4BJJB

Sfc1-sfc7 dimerization module
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
94
structure length
85
Chain Sequence
SLETDVENIVFQFQNSSLDFQSSDDFSILGIDQPHPIVRIGGMFFRGTWHQPIGTDIVVPSVNDGLVLCKRRLMLEQIRLVPKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR TAU SUBUNIT SFC1
publication title RNA Polymerase III-Specific General Transcription Factor Iiic Contains a Heterodimer Resembling Tfiif RAP30/RAP74.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 9
structure length 85
sequence length 94
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10419 TFIIIC_sub6 TFIIIC subunit triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.170 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bjjB00
4BJJB
chains in the Genus database with same CATH superfamily
5D9HA 4DC2A 3F9NA 3Q9YA 3D5VA 3EQFA 4P90A 2H6DA 4M84A 4UALA 4JG7A 4TYHB 4II5A 3R7EA 5IA5A 3F69A 3UNKA 1JQHA 3KF4A 3O0GA 2X7GA 3QLFA 3ZFYA 5FG8A 2WQNA 4DTKA 4EBWA 3NWWA 4CCUA 4XLIA 3FLWA 2HZIA 4LUDA 2YCFA 3QC4A 5CEMA 4ZZMA 4EH2A 4A9UA 3DA6A 3VVHA 4CD0A 4EJNA 2WPAA 1OMWA 3IOPA 4YJNA 3VS6A 4AT5A 4AW2A 2XF0A 3M2WA 2XIYA 3OTUA 4XG8A 4ZSEA 2FO0A 2YIYA 4J98A 2VX1A 1UKHA 4QPSA 2BIYA 3CP9A 4YZBA 4DAWA 2OBJA 3WBLA 1GIIA 5KKRB 1DM2A 1YXXA 2Z8CA 3FC1X 5HIEA 4K6ZA 4FV7A 3DK7A 4U7ZA 2EXCX 3ZCLA 2QD9A 1IG1A 3L9MA 4XRLA 5A4EA 2W96B 3QALE 3GBZA 2DQ7X 5ICPA 4NWMA 2C30A 2Y9QA 2CGVA 4IQ6A 2BTRA 2X8IA 4R77A 2WMWA 3NAYA 1JBPE 4ANLA 2IVVA 4USDA 1HOWA 2WHBA 3FPMA 2WNTA 5D12A 3QUPA 3U9NA 3UC3A 3WZUA 2CN8A 3FXZA 4PQNA 3P08A 5LXMA 4BJJB 5A6OA 4DF3A 5LOHA 3VUKA 4PRJA 4Z7HA 2NYAA 3GFEA 5LARA 1LPUA 3LFBA 3OBGA 4UV0A 5H3QA 1UNHA 5DRBA 5HO8A 4CLIA 3R9HA 1IAHA 1PXMA 3QGYA 5B2MA 2VTOA 3D5UA 5IQIA 3OFMA 2GNJA 3BGZA 2B7AA 4C59A 4O81A 4M68A 3ATTA 3KVWA 4E73A 4CFXA 2W1IA 4BB4A 3AD5A 4GJ3A 2HXQA 3Q52A 4MNEB 3RK5A 1OUYA 4EBVA 4F7NA 5JFWA 1MQ4A 4CG8A 4CEGA 4HVSA 3O8PA 4XMOA 4C2VA 5GNKA 2B54A 2B1PA 4RWLA 3ZUVA 4ALVA 3KRRA 2R3GA 2YDKA 2P55A 3PA3A 3RAWA 3W32A 3KXXA 3QX2A 4RC2A 4FTJA 2A4LA 1Y8YA 4OTRA 3IDPA 4QP7A 4CMOA 3VW8A 1LP4A 4EK3A 5AM6A 4BGQA 5CF5A 4JJRA 2VU3A 1Y6BA 4O83A 