5M09A

Crystal structure of mycobacterium tuberculosis pkni kinase domain, c20a_r136n double mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
246
Chain Sequence
MALASGVTFAGYTVVRMLGASAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHNDVNPANVVLTSQDQRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Signaling protein
molecule keywords Serine/threonine-protein kinase PknI
total genus 70
structure length 246
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m09A01
1H1SA 2G15A 4IACA 1U5QA 4DG0E 4YJSA 4QQJA 3B8QA 5AWMA 1H01A 2JEDA 3TEIA 3PA4A 4YO4A 2YA9A 3UO6A 1HCKA 3ACJA 3AMYA 5DH3A 4FVRA 4YPSA 1H24A 4I0SA 3PG1A 3F69A 4Y8DA 4KB8A 1OM1A 3M2WA 3GCQA 5K3YA 1SNUA 1ZYCA 5HU9A 2B9HA 3QTZA 3HAMA 2XCHA 4ZP5A 4TL0A 3DKGA 4WT6A 5I9UA 4C0TA 1AQ1A 3R00A 3MA3A 3QHWA 4GVAA 5F20A 3NUUA 3LE6A 1CKIA 4CGAA 2UVXA 3D7TA 5CALA 4U5JA 2GHLA 2HZNA 3DLSA 2GMXA 1DS5A 2GU8A 2XNGA 3NS9A 4V05A 4A06A 4RLKA 2BRNA 3BEAA 5HORA 1R0EA 1QPCA 2VUWA 4AN3A 4JNWA 4ZTMA 2Y4PA 4QMMA 2FYSA 4FGBA 1S9IA 4A4XA 4BY9E 3F2AA 4ASEA 4P2KA 4TYHA 3ULIA 4EC9A 3VQHA 4F0FA 3OOGA 4EH6A 3KVXA 3GQIA 3FUPA 4YJVA 2XBAA 3FLYA 4NFNA 2C6KA 4IZ5A 5E90A 3C51A 2CHLA 3VW6A 3ZEWA 3PPKA 2DYLA 4TNBA 3R7UA 2FVDA 2NRUA 3HA8A 3PE1A 4FKQA 4GUBA 4BCPA 5KX8A 3AC4A 3F5PA 3V6SA 5HD7A 3RCJA 1WBPA 4MD8E 5CLPA 3WARA 4V0GA 4C33A 2P55A 4DEGA 4FSNA 5M56A 3DB6A 4U45A 5LVPA 3AXWA 1W83A 2VAGA 4CV8A 2B1PA 3E3PA 4NJDA 4OBOA 2XJ2A 2B9JA 4R78A 3G0EA 1PMNA 1ZARA 3DAJA 4HGSA 4I21A 4RRVA 5HBEA 4QMQA 2R3OA 4M68A 3QC9A 4RFYA 2J0LA 1W98A 4FTLA 3UO4A 4MD9E 3DCVA 4AOJA 3D7ZA 4KRCA 1Q99A 3NUAA 4KD1A 4UBAA 3VF8A 2XNOA 5GIOE 3K3JA 3ANRA 3PP0A 3K2LA 3KXHA 1SVHA 4FT3A 2QG5A 4PDOA 2P3GX 4F08A 1V1KA 5M4IA 3OY1A 4WIHA 3HDNA 3DK6A 3GC9A 4FSZA 2OSCA 3K5UA 2W0JA 4P90A 4BYIA 1UV5A 2Z7QA 2IZSA 4NSTA 1BYGA 1FVRA 4XX9A 3R04A 3REPA 2IVTA 1NW1A 3LFFA 4FIEA 4QRCA 5FXSA 4BIBA 2V62A 1Q3WA 1A9UA 2A2AA 5G6VA 4BTKA 3VVHA 2C3KA 4U8ZA 3QX2A 4TKSA 3QQFA 4X3JA 4L7SA 4XV9A 1MRUA 5A6OA 2GQRA 1VYWA 3D2KA 4MXXA 3OXIA 4DN5A 4D4SA 4H3QA 3EH9A 3QALE 1GZKA 2PUNA 4RSSA 3IW6A 3LXNA 4CFVA 5IQGA 2W1HA 4AX8A 1WMKA 4DTBA 4C4EA 3FC1X 5D10A 3P08A 4EWQA 1H1WA 2BRMA 3Q9XA 4HOKA 3VRYA 1M14A 2X81A 2Z2WA 3EQHA 4IX3A 5KZIA 5BMMA 2XK6A 3RPSA 4H3PA 3GENA 3I1AA 1J7UA 4BCGA 2X2MA 1JAMA 3H0ZA 5JZNA 4AT3A 4JAJA 5M07A 3CTHA 5HE2A 4CMUA 3DBEA 3ORZA 5DPVA 1M2PA 4W4WA 4NKAA 5AA9A 5ITAA 3W8LA 2WZJA 1H25A 4IE9A 4C59A 4E20A 5A54A 4JBPA 4LL5A 3SDJA 3TNHA 3GCUA 4EOOA 3HMPA 4C3FA 4IQ6A 4I1ZA 3NUNA 3IECA 5AP4A 2C5YA 4HJOA 4WG5A 2UZBA 5EQPA 2OF4A 5HESA 4YBKA 4U40A 5AM6A 2CN5A 4AU8A 4EUUA 4FK3A 4GCJA 3GOKA 3I81A 4IJPA 5BQ0A 4E93A 3UMWA 3ZBFA 4YZMA 4BCOA 5CU3A 1E9HA 2C5NA 3QA0A 5EYDA 1PMEA 3UMXA 2HZ0A 4QMUA 1BL7A 2OJ9A 4YR8A 2R9SA 4HVGA 4HZSA 3SRVB 4AZWA 3WZDA 4KNBA 1YWRA 4L3JA 2OZAA 2CLQA 2X9FA 4CKJA 4KSPA 2XKDA 4EQCA 3PXQA 2PSQA 2ESMA 4F6WA 2O65A 2C1AA 3CJGA 4B6LA 3D5WA 3IOPA 3M11A 3Q9WA 2UW5A 4JIAA 2V5QA 1F3MC 4FG9A 5HIEA 3RTPA 4AGUA 2I40A 2C6DA 1QL6A 2Y8OA 1IAJA 3ORIA 4AGCA 2BZJA 2VN9A 4PV0A 3ODZX 1JKLA 3PY1A 4MXOA 3QKLA 2WMXA 3RJCA 3PG3A 4L43A 4IB0A 2YJSA 4MD7E 5L8JA 1Y91A 3Q4ZA 5CXZA 3LOKA 2ZV2A 4R5YA 1RW8A 2WU7A 5DVRA 3ZZEA 3DNEA 2VO7A 3KGAA 2QOLA 2OK1A 2RFDA 2Z7SA 3DQXA 4CKIA 4YMJA 5A14A 3S1HA 4U3YA 4D0XA 4TRLA 4E5WA 4K6ZA 2YFXA 4X2FA 4MBJA 4A7CA 3ETAA 4FKWA 4XG4A 3EN9A 5DFPA 2X39A 4AA5A 4F6SA 5I9WA 3T9TA 1YRPA 1OL2A 4KINA 4I41A 2VWIA 4BR3A 3OG7A 5BVEA 3GCVA 3QTUA 1UKHA 5IQBA 4JG6A 2PVKA 2QQ7A 2C6EA 3BHHA 4GFOA 2VWZA 4BCMA 3OWPA 1IASA 4LOQA 5E8WA 3DXNA 4YJPA 2XZSA 3FI4A 3QHRA 4IWPA 3PVWA 2QR8A 4PTGA 4QP8A 5AJQA 3TTJA 5IH5A 4X2NA 4KKGA 2ZVAA 3RALA 1KE9A 4L46A 3PA3A 1Q62A 4O7YA 3VIDA 2F7ZE 4JX7A 4DEAA 1RJBA 1YI4A 4ZTLA 3LFNA 3KKVA 4Y5HA 3F5GA 4FT5A 1Y6AA 2VNYA 4I92A 3PSDA 3UJGA 4QTEA 2X2KA 3CC6A 4FK6A 5TKDA 1YVJA 2WMAA 3FDNA 2WQOA 3KMUA 4WBOA 5EG3A 3ZC6A 5I9XA 4H05A 2F7EE 4CMOA 2NP8A 4MKCA 5JN2A 3FI3A 3RM6A 4BI2A 3Q9ZA 3Q53A 3MS9A 3W32A 2ONLA 3ENMA 3ZONA 1JBPE 5E7RA 2QI8A 5M51A 4E5AX 2FB8A 3HMOA 2VTRA 4JBQA 3OCTA 3TXOA 4TPTA 4YNOA 5AV2A 3EYGA 5HX6A 1Q4LA 2VU3A 1KE5A 1OIYA 3HDMA 4ACMA 3GGFA 2C6LA 1P4FA 4HVSA 4YZNA 2BKKA 3Q9YA 4YLLA 1XH7A 3AD4A 3GEQA 2HAKA 1Y8GA 1JKSA 3BYVA 3I5ZA 4R77A 2XVDA 4XLVA 4AXAA 4DAWA 2VGPA 5LXMA 5C1QB 2BCJA 4DEIA 4HNIA 5DT3A 4I20A 4X0MA 4M67A 4O0XA 4R7IA 1V0BA 4XS2A 2BTRA 1YKRA 2HK5A 2YM8A 3MJ2A 3QC4A 4EH2A 5AV0A 3LCDA 2WOTA 3SW4A 4NM7A 5BMSA 3MESA 3F5XA 2WELA 3OW4A 3VJNA 3QWJA 3S0OA 2Q83A 2XK3A 2Y4IB 3OEFX 3VBXA 5IISA 4GK2A 4I22A 3ORMA 3QGWA 2H34A 4BTFA 1GIJA 4NCTC 1P14A 3BYMA 3FLNC 4GKHA 2VTMA 4WG4A 5JSMA 2I0HA 4L53A 3E88A 3EZRA 4FV0A 4PL4A 4CTBA 5CEMA 5AUWA 4IDVA 3F2RA 4YZCA 5HBHA 3FYJX 5EW9A 4MX9A 4ANMA 5HVJA 2X4FA 3CJFA 5F1ZA 4ASXA 3Q4CA 2Q0NA 3OWKA 1V0PA 3DTCA 5E1EA 4GIIA 1XBCA 3WF7A 2WU6A 2QC6A 1T45A 4WA9A 4LQMA 1TQIA 5EM6A 2JIVA 4NUSA 3RHXA 4YBJA 3DZOA 3FXZA 4ONAA 2Z7LA 1PXOA 4BCJA 4RIXA 3GFWA 4JIKA 2WQEA 5IQHA 2WTIA 3KEXA 3OXTA 3E87A 2BIKB 2PULA 3RPVA 3UP7A 4QMSA 1QPJA 2QOCA 3PJ2A 4J8MA 3FMLA 3ZBXA 5CI6A 4ZEGA 4I5PA 4PF4A 4EOJA 4ZJVA 