5HNBA 3M2WA 2A27A 5IH6A 3PZEA 4NZWB 3QYWA 1T46A 4G6LA 5JEBA 3F3ZA 3C4CA 4QT1A 3QKLA 3UP2A 1YQJA 4C4FA 4Z55A 2BZIB 1DAYA 3OCBA 5L3AA 2VTIA 4MH7A 1Q41A 5IU2A 1JNKA 2E9PA 1U59A 2QLUA 3W10A 3MFUA 4I6FA 3SOCA 3KF4A 2C69A 4UYAA 3DZOA 5IQAA 2YJSA 3CKXA 4DINA 1H1RA 3A2CA 3BGPA 2XNOA 3JPVA 3D5WA 1UU8A 4EHZA 4Y85A 5CEMA 2O5KA 4QP2A 2IW6A 4MX9A 2XK3A 3L9MA 5JFSA 2EXMA 4I23A 2ZV9A 3C5IA 5DGZA 3DK6A 4R7BA 1KOBA 3I4BA 3QYZA 3S4QA 2WGJA 2OI4X 3C4ZA 5AFVA 3RK9A 3HA8A 2XS0A 4PDOA 1YWVA 5JT2A 1G8SA 1STCE 5KHXA 3MFSA 4RX5A 2YCRA 2PZRA 4AGCA 3NNXA 4ZIMA 4F9YA 1W0XC 4YC3A 3L9PA 3E93A 4BI0A 1VR2A 2OFUA 4O7ZA 4J53A 5IEXA 3NUUA 4ZMEA 4F9WA 3QKMA 1GY3A 3OP5A 4FL2A 1J91A 5DT4A 4FYNA 3WE8A 5BQ0A 3HGKA 1XH9A 5DR6A 4EONA 4CEGA 5D7AA 5F1ZA 2V55A 5IG1A 3FV8A 4JX3A 4IM3A 4BBFA 2UZWE 2YIQA 2VGPA 3RAIA 3D0EA 1OMWA 3ZLWA 4JBQA 4JL9A 4ITIA 5HLPA 5HNGA 1IEPA 2WTDA 5CSPA 1QMZA 1W8CA 3KXZA 3T3VA 2PSQA 3DDPA 4NW6A 4YPDA 3QXOA 4XOYA 5AA9A 4FTJA 5EDRA 3BBWA 1BL6A 1XH4A 1CKJA 2PMOX 5E1SA 3S2PA 3PSDA 4TKSA 3W2CA 3VWAA 3R2YA 2VV9A 4TTHB 1VJYA 3U4WA 2OJJA 5JGDA 4NKSA 4C37A 1OPJA 4J8MA 1CKPA 2C0OA 2GFSA 5ANIA 4M67A 5DNRA 3DPKA 4I5CA 4IWOA 1DAWA 1P5EA 4GKIA 4JBVA 5AP5A 4IWQA 3A61A 4L3LA 5KHWA 3EYGA 3QRUA 2V5QA 1MRYA 4OTDA 2QU6A 1CM8A 2R3OA 4U3ZA 5FXRA 4GVJA 3R6XA 2VTNA 1R39A 2O65A 3PVUA 3ZU7A 1GAGA 3ZSIA 3P9JA 3QQUA 1PRYA 2GQRA 2R9SA 4QMYA 4MQ1A 2WZJA 4JDHA 3DV3A 4YJVA 4JX7A 2WTKC 5DA3A 1XHAA 3LM0A 1J1CA 3CR0A 4USDA 3I7CA 3MBLA 2FO0A 2BRGA 3COMA 4Y46A 4ZTLA 3O8TA 4FV8A 3R8VA 5I9YA 3D5UA 4XX9A 3AC5A 3EIDA 2I0VA 2UVXA 1KE7A 4QMPA 3KULB 4FZ7A 1JVPP 4IH8A 4YHJA 5A4LA 3RPOA 2VO0A 4FT5A 3LLAA 4IM0A 1ZRZA 3P7BA 4IB5A 3LFDA 3QD2B 5J95A 1O6YA 3BWJA 4C59A 1OIRA 4BCGA 4U40A 4BCFA 3UVQA 4HOKA 2P33A 3A4OX 3D5XA 4G3FA 4BHNA 1OKWA 1UNGA 3KKVA 2X8IA 3KA0A 3WF8A 4C62A 4HVSA 5AP4A 3KQ7A 4CKIA 4HYIA 4C4HA 1YXUA 5LMBA 3D2KA 4HPUE 5H8EA 5FUTA 3BLRA 2ITWA 4KBCA 2R3PA 1XBCA 2ZYBA 1V0PA 4WBBB 4IVDA 3TACA 2C6IA 4QTEA 1KV1A 2YITA 4QMSA 4GT5A 5H2UA 2BROA 2IVSA 4AZSA 5HTCA 2Z8CA 2XEZA 3EQFA 4EKKA 5CEOA 2J0JA 1K9AA 3UYSA 2A1AB 2DS1A 3QQLA 4XUFA 3RAHA 4CFMA 3GXLA 2HYYA 2OJGA 2ZVAA 4R3PA 3LFFA 5ICPA 2WO6A 1RJBA 2QOQA 3DKFA 2QC6A 5BVNA 1YXXA 3FL5A 1PXLA 5DIAA 4QTAA 4MK0A 2YIWA 4I0SA 2CPKE 4RIXA 4PMSA 5FP5A 1F0QA 1R0PA 2YA9A 5T68A 4D28A 4CXAA 4F6SA 3TV7A 3HX4A 5KMJA 4DTAA 2GNFA 3ZXTA 3LMIA 1ZYJA 3QCXA 4DEAA 2YM7A 2R3LA 1PMNA 1H26A 3AGLA 2ZB0A 3E8NA 4RMZA 2Q0NA 3KMMA 4RIYB 4DT8A 1P14A 2W17A 3NWWA 4WUNA 4S30A 4ZTSA 4B8LA 1RDQE 2OU7A 5KBQA 3KMWA 2VX1A 3C0IA 3V51A 1V0BA 2JKQA 4K1BA 4RJ4A 4WHZA 4BZNA 3R9RA 3GFEA 4O7RA 5CF5A 3MTFA 3FMMA 4Z9LA 5EK7A 4R78A 4EOMA 3NDMA 3V5JA 4QP1A 2BR1A 5A4TA 4A9TA 4FIHA 3W8QA 2J9MA 4ONAA 4RLLA 1DI9A 3EFWA 4JI9A 4PUZA 2EB2A 3D2IA 5CVHA 3OY1A 4M13A 1FVRA 4IVBA 3SG9A 2J0MB 3WE4A 1UKIA 4UWBA 2ITPA 3ZEWA 3OBGA 3UP7A 2JKOA 4OTFA 2OZOA 5EYKA 2R7IA 5LARA 3NLBA 5HG8A 5CAOA 1OKVA 