3N9XA 4WSYA 5EQEA 3T9TA 3ZXZA 5FDPA 5IA0A 2R3QA 3TACA 1Z9XA 3CR0A 4AWIA 4OTQA 4O0WA 2J2IB 1AD5A 3E93A 4ID7A 4RJ6A 4IB1A 4EQCA 1GIHA 2VN9A 3LMGA 5BVNA 2XKDA 2XIRA 3FUPA 3CCNA 5CAOA 1Q8WA 3E3BX 3PIYA 5TF9A 2WKMA 5CS6A 2O8YA 1AGWA 2VWWA 4UZHA 2R3KA 4QTEA 1M2PA 4PWNA 4F09A 4I0SA 5I4NA 2WMUA 5CU0A 3NW5A 1H8FA 4I6QA 1OKVA 4YJUA 4D58A 3H0ZA 5E92A 3PJ3A 2OXYA 3FLYA 2I0EA 3LE6A 4DG2E 2FSMX 2R3PA 3R8ZA 3F82A 3L8VA 4JBVA 4YZNA 1APME 2OZOA 2WU7A 4J7BA 5D11A 4Z55A 4IX6A 4CKJA 3ZH8A 5KO1A 4AF3A 3K2LA 4FTTA 3OHTA 4ZMFA 5IEYA 4EQUA 4YJQA 4LV8A 3NNVA 4TRLA 2P4IA 2JEDA 4BCOA 5LJJA 4GFOA 2ONLC 2C3IB 4O82A 5HIBA 3NLBA 3R1QA 5CEQA 4AE6A 1OL5A 3E8NA 2HY0A 3EIDA 4EUUA 2PPQA 3WYXA 2UUEA 3P4KA 1T46A 3QXOA 5C03A 3R9DA 1I09A 3SXRA 4D0XA 4UN0C 4IWPA 3HNGA 1S9JA 4IB5A 5HNGA 2E9NA 4CT2A 2OH4A 4RLKA 4TYHA 5ANOA 3BELA 2XK6A 3IPHA 3E64A 3QA0A 1YQJA 3BIZA 4XP3A 4A9TA 4O0TA 4RJ7A 5AV2A 1STCE 3FMDA 1PMUA 3C50A 3KA0A 2ZMDA 4O86A 5EH0A 2G9XA 2ETKA 2YHVA 2EWAA 2A19B 4HYIA 2ZOQA 3NFFB 1S9IA 5FBOA 2IPXA 1OL7A 3QTRA 3ORIA 3MI9A 3MS9A 5AV1A 5JH6A 3PXKA 4AAAA 3PDTA 4YHTA 3BGPA 4IADA 2VO7A 3D7ZA 4W4YA 2X4ZA 3SOCA 4HCUA 2W1FA 4UYNA 3OCBA 4QP1A 3W2RA 4I6FA 2OU7A 2XJ2A 4CLJA 2JIIA 1UU9A 3HV5A 4EC9A 4EUTA 3R71A 3MH2A 5E9EA 4YBKA 3VS4A 1RDQE 3LKMA 5CSWA 5EW3A 4BGHA 2ZV7A 3VJOA 4F0IA 4BHZA 1KE7A 4BTKA 2WTKB 3BKBA 5CX9A 4IJ9A 4G9CA 1U54A 3QYWA 4BDJA 2PY3A 4DH1A 2VX3A 4WA9A 1T45A 3F5PA 2C6IA 2QU6A 3JR1A 3VJNA 2DUVA 4CFMA 4FT3A 4QPAA 2UW8A 3OCGA 3TNPC 1K3AA 3CPCA 3LJ1A 4ZTNA 3W33A 4O0VA 4R5YA 3FE3A 2IZSA 4TWOA 5EI2A 2C6EA 1U46A 4QMVA 3R1YA 4BCNA 5AA9A 4BTJA 1YDRE 3GU4A 3G5DA 5C27A 3G51A 3R7IA 2XALA 3JS2A 5EHLA 5KMMA 1PKGA 2Y6OA 4BJJA 3MPTA 4FL2A 4FK6A 3W8QA 3FZTA 3O71A 4UBAA 3SHEA 3PVUA 5DOSA 4D1SA 5CAVA 5EKOA 3ZFMA 5DN3A 4GV1A 3GT8A 2BFXA 2Y4PA 3KXZA 2WMTA 5DLSA 4L3LA 4C62A 3V8SA 2E9UA 4D9TA 4JR7A 4RA5A 4YU2A 3ZZWA 4GSBA 3PXYA 4QMYA 3LCKA 2I0VA 4LMUA 2R3MA 3G15A 5EYCA 3VBVA 2J90A 4JOAA 2RFDA 3AT3A 3QTIA 3CJFA 1EH4A 2QOBA 3PP1A 4F6UA 4IAFA 3W0RA 4F9AA 4OW8A 3A7HA 3VBQA 3PXFA 3PXQA 4AFJA 3GCSA 4IM3A 3G33A 3NS9A 3DS6A 3GU6A 4O6EA 5I9VA 5BMMA 3UIXA 3CD3A 