5A4QA 1XH4A 4N6YA 5EH0A 3EZVA 4PDSA 3IDPA 4EORA 3MVMA 3KULB 4DH7A 3SG9A 3EQCA 3BPRA 1PXMA 2B55A 4PMMA 2HENA 1GIHA 2DUVA 3OFMA 4O7SA 2WXVA 3V8WA 4N0SA 4ENYA 4X3FC 3ULZA 5A3XA 2WMRA 1PKDA 3LZBA 3BE2A 4OR5A 3EJ1A 3NVMB 4FNXA 1JKTA 1CMKE 4HGTA 2G1TA 3HV4A 3MB6A 5FRIA 1M2QA 3EB0A 1ND4A 2GQSA 4EWHA 3HGKA 3OP5A 2IZUA 4DITA 3TJCA 5IA3A 3WZJA 4NM3A 1J91A 4FV6A 5ACKA 2YDIA 5CSXA 3U4WA 3VJOA 1UNLA 5LMKC 3UPZA 3FI8A 3HLLA 3A7FA 5CEKA 4QMOA 5AAGA 3ZLWA 4Y83A 4I4EA 5FXQA 1H28A 3BEGA 3WE8A 3E93A 5FLFA 5JGBA 2RFNA 4R6VA 4LG4A 1YWVA 3DOGA 5L6WL 2BKZA 2YEXA 4S32A 3K54A 3RK7A 3NMUF 4HCTA 4N70A 1K9AA 2IZTA 4TYGA 3CLYA 4Q9SA 3KU2A 3GU4A 5D7AA 4UV0A 5EKNA 3QD4A 4X21A 3BZ3A 3WZUA 3SVVA 5J87A 2EVAA 3DBDA 2OIBA 1U54A 4W8EA 4BKJA 1Q5KA 2CGUA 4BDKA 4CG8A 1MUOA 4BGGA 3D83A 1KE8A 3O71A 1XR1A 2C1BA 4JI9A 3KMWA 4KIPA 4XLIA 4HVDA 3OCBA 3W2RA 2X7GA 4AOIA 3SG8A 3F5UA 3KC3A 3D7TB 4RWIA 4JBOA 2JBPA 3UPXA 3VUMA 5HBJA 2QLQA 4KWPA 5TT7A 3MVJA 3SLSA 1J3HA 3QLGA 3KY2A 2UZOA 3OD6X 5D41A 5IEXA 2GNIA 3VC4A 3A61A 3NIEA 4QYFA 4C4IA 4I0RA 3DNDA 3QTQA 3O8PA 2HWOA 4TT7A 1XBAA 4RGJA 1HOWA 3IW8A 4NJ3A 1PYEA 3CD8A 4LM5A 4O7TA 4F64A 4Z16A 5M4CA 2WTDA 2E9NA 2PPQA 4QP9A 5TOZA 1BMKA 5F95A 3RAKA 4H36A 5DI1A 3HAVA 4FTRA 4QQCA 3R8MA 4H1MA 4FTUA 4FL1A 4FVQA 5B2MA 5IQCA 3VRZA 3DA6A 3VBTA 2R4BA 1PJKA 1VR2A 2IW9A 3RPRA 1GIIA 5D11A 1NT2A 2BAJA 3G33A 4YC8A 2ITZA 2Y9QA 4RIWB 2QVSE 2JGZA 1I44A 5CZHA 1ZY5A 4IAZA 3VQUA 3TNPC 3GFEA 4N6ZA 2Q0BA 1XQZA 4ITJA 4B8MA 2BDFA 4YTIA 5FUTA 3R9RA 3MTFA 3FPMA 5AM7A 4FL2A 2PK9A 3G6HA 1R78A 4RA4A 4XBUA 3CY2A 4YJRA 5BNJA 4EH7A 3FI2A 3GVUA 3MH1A 3RGFA 3W2SA 5KMJA 5JMSA 3SXRA 3LMGA 1GZ8A 2V22A 2C3LA 5J8IA 5HVYA 2J5EA 4V01A 3ZFXA 3ZTXA 4G17A 4I5HA 5EYMA 5CAUA 3HRBA 5IA0A 1KWPA 3QRJA 3FXWA 2OFUA 4FZFB 3H10A 2BR1A 1ZAOA 2NO3A 4TN6A 4UX9A 2YZLA 4ZS0A 3FKNA 4FTCA 3ZZWA 2QOOA 3QUEA 5BVOA 4HYIA 4LUDA 4IDTA 1YDRE 4MVFA 5DGZA 3QWKA 1XWSA 1WVYA 5EQEA 2UV2A 2XIXA 3C4XA 5B2KA 1JLUE 2JAVA 3MWUA 2GNGA 4ITHA 1UWHA 3JUHA 4B4LA 4CFWA 1J1CA 4R1VA 5C8MA 4AWIA 4M13A 4BDJA 4RQKA 5IDPA 5M44A 3F2NA 4MCVA 2C47A 5EHOA 1UU3A 3HKOA 2VO6A 3SD0A 4C61A 1STCE 4XV3A 2GHGA 4ZS4A 4EK8A 3H0YA 3EQBA 1KE6A 3G15A 3Q5ZA 4EEVA 1H08A 2YITA 4IX6A 2SRCA 3TZ8A 2UZDA 2GNJA 3R9NA 2ZB0A 5FDXA 3U6HA 4S30A 3OW3A 4G3CA 4RJ3A 4FGRA 1PXLA 3QCXA 4RVTA 3QZIA 3PJCA 5IU2A 3MVLA 4IAFA 1NA7A 2UW8A 4D2RA 5CWZA 2QKRA 4O7NA 4II5A 1ZOGA 1WFCA 2FSLX 2O3PA 3B8RA 3PZHA 2W4JA 3P86A 3BHVA 1GY3A 2ETMA 4DLIA 5FD2A 2BHEA 2QOHA 4G3EA 3ZEPA 1CSNA 1YHWA 3E8DA 1MQ4A 1OPLA 3C9WA 3MPMA 2W7XA 3I5NA 3LXLA 3O23A 3QQJA 4GEOA 4MH7A 3L8VA 3V01A 5IQDA 3UOJA 4IBMA 2WEIA 5AA8A 3KRRA 4G1WA 4XCUA 3QUDA 4JQ8A 4XP3A 2OZOA 1PKGA 2YCFA 4D5HA 3I79A 2CNUA 3PLAE 3DJ7A 3E7VA 3H9FA 3ZO3A 3AT3A 1ZYSA 3R8LA 5AUUA 3SX9A 2F9GA 3GCSA 4BRXA 4C4GA 1G5SA 3BWJA 4EUTA 2HXQA 4RBLA 4TWNA 4FKGA 3QTWA 5LVMA 2G2FA 3LMHA 3QCQA 3HUBA 3LCOA 3OROA 3PP1A 4UZHA 5EHYA 5AV4A 3ZSIA 3F61A 3QU0A 4GFMA 4PX6A 4ACGA 5KO1A 4DHFA 1XH8A 4IJ9A 5CSWA 4WNOA 2HXLA 4KBCA 4Y85A 2BVAA 5LVNA 4PL5A 4BBMA 3FMDA 2OFVA 3TG1A 2R0UA 4HVIA 2W5HA 4O91A 5DE2A 3DJ5A 4EH9A 3ZS5A 3IKAA 2X8DA 4IIRA 2WNTA 5TF9A 4IZAA 4K11A 3KXZA 3KCFA 1JSUA 3BYSA 4WUNA 4AFEA 4FNYA 3WF6A 4OTFA 3EHAA 1OL6A 3LM0A 3PE2A 4J1RA 4QP7A 5DR2A 4YJUA 4H1JA 3QXOA 5AEPA 2XM9A 2XNMA 3ORXA 3W16A 5EW3A 3ZMMA 1O6KA 3ZLYA 1GZNA 2J6MA 4CT1A 4F9BA 4FR4A 2QHNA 4GFGA 2XNNA 3QQHA 5E1SA 2CCHA 3KRJA 5E8SA 1YI6A 1G8SA 5EKOA 3RCDA 4I23A 5L2SA 4LYNA 3KXXA 4Y73A 1H07A 4O83A 5IA2A 4FUYA 1YXUA 2XRUA 3IO7A 2PU8A 4RFMA 4QMWA 4BCIA 4E4MA 1KUTA 1A48A 3AT2A 2OBJA 3C7QA 3HMNA 4IAIA 3UODA 3DKOA 2PVLA 4CKRA 4WO5A 4BGQA 4O7VA 4QPAA 4K18A 1Q8ZA 5DT0A 3IG7A 5CI7A 4YLKA 3AC8A 1KOBA 4RWKA 4A9TA 4V0GB 4F7LA 3EWHA 4FG7A 5A4TA 5F9EA 3MSSA 2W99B 4TZRA 4OTRA 2PZIA 3UC4A 4E6QA 4ZY5A 1LEWA 4DFBA 2XK8A 3GT8A 4F9CA 5BX0A 5CEOA 2H96A 4I3ZA 3NW6A 2XA4A 1OKWA 3EIDA 3KRLA 4GRBA 4CQEA 2XEYA 3TDVA 5AUZA 3BWFA 4BCKA 5I0BA 1LP4A 2OIQA 1PMUA 3HX4A 3VS2A 2UW7A 5ANKA 2WQNA 4JJRA 4MBIA 4IAKA 4E26A 4QYYA 2HYYA 5FTOA 1W82A 4E8AA 4HW7A 2CDZA 4CD0A 4GUEA 5C4KA 3PVGA 1FVVA 4E4NA 5FM3A 2XJ0A 3FSKA 1IRKA 2EXCX 3F7ZA 3UE4A 5BVDA 1PHKA 2I0YA 3FY0A 1E1VA 3Q96A 3QLFA 3ZO2A 3HRCA 2W1EA 3D14A 5KMNA 1IA9A 3BI6A 3VBQA 4EJNA 4L8MA 2WMSA 2UZWE 4O38A 3CKXA 3W18A 3GNIB 2XJ1A 5GJGA 4FUXA 3NAYA 2WGJA 5CU2A 4YHTA 5HNGA 3S4QA 5CYIA 4KKHA 1FMOE 2WO6A 4C38A 4FE2A 4BZDA 2R3KA 5C27A 2RG5A 5L2IA 3WF5A 1OPJA 3MBLA 4UYAA 2PVMA 3TZ9A 5ETAA 5KMKA 1QMZA 2JKKA 3P5KA 2UZEA 1M7NA 3NNXA 1UKIA 3H3CA 4X6RA 5KBRA 3O96A 1S9JA 2V0DA 2X4ZA 4BBFA 3NSZA 3ZH8A 4EOIA 4DFXE 4FTAA 4I0TA 3BU3A 3DZQA 4CFMA 2ZM1A 3ZOSA 4DBXA 5DRBA 3GBZA 3QX4A 5CENA 5LWNA 3TZ7A 3EFLA 2OKRA 3ZO1A 1PXKA 3SV0A 2PUUA 4JRVA 5K5NA 5EI2A 4CFUA 2VTPA 3AC2A 4PTCA 4NM5A 1XHAA 3L8XA 4GG5A 4IX4A 3VS0A 4FV1A 4JR3A 4O2PA 4OTWA 4RQVA 4ZXTA 4E7WA 3DU8A 2JDSA 5EDQA 3UDBA 4L45A 4USFA 4TYEA 2YIXA 3QQUA 4EOSA 1PF8A 3ALOA 2BZIB 3BQRA 2WPAA 4NZWB 3EFWA 3TTIA 3BYOA 5LWMA 4QP4A 3EN7A 5HGIA 5LMAA 3FJQE 2FH9A 2RFEA 1YXXA 2QR7A 3PXKA 1ZYJA 3B2WA 4RJ4A 5ANDA 4AOTA 5IMEA 2H6DA 