4FZAB 4OTIA 3OG7A 4WNPA 3UZPA 4DLIA 4FOBA 3OEZA 5TR6A 4AG8A 2W1IA 2UZLA 5JMSA 4FSQA 3EB0A 4LI5A 5EDPA 1ATPE 3AXWA 3FMNA 5LMAA 5CSVA 2JAMA 4DH1A 4EH9A 1FGIA 1XH5A 3GC8A 3MPAA 3E87A 3GVUA 5HGIA 4TN6A 3MPTA 5EYCA 2XCHA 1KWPA 2RGPA 4R3CA 5JK3A 4KSPA 3PUPA 4U79A 4LRJA 4FKUA 3ZMMA 2ONLA 4L01A 5FM3A 2X4ZA 3PXYA 4YPSA 2CHLA 3CBLA 3Q2MA 4DA5A 3CQUA 3MDYA 3QRTA 4HCUA 2XJ0A 1SNXA 1M14A 1Q8WA 2BAJA 2XKDA 3JS2A 3KL8A 4L9IA 4FV6A 4FKOA 5IUGA 1S9JA 2R7BA 3CD8A 3ORZA 3D5VA 4HYSA 4O7WA 3QTSA 4NCTC 4QYGA 3QU0A 4QTBA 4IAAA 4ACMA 5A14A 2XBJA 3F5UA 5I5ZA 5F20A 3SX9A 4BYJA 5CQUA 3PIZA 3N4TA 4QYHA 5E8YA 4E73A 2C5OA 5A6NA 1TVOA 3H9FA 2YERA 3EQCA 5BMSA 3DNEA 3KN5A 4P5ZA 4TYHB 4G17A 5LMKA 5A46A 1U5QA 4B8MA 3PE1A 4JRVA 2IZRA 2JIVA 3PRIA 4FT3A 1BX6A 4O7YA 3UIBA 3SV0A 3R73A 2QO9A 3VBYA 5FXQA 4BI2A 1MRVA 5IQIA 3KB7A 5AUXA 4YZBA 3LQ8A 4V01A 2QHMA 4L53A 4WG3A 4FNZA 4KD1A 3QUEA 3R1QA 3FI8A 4QP4A 4QNYA 2H9VA 5CI7A 5ETCA 4BDEA 3COIA 3SW4A 5DLSA 3MY5A 3R7UA 3C4FA 3PE2A 4EK6A 4L45A 2PUPA 1OECA 2GQSA 2IPXA 5ITAA 1JOWB 3BZ3A 3LHJA 5EI8A 2XYNA 2V7OA 2PYWA 2R0UA 2WPAA 2YCQA 4FSWA 3ROCA 1W98A 4K6ZA 1JLUE 2ITQA 3Q9WA 4P2KA 3AD6A 3UMWA 2PZPA 5KMLA 4I4FA 4F1MA 4NW5A 2BZHB 3R02A 1MRUA 4XH6A 2F2CB 4ASXA 3DT1A 4OT6A 2EVAA 3NNWA 4DCAA 3BEAA 5FEEA 4FIGA 4F9CA 5DI1A 4EHGA 5CAQA 4A7CA 4QPSA 5HG9A 2HIWA 2QOLA 4P7EA 2QURA 3CY2A 3OCGA 4NFMA 1BLXA 1Y8YA 3GQIA 1Y8GA 3ORLA 1F5QA 3I81A 4WKQA 4Q9ZA 2RFSA 4MBIA 4CFFA 1Q8TA 2J50A 4YSJA 1H1PA 4LUDA 5ETIA 2WQNA 3RM7A 4DEBA 4E1ZA 5EOBA 4M69B 3TM0A 4EK3A 3MSSA 3KRLA 2OIBA 1Y91A 2ITTA 3D15A 3HUCA 3NIZA 3O8UA 4I92A 5DBXA 1AQ1A 2GTNA 4ZZOA 5JQ8A 3WZDA 4BGQA 3PG3A 2HZIA 4EZ5A 4X3FA 4E5WA 3Q4CA 5AV3A 4IW0A 4YC6A 2BHEA 1IR3A 2QODA 3L9LA 4FYOA 3HAVA 4XLIA 3UG1A 2QG5A 3E8EA 3O7LD 5EG3A 3OWJA 5EQPA 3CS9A 3UE4A 3OOMA 1JKKA 3QLFA 4I6HA 4YJUA 2I0YA 3PSBA 3DXNA 1H07A 4IB1A 2CSNA 1WMKA 2HXLA 2XIXA 2F7EE 2XEYA 3PVBA 2ZJWA 2YEXA 4U42A 3K2LA 1ZZLA 2ETMA 3RCJA 4KABA 4LFIA 4JAIA 4O0UA 3R28A 4G9CA 2XK6A 3EL7A 4DFLA 3QTQA 4UWCA 4G9RA 4L3PA 4OR5A 3QALE 2W1FA 2J2IB 5JSMA 4ACDA 4KIQA 3AC4A 3FMHA 3E7VA 1Y6AA 2WMXA 4N0SA 4ANMA 4WNOA 3JR1A 5C03A 2GNGA 3F2NA 5DYJA 3FLYA 4DFYA 5CANA 4WRSA 3K5UA 5CY3A 4HVIA 3KXNA 4X3JA 3DJ7A 4NU1A 4LGHA 2RF9A 4DFUA 3ENMA 3GQLA 5EFQA 3QHRA 1LEZA 3GU8A 3QCQA 4TWCA 3UDBA 1JSVA 1PXPA 3VN9A 5IH5A 4IZYA 3K5VA 5HBJA 2B53A 3S3IA 2BMCA 3H0ZA 4EOOA 5C8NA 2JKKA 4E20A 2YAAA 2PUIA 4FV0A 4I24A 3Q96A 3IQ7A 2OGVA 2UV2A 3LJ1A 4ZLOA 4KRDA 2XNEA 3DB6A 4JQEA 2BTRA 3EQIA 3F7WA 4XS2A 5LVPA 1IRKA 4IAIA 4FTOA 4AOJA 4HJOA 1Q8UA 2CLXA 1J7IA 3D14A 2I0EA 2PHKA 2PK9A 4R1YA 3WYYA 3Q60A 4DC2A 3BYOA 4WNKA 4RVTA 3EFJA 4Y83A 5C8MA 3QHWA 2FH9A 4LOQA 4MNEB 5CXHA 2IW8A 5L6PA 4RZWA 3RTPA 2R3KA 3LMGA 2UW6A 3FI3A 2B55A 3MVLA 5H3QA 1KSWA 2UW4A 2X8EA 3CXWA 4PP7A 4LOPA 2VTAA 3MVMA 3MH3A 2XM9A 5ANJA 3W16A 4EK4A 1LUFA 3DAJA 3OOGA 5DT0A 5HI2A 3RJCA 5IEYA 3LFNA 1IA8A 3AOXA 