2PZPA 2VO0A 2YWPA 3PJ3A 4OT5A 2HOGA 5DR6A 4D9UA 2JIUA 2JAMA 3LCSA 5M4UA 1WVWA 4FSQA 2J0IA 4RJ5A 2I0EA 4XG8A 2CKQA 4GU9A 2WTCA 4QMLA 5EM5A 5IQAA 2YDJA 4FICA 5GHVA 3NVKI 5ANGA 3TJDA 3E3BX 5GJDA 3UIBA 4QYHA 4BHNA 3PWDA 4I4FA 4C4JA 3SGCA 5IQEA 2AC5A 5AADA 2C0TA 3Q32A 3W2PA 2OJFE 4HYHA 4U6RA 5H8EA 3LM5A 3QQLA 4ZMFA 4DFYA 2UUEA 3UNJA 4GL9A 5AX3A 4G6OA 4JBVA 2C68A 2O63A 2J0KA 4WBBB 1U4DA 4AZVA 2VTIA 2HZIA 4NTTA 5IA5A 4FEWA 3N51A 3NRMA 4ZIMA 3TV4A 1OUYA 4D2SA 2X1NA 2QOQA 4I93A 5I9VA 3U6JA 1ZY4A 2R3PA 2EWAA 4FKPA 3G51A 4O6LA 2WMQA 3UG2A 3FMJA 4HYUA 4XV2A 2XP2A 2YCRA 4XOZA 4BCHA 3MGYA 4BDFA 3C4CA 5HE0A 1PXPA 3P78A 4B9DA 3UIUA 3RWPA 3HNGA 3C4FA 3A7HA 4L9IA 3LQ3A 3WZKA 4ZMEA 3QF9A 3JY9A 1REJA 2XK4A 2OXDA 2WKMA 2IW8A 1REKA 3V5PA 4RX5A 2C5XA 5A4EA 4O0UA 4XH6A 2C30A 4FKIA 3RPYA 1ZWSA 3CGFA 3FBVA 4M84A 3AMAA 2C6TA 2QO7A 4EOMA 4FMQA 1RE8A 3AGMA 2VWBA 5CSHA 5ANJA 3GC7A 4FTKA 2RF9A 2YISA 3LKMA 4LGHA 4X7QA 4CLIA 4BICA 4FKRA 3QZFA 3FWQA 3IW4A 3MFSA 5ACBC 5CAOA 4DT9A 4K33A 4ACDA 3NIZA 4L68A 4BDHA 4B8LA 5CF5A 3WIGA 4O0WA 5HO8A 2UW6A 3R9DA 1FOTA 2R5TA 3HECA 3R1QA 4G3GA 3GU5A 4FEQA 4MHAA 1YI3A 5BUJA 4GIHA 2E9OA 4FIHA 2JBOA 3PA5A 3DGKA 4Y5QA 3ZFYA 2W1FA 2UW9A 1U59A 5H8GA 4PNKA 3D2IA 2WTKC 4JQEA 5M06A 4XYFA 4CTCA 3EQPA 3OC1A 4O86A 5AFVA 4J53A 5FP5A 5FGKA 4DH8A 4QNYA 3NUPA 1H0WA 1XO2B 3BU5A 5CSVA 2ITPA 2GNHA 4KIQA 4C2WA 1YDSE 5AIRA 1OKZA 5M53A 4AP7A 3SW7A 3E8NA 3HV5A 3KQ7A 5IG1A 1Z5MA 3VHKA 2GNLA 5LVOA 1YHVA 2HIWA 3A4OX 3V8TA 3IGGA 5HEZA 4CEGA 3R1NA 3D4QA 4FTNA 4JDIA 2CGWA 1W8CA 2DS1A 3P0MA 1CKPA 4K9YA 4S31A 5T68A 3V51A 4F9YA 3CBLA 5A4CA 4OTQA 3DT1A 4JQ7A 3DY7A 3EQIA 3MPTA 3R7YA 3OUNB 4D5KA 3HMMA 3NYNA 4CRSA 4D9TA 4EK6A 4EL9A 4HCUA 2EUFB 2UZTA 5I4NA 3UBDA 2VO3A 4HGLA 4J7BA 3F3VA 3BCEA 4FEXA 3O51A 5ANEA 1QPDA 3VS4A 5HLWA 1V0OA 3OF0A 2V7OA 4H3BA 1MQBA 3SQQA 2B54A 4MQ2A 2WQMA 2J7TA 3CTQA 2VWUA 4L01A 4CRLA 4XG6A 4Z55A 1XH5A 2EU9A 3L1SA 4D55A 5DYJA 4PNIA 4O0SA 1EH4A 3AC3A 3ZDIA 3PXZA 2XIKA 2GFSA 4O27B 4J95A 2OH4A 4JRNA 2UVZA 5HTBA 2OJJA 2Y6MA 4DT8A 3RWQA 5HQ0A 4AW5A 5LOHA 3WE4A 2JFMA 4M97A 4WNKA 3R8PA 5F4NA 2I0VA 5AP0A 4QP2A 2ZDUA 3UVPA 5BVKA 5IEVA 1LR4A 2PZRA 5DT4A 4UY9A 4U81A 3GI3A 3SHEA 1ZZ2A 3QD2B 5HNBA 1PYXA 2PMOX 3GXLA 4J97A 2PYWA 1TVOA 3KVWA 3KULA 5HIBA 3LCTA 3L9NA 4IWOA 4RWJA 5JQ5A 3NPCA 3IONA 3PPJA 5CEQA 2FO0A 2J90A 2CKEA 3COKA 4HPTE 3EQFA 3NEWA 3LVPA 2EB3A 2I6LA 3CGOA 4I24A 4CFFA 4EK3A 2VTSA 3VUIA 3UZTA 4WRGA 3MDYA 2F4JA 3G0FA 4GS6A 4A9YA 1YOJA 2OLCA 3LLAA 5CU0A 4C3RA 4EKLA 2PZ5A 4OLIA 4RJ6A 4ALVA 4QMZA 3VUHA 3GUBA 1IA8A 3LJ0A 3LLTA 4OTGA 3VF9A 1R3CA 4CFXA 4IVAA 3P7AA 3UQCA 1CM8A 3NYXA 3MIAA 1ATPE 1NVSA 3LFQA 2UZLA 4WG3A 4AF3A 4E6DA 1WZYA 3FLZA 2XNPA 3VS5A 2OG8A 3HP2A 2B4SB 2ERKA 4G2FA 5D7VA 4F7SA 4TTHB 4NFMA 4AZEA 3RP9A 4P5ZA 3M42A 3KB7A 4BDBA 4ERWA 3KXGA 1WBNA 3UZRA 3QQKA 3N4VA 4EC8A 4E5BA 2R64A 3CPCA 3TCPA 4BZNA 2VTQA 3FC2A 2YAKA 4NH1A 3QAME 5CX9A 4R7HA 4UWYA 4NT4A 3MJ1A 4FSYA 3IK3A 3AC1A 2YDKA 2RGPA 3EN4A 4M15A 4NTSA 4YZ9A 3DXQA 5A46A 3ZLSA 5J1VA 1CDKA 4FV5A 5FTGA 3VUGA 3AD5A 2R3RA 3CKWA 2ETRA 5IDNA 4BZOA 3TUBA 4OW8A 3PXYA 4RJ8A 1OGUA 5EI6A 4A9SA 3F3ZA 5HIDA 3D5VA 4USDA 3Q2MA 4EH3A 1FINA 2PMLX 3ORTA 2A27A 2C6MA 4FTTA 4L52A 3CPBA 4LGGA 4O7LA 4P5QA 3SOAA 3T8OA 1JSTA 2J0JA 3FZ1A 4G6NA 4YJQA 2ZOQA 2WIPA 4IHPA 4S2ZA 3TKHA 4USEA 3CQEA 3PUPA 2JFLA 3KK8A 4HGEA 3MFRA 3FQHA 4MK0A 2Y4IC 3F9NA 3NR9A 4F9AA 4U97A 3DAKA 1OECA 4FKSA 3ZM4A 3VWAA 3PFQA 3FKLA 1KOAA 1SVGA 3EN6A 3DDQA 4Y46A 4LFIA 3R8VA 4OBPA 3R0TA 3UNKA 1M2RA 5C8KA 3UIMA 3Q4TA 3QA8A 1IEPA 3QRTA 4RVMA 4AGWA 3POZA 3DKFA 5AIKA 1XKKA 2X8IA 4ACCA 4ZZOA 1JQHA 3BLQA 5KHWA 4RX9A 2HCKA 3QTXA 5ANIA 4UYNA 3U4UA 4MNEB 4FZDB 2ZMDA 3ELJA 5ETIA 5L2TA 3TL8A 1OZ1A 4WOVA 5DOSA 3HUCA 2BZKB 2P2HA 4EOKA 3OUKA 4LRKA 3N4UA 3S2PA 5JGDA 4ZSLA 3QXPA 3FZRA 2VTAA 4EH4A 2X7FA 4IB1A 2KULA 3OMVA 4U44A 5KBQA 4FIGA 3T3VA 2UW3A 3Q60A 4BDAA 5IA1A 4O22A 4WKQA 4BGHA 4L44A 2X6DA 3PY3A 2J50A 4TYIA 4IM2A 4BCNA 4A4OA 3DB8A 4E1ZA 3KRXA 5EW8A 4EK4A 4KAOA 3NNUA 2W5BA 3RVGA 2XF0A 2XM8A 3DPKA 5AUVA 2KTYA 2X0GA 3ZSGA 2PE2A 3A62A 4G5PA 4ALWA 3V04A 1BKXA 4ERKA 5AUXA 4YTFA 5E8UA 1Q8WA 3HYHA 4DFZE 3BGZA 4O7WA 5IUHA 3ERKA 3SKCA 3BIZA 2WTVA 4DE4A 4D28A 4JT3A 5FDPA 5TR6A 3ROCA 2O2UA 3G9LX 3S3IA 4C37A 4S33A 2O8YA 3FZSA 3FAAA 3R8ZA 4R3PA 4NM0A 2DQ7X 3NYVA 5BVWA 4BTJA 2Z7RA 4FNZA 2IPXA 4U3ZA 5CF8A 4B7TA 3UVQA 4E6AA 2VZ6A 4L42A 4XP2A 2GS6A 1AGWA 2IJMA 4XJ0A 1CTPE 4Q2AA 3T3UA 4EHVA 3V5LA 1YOMA 3TV6A 4K2RA 3W2QA 4RA5A 3OVVA 4FSTA 4NW5A 4XEYA 3TN8A 2QLUA 4ENXA 5FBNC 3WF8A 2PHKA 5JK3A 5E4HA 3QKMA 4EKKA 4AT4A 5E92A 4FA2A 4AQCA 4EZ7A 3ZDUA 2BILB 3COIA 5J7HA 2C5VA 3C1XA 3FLWA 3QYWA 3LPBA 2YHVA 4CXAA 4BDDA 2WOUA 5M57A 1JOWB 2J4ZA 4O81A 4G31A 4EQUA 2ITUA 4FVPA 4XNEA 5TO8A 3O2MA 4Y72A 3DBFA 4EK5A 3PY0A 3E64A 3DK3A 4DEBA 3EKKA 1LPUA 3BQCA 4FKUA 3R2BA 5HG5A 3FZTA 3CEKA 2BUJA 3TUDA 4UXQA 3A99A 1OMWA 1FGKA 4F7NA 2JDTA 4Q5HA 3PYYA 4IB5A 4AG8A 3TIZA 2ZV7A 1MP8A 3R9HA 1OBGA 2WAJA 5JFSA 3K5VA 1LUFA 4YC3A 5IUIA 3KCKA 5DHJA 1JPAA 4K77A 4BC6A 1W0XC 4ZJJA 3TI1A 2Y6OA 5I9YA 