5IPJA 3TNQB 2XP2A 4DGNA 4YZDA 3SXRA 3UYTA 4QYFA 3C13A 3FE3A 5AUWA 2P2HA 3RHXA 2OFVA 2FSMX 3VAPA 2ITOA 5HTBA 3ZUUA 5HD4A 4RC3A 3SXSA 4ZSJA 3ET7A 2IZSA 4O0YA 1PYXA 4BGGA 3RGFA 3UOKA 3P5KA 1OITA 2VNYA 2Z2WA 3V04A 4D1SA 2Q0BA 3EL8A 1V1KA 4Y8DA 4F63A 2PL0A 5AV4A 2GMXA 2CKOA 1GZOA 2OLCA 4ZY4A 4UYNA 2W1DA 1B38A 3ODYX 4M0YA 3BEGA 4WBOA 1KE8A 3R9NA 4DE4A 1H00A 2QLQA 1YXVA 2OZAA 5DEWA 4O83A 5I0BA 3PLAE 3SA0A 2PTKA 3P23A 3F82A 2G2FA 4G3DA 4AFEA 4IX3A 3B8QA 3GCVA 3MPMA 3TDWA 4GCJA 3LFCA 3VBWA 4YJRA 2WMBA 3NVMB 4D4VA 3G9NA 4EQCA 4AFJA 1OIYA 3UNZA 4ACGA 5J1VA 2C5NA 3HEGA 1UVRA 1XWSA 2DWBA 4FSTA 4JT3A 2OO8X 2PWLA 1A48A 4CT1A 2VWIA 2ZV2A 1Q5KA 1ZZ2A 2XZSA 5AP6A 3W2RA 2VO6A 4A07A 2AYPA 4DEEA 2C30A 1FQ1B 4TZRA 3ALOA 4W4VA 4CCUA 4EZ3A 4BDAA 4BHZA 1PKDA 4KWPA 3GENA 4FIEA 4FKJA 3PJCA 4AOIA 5J9YA 3DY7A 2V0DA 5HLNA 1H08A 4L6QA 4I6BA 5H8GA 4HVGA 4GU6A 2QR8A 4KKHA 4Y5QA 4F9BA 4O2PA 3W8LA 3FC2A 1J3HA 1M2PA 3DOGA 3L1SA 3BLQA 4JXFA 1OGUA 2VTSA 4OTHA 4PP9A 3PTGA 4RWKA 5F95A 2XRWA 3VUDA 5AV1A 4F0IA 4AP7A 4P5QA 4QMLA 3Q5IA 5BUEA 2PE1A 3NYNA 2Z7LA 2CGVA 4FGRA 3ORIA 4FG7A 2UZBA 2P3GX 4NSTA 1Q99A 5C27A 2A2AA 4WOVA 3FQSA 4ANLA 2QONA 4BYIA 1YHVA 2OXDA 4EOKA 4JS8A 2A4LA 4X0MA 5E8TA 4V0GB 1DS5A 4RZVA 3VUHA 4EKLA 2R3IA 1O9UA 3DQXA 3QKKA 1XH7A 4GK4A 4R7IA 3EN7A 2BKKA 3CLYA 1JQHA 3MH1A 1PMVA 3GBZA 4IZAA 3DLSA 4JRNA 4WD5A 3REPA 3WF5A 3A60A 4LGGA 2R2PA 3UO4A 3WOWA 4EJ7A 3CKWA 1WFCA 2UW0A 4FEQA 3FXZA 5ANDA 1PXOA 4MYGA 4ZAUA 4LG4A 5HX8A 1S9IA 4KINA 2VU3A 4QTCA 2B9FA 1BKXA 2XIYA 2Y4PA 3NEWA 4FIIA 2DUVA 3ZFMA 4JBPA 3R8MA 4EOQA 2X7OA 4E5BA 4LM5A 1DM2A 4RFMA 3RPYA 4F70A 4L52A 3QC4A 2IN6A 3S0OA 1SMHA 3ZHPC 3EZRA 3UOJA 4D4SA 5H8BA 2VTTA 3MIYA 3VHKA 4TPTA 4FZDB 3DKCA 4M97A 2R3FA 3FMEA 4WUAA 3I60A 3VS6A 4ALWA 4G34A 2XVDA 2UZVA 4BRXA 3F7ZA 1ZMVA 3QGYA 5CAUA 4RA4A 2VO7A 3E8CA 4FKLA 3ANQA 3TWJA 3SXFA 4FK3A 5JH6A 2BHHA 5FD2A 3OXZA 2XNGA 4MKCA 5TT7A 4D0XA 3HMIA 5HIBA 4I3ZA 2ITYA 2ZM4A 4FKGA 4UEUA 3UVRA 4O7VA 4RJ5A 3KXGA 3BRBA 5B2MA 3GOKA 4DH5A 4C02A 3HMPA 4YUQA 4J8NA 4W4XA 3THBA 3PZHA 4JR3A 3U6IA 5EW3A 2JBPA 3ZRKA 4UALA 3RK7A 2PMLX 3GC7A 3Q2JA 5BUJA 3TT0A 4BICA 3C4XA 3OXTA 2VUWA 4XEYA 4YGAA 3TJDA 4CG8A 5GNKA 3TNHA 4O0VA 4EH4A 4U7ZA 4TYIA 5HU9A 5KZIA 4QTDA 3DTCA 5B2KA 4PX6A 4ERKA 3DB8A 3QXPA 3MB6A 2XB7A 4E6CA 2W9ZB 4W4YA 3EQGA 4YLLA 4AS0A 4QMXA 2XNBA 4BDHA 2R4BA 2Z60A 3U4UA 2QOFA 4ZLYA 4ZTMA 4LUEA 2Q83A 4EORA 5L2IA 4FMQA 1PXIA 5AAEA 4RWLA 4ENXA 3ZZWA 2A19B 3CD3A 1M52A 4LRKA 1Q8YA 4CV9A 4EH5A 1W82A 4U5JA 4XOZA 4GK3A 4XG3A 2VWUA 1ZYDA 3KFAA 4H39A 3NUYA 4GSBA 2JDTA 3TZ9A 3V5QA 1YKRA 1BI8A 5K9IA 3UQCA 4UXLA 4JJRA 2E9NA 1OB3A 3ZFYA 3ZXZA 5KNJA 4C3PA 3R1NA 4GT3A 2JDVA 4IACA 4C2WA 1Y57A 3ZSHA 1ZLTA 2VAGA 3PXZA 4FI1A 3R8LA 1OIUA 4A9SA 3MVHA 3DCVA 1H1WA 4AZFA 5J9ZA 2VWYA 4FR4A 1ZYSA 4RFYA 5AIKA 4EHEA 3CPCA 3D7TB 2O2UA 4IHPA 3KMUA 1AD5A 4XYFA 4BC6A 1CTPE 1P4FA 4EBWA 4AN9A 4G6NA 5G6VA 4H3PA 3FHRA 4IIRA 1PMUA 2J5EA 4M12A 5CF4A 3U87A 3RWPA 3F3WA 3NRMA 4C36A 5DRDA 3R9DA 4H1MA 4LV8A 4MQ2A 4U81A 4WO5A 4WT6A 3MN3A 5AV2A 2PUUA 3LCDA 3V8SA 5AUTA 3QRJA 3RALA 3C50A 4AAAA 3BV2A 4U8ZA 3UG2A 4NH1A 3BE2A 2WD1A 5AM6A 1JPAA 2XK7A 5CSWA 1V0OA 2UW7A 2HW7A 2BIYA 2C5VA 3F88A 3SRVB 3DBDA 3VUGA 2VTMA 4HW7A 1MQBA
chains in the Genus database with same CATH superfamily
3ZOSA 4V04A 3W55A 4ZY5A 3A7IA 1URCA 1OKYA 2IZTA 5B2LA 3ORXA 3FUPA 3QZFA 4I0RA 4D5KA 4S33A 4PTCA 3ALNA 3TNPC 3F2RA 3OC1A 2WMVA 4FV9A 3TKIA 1WVYA 3LJ0A 3CEKA 3FEGA 3H9OA 2P0CA 5CQWA 1GIIA 5AP1A 2P2IA 4CMTA 3F9NA 3GU5A 4YZNA 5T3QA 4XMOA 5D1JA 3OD6X 4IB3A 1YI3A 2GNJA 2Z7SA 3GT8A 2G1TA 5L2TA 4O27B 4YC8A 1Z9XA 4DLJA 4IZ5A 1H25A 2G9XA 4MXXA 4L42A 4YURA 5GIOE 4JBOA 4BTMA 4EC9A 4OBPA 4RC4A 3RKBA 1PMEA 4HGTA 3HV7A 2QG7A 3QAME 4BTKA 4V05A 5D7VA 4NCTA 2BZKB 3AMAA 4FA2A 3P4KA 3U8WA 3WIGA 4PRJA 2JEDA 1WZYA 3QWKA 5LVOA 2ZDUA 3UZRA 1Q62A 3TNIA 4DHZA 3QQGA 4IAFA 3LM5A 2B1PA 3O8PA 4AA0A 2PMNX 2C3JA 4O2ZA 1CKIA 4JDIA 3UC4A 3HV5A 4WRGA 3R8PA 2VD5A 1REJA 1K3AA 2PE0A 3MV5A 4YHFA 2CLQA 2KULA 3OUNB 5C1QB 4KRCA 2GS6A 3H10A 4OTWA 1FBNA 4I41A 3A99A 5DPVA 2BDJA 4C7TA 3GI3A 3LKMA 1UA2A 3PFQA 4UWYA 5I9WA 3U54A 4ASDA 4QMVA 3EFKA 4KKGA 1LEWA 3KRXA 4GJ2A 4K77A 4EUUA 4XG9A 3MA6A 3ZBFA 5HICA 3ZLYA 3R63A 4IX5A 3NZ0A 3NMUF 3Q9XA 4RC2A 4DH8A 3LZBA 2WTJA 5ACKA 4MCVA 3R2BA 3D4QA 4FEWA 2IZUA 2JIIA 4X6RA 4YHTA 3UDTA 3ZDIA 3UPZA 2XIRA 2XJ1A 1SVGA 3AKLA 1YI4A 2P55A 3QQJA 4FUXA 4F9AA 2VN9A 3LCOA 3HLLA 3PY1A 3KEXA 3Q6WA 5GJGA 4Y73A 4FX3A 3NPCA 4MAOA 3ZDUA 4B4LA 1JBPE 4DBXA 4EL9A 5IUHA 3AMYA 4JG8A 2VX3A 5JFWA 4YU2A 3TCPA 3S00A 1U54A 3NGAA 2XK9A 3A7JA 2YIRA 4EQMA 1XMMA 3FAAA 3QLGA 4O6LA 3VBXA 3U6JA 2HCKA 2QU5A 3OY3A 4FEVA 4NL0A 2ZV7A 4E6DA 4IWDA 4BBEA 2WHBA 3FMDA 3FYJX 4LMUA 1ZMWA 5E1EA 3W18A 2ZM1A 2YDJA 2J0LA 2O63A 2X81A 4L46A 5IQBA 2WKMA 4EH3A 2JDSA 4DGGA 2PVNA 4EQUA 3LXLA 3PRFA 2R5TA 3O23A 3ZZEA 3LQ3A 3F3VA 5CU3A 4GL9A 3I0QA 4EYJA 5IZFA 1YI6A 3NYVA 3FZTA 4IDTA 2R3QA 3WF7A 5JGAA 5EI2A 5K5XA 5BVFA 2R3JA 4TYEA 4H05A 5E8SA 2VZ6A 4M68A 1XQZA 5LJJA 4CNHA 2V22A 4FKSA 5TKDA 4XP2A 4D4RA 4RBLA 5AWMA 3CIKA 5CU6A 3C5UA 3GCUA 4FV7A 3OWPA 1BI7A 4O86A 5IDPA 4X2KA 4RX9A 4XV9A 2ITVA 3MJ1A 4B0GA 3VC4A 4EH7A 4USFA 4K9YA 4EEVA 3LFQA 3L8XA 1O6LA 1SZMA 3HKOA 3JVRA 3QTIA 5L6OA 3HDMA 2XNPA 2Y6MA 4RT7A 1QPJA 3ZS5A 4F7NA 5HVKA 4FJVA 3JY0A 3IW8A 3Q9ZA 5C4LA 4DFNA 2V7AA 5HD7A 5J8IA 4WNMA 3VHEA 3QD3A 3LFSA 2GTMA 3A7HA 4GS6A 3W33A 4R3RA 4XG8A 3NR9A 2CDZA 1Q3WA 2WIPA 3R71A 3ZUVA 4A06A 4ASEA 2HZ4A 4AXDA 1G8KA 1SYKA 4NFNA 4C2VA 4KS8A 4F1OA 3MH2A 4N57A 3MIAA 4IZ7A 1Q97A 3EQDA 3PXFA 2VRXA 4X21A 3VUMA 2UZEA 1JSTA 2W1CA 2AC3A 3PDTA 5A4CA 2C3LA 2ITNA 4MD8E 2QHNA 4DFBA 2RG6A 3QZIA 4CMUA 2W5BA 3ZC5A 4XRLA 5KZ0A 4ZJJA 2IW9A 4FVPA 4MXCA 4D55A 2W7XA 4FG8A 3HVCA 4O7SA 4O81A 3NW5A 4KA3A 4PL5A 4FTCA 4E7WA 4BIDA 2ZMCA 3IOKA 4FTNA 2CKPA 3DJ6A 2YM8A 