2WQBA 1JNKA 5HG8A 4F6UA 2PVHA 2VTTA 5D9HA 5JFXA 2ITYA 3Q2JA 1P4OA 4O0TA 3JY0A 3L9PA 3NLBA 2ZM3A 3BHYA 2XIRA 4PDYA 4ZSGA 3R28A 2B7AA 2W06A 5DN3A 2C69A 3JVSA 5HI2A 3ZUUA 3FE3A 1RQQA 5HG9A 4O2ZA 2BFYA 2BRHA 3UIXA 2CJMA 3DJ6A 3EL8A 3JYAA 1URCA 4FT9A 4FTMA 3GQLA 3E7OA 4I5CA 3VS1A 5EHLA 4WNMA 3QRKA 2OWBA 2ZV9A 1BL6A 5CANA 3C5IA 4I6BA 4TNDA 3R1YA 3W2CA 2QOFA 3H9OA 3L9MA 3F82A 4X2JA 4EOQA 3DFCB 2LGCA 4XG9A 4XRLA 3DDPA 5IEYA 2FGIA 3NNWA 5CT7A 3GCPA 5IH4A 3D94A 4LI5A 4MWHA 3GC8A 4YTCA 3TNIA 2PZYA 2FA2A 2R0IA 2C3JA 5KHXA 2W1IA 4EZ5A 4QP6A 2Z02A 4ASDA 3EYHA 5KKRB 4KIOA 5M09A 4GYGA 2R3LA 4OTHA 2GTNA 2W4OA 3BYUA 4ZK5A 4DBNA 5IUGA 3KN6A 4NU1A 3WIKA 4FYOA 3ZXZA 3V6RA 1GJOA 3NWWA 4MBLA 3C5UA 2YIRA 4I6FA 5BUIA 4D1SA 2ITXA 3C50A 2E9UA 1Q8YA 3P7CA 2BROA 5KNJA 1WAKA 2BHHA 5CZIA 2X7OA 5EOLA 4C4HA 4CV9A 5JKGA 2E2BA 3MY1A 3KA0A 2OJGA 3QZHA 4BTMA 5HD4A 4EBWA 3AMBA 5HTCA 4L7FA 5E91A 4ZTRA 4XUFA 3OZ6A 4EOLA 4FV2A 3GOPA 5C4LA 1B39A 3ZCLA 4BDIA 4ZY6A 2PVFA 4ORKA 3UZPA 2XB7A 4EHEA 3ORLA 1OIUA 4IH8A 3R83A 4E4LA 2B53A 4F99A 3VUKA 3BRBA 1O9UA 1QCFA 1DAWA 3C0HA 5AP1A 3VULA 4FKTA 3HV6A 4EOPA 4IAAA 4APPA 1LEZA 2R3IA 4YZBA 3WYYA 3ORPA 4AUAA 4W4VA 2AC3A 4RPVA 5AUTA 2X2LA 4IB3A 1U46A 5K4JA 1BI8A 4AZSA 3TUCA 3LFBA 4CCBA 2LAVA 3A8XA 4AFJA 4O0VA 2RFSA 4PMSA 4ASZA 3R7EA 2CPKE 4DGLC 1CKJA 3R9OA 2GDOA 3B2TA 4E73A 3FQSA 2R3FA 4G9CA 5LMKA 1Z9XA 2P2IA 1FMKA 3OHTA 4L3LA 5CAVA 2XIYA 2YM7A 3AC5A 5B7VA 3EMGA 4FC0A 4EI4A 3FHRA 4I5MA 3FMKA 1UU9A 2YWVA 2C6IA 4MEDA 4O21A 5BVFA 1BLXA 5CS6A 2AUHA 2CSNA 3R2YA 2OXXA 3BU6A 5DWRA 4JVGA 1SVEA 4DEHA 3N9XA 2VTHA 1ERKA 2OJIA 3R73A 5H2UA 3UNZA 4FV9A 4Q5EA 5JRSA 1P2AA 2CGVA 4G3FA 1XH6A 3E63A 4K1BA 2QO9A 4GJ2A 4DCEA 4QTAA 2EB2A 1G8AA 3LFDA 2BDWA 4JDHA 1B38A 4GSBA 4QT1A 2IO6A 3D5XA 3QYZA 1WVXA 3HL7A 4XG7A 2BIYA 3W2OA 4DF3A 1K2PA 2OU7A 4J96A 3IW7A 2HY0A 3ZFMA 3T9IA 4TWCA 3DKCA 1WBSA 2PE0A 4ZTHA 2ZV8A 3I60A 4PMTA 4QPSA 5J9LA 2VTLA 2WD1A 2OXYA 2YACA 4F70A 3VAPA 4PP9A 5CU4A 5T6KA 4MYGA 5AP3A 3VHEA 3ZC5A 2QURA 4ACHA 2QHMA 2R3QA 3OEZA 3UOLA 4Z3VA 4EH8A 1OL5A 4OT6A 4DFLA 2XIZA 3BGPA 4JDKA 4DH5A 5CVFA 5CAPA 4X3FB 5BYLA 4ARKA 4EZ3A 4RMZA 3HV7A 1PY5A 5H9BA 2ERZE 1KV2A 3F6XA 3MH0A 2ZJWA 5IQFA 5BPYA 1H27A 2F2UA 4O7ZA 4RIYA 4PRJA 1X8BA 1DI9A 2B9IA 4C2VA 4KSQA 4YC6A 2C6OA 4FV3A 3JPVA 3OT3A 2QODA 4AW2A 3KMMA 5LCKA 2PVYA 2GNFA 2IW6A 4BI1A 1JKKA 4RC3A 3LFSA 4BB4A 3P9JA 5CQUA 3TZMA 2XS0A 3PJ1A 4WHZA 3BX5A 4BDCA 1IG1A 2PY3A 1BI7A 2F49A 4IEBA 4PY1A 3TKUA 1Q3DA 1PXJA 3PIXA 2C0IA 4M7IA 5CTPA 3CR0A 3RPOA 2PMNX 4ZSEA 2P0CA 3LIJA 1ZLTA 2VWVA 3PXRA 4L3PA 2DWBA 3C13A 4YTHA 1TQMA 3QQGA 4L6QA 2QOBA 5M55A 2R3NA 2XUUA 2WMTA 3NX8A 4C62A 1OBDA 3R30A 3HVCA 4DGNA 2JC6A 3OWLA 1YWNA 3R71A 4EYMA 3KRWA 3RNIA 4QQ5A 2BAKA 4JDJA 1H1QA 3FV8A 3PTGA 3MA6A 1L8TA 3QL8A 4M0ZA 3NYOA 1OKVA 2R3GA 2CNVA 3RK5A 4A9UA 4FYNA 4RX7A 1WBOA 3TWJA 3SA0A 2QCSA 2YN8A 2PTKA 4PQNA 4E4XA 4IX5A 5KMOA 4O6EA 5J95A 3UOKA 1UWJA 2ACXA 1VZOA 2CLXA 3TT0A 4D4YA 5CVHA 5CY3A 2ZB1A 2IVSA 3OBJA 3TDWA 5HLNA 3F3WA 2YM4A 1WCCA 2BTSA 2PE1A 3R6XA 4JL9A 3F3UA 4RJ7A 4U0IA 3TACA 3QD0A 4C02A 4XP0A 2IG7A 3EKNA 1PW2A 3S95A 1PXIA 3IOKA 5GJFA 2V7AA 4ZJIA 2I1MA 4IZ7A 4L00A 5FXRA 4AN2A 1UNGA 2RL5A 5K4IA 5EDRA 5CVGA 2Y0AA 3GU7A 5GNKA 3TV7A 1UU7A 4IADA 2ITWA 4WNPA 3PWYA 4O82A 4ALUA 4BCFA 3PRIA 5DR9A 5CSPA 2QNJA 1J1BA 4IC8A 4DTAA 4UB7A 4FV7A 5EOBA 1H26A 3HRFA 5L8LA 3FEGA 3GP0A 4BDEA 3QTRA 4AA0A 3LCKA 5F94A 5FM2A 3ALNA 1M7QA 4K8AA 1OL7A 2ITOA 4I6HA 5KMIA 3RHKA 5E8XA 2GQGA 4YJNA 5HHWA 4HPUE 1U5RA 3W10A 4CNHA 4L67A 3C4ZA 3KN5A 5HLPA 2J0MB 2CCIA 2XEZA 1SM2A 4PL3A 4A9RA 5C9CA 3FLSA 1UU8A 4ZZNA 3DBCA 4FTJA 3ZXTA 5FEDA 5LMBA 5FTQA 3KF7A 4JG8A 4UEUA 3UVRA 3L9LA 4P7EA 2WTWA 3JR1A 4NW6A 2PVNA 4H58A 4R1YA 4AN9A 3COMA 3KREA 1YXSA 4CMTA 3IDCA 3RAIA 3BBWA 1FBNA 3FQEA 3R8UA 2W4KA 2B52A 5CQWA 3QBNA 5AX9A 5EYKA 1JWHA 3ODYX 3SAYA 4YHJA 3UG1A 5EDPA 4F9WA 2JLDA 3PIZA 4UZDA 4KUJA 1FQ1B 4EJ7A 4QYGA 2R3JA 5AP2A 5M08A 2W9FB 4TWOA 2XMYA 4P4CA 4FT7A 3ZRLA 4CT2A 1OL1A 3ZM9A 4F63A 2VD5A 2VTJA 3PSCA 4GT5A 5IF1A 3ET7A 4QYEA 3E5AA 2IWIA 2XYUA 1XH9A 4RWLA 2GCDA 2FSOX 5HCXA 5KZ0A 4ANLA 1O6YA 3Q3BA 4DGOA 5KKRC 2C3IB 2F57A 3LQ5A 4TY1A 3TKIA 5LQFA 4QMTA 2RIOA 4HZRA 5FG8A 1VJYA 1NVRA 3PVUA 3R1SA 2VWWA 4U79A 4QMYA 2IVUA 3FYKX 3P23A 2WFYA 4KS7A 3QD3A 5C26A 5A9UA 3O7LD 3P1AA 3I6UA 4RZVA 4IM0A 4KRDA 3CQUA 2X9EA 4YHFA 5LARA 5FP6A 1F5QA 2GFCA 2EXMA 4D4RA 1ZMWA 2BZHB 5E9EA 3LXKA 3TM0A 3R21A 5IZFA 5A6NA 4IWDA 2GTMA 1VYZA 4CCUA 3WI6A 4LMNA 5A4LA 3BHTA 4KS8A 4ZZMA 1R39A 4MXZA 5AV3A 5L8KA 3UQFA 3F66A 2QU5A 3L8SA 2JKQA 4BDGA 5BYYA 3HV3A 4QP3A 4F0GA 2WTJA 4OGRA 3GU6A 4H39A 3A8WA 4G9RA 3MH2A 1M52A 4MXYA 4RIOA 1Y57A 4XHKB 4M12A 2P33A 4QMNA 4M69B 5L3AA 2O64A 4CG9A 2F7XE 4PP7A 3LFCA 3D0EA 3WOWA 1ZYDA 5J9ZA 3NW5A 4FOCA 1UNHA 1H1PA 4IM3A 1UVRA 2VV9A 3W8QA 3LW0A 2W1ZA 3A4PA 3OS3A 4OTDA 5CASA 2A0CX 3R02A 1PXNA 4I6QA 3NGAA 1YXTA 2VWXA 4GV1A 4JX3A 1ZXEA 4O84A 4ZOGA 3V8SA 5C8NA 1T46A 3R7OA 3ZYAA 4ZTNA 1YOLA 2YM6A 4AAAA 3E92A 1J7LA 4QO9A 3OBGA 3C4WA 2XK9A 4ANSA 1OIRA 3UOHA 3LAUA 2RKUA 2O0UA 