2GFCA 4MHAA 1ZXEA 3EFLA 3TKHA 2W1GA 4DAWA 5HIDA 3KVWA 1YDTE 4YTHA 4G1WA 2YCSA 3CQEA 5DWRA 4BDCA 3QD0A 5LXMA 3TJCA 2G15A 2X9EA 4RWIA 4QMOA 3CSVA 4B9DA 4EH8A 3QX4A 1UU7A 3BU6A 5EH0A 4MTAA 4O6EA 4AACA 3LXKA 4BIBA 4AZWA 3FLZA 3TI1A 2XUUA 2Y7JA 3F3UA 3IW6A 2X2LA 2NO3A 3R7VA 4ZZNA 5EM6A 3NUAA 2J0IA 2X8DA 5A3XA 3A8XA 3BGQA 3NUSA 2C68A 4O7LA 3BHHA 4JG7A 1GNGA 3FMKA 3QQKA 4RIWA 3R7EA 3MFRA 1SVEA 3EQBA 5BYLA 2EWAA 4GUEA 3P5JC 3BPRA 3DGKA 3F5XA 4MXYA 4FSZA 3HECA 4FTUA 2OH4A 4EOJA 4ZMFA 5KMKA 2RFEA 3GEQA 3OW3A 4I94A 3UQFA 3PA5A 5AP7A 5HE0A 3UIUA 3PVWA 2W5AA 4AQCA 3KULA 4L67A 4TYJA 2C6TA 3GGFA 3NIEA 4FV3A 3T9TA 2J90A 4AW5A 4DEDA 5B7VA 2C3IB 4RFZA 5D11A 5HX6A 2HXQA 2YHVA 3I5ZA 4AA5A 2OBJA 4LQMA 1SM2A 2E9UA 3W2PA 1T45A 5BVKA 1UNHA 3DTWA 4JQ7A 4C4EA 2GNIA 4D2RA 3OW4A 4EI4A 3DFCB 4DEGA 3TZ7A 1I44A 2LAVA 1KE6A 3E7OA 3LJ2A 4IWPA 4OUCA 4L3JA 4GW8A 4S31A 4ANQA 3P08A 4GH2A 2O0UA 1PW2A 2AUHA 5E92A 4AXAA 2YACA 3PXRA 3QZHA 2W9FB 5JZJA 3IW4A 5K4IA 4CZTA 4AOTA 3B8RA 5FXSA 5AX9A 5JKGA 3DZQA 1IG1A 4YSMA 2QVSE 2BALA 3IG7A 2ITXA 4IVCA 5BMMA 3CY3A 3F6XA 5JQ5A 5KUPA 4FT0A 5HO8A 4ZSEA 3Q53A 5CEPA 2UVZA 4ORKA 1YW2A 2HY0A 3KIOC 1M17A 2PZ5A 3R01A 5D10A 2XK8A 5EHOA 5HORA 4CQEA 1LR4A 1FMOE 2QNJA 2G01A 5KMMA 3GU6A 3EKKA 2GQGA 3SVVA 2YABA 2C47A 4GFOA 4DG3E 3E63A 3NCGA 1YOJA 4XLVA 4AGUA 4A9UA 4KAOA 4A9YA 1G5SA 3RCDA 3UZTA 4LL5A 1ZMUA 2PULA 1PXJA 5KMIA 4C4GA 4F08A 3KN6A 4BZDA 3ORKA 1GZKA 3G15A 4BGHA 2BILB 4IE9A 4IAZA 4KBKA 4Z7HA 2F49A 3SG8A 4FKIA 3FLSA 3G6HA 4RIYA 5BUIA 1FMKA 4FKRA 5ACBC 4QMQA 2OKRA 1YWRA 4FUYA 4BY9E 4BZOA 4JR7A 1PF8A 4U44A 1A06A 1PXMA 2QO2A 3FBVA 1FOTA 3GCPA 4FKPA 4RVKA 4BIEA 4F7LA 5M53A 5GIPE 4BKJA 3WZEA 1WBWA 4XV3A 3DFAA 1AGWA 2GDOA 3QA8A 2VTPA 5FBOA 5CSHA 5L8JA 4OBQA 3AT3A 4N70A 4U41A 3V8WA 4F0FA 4EJNA 3R8ZA 3G90X 4IEBA 2C6DA 1OZ1A 2WMSA 3C9WA 3LXNA 4PMTA 4ZOGA 5DEYA 5DRBA 4EC8A 4ZSAA 3HDNA 3VS5A 2XARA 1U46A 3VIDA 4EOPA 3FLQA 3ZM4A 4DT9A 1O6KA 4DF3A 3BYMA 4EBVA 5J5SA 4MXZA 1EH4A 3EJ1A 4O91A 4YTIA 3ORPA 3I79A 3DU8A 2YCFA 4I1ZA 3I7BA 5DR2A 2UW3A 4MF1A 5FTGA 2UUEA 2OK1A 2C0IA 4FNXA 3PA3A 3HV4A 1ERKA 4F7SA 1YVJA 5IEVA 4CLIA 5CTPA 2B9JA 2PVRA 5EW9A 4IJ9A 4MBJA 4J98A 4JAJA 2WMTA 5TO8A 2GS7A 3U9NA 4FEUA 4XP3A 1GIJA 4M0ZA 2ZFYA 4BVUA 3FY2A 2WELA 3IDCA 1M2QA 3PJ8A 3R83A 1J7LA 1GIHA 3HV6A 4ZXTA 3NNVA 4OTQA 2JKMA 5EQYA 5C9CA 5A54A 4G5PA 4GV1A 4IADA 1OL2A 4L7FA 2E9OA 5AP2A 3ORNA 5HHWA 2QKWB 2QKRA 3N9XA 1UKHA 4B7TA 1QCFA 4I20A 2W1ZA 2JLDA 2REIA 4U3YA 3OS3A 1NVQA 1NW1A 4BCQA 3V5TA 4PL4A 3RINA 4APCA 2UZOA 2XNMA 4YJQA 4CV8A 3H30A 3AT2A 3OCSA 3DDQA 3FL4A 3PP0A 2G2IA 3M42A 4QP8A 3ZONA 3PXQA 2JD5A 1OL1A 1JKLA 4ANSA 4BJJA 3F61A 3T3UA 2AEGA 3AKJA 5M4IA 3OVVA 4I5PA 2WTCA 4LYNA 3Q4TA 4TYHA 5GHVA 3SW7A 2HWPA 3DBCA 1JKSA 5CEQA 3UVPA 1YHSA 1APME 1FINA 4BDDA 3QRKA 2WTVA 5FGKA 2GNLA 3RWQA 5TOZA 4FV1A 1SNUA 4CFVA 5FBNC 1RW8A 3ANRA 3L8SA 1R0EA 1SVHA 1YDSE 3AGMA 3RAWA 3SDJA 1ZY5A 3R1SA 4QMZA 1VYZA 3MVJA 4FVRA 4EK8A 1XO2B 3W2OA 3BHTA 3P7AA 3DQWA 4AA4A 4AE9A 5IQFA 2I0HA 4G3EA 5C01A 1IAJA 1RQQA 4YBJA 1NA7A 2V62A 5CX9A 4GEOA 2ZV8A 4FNWA 2R3GA 4JDKA 4F65A 4KS7A 4FV5A 3TUDA 3S1HA 3TEIA 2I7QA 2DYLA 2DQ7X 3TZMA 4YR8A 3W2SA 3WIKA 4BTJA 3FLWA 3EOCA 4HZRA 3LCTA 3ZSGA 4DGOA 2QR7A 1W83A 4FTMA 2WQOA 4QEBA 4Y95A 4E8AA 4EOLA 4DDGA 4DH7A 4RPVA 5E9EA 4RJ8A 4R5YA 1WCCA 4M14A 3BU5A 4C34A 2ACXA 2BAKA 2F9GA 5L6WL 5FLFA 4LV5A 2F7XE 2Y8OA 3MFTA 4O0TA 4XNEA 3RAKA 4E4NA 3B2TA 3JVSA 3PSCA 5E8VA 3TDVA 5M4CA 1WBTA 5FM2A 5IMXA 3R9OA 3C4WA 4I4EA 3DLZA 1BUHA 1FPUA 3CJGA 3M1SA 5K3YA 3C7QA 4RJ6A 1WBVA 4AE6A 3RP9A 5EKNA 3EWHA 1WVWA 4I6QA 5F4NA 1W84A 2BZJA 2XIZA 4HVDA 5M4FA 3QUDA 5AUYA 2WMRA 4ITHA 3VS7A 1L8TA 5EM5A 2WEIA 5CS6A 3IS5A 4FIFA 4H1JA 3BIZA 3QQFA 3QTRA 3LFEA 3E92A 4MNFA 2Y9QA 1CMKE 5CF8A 4CFNA 4M8TA 1BMKA 3EQRA 5CNOA 2OG8A 3DAEA 4IX4A 2IG7A 4AXEA 3AG9A 3M11A 3TUCA 3DBEA 2FA2A 2QOKA 3O96A 4LL0A 2CGXA 4XV1A 5E91A 4GUBA 4DTBA 2YM6A 3FSKA 3GOPA 3IOPA 4FTIA 4IANA 2YFXA 4ACHA 2GSFA 3KK9A 1PJKA 3KU2A 5CU0A 2RKUA 1XKKA 1ZAOA 4OGRA 2WOTA 3EQPA 1YRPA 2XJ2A 4KNBA 4A4XA 1TQPA 1ZY4A 2WAJA 2XBAA 3BKBA 3W32A 1H1QA 3BV3A 1E9HA 4BCNA 2WQEA 4NKAA 4C33A 5DFPA 4PMPA 4U0IA 3VRYA 3Q5ZA 4DHFA 4FBXA 2W5HA 1Q4LA 3R1YA 4TT7A 4AW0A 4BDKA 4EUTA 3OZ6A 4FV2A 4YJPA 3Q4ZA 3UNKA 4BI1A 4BF2A 1KE9A 2YZLA 5D41A 3LE6A 4IBMA 2OIQA 3IW5A 5GINE 4BCHA 4N4SA 1PKGA 1OPKA 1WBNA 5AP0A 3ROYA 2YWPA 2C6EA 5E4HA 4BDGA 5IA4A 4KKEA 1PYEA 4CKRA 5JRSA 4QMWA 3LOKA 3K54A 5HE1A 3F66A 3HYHA 3TTIA 2CJMA 2OJ9A 2PVFA 3NCZA 4WSYA 3SAYA 2G2HA 1H0VA 2WMUA 3EYHA 2NP8A 3AMBA 5L8LA 5DHJA 2BUJA 4U45A 4YBKA 3VF8A 2HAKA 2VWBA 2WTIA 5IMEA 2QOBA 4RQVA 2NRYA 3BYSA 4YTFA 4ZJIA 1XJDA 1VLRA 4AGDA 4BB4A 2ETRA 4HNFA 5D9HA 4PNKA 3FPMA 1YDRE 2J51A 3ATTA 3TIZA 4MNEA 2VTLA 3ZO2A 4CFUA 2Z02A 4HNIA 2CMWA 4NJDA 3T9IA 3WYXA 1J7UA 1GZNA 3KCKA 3QCYA 4PF4A 3SQQA 5EYMA 5C4KA 4TY1A 2YWVA 1ZYLA 4D9UA 3DBQA 4HGLA 4HYUA 2OICA 3E64A 5HU3A 2BAQA 3BGZA 5DVRA 4BCJA 4Z3VA 2Y4IB 5LQFA 4O7NA 4XHKB 2GU8A 2HK5A 1BYGA 5EQEA 4ZTHA 2BFYA 5IUIA 3ATSA 3V8TA 5CNNA 4ZTRA 4XCUA 4WG4A 3TKUA 4FOCA 3ORTA 4CGAA 4ALUA 3SHEA 2HENA 3ZTXA 2W0JA 2X9FA 3FI4A 3O17A 4F09A 2JIUA 3HL7A 4PDSA 3OMVA 5A6OA 2F7ZE 4J1RA 2PE2A 1WBOA 3CQWA 3BHVA 4PDYA 3PY3A 4CKJA 3ZO3A 3SGCA 5CEIA 3ZO1A 3AT4A 4HZSA 2JGZA 1OVEA 4IJPA 3UOHA 2W4JA 3OT3A 2BRNA 3O0GA 4GKHA 4I93A 3HZTA 4ZZMA 1PY5A 4H3QA 3F2AA 2Z7QA 4GMYA 4YNOA 2F4JA 2CNVA 3EMGA 5HCZA 5IA5A 5GJFA 4QP7A 2J7TA 3TNWA 4BTFA 1JAMA 2QOIA 5HVYA 3DNDA 3G2FA 2YM4A 5DT3A 2Y6OA 4AT3A 5M09A 4E93A 3E88A 3VJOA 3QD4A 4ARKA 4NM7A 4GJ3A 4X2GA 2C6KA 4D58A 3HNGA 3R7YA 1B39A 2QQ7A 3B2WA 3ZLSA 2JDRA 2OJFE 5AEPA 3TV6A 2JBOA 3COHA 3KRJA 3PJ2A 3IDPA 2Y0AA 5BVWA 1MUOA 3LPBA 5M56A 3HP2A 2YZAA 5K4JA 1R1WA 3LFAA 4QQTA 4NTSA 3LIJA 1KUTA 4H58A 1IAHA 3MGYA 5ETAA 2XK4A 1KV2A 3C0HA 2JFMA 2UZNA 4IAKA 2GPHA 4IX6A 4DH3A 4ZP5A 