3FY2A 4FNWA 4RC4A 5DEYA 5CEIA 4B0GA 3QTIA 3W1FA 4F65A 4IFGA 3O17A 2J2IB 2XK7A 2CKPA 2QOIA 4YLJA 3THBA 5GIPE 4QTCA 5J5SA 2R7IA 4BHZA 2HW7A 4FEVA 3A2CA 3D5UA 3TNWA 4J99A 3VBWA 3UO5A 2GSFA 5DEWA 4YJOA 4GYIA 1J7IA 4DGMA 4YURA 2ITQA 3VO3A 5AAFA 2H9VA 3MV5A 4FG8A 4FSRA 5KCVA 3QCYA 4FIFA 2OGVA 2JKMA 4QP1A 5KMLA 2BMCA 2QKWB 1RDQE 4W8DA 5LJJA 2ZMCA 1BX6A 2W5AA 3DS6A 3A60A 2ZYBA 2P4IA 3A7JA 3FL5A 3PIYA 4FT0A 4FV8A 3UC3A 3UQGA 4RLLA 4OTIA 4UXLA 1MRVA 2PUIA 2VX1A 3DK7A 3TNQB 4DC2A 2BRGA 2WB8A 3HMIA 4G3DA 4KBAA 4UWBA 4GT4A 2YIQA 3QZGA 3FLQA 4D1XA 5JH6A 4LV8A 3KXNA 3DXPA 4JAIA 4R3RA 4JOAA 5LCJA 4YUQA 3OTUA 4C3PA 4Z9LA 4DEEA 4FIJA 3E8EA 3DLZA 2VGOA 3O0GA 1FPUA 3QKKA 1H8FA 2OZAB 5HVKA 5HE1A 4GJ3A 4AE9A 5CU6A 1Q41A 5DG5A 3ID6C 3AT4A 2BALA 3BBTB 4G6LA 2C4GA 5E8YA 2X6EA 3KXMA 4U43A 3CCNA 4M0YA 3H9RA 4BIEA 5DA3A 4MTAA 1G3NA 3QCSA 3EQDA 4I94A 5HCZA 3HA6A 5EI8A 2GHMA 3W33A 2B0QA 2W9ZB 3Q6UA 4BYJA 3A7IA 5I9ZA 1OKYA 3AOXA 5J1WA 3MVHA 4CZUA 2ZM4A 5EK7A 4ZAUA 4HVHA 4KBKA 3P7BA 4DTKA 2UZNA 2YCQA 4PTEA 3BLRA 5JFVA 3FXXA 3D9VA 3V3VA 3OOMA 3OY3A 3R7VA 4E6CA 3U9NA 5ETFA 1WBTA 4IAYA 4C7TA 2W17A 3P4KA 4QMVA 2E9VA 2HY81 3HEGA 3NAXA 2OIDA 5L6PA 4TWPA 1SNXA 3BELA 4RT7A 2PWLA 4FZAB 5KE0A 3FHIA 4C34A 4DINA 3OWJA 4C35A 3QRIA 4YSJA 2CNQA 3DAEA 4PUZA 3II5A 5HX8A 5AP6A 4LOOA 5HE3A 3K3IA 5C01A 3E62A 3ANQA 1GZOA 4IMYA 2BPMA 1WBWA 2C5OA 4S34A 3U87A 1TKIA 5JZJA 1FGIA 3R22A 1H4LA 4XOYA 3JVRA 4ZLZA 4IVCA 4CFNA 3BHUA 4GMYA 3DV3A 3MW1A 3E8CA 4FV4A 4FZ6A 4TYJA 2XNEA 5G1XA 3ORKA 4FTQA 3BKBA 4OBQA 1Q8TA 2YM3A 3U51A 4O0RA 4A07A 3ZLXA 3G9NA 5DBXA 3FPQA 3FMHA 4YU2A 2OI4X 5JGAA 2GPHA 5AP7A 3O8UA 4BI0A 2V55A 3ZSHA 1Q24A 4CLJA 3NW7A 4FTIA 1OI9A 4O7RA 4FTOA 3NUSA 4FODA 3LFEA 3MFUA 4FKLA 4J71A 4LL0A 5CF4A 5HO7A 3KK9A 1KE7A 1OIQA 2WMUA 3C0GA 3I6WA 3VBYA 2BFXA 4WRSA 1BUHA 1R0PA 2A19B 2CN8A 3PDTA 4APCA 3V5WA 4QQTA 4QOXA 3FSFA 4IW0A 3NUXA 1DM2A 4LV5A 4NCTA 4QTBA 2W1GA 4K0YA 3WF9A 3HZTA 2Z8CA 5ETCA 5LVLA 4F0IA 3PZEA 5CNOA 2B9FA 3COHA 3BE9A 3F3TA 3FL4A 3Q52A 1ZOEA 1W84A 3QFVA 3CQWA 3UTOA 4NL0A 4EHGA 4F1TA 5JEBA 5KMMA 4BVUA 2CKOA 3AQVA 4TYHB 3FMNA 3VW8A 4AW1A 2VTOA 3GC0A 3G6GA 2JITA 2YABA 3JS2A 2ONLC 3EN5A 3MH3A 3NZ0A 4O96A 4R3CA 5BYZA 2CGXA 4ZTSA 4XMOA 3ZUVA 1Q97A 4YP8A 1KV1A 5DIAA 3PJ8A 4MXAA 1PRYA 4B99A 4TXCA 4ZY4A 3ATTA 1Q8UA 4ITIA 2W1CA 3MI9A 4PDPA 1WBVA 5DNRA 3ROYA 3RK9A 5D1JA 5JT2A 4WD5A 4AACA 2XKEA 3H30A 3R7IA 4ANQA 1YW2A 2HWPA 4KA3A 4W4YA 3KL8A 4NKSA 4AW0A 4N4SA 4C4FA 3DQWA 1APME 3PSBA 4U9AA 1JVPP 5HCYA 4D0WA 2X8EA 2A1AB 3RZBA 5CF6A 5D12A 4G5JA 4Y95A 5EYCA 3I7CA 4FZ7A 3PLSA 4AGDA 3LJ2A 4HCVA 3D15A 3RAHA 5HNIX 1UA2A 5CAQA 4KABA 2R7BA 3FMEA 4PWNA 4JS8A 4XRJA 1OPKA 2QOKA 4LUEA 2RG6A 3OCGA 4MAOA 4MXCA 3ENHA 3OT8A 4X3FA 2JDRA 3QRUA 3ZO4A 1Y6BA 2QG7A 2R2PA 3PPZA 4X2KA 4YNEA 5B2LA 4JLCA 4V04A 2G9XA 4XG3A 2IVVA 2Y7JA 4EHZA 5B0XA 3O50A 4XBRA 4EYJA 4NIFB 4YSMA 3SRVA 2JDOA 3PVBA 1GOLA 3O7LB 4RC2A 3OTVA 4DGGA 3ITZA 4BN1A 4XV1A 4XG2A 5AMNA 4RX8A 3LJ1A 3LMIA 5GINE 2XH5A 4RIXB 2I7QA 2ITVA 4WUAA 2WMWA 4U80A 4U41A 4JXFA 2IN6A 2J5FA 3LHJA 3GU8A 3SC1A 3VS7A 3MY5A 2UVYA 1OUKA 4D58A 5AV1A 3P79A 1R1WA 2VNWA 4FOBA 1GAGA 3ZHPC 3S00A 2G01A 3AGLA 3RAWA 2W96B 3FZPA 2UZVA 3LFAA 4Z7GA 3Q04A 2A4LA 2WHBA 4RZWA 2XKFA 5K5XA 4Z7HA 4FL3A 3I7BA 1XJDA 3RKBA 2HW6A 2PMIA 1H1RA 1OITA 2REIA 2YIWA 5T3QA 3G5DA 2BRBA 2JIIA 2JKOA 3L8PA 3HP5A 2XNBA 3BGQA 4EQMA 3IW5A 1JSVA 4F7JA 4QTDA 3FMMA 2WIHA 1KSWA 1QPEA 4NK9A 5FEEA 4YZDA 3I4BA 5HKMA 5EM8A 2R3HA 2VWYA 4RFZA 3RMFA 5FEQA 2XYNA 2ZDTA 1F0QA 5DLSA 5EQYA 5H8BA 3V5QA 1YDTE 2WEVA 3ZRMA 1Y8YA 2ZAZA 5IMXA 1M17A 4GH2A 3IS5A 3JXWA 1XBBA 2YERA 3VBVA 3M1SA 3CSVA 2PVJA 3CTJA 5HICA 4NWMA 4PMPA 3BV3A 4W4XA 2XRWA 4IANA 4FX3A 4RIWA 2AYPA 1AD5A 3N4TA 2FUMA 3MTLA 4A4LA 5J9YA 2OH0E 4IZYA 4F09A 1U54B 3Q6WA 1SYKA 4CZTA 1SZMA 3U8WA 5HG7A 4D4VA 3RM7A 2YZAA 1YHSA 3UYTA 2VTNA 1P5EA 4GVJA 4Q9ZA 4FKOA 4RG0A 4C58A 4R5SA 4IC7A 3A7GA 3LQ8A 3EFJA 3OXZA 2OICA 4LMUA 1DAYA 5C03A 3F7WA 2XCKA 3KFAA 4GU6A 3PXFA 3WBLA 3QUPA 5IH6A 3NNVA 3UYSA 2ITNA 4YJTA 4M3QA 3R01A 3WZEA 1W7HA 3ATSA 3MFTA 4FSWA 2UZUE 4JR7A 2XKCA 4GT3A 5I5ZA 4JG7A 2PL0A 1YXVA 2CMWA 5IA4A 3R63A 1E1XA 1Z57A 2H8HA 2G2HA 5HU3A 3UP2A 4DFNA 1Q61A 3IPHA 3NCGA 1NXKA 3MYGA 4X2GA 4AZTA 4EBVA 2G2IA 4U42A 5CXHA 5BVNA 4J52A 2Z60A 4UALA 3U9CA 3EQRA 3ZU7A 2F2CB 2NNWB 4RVKA 4YGAA 2BDJA 4DG2E 5HZNA 1NVQA 4AS0A 3MB7A 2GS2A 4ID7A 4MNEA 3BV2A 5L2WA 4ANBA 3VN9A 1FVTA 3SXSA 3O8TA 5AAEA 2QO2A 3NCZA 3IDBA 1OVEA 4TW9A 1ZZLA 3I0QA 2YAAA 5AP5A 4F4PA 2PUPA 4O0YA 3VS3A 4WSYA 1SMHA 2OF2A 2VRXA 1MRYA 2XBJA 1O6LA 4FEUA 4YO6A 4CSVA 4MF1A 3I0OA 5KUPA 3U55A 1K3AA 4M8TA 3FKOA 3C0IA 3ZUTA 4QMPA 2QD9A 4EH5A 1OB3A 3KF4A 4HNFA 3V5TA 4AA4A 5JQ8A 3V5JA 5FBOA 1ZRZA 5K9IA 4FKVA 3ORNA 2VX3A 4X6QC 4C36A 5AUYA 3U6IA 4FBXA 1IAHA 1PMVA 4FI1A 3DFAA 4AZFA 4MNFA 3CIKA 4IVBA 3PRFA 3U54A 4NYEA 4N57A 4IFCA 3ZRKA 4U7ZA 5L6OA 1L3RE 3TIYA 2YCSA 2J51A 4DG3E 2FSTX 4RVLA 2UW0A 1B6CB 2NPQA 3POOA 1NY3A 3CP9A 4GKIA 4DH3A 3AG9A 1H0VA 2NRYA 3G90X 4F1OA 3EL7A 2FSMX 5IQIA 3GB2A 3CD3A 1H00A 1YQJA 4RIYB 4GK4A 