5M06A 2NNWB 1QL6A 3DBFA 1ST4A 3II5A 3NNUA 2YDKA 4RVLA 4RX8A 4NM3A 5M55A 5CAPA 3V3VA 5IF1A 2WU6A 3ORMA 1OBDA 3HMOA 4OTRA 3TMOA 4ID7A 4RIXB 3G9LX 3I1AA 3QX2A 4XG2A 2YM5A 3D83A 5L8KA 1H24A 3KGAA 4O7TA 4U9AA 2C5XA 5IDNA 1ZYCA 3QTWA 3TTJA 4R77A 2XM8A 2ZM3A 3WZKA 4ZSLA 4ZS4A 4LRMA 3VBQA 2B52A 2ESMA 5F9EA 4I21A 3LVPA 4BCKA 3ENHA 3DS6A 5KE0A 3RVGA 3WI6A 4E6AA 2OXYA 2CCHA 3VS3A 4V0GA 5E8XA 4E4LA 2XMYA 3OF0A 4QMMA 3HV3A 2GCDA 3CPBA 3MA3A 4KIPA 2UW8A 1ZOEA 2PMIA 5KKRB 3UIMA 3I6WA 4G16A 3UMXA 3QFVA 3RI1A 5M07A 4ACCA 5JGBA 4DEHA 4DGMA 1L3RE 2VWZA 4FKTA 4JDJA 1JSUA 4RG0A 5BYZA 4N6ZA 3G0EA 4A9RA 3TXOA 1YXSA 4R6VA 3U55A 1Q61A 4OBOA 3VVHA 2YM3A 3L8PA 4NWMA 2RIOA 2W05A 3GCQA 3BYVA 3CTQA 3EN4A 3FZ1A 4BDJA 1FVVA 1Z5MA 4QQCA 3ML1A 1UNLA 3FWQA 3WZJA 4O22A 1LPUA 3IK3A 3HRFA 4TL0A 3H3CA 3ZO4A 2RFDA 4G3CA 4QP3A 5JZNA 4O82A 4AN2A 4MWHA 4HVHA 3DXPA 2UVYA 2H6DA 3MWUA 4OLIA 3LMHA 5HEZA 4DN5A 2ERZE 1R3CA 3EN9A 5M44A 3VULA 2WQMA 4MVFA 4FT7A 3G33A 1HOWA 2OJIA 3RPVA 3ACJA 2X2KA 3CGFA 4B6LA 4ENYA 3OWKA 4FSYA 4FZFB 3ULZA 3DKGA 3UC3A 2EXCX 3OROA 4FTTA 4QMNA 5K5NA 3PYYA 4I5MA 3D9VA 4Q5EA 5CT7A 3TIYA 4CTCA 3JYAA 2ETKA 4QNAA 4EYMA 3NVKI 3SC1A 2CKQA 2FVDA 3FHIA 3P79A 1OPLA 4FSMA 1ND4A 3ITZA 4F6UA 1NT2A 5AA8A 1P4OA 1Z57A 3NAYA 4PDPA 3K3JA 3Q04A 4QOXA 3BWFA 2E2BA 3E8DA 4NM0A 5IQEA 3EH9A 3F5GA 1PXNA 3IW7A 1OBGA 3TL8A 4K18A 5CU4A 3VS0A 4QP6A 3ELJA 4JOAA 4FSUA 3O50A 4J99A 4ITJA 3GNIB 4TWNA 1XR1A 3HA6A 4MBLA 4RIWB 5ETFA 4B99A 2C6LA 5ANEA 1YOMA 2JDOA 5EW8A 3V5WA 2B0QA 4TNBA 2IVTA 3TV4A 2QCSA 3GU4A 3EN6A 3MESA 4BCIA 3OHTA 5EM8A 2YISA 3V6RA 1KOAA 2YN8A 3LXPA 2IO6A 2WIHA 3P7CA 3ZCLA 4CMOA 4QQJA 4EH2A 5AM7A 3P78A 4ZTNA 3G5DA 3NAXA 2X7FA 5DR9A 3VW6A 4UZHA 4TXCA 1FGKA 2XA4A 3NUNA 5C8KA 2PVYA 3OT8A 4X7QA 1LP4A 5M57A 4P90A 1Q8ZA 3FKNA 1UU3A 2A0CX 3RM6A 4PWNA 3COKA 3UIXA 5BYYA 3CTJA 2EUFB 3U9CA 2W99B 4PV0A 4APPA 1U4DA 3N4VA 5HE2A 3W1FA 4Z16A 5ANOA 4RA5A 2CNUA 5LCKA 4AWIA 3AD5A 4R7HA 1KE5A 5JFXA 4I0TA 4C38A 2BRHA 2QOHA 4MWIA 3QCSA 1XBBA 4D9TA 5J1WA 1M7QA 3HAMA 4YJSA 5I9ZA 1TQIA 3D7TA 4GYIA 2XYUA 2VTJA 4CRLA 4QMUA 3UO6A 4C4IA 4EHVA 5AV0A 3W2QA 2X6DA 3KF7A 4RLKA 3H9RA 5E7RA 2C1AA 5AAFA 1UWJA 4CCBA 4O0SA 4BDIA 1ZOHA 4RQKA 3EN5A 3FZSA 3MS9A 4RRVA 4YO6A 4DHJA 3QTZA 4FTRA 3UNJA 3PVGA 3AC1A 3SKCA 4RIOA 3GC9A 2VTRA 3VS1A 4K2RA 3I0OA 1OUYA 3FMJA 4JMQA 2X2MA 4KSQA 3TG1A 4G2FA 3CP9A 2YIYA 3SRVA 1IASA 4M3QA 3ZH8A 3PLSA 3JY9A 4YMJA 4X3FB 4CT2A 2W1HA 1JWHA 3OEFX 2PVKA 2VO3A 2XKEA 4FZ6A 5BX0A 3E3BX 3EQHA 5HE3A 3G6GA 3MYGA 3SD0A 3VNTA 4EOIA 2FUMA 5CT0A 1HCKA 5E90A 4NM5A 2ZB1A 3VBVA 4YJTA 2H8HA 2FGIA 3R22A 4NJ3A 4FTLA 2WNTA 4BBMA 4ZJVA 3C1XA 3HRBA 1X8BA 1MP8A 4PMMA 5EYDA 3C51A 2QO7A 3OTVA 4AUAA 1TKIA 2CGUA 3VO3A 3FKOA 5DN3A 2VNWA 1I09A 4ALVA 1H28A 2BDFA 4JVGA 4LOOA 4TWOA 5G1XA 3G0FA 3OUKA 1M2RA 4FICA 1GOLA 4IMYA 4LMNA 3EKNA 3MY0A 4FTAA 4TYGA 4AX8A 3MY1A 5CASA 4G5JA 4IM2A 5JRQA 4JQ8A 4JLCA 