4MWIA 3MN3A 3SOCA 4DEDA 2J9MA 2GS7A 4G16A 4FSUA 2WMVA 4AE6A 4J8NA 4DA5A 1VEBA 4J98A 3EOCA 4IWQA 3RI1A 3DBQA 4YPDA 3VS6A 3EFKA 4EONA 3CS9A 4F1MA 1A06A 2W1DA 2YM5A 3MIYA 3NUYA 3WILA 4DFUA 4MQ1A 3BLHA 2YJRA 2YIYA 4R7BA 5BUEA 5FQDC 4D1ZA 3CY3A 3LXPA 3IQ7A 3NDMA 4BIDA 3G2FA 5M4FA 1I09A 1GNGA 4HYSA 5EM7A 2UW4A 5ANOA 3Q5IA 2E9PA 1ZOHA 3OCSA 4LRJA 2OO8X 4DCAA 1IR3A 4ZSJA 4DH1A 2BAQA 3IGOA 3ACKA 4DLJA 2R3MA 5IPJA 5E8ZA 2HZ4A 1URWA 5CNNA 3UGCA 3SXFA 2HELA 2O5KA 4BBEA 4FKJA 4FSMA 4GK3A 4QNAA 3H4JA 4ZLYA 1HCLA 4ZSAA 3MPAA 4OUCA 1ZMUA 4G34A 3VNTA 4ZTQA 4CVAA 3FZOA 3W55A 2WTKB 1DI8A 3CXWA 2JDVA 4UWCA 3Q4UA 4GW8A 4LRMA 4M14A 3RINA 1ZMVA 4BF2A 5JFWA 2C0OA 4QMXA 2ETKA 3AD6A 4ZLOA 2PVRA 3DTWA 3EQGA 5E8TA 3CE3A 5CT0A 3VUDA 5CEPA 5H3QA 4BCQA 5DRDA 3C4EA 4FIIA 3MY0A 4AT5A 2VX0A 2OW3A 2QU6A 4GG7A 4LOPA 3WYXA 1TQPA 3QGYA 3F88A 5EFQA 4UN0C 5JRQA 2IZRA 2JD5A 2W05A 2WMBA 3QTSA 4KKEA 5E8VA 4IVDA 5ICPA 4DYMA 2QONA 2ITTA
chains in the Genus database with same CATH superfamily
1H1SA 2G15A 4IACA 1U5QA 4DG0E 4YJSA 4QQJA 3B8QA 5AWMA 1H01A 2JEDA 3TEIA 3PA4A 4YO4A 2YA9A 3UO6A 3BL7A 1HCKA 3ACJA 3AMYA 5DH3A 4FVRA 4YPSA 1H24A 4I0SA 3PG1A 3F69A 4Y8DA 4KB8A 1OM1A 3M2WA 3NFGB 3GCQA 5K3YA 1SNUA 1ZYCA 5HU9A 2B9HA 3QTZA 3HAMA 2XCHA 4ZP5A 4TL0A 3DKGA 4WT6A 5I9UA 4C0TA 1AQ1A 3R00A 3MA3A 3QHWA 4GVAA 5F20A 3NUUA 3LE6A 1CKIA 4CGAA 2UVXA 3D7TA 5CALA 4U5JA 2GHLA 2HZNA 3DLSA 2GMXA 1DS5A 2GU8A 2XNGA 3NS9A 4V05A 4A06A 4RLKA 2BRNA 3BEAA 5HORA 1R0EA 1QPCA 2VUWA 4AN3A 4JNWA 4ZTMA 2Y4PA 4QMMA 2FYSA 4FGBA 1S9IA 4A4XA 4BY9E 3F2AA 4ASEA 4P2KA 4TYHA 3ULIA 4EC9A 3VQHA 4F0FA 3OOGA 4EH6A 3KVXA 3GQIA 3FUPA 4YJVA 2XBAA 3FLYA 4NFNA 2C6KA 4IZ5A 5E90A 3C51A 2CHLA 3VW6A 3ZEWA 3PPKA 2DYLA 4TNBA 3R7UA 3NFFB 2FVDA 2NRUA 3HA8A 3PE1A 4FKQA 4GUBA 4BCPA 5KX8A 4DDIA 3AC4A 3F5PA 3V6SA 5HD7A 3RCJA 1WBPA 4MD8E 5CLPA 3WARA 4V0GA 4C33A 2P55A 4DEGA 4FSNA 5M56A 3DB6A 4U45A 5LVPA 3AXWA 1W83A 2VAGA 4CV8A 2B1PA 3E3PA 4NJDA 4OBOA 2XJ2A 2B9JA 4R78A 3G0EA 1PMNA 1ZARA 3DAJA 4HGSA 4I21A 4RRVA 5HBEA 4QMQA 2R3OA 4M68A 3QC9A 4RFYA 2J0LA 1W98A 4FTLA 3UO4A 4MD9E 3DCVA 4AOJA 3D7ZA 4KRCA 1Q99A 3NUAA 4KD1A 4UBAA 3VF8A 2XNOA 5GIOE 3K3JA 3ANRA 3PP0A 3K2LA 3KXHA 1SVHA 4FT3A 2QG5A 4PDOA 2P3GX 4F08A 1V1KA 5M4IA 3OY1A 4WIHA 3HDNA 3DK6A 3GC9A 4FSZA 2OSCA 3K5UA 2W0JA 4P90A 4BYIA 1UV5A 2Z7QA 2IZSA 4NSTA 1BYGA 1FVRA 4XX9A 3R04A 3REPA 2IVTA 1XMLA 1NW1A 3LFFA 4FIEA 4QRCA 5FXSA 4BIBA 2V62A 1Q3WA 1A9UA 2A2AA 5G6VA 4BTKA 3VVHA 2C3KA 4U8ZA 3QX2A 4TKSA 3QQFA 4X3JA 4L7SA 4XV9A 1MRUA 5A6OA 2GQRA 1VYWA 3D2KA 4MXXA 3OXIA 4DN5A 4D4SA 4H3QA 3EH9A 3QALE 1GZKA 2PUNA 4RSSA 3IW6A 3LXNA 4CFVA 5IQGA 2W1HA 4AX8A 1WMKA 4DTBA 4C4EA 3FC1X 5D10A 3P08A 4EWQA 1H1WA 2BRMA 3Q9XA 4HOKA 3VRYA 1M14A 2X81A 2Z2WA 3EQHA 4IX3A 5KZIA 5BMMA 2XK6A 3RPSA 4H3PA 3GENA 3I1AA 1J7UA 4BCGA 2X2MA 1JAMA 3H0ZA 5JZNA 4AT3A 4JAJA 5M07A 3CTHA 5HE2A 4CMUA 3DBEA 3ORZA 5DPVA 1M2PA 4W4WA 4NKAA 5AA9A 5ITAA 3W8LA 2WZJA 1H25A 4IE9A 4C59A 4E20A 5A54A 4JBPA 4LL5A 3SDJA 3TNHA 3GCUA 4EOOA 3HMPA 4C3FA 4IQ6A 4I1ZA 3NUNA 3IECA 5AP4A 2C5YA 4HJOA 4WG5A 2UZBA 5EQPA 2OF4A 5HESA 4YBKA 4U40A 5AM6A 2CN5A 4AU8A 4EUUA 4FK3A 4GCJA 3GOKA 3I81A 4IJPA 5BQ0A 4E93A 3UMWA 3ZBFA 4YZMA 4BCOA 5CU3A 1E9HA 2C5NA 3QA0A 5EYDA 1PMEA 3UMXA 2HZ0A 4QMUA 1BL7A 2OJ9A 4YR8A 2R9SA 4HVGA 4HZSA 3SRVB 4AZWA 3WZDA 4KNBA 1YWRA 4L3JA 2OZAA 2CLQA 2X9FA 4CKJA 4KSPA 2XKDA 4EQCA 3PXQA 2PSQA 2ESMA 4F6WA 2O65A 2C1AA 3CJGA 4B6LA 3D5WA 3IOPA 3M11A 3Q9WA 2UW5A 4JIAA 2V5QA 1F3MC 4FG9A 5HIEA 3RTPA 4AGUA 2I40A 2C6DA 1QL6A 2Y8OA 1IAJA 3ORIA 4AGCA 2BZJA 2VN9A 4PV0A 3ODZX 1JKLA 3PY1A 4MXOA 3QKLA 2WMXA 3RJCA 3PG3A 4L43A 4IB0A 2YJSA 4MD7E 5L8JA 1Y91A 3Q4ZA 5CXZA 3LOKA 2ZV2A 4R5YA 1RW8A 2WU7A 5DVRA 3ZZEA 3DNEA 2VO7A 3KGAA 2QOLA 2OK1A 2RFDA 2Z7SA 3DQXA 4CKIA 4YMJA 5A14A 3S1HA 4U3YA 4D0XA 4TRLA 4E5WA 4K6ZA 2YFXA 4X2FA 4MBJA 4A7CA 3ETAA 4FKWA 4XG4A 3EN9A 5DFPA 2X39A 4AA5A 4F6SA 5I9WA 3T9TA 1YRPA 4AXCA 1OL2A 4KINA 4I41A 2VWIA 4BR3A 3OG7A 5BVEA 3GCVA 3QTUA 1UKHA 5IQBA 4JG6A 2PVKA 2QQ7A 2C6EA 3BHHA 4GFOA 2VWZA 4BCMA 3OWPA 1IASA 4LOQA 5E8WA 3DXNA 4YJPA 2XZSA 3FI4A 3QHRA 4IWPA 3PVWA 2QR8A 4PTGA 4QP8A 5AJQA 3TTJA 5IH5A 4X2NA 4KKGA 2ZVAA 3RALA 1KE9A 4L46A 1ZYLA 3PA3A 1Q62A 4O7YA 3VIDA 2F7ZE 4JX7A 4DEAA 1RJBA 1YI4A 4ZTLA 3LFNA 3KKVA 4Y5HA 3F5GA 4FT5A 1Y6AA 2VNYA 4I92A 3PSDA 3UJGA 4QTEA 2X2KA 4QDVA 3CC6A 4FK6A 5TKDA 2XANA 1YVJA 2WMAA 3FDNA 2WQOA 3KMUA 4WBOA 5EG3A 3ZC6A 5I9XA 4H05A 2F7EE 4CMOA 2NP8A 4MKCA 5JN2A 3FI3A 3RM6A 4BI2A 3Q9ZA 3Q53A 3MS9A 3W32A 2ONLA 3ENMA 3ZONA 1JBPE 5E7RA 2QI8A 5M51A 4E5AX 2FB8A 3HMOA 2VTRA 4JBQA 3OCTA 3TXOA 4TPTA 4YNOA 5AV2A 3EYGA 5HX6A 1Q4LA 2VU3A 1KE5A 1OIYA 3HDMA 4ACMA 3GGFA 2C6LA 1P4FA 4HVSA 4YZNA 2BKKA 3Q9YA 4YLLA 1XH7A 3AD4A 3GEQA 2HAKA 1Y8GA 1JKSA 3BYVA 3I5ZA 4R77A 2XVDA 4XLVA 4AXAA 4DAWA 2VGPA 5LXMA 4QEBA 2BCJA 4DEIA 2XALA 5C1QB 4HNIA 5DT3A 4I20A 4X0MA 4M67A 4O0XA 4R7IA 1V0BA 4XS2A 2BTRA 1YKRA 2HK5A 2YM8A 3MJ2A 3QC4A 4EH2A 5AV0A 3LCDA 2WOTA 3SW4A 4NM7A 5BMSA 3MESA 3F5XA 2WELA 3OW4A 3VJNA 3QWJA 4AAYA 2Q83A 3S0OA 2XK3A 2Y4IB 