4F64A 3JUHA 3KXMA 2CN5A 1QPDA 3UODA 3OXIA 1YXTA 5EM7A 1OL6A 2JFLA 4FK6A 5AIRA 4USEA 2B9IA 4JIKA 4O0XA 1H1SA 2W96B 5BNJA 5AMNA 3U6HA 3Q4UA 4J97A 2PVJA 4ANBA 1YOLA 1WBPA 4IB0A 5HCXA 5FTQA 5J9LA 5FP6A 3UDSA 1XMLA 1OKZA 2UZTA 4W8EA 4EZ7A 2BPMA 4O21A 4RWJA 5LVLA 4DBNA 4UV0A 4BCPA 3FJQE 3MH0A 3H0YA 1PXKA 3ZYAA 4FSRA 3ZBXA 3BQRA 3PWDA 4YJOA 4QPAA 4FGBA 4RGJA 1E1XA 4BN1A 2BRBA 2PVMA 2IJMA 3PWYA 3BYUA 3CGOA 1WAKA 3AC3A 3QWJA 4AQKA 4AT4A 1JKTA 3AC8A 3Q52A 3FQHA 5EHYA 3A4PA 5KMOA 4QYYA 4AW1A 3P1AA 3Q3BA 2F2UA 4PTGA 4W4WA 3KK8A 2VGOA 3UJGA 3DK7A 3SOAA 2Y4IC 4PY1A 4L8MA 2X6EA 1H0WA 2BVAA 2WXVA 3FZOA 2CNQA 2IVUA 2W1EA 1URWA 3BCEA 3OBJA 4K0YA 3IPHA 4J52A 3BLHA 4NT4A 5GJDA 3V5LA 4IAYA 3VQHA 5HIEA 4JG6A 2OIDA 5A4EA 3VONA 3KY2A 3RHKA 1OI9A 2BTSA 3NW7A 4MEDA 4TNDA 4BR3A 2R3RA 5HVJA 4GFMA 4C0TA 1GZ8A 3ZRMA 1RE8A 4W8DA 2R64A 3EHAA 3ULIA 2OSCA 2VTQA 4FL3A 4IC8A 3HRCA 5LCJA 4YZCA 5B0XA 4Q5HA 3RPSA 3NS9A 2XH5A 4S34A 3UPXA 3WF6A 3LLTA 3DK3A 1OL7A 2CCIA 2W4KA 3BL7A 3QL8A 4M7IA 2OZAB 2VTOA 4K8AA 4CD0A 4EK5A 3ID6C 4FV4A 4FKVA 4JIAA 4TW9A 5HO7A 2P4IA 5LVNA 4ZS0A 4MXOA 4CZUA 5FG8A 3MJ2A 3R00A 3FPQA 4C3RA 5IQGA 1K2PA 5L2SA 5EHLA 3DA6A 4YTCA 3PFYA 3QA0A 5CEKA 2C1BA 2PPQA 5FEQA 3WBLA 4ZY6A 2QOOA 3QZGA 3G51A 1E1VA 1IA9A 3FSFA 4GFGA 4ZK5A 4BDBA 4DFZE 1GJOA 2R3NA 2X4FA 3CCNA 3H4JA 3NUPA 4G3GA 5T6KA 5M08A 4X2JA 2I6LA 1VZOA 2W4OA 3V01A 4A4LA 4E5AX 2WOUA 2OF4A 4WA9A 5CENA 4CG9A 4L68A 3ZUTA 1CDKA 4FVQA 2HY81 4BDFA 4GIIA 4IFGA 2NRUA 1WVXA 4UBAA 2WMQA 4ZLZA 5CWZA 2J0KA 3FMLA 3R7IA 3R04A 4H3BA 5BVDA 4CFXA 5CVFA 3VJNA 4GYGA 3UTOA 3PXKA 3ZC6A 4CLJA 4Q9SA 4RJ3A 3R8UA 1TQMA 3RPRA 4YLKA 4R5SA 2VWXA 4L7SA 3BHUA 1P2AA 4N6YA 5E8UA 5AUVA 3VBTA 4DEIA 4E4XA 3KXXA 5AUZA 4EH6A 4GVAA 3MTLA 5FTOA 4YJNA 2QI8A 3O2MA 4C35A 2GHGA 5I9XA 3QRIA 5L2WA 1G8AA 4MD9E 3JXWA 2OWBA 3IKAA 5CSXA 2C0TA 4R1VA 4F0GA 2WEVA 3WILA 2GNHA 1F3MC 3QTXA 4RVMA 5HBHA 3ZM9A 2XKCA 4F99A 4L44A 4QDEA 5CZHA 4QQ5A 4YP8A 2EU9A 3POZA 4PL3A 3VF9A 5KKRC 5AX3A 4PQNA 1Y6BA 4WG5A 4XRJA 1CSNA 1R78A 4HGEA 3ZRLA 4QMTA 3GCSA 2VWWA 4FT9A 5E8ZA 3TZ8A 3UO5A 1OM1A 3PJ3A 2WMWA 2KTYA 3DXQA 4BCOA 4C58A 3OTUA 2IWIA 1NXKA 3Q9YA 1VEBA 2FSLX 4O84A 2QD9A 4XG7A 4I5HA 4DG0E 4BCMA 4KUJA 3CE3A 2E9VA 4FKWA 3IDBA 2ZMDA 2ZDTA 3V6SA 5AADA 4EWHA 3MB7A 5A4QA 4AZEA 2J5FA 2RL5A 4FNYA 2FSTX 3IONA 4EOSA 4II5A 3LCKA 4PNIA 2HW6A 4J71A 1YWNA 1ZOGA 3U51A 3KXHA 4DYMA 4J96A 4U97A 3FLNC 2YDIA 1WBSA 4DTKA 4RJ7A 4XP0A 4FL1A 3VS4A 2C5YA 2IVVA 3FZPA 4NYEA 4AGWA 5AJQA 4FE2A 4F7JA 2WMAA 2UW5A 2WQBA 2H96A 4E4MA 2B4SB 2CN8A 3Q6UA 3P0MA 4UB7A 5HBEA 2ONLC 5CZIA 3LAUA 3DKOA 3FQEA 3PIYA 4YLJA 3O7LB 4ZTQA 5HG5A 3VUKA 2WTKB 5A9UA 2VX0A 5EKOA 2Z7RA 4S2ZA 5IA1A 4C4JA 3FXXA 3VUIA 4UX9A 2BCJA 4DCEA 3I6UA 4D1XA 4AU8A 4FIJA 4LDTA 3BI6A 4L00A 3FI2A 3FKLA 5KX8A 4EWQA 3QF9A 3KREA 4UN0C 2R0IA 3NSZA 4DITA 2OW3A 3D94A 4D1ZA 2CKEA 2O8YA 4H36A 4OTGA 1A9UA 4J7BA 2ZAZA 5AP3A 4DFXE