3OEFX 3VBXA 5IISA 4GK2A 4I22A 3ORMA 3QGWA 2H34A 4BTFA 1GIJA 4NCTC 1P14A 3BYMA 4DHZA 3FLNC 4GKHA 2VTMA 4WG4A 5JSMA 2I0HA 4L53A 3E88A 3EZRA 4FV0A 4PL4A 4CTBA 5CEMA 5AUWA 4IDVA 3F2RA 4YZCA 5HBHA 3FYJX 5EW9A 4MX9A 4ANMA 5HVJA 2X4FA 3CJFA 5F1ZA 4ASXA 3Q4CA 2Q0NA 3OWKA 1V0PA 3DTCA 5E1EA 4GIIA 1XBCA 3WF7A 2WU6A 2QC6A 1T45A 4WA9A 4LQMA 1TQIA 5EM6A 2JIVA 4NUSA 3RHXA 4YBJA 3DZOA 3FXZA 4ONAA 2Z7LA 1PXOA 4BCJA 1G8JA 4RIXA 3GFWA 4JIKA 2WQEA 3ML1A 5IQHA 2WTIA 3KEXA 3OXTA 3E87A 2BIKB 2PULA 3RPVA 3UP7A 4QMSA 1QPJA 2QOCA 3PJ2A 4J8MA 3FMLA 3ZBXA 5CI6A 4ZEGA 4I5PA 4PF4A 4EOJA 4ZJVA 5A4QA 1XH4A 4N6YA 5EH0A 3EZVA 4PDSA 3IDPA 4EORA 3MVMA 3KULB 4DH7A 3SG9A 3EQCA 3BPRA 1PXMA 2B55A 4PMMA 2HENA 1GIHA 2DUVA 3OFMA 4O7SA 2WXVA 3V8WA 4N0SA 4ENYA 4X3FC 3ULZA 5A3XA 2WMRA 1PKDA 3LZBA 3BE2A 4OR5A 3EJ1A 3NVMB 4FNXA 1JKTA 1CMKE 4HGTA 2G1TA 3HV4A 3MB6A 5FRIA 1M2QA 3EB0A 1ND4A 2GQSA 4EWHA 4F78A 3HGKA 3OP5A 2IZUA 4DITA 3TJCA 5IA3A 3WZJA 4NM3A 1J91A 4FV6A 5ACKA 2YDIA 5CSXA 3U4WA 3VJOA 1UNLA 5LMKC 3UPZA 3FI8A 3HLLA 3A7FA 5CEKA 4QMOA 5AAGA 3ZLWA 4Y83A 4I4EA 5FXQA 1H28A 3BEGA 3WE8A 3E93A 5FLFA 5JGBA 2RFNA 4R6VA 4LG4A 1YWVA 3DOGA 5L6WL 2BKZA 2YEXA 4S32A 3K54A 3RK7A 3NMUF 4HCTA 4N70A 1K9AA 2IZTA 4TYGA 3CLYA 4Q9SA 3KU2A 3GU4A 5D7AA 4UV0A 5EKNA 3QD4A 4X21A 3BZ3A 3WZUA 3SVVA 5J87A 2EVAA 3DBDA 2OIBA 1U54A 4W8EA 4BKJA 1Q5KA 2CGUA 4BDKA 4CG8A 1MUOA 4BGGA 3D83A 1KE8A 3O71A 1XR1A 2C1BA 4JI9A 3KMWA 4KIPA 4XLIA 4HVDA 3OCBA 3W2RA 2X7GA 4AOIA 3SG8A 3F5UA 3KC3A 3D7TB 4RWIA 4JBOA 2JBPA 3UPXA 3VUMA 5HBJA 2QLQA 4KWPA 5TT7A 3MVJA 3SLSA 1J3HA 3QLGA 3KY2A 2UZOA 3OD6X 5D41A 5IEXA 2GNIA 3VC4A 3A61A 3NIEA 4QYFA 4C4IA 4I0RA 3DNDA 3QTQA 3O8PA 2HWOA 4TT7A 1XBAA 4RGJA 1HOWA 3IW8A 4NJ3A 1PYEA 3CD8A 4LM5A 4O7TA 4F64A 4Z16A 5M4CA 2WTDA 2E9NA 2PPQA 4QP9A 5TOZA 1BMKA 5F95A 3RAKA 4H36A 5DI1A 5L8LA 3HAVA 4FTRA 4QQCA 3R8MA 4H1MA 4FTUA 4FL1A 4FVQA 5B2MA 5IQCA 3VRZA 3DA6A 3VBTA 2R4BA 1PJKA 1VR2A 2IW9A 3RPRA 1GIIA 5D11A 1NT2A 2BAJA 3G33A 4YC8A 2ITZA 2Y9QA 4RIWB 2QVSE 2JGZA 1I44A 5CZHA 1ZY5A 4IAZA 3VQUA 3TNPC 3GFEA 4N6ZA 2Q0BA 1XQZA 4ITJA 4B8MA 2BDFA 4YTIA 5FUTA 3R9RA 3MTFA 3FPMA 5AM7A 4FL2A 2PK9A 3G6HA 5BV3A 1R78A 4RA4A 4XBUA 3CY2A 4YJRA 5BNJA 4EH7A 3FI2A 3GVUA 3MH1A 3RGFA 3W2SA 5KMJA 5JMSA 1ST4A 3SXRA 3LMGA 1GZ8A 2V22A 2C3LA 5J8IA 5HVYA 2J5EA 4V01A 3ZFXA 3ZTXA 4G17A 4I5HA 5EYMA 5CAUA 3HRBA 5IA0A 1KWPA 3QRJA 3FXWA 2OFUA 4FZFB 3H10A 2BR1A 1ZAOA 2NO3A 4TN6A 4UX9A 2YZLA 4ZS0A 3FKNA 4FTCA 3ZZWA 2QOOA 3QUEA 5BVOA 4HYIA 4LUDA 4IDTA 1YDRE 4MVFA 5DGZA 3QWKA 3P5JC 1XWSA 1WVYA 5EQEA 2UV2A 2XIXA 3C4XA 5B2KA 1JLUE 2JAVA 3MWUA 2GNGA 4ITHA 1UWHA 3JUHA 4B4LA 4CFWA 1J1CA 4R1VA 5C8MA 4AWIA 4M13A 4BDJA 4RQKA 5IDPA 5M44A 3F2NA 4MCVA 2C47A 5EHOA 1UU3A 3HKOA 2VO6A 3SD0A 4C61A 1STCE 4XV3A 2GHGA 4ZS4A 4EK8A 3H0YA 3EQBA 1KE6A 3G15A 3Q5ZA 4EEVA 1H08A 2YITA 4IX6A 2SRCA 3TZ8A 2UZDA 2GNJA 3R9NA 2ZB0A 5FDXA 3U6HA 4S30A 3OW3A 4G3CA 4RJ3A 4FGRA 1PXLA 3QCXA 4RVTA 3QZIA 3PJCA 5IU2A 3MVLA 4IAFA 1NA7A 2UW8A 4D2RA 5CWZA 2QKRA 4O7NA 4II5A 1ZOGA 1WFCA 2FSLX 2O3PA 3B8RA 3PZHA 2W4JA 3P86A 3BHVA 1GY3A 2ETMA 4DLIA 5FD2A 2BHEA 2QOHA 4G3EA 3ZEPA 1CSNA 1YHWA 3E8DA 1MQ4A 1OPLA 3C9WA 3MPMA 2W7XA 3I5NA 3LXLA 3O23A 3QQJA 4GEOA 4MH7A 3L8VA 3V01A 5IQDA 3UOJA 4IBMA 2WEIA 5AA8A 3KRRA 4G1WA 4XCUA 3QUDA 4JQ8A 4XP3A 2OZOA 1PKGA 2YCFA 4D5HA 3I79A 2CNUA 3PLAE 3DJ7A 3E7VA 3H9FA 3ZO3A 3AT3A 1ZYSA 3R8LA 5AUUA 3SX9A 2F9GA 3GCSA 4BRXA 4C4GA 1G5SA 3BWJA 4EUTA 2HXQA 4RBLA 4TWNA 4FKGA 3QTWA 5LVMA 2G2FA 3LMHA 3QCQA 3HUBA 3LCOA 3OROA 3PP1A 4UZHA 5EHYA 5AV4A 3ZSIA 3F61A 3QU0A 4GFMA 4PX6A 4ACGA 5KO1A 4DHFA 1XH8A 4IJ9A 5CSWA 4WNOA 2HXLA 4KBCA 4Y85A 2BVAA 5LVNA 4PL5A 4BBMA 3FMDA 2OFVA 3TG1A 2R0UA 4HVIA 2W5HA 4O91A 5DE2A 3DJ5A 4EH9A 3ZS5A 3IKAA 2X8DA 4IIRA 2WNTA 5TF9A 4IZAA 4K11A 3KXZA 3KCFA 1JSUA 3BYSA 4WUNA 4AFEA 4FNYA 3WF6A 4OTFA 3EHAA 1OL6A 3LM0A 3PE2A 4J1RA 4QP7A 5DR2A 4YJUA 4H1JA 3QXOA 5AEPA 2XM9A 2XNMA 3ORXA 3W16A 5EW3A 3ZMMA 1O6KA 3ZLYA 1GZNA 2J6MA 4CT1A 4F9BA 4FR4A 2QHNA 4GFGA 2XNNA 3QQHA 5E1SA 2CCHA 3KRJA 5E8SA 1YI6A 1G8SA 5EKOA 3RCDA 4I23A 3W0PA 5L2SA 4LYNA 3KXXA 4Y73A 1H07A 4O83A 5IA2A 4FUYA 1YXUA 2XRUA 3IO7A 2PU8A 4RFMA 4QMWA 4BCIA 4DHIB 1KUTA 4E4MA 1A48A 3AT2A 2OBJA 3C7QA 3HMNA 4IAIA 3UODA 3DKOA 2PVLA 4CKRA 4WO5A 4BGQA 4O7VA 4QPAA 4K18A 1Q8ZA 5DT0A 3IG7A 5CI7A 4YLKA 3AC8A 1KOBA 4RWKA 4A9TA 4V0GB 4F7LA 3EWHA 4FG7A 5A4TA 5F9EA 3MSSA 2W99B 4TZRA 4OTRA 2PZIA 3UC4A 4E6QA 4ZY5A 1LEWA 4DFBA 2XK8A 3GT8A 4F9CA 5BX0A 5CEOA 2H96A 4I3ZA 3NW6A 2XA4A 1OKWA 3EIDA 3KRLA 4GRBA 4CQEA 2XEYA 3TDVA 5AUZA 3BWFA 4BCKA 5I0BA 1LP4A 2OIQA 1PMUA 3HX4A 3VS2A 2UW7A 5ANKA 2WQNA 4JJRA 4MBIA 4IAKA 4E26A 4QYYA 2HYYA 5FTOA 1W82A 4E8AA 4HW7A 2CDZA 4CD0A 4GUEA 5C4KA 3PVGA 1FVVA 4E4NA 5FM3A 2XJ0A 3FSKA 1IRKA 2EXCX 3F7ZA 3UE4A 3W0RA 5BVDA 1PHKA 2I0YA 3FY0A 1E1VA 3Q96A 3QLFA 3ZO2A 3HRCA 2W1EA 3D14A 5KMNA 1IA9A 3BI6A 3VBQA 4EJNA 4L8MA 2WMSA 2UZWE 4O38A 3CKXA 3W18A 3GNIB 2XJ1A 5GJGA 3UDSA 4FUXA 3NAYA 2WGJA 5CU2A 4YHTA 5HNGA 3S4QA 5CYIA 4KKHA 1FMOE 2WO6A 4C38A 4FE2A 4BZDA 2R3KA 5C27A 2RG5A 5L2IA 3WF5A 1OPJA 3MBLA 4UYAA 2PVMA 3TZ9A 3TMOA 5ETAA 5KMKA 1QMZA 2JKKA 3P5KA 2UZEA 1M7NA 3NNXA 1UKIA 3H3CA 4X6RA 5KBRA 3O96A 1S9JA 2V0DA 2X4ZA 4BBFA 3NSZA 3ZH8A 4EOIA 4DFXE 4FTAA 4I0TA 3BU3A 3DZQA 4CFMA 2ZM1A 3ZOSA 4DBXA 5DRBA 3GBZA 3QX4A 5CENA 5LWNA 3TZ7A 3EFLA 2OKRA 3ZO1A 1PXKA 3SV0A 2PUUA 4JRVA 5K5NA 5EI2A 4CFUA 2VTPA 3AC2A 4PTCA 4NM5A 1XHAA 3L8XA 4GG5A 4IX4A 3VS0A 4FV1A 4JR3A 4O2PA 4OTWA 4RQVA 4ZXTA 4E7WA 3DU8A 2JDSA 5EDQA 3UDBA 4L45A 4USFA 4TYEA 2YIXA 3QQUA 4EOSA 1PF8A 3ALOA 2BZIB 3BQRA 2WPAA 4NZWB 3EFWA 3TTIA 3BYOA 5LWMA 4QP4A 3EN7A 5HGIA 5LMAA 3FJQE 2FH9A 2RFEA 3W0QA 1YXXA 2QR7A 3PXKA 1ZYJA 3B2WA 4RJ4A 5ANDA 4AOTA 4AXDA 5IMEA 2H6DA 2PZPA 2VO0A 2YWPA 3PJ3A 4OT5A 2HOGA 5DR6A 4D9UA 2JIUA 2JAMA 3LCSA 5M4UA 1WVWA 4FSQA 2J0IA 4RJ5A 2I0EA 4XG8A 2CKQA 4GU9A 2WTCA 4QMLA 5EM5A 5IQAA 2YDJA 4FICA 5GHVA 3NVKI 5ANGA 3TJDA 3E3BX 5GJDA 3UIBA 4QYHA 4BHNA 3PWDA 4I4FA 4C4JA 3SGCA 5IQEA 2AC5A 5AADA 2C0TA 3Q32A 3W2PA 2OJFE 4HYHA 4U6RA 5H8EA 3LM5A 3QQLA 4ZMFA 4DFYA 2UUEA 3UNJA 4GL9A 5AX3A 4G6OA 4JBVA 2C68A 2O63A 2J0KA 4WBBB 1U4DA 4AZVA 2VTIA 2HZIA 4NTTA 5IA5A 4FEWA 3N51A 3NRMA 4ZIMA 3TV4A 1OUYA 4D2SA 2X1NA 2QOQA 4I93A 5I9VA 3U6JA 1ZY4A 2R3PA 2EWAA 4FKPA 3G51A 4O6LA 2WMQA 3UG2A 3FMJA 4HYUA 4XV2A 2XP2A 2YCRA 4XOZA 4BCHA 3MGYA 4BDFA 3C4CA 5HE0A 1PXPA 3P78A 4B9DA 3UIUA 3RWPA 3HNGA 3C4FA 3A7HA 4L9IA 3LQ3A 3WZKA 4ZMEA 3QF9A 2XAMA 3JY9A 1REJA 2XK4A 2OXDA 2WKMA 2IW8A 1REKA 3V5PA 4RX5A 2C5XA 5A4EA 4O0UA 4XH6A 2C30A 4FKIA 3RPYA 1ZWSA 3CGFA 3FBVA 4M84A 3AMAA 1ST0A 2C6TA 2QO7A 4EOMA 4FMQA 1RE8A 3AGMA 2VWBA 5CSHA 5ANJA 3GC7A 4FTKA 2RF9A 2YISA 3LKMA 4LGHA 4X7QA 4CLIA 4BICA 4FKRA 3QZFA 3FWQA 3PUFC 3IW4A 3MFSA 5ACBC 5CAOA 4DT9A 4K33A 4ACDA 3NIZA 4L68A 4BDHA 4B8LA 5CF5A 3WIGA 4O0WA 5HO8A 2UW6A 3R9DA 1FOTA 2R5TA 3HECA 3R1QA 4G3GA 3GU5A 4FEQA 4MHAA 1YI3A 5BUJA 4GIHA 2E9OA 4FIHA 2JBOA 3PA5A 3DGKA 4Y5QA 3ZFYA 2W1FA 4MUQA 2UW9A 1U59A 5H8GA 4PNKA 3D2IA 2WTKC 4JQEA 5M06A 4XYFA 4CTCA 3EQPA 3OC1A 4O86A 5AFVA 4J53A 5FP5A 5FGKA 4DH8A 4QNYA 3NUPA 1H0WA 1XO2B 3BU5A 5CSVA 2ITPA 2GNHA 4KIQA 4C2WA 1YDSE 4BJJA 5AIRA 1OKZA 5M53A 4AP7A 3SW7A 3TYKA 3E8NA 3HV5A 3KQ7A 5IG1A 1Z5MA 3VHKA 2GNLA 5LVOA 1YHVA 2HIWA 3A4OX 3V8TA 3IGGA 5HEZA 4CEGA 3R1NA 3BLAA 3D4QA 4FTNA 4JDIA 2CGWA 1W8CA 2DS1A 3P0MA 1CKPA 4K9YA 4S31A 5T68A 3V51A 4F9YA 3CBLA 5A4CA 4OTQA 3DT1A 4JQ7A 3DY7A 3EQIA 3MPTA 3R7YA 3OUNB 4D5KA 3HMMA 3NYNA 4CRSA 4D9TA 4EK6A 4EL9A 4HCUA 2EUFB 2UZTA 5I4NA 3UBDA 2VO3A 4HGLA 4J7BA 3F3VA 3BCEA 4FEXA 3O51A 5ANEA 1QPDA 3VS4A 5HLWA 1V0OA 3OF0A 2V7OA 4H3BA 1MQBA 3SQQA 2B54A 4MQ2A 2WQMA 2J7TA 3CTQA 2VWUA 4L01A 4CRLA 4XG6A 4Z55A 1XH5A 2EU9A 3L1SA 4D55A 5DYJA 4PNIA 4O0SA 1EH4A 3AC3A 3ZDIA 3PXZA 2XIKA 2GFSA 4O27B 4J95A 2OH4A 4JRNA 2UVZA 5HTBA 2OJJA 2Y6MA 4DT8A 3RWQA 5HQ0A 4AW5A 5LOHA 3WE4A 2JFMA 4M97A 4WNKA 3R8PA 5F4NA 2I0VA 5AP0A 4QP2A 2ZDUA 3UVPA 4AQKA 5BVKA 5IEVA 1LR4A 2PZRA 5DT4A 4UY9A 4U81A 3GI3A 3SHEA 1ZZ2A 3QD2B 5HNBA 1PYXA 2PMOX 3GXLA 4J97A 2PYWA 1TVOA 3KVWA 3KULA 5HIBA 3LCTA 3L9NA 4IWOA 4RWJA 5JQ5A 3NPCA 3IONA 3PPJA 5CEQA 2FO0A 2J90A 2CKEA 3COKA 4HPTE 3EQFA 3NEWA 3LVPA 2EB3A 2I6LA 3CGOA 4I24A 4CFFA 4EK3A 2VTSA 3VUIA 3UZTA 4WRGA 3MDYA 2F4JA 3G0FA 4GS6A 4A9YA 1YOJA 2OLCA 3LLAA 5CU0A 4C3RA 4EKLA 2PZ5A 4OLIA 4RJ6A 4ALVA 4QMZA 3VUHA 3GUBA 1IA8A 3LJ0A 3LLTA 4OTGA 3VF9A 1R3CA 4CFXA 4IVAA 3P7AA 3UQCA 1CM8A 3NYXA 3MIAA 1ATPE 1NVSA 3LFQA 2UZLA 4WG3A 4AF3A 4E6DA 1WZYA 3FLZA 2XNPA 3VS5A 2OG8A 3HP2A 2B4SB 2ERKA 4G2FA 5D7VA 4F7SA 4TTHB 4NFMA 1OGYA 4AZEA 3RP9A 4P5ZA 3M42A 3KB7A 4BDBA 4ERWA 3KXGA 1WBNA 3UZRA 3QQKA 3N4VA 4EC8A 4E5BA 2R64A 3CPCA 3TCPA 4BZNA 2VTQA 3FC2A 2YAKA 4NH1A 3QAME 5CX9A 4R7HA 4UWYA 4NT4A 3MJ1A 4FSYA 1VLRA 3IK3A 3AC1A 2YDKA 2RGPA 3EN4A 4M15A 4NTSA 4YZ9A 3DXQA 5A46A 3ZLSA 5J1VA 1CDKA 4FV5A 5FTGA 3VUGA 3AD5A 2R3RA 3CKWA 2ETRA 5IDNA 4BZOA 3TUBA 4OW8A 3PXYA 4RJ8A 1OGUA 5EI6A 4A9SA 3F3ZA 5HIDA 3D5VA 4USDA 3Q2MA 4EH3A 1FINA 2PMLX 3BL9A 2A27A 2C6MA 3ORTA 4FTTA 3CPBA 4L52A 4LGGA 4O7LA 4P5QA 3SOAA 3T8OA 1JSTA 2J0JA 3FZ1A 4G6NA 4YJQA 2ZOQA 2WIPA 4IHPA 4S2ZA 3TKHA 4USEA 3CQEA 3PUPA 2JFLA 3KK8A 4HGEA 3MFRA 3FQHA 4MK0A 2Y4IC 3F9NA 3NR9A 4F9AA 4U97A 3DAKA 1OECA 4FKSA 3ZM4A 3VWAA 3PFQA 3FKLA 1KOAA 1SVGA 3EN6A 3DDQA 4Y46A 4LFIA 3R8VA 4OBPA 3R0TA 4LV7A 3UNKA 1M2RA 5C8KA 3UIMA 3Q4TA 3QA8A 1IEPA 3QRTA 4RVMA 4AGWA 3POZA 3DKFA 5AIKA 1XKKA 2X8IA 4ACCA 4ZZOA 1JQHA 3BLQA 5KHWA 4RX9A 2HCKA 3QTXA 5ANIA 4UYNA 3U4UA 4MNEB 4FZDB 2ZMDA 3ELJA 5ETIA 5L2TA 3TL8A 1OZ1A 4WOVA 5DOSA 3HUCA 2BZKB 2P2HA 4EOKA 3OUKA 4LRKA 3N4UA 3S2PA 5JGDA 4ZSLA 3QXPA 3FZRA 2VTAA 4EH4A 2X7FA 4IB1A 2KULA 3OMVA 4U44A 5KBQA 4FIGA 3T3VA 2UW3A 3Q60A 4BDAA 5IA1A 4O22A 4WKQA 4BGHA 4L44A 2X6DA 3PY3A 2J50A 4TYIA 4IM2A 4BCNA 4A4OA 3DB8A 4E1ZA 3KRXA 5EW8A 4EK4A 4KAOA 3NNUA 2W5BA 3RVGA 2XF0A 2XM8A 3DPKA 5AUVA 2KTYA 2X0GA 3ZSGA 2PE2A 3A62A 4G5PA 4ALWA 3V04A 1BKXA 4ERKA 3W0OA 5AUXA 4YTFA 5E8UA 1Q8WA 3HYHA 4DFZE 3BGZA 4O7WA 5IUHA 3ERKA 3SKCA 3BIZA 2WTVA 4DE4A 4D28A 4JT3A 5FDPA 5TR6A 3ROCA 2O2UA 3G9LX 3S3IA 4C37A 4S33A 2O8YA 3FZSA 3FAAA 3R8ZA 4R3PA 4NM0A