2IZUA 1W98A 4R7HA 2B9JA 1OI9A 2QU5A 3DAKA 4J97A 4JT3A 4QO9A 1Y6AA 3ZBFA 3RM7A 3CSVA 2V7AA 4WOVA 5EW9A 4KIQA 4UY9A 3CJGA 2XNPA 3BV3A 3AMAA 4AXDA 1CDKA 4FA2A 4J96A 1YHWA 4YURA 1ZMWA 2Y6MA 4AU8A 1XO2B 1K2PA 1VEBA 4W4XA 3VAPA 4EK8A 2B55A 5CWZA 4EZ3A 5HNBA 3UQGA 4YJTA 2F2UA 2P33A 2JKMA 4HPTE 3SRVA 2CNUA 5JMSA 3I1AA 3LFFA 1R78A 3KXHA 4U45A 2G01A 3EOCA 1U5QA 1DI9A 4MF1A 3CQWA 2ITOA 3T3UA 3VW6A 2GS2A 3OEZA 4S2ZA 4LOQA 2G2HA 2B4SB 2WD1A 5AFVA 4IWOA 4L3PA 1P4OA 1OIQA 3ZO2A 3QTUA 3PPZA 4FBXA 2I0YA 3R9OA 1H27A 4RPVA 5BUEA 2YM5A 1K9AA 2FSOX 1NT2A 3B2TA 2PVRA 4DEHA 4M67A 2VTQA 1P14A 2EVAA 3KFAA 3MA3A 4E5WA 4LQMA 2ZV2A 3EWHA 3OD6X 4FKOA 5JQ5A 3OUKA 1VYZA 1H08A 4AGDA 5IQAA 3BHUA 1R0EA 2JDSA 1WBNA 1OKYA 3Q60A 2PZIA 2C3JA 2ZMCA 1GOLA 2GPHA 1GY3A 2YCQA 3K5UA 3MW1A 3W18A 4AS0A 4BDFA 4CRLA 4YTIA 5L2SA 1YOJA 4NUSA 4UB7A 3VUMA 4ANQA 2NNWB 3RI1A 4PMTA 4X3JA 4GYGA 3DK3A 2P0CA 3A60A 5JGDA 1H1WA 5IQHA 2RG6A 4ZSAA 4XG7A 3RK9A 2R3JA 4DBXA 4FOCA 4EOJA 2BTSA 5AP7A 4D2RA 2PVLA 4RZWA 2RL5A 4I1ZA 3NMUF 3DDQA 3DTCA 3G0FA 3GC9A 3TNQB 4XJ0A 4HVGA 5LQFA 4DFXE 4C34A 4DEAA 2H9VA 1ZOHA 1YXTA 4EHZA 3PIXA 3IONA 5KCVA 1GZOA 4EOOA 4FV6A 3D7TB 3GOPA 3UVPA 4FV3A 2ZVAA 3OBJA 3VQUA 4UZDA 4RBLA 3QD0A 1SM2A 2JKOA 1B39A 2F7EE 3FMNA 5K9IA 4BIEA 5CEOA 1YI3A 2X8EA 5AP0A 2CGXA 2VRXA 1P5EA 2WIPA 3FDNA 1Z5MA 5IDNA 3SD0A 1UKIA 3IDBA 2VTJA 4MHAA 4FTQA 4YTHA 2X7FA 2C5VA 3EN4A 2NRUA 4F64A 2B9FA 3EN9A 4DCEA 4QP3A 1A9UA 3H9OA 4M8TA 4QP9A 4CMTA 5HX8A 2UZDA 1DS5A 3CKWA 3KRWA 2GTMA 2YCRA 1OM1A 3JY0A 5KZ0A 1HCLA 5AJQA 2W4OA 3O51A 4FSWA 3QKMA 4NYEA 4C3RA 4C4FA 5JN2A 4FSZA 3ZUTA 2F9GA 2YN8A 4LDTA 4HGSA 2OICA 5HTCA 3RHKA 1UWJA 2PMLX 3DBDA 3UYSA 2R0IA 3Q5IA 3P79A 4CGAA 4BTFA 2KTYA 2GTNA 4H3PA 1W7HA 3WYYA 1YDTE 3DZOA 5K3YA 5F4NA 5E8TA 3EH9A 4RWIA 4MQ2A 1DAWA 2NP8A 3ZFXA 5EW8A 4LRMA 3SGCA 4X3FC 3I5ZA 3AC8A 3V04A 3R8MA 3NYXA 3FZOA 3QKKA 1M17A 4RQKA 3U4UA 3ID6C 4NJDA 4F63A 5HNIX 4AOJA 3MESA 5M4FA 3FMJA 3BBWA 2YCSA 4EK5A 4U81A 2WIHA 2VTMA 1Q5KA 3F2AA 3JPVA 4CRSA 1P4FA 3G9LX 1H0WA 4F78A 4RX5A 4I4FA 2OSCA 3EMGA 4TNBA 1FQ1B 2PVYA 3ZLYA 3ORKA 2JFLA 1JKKA 4F9YA 4OTWA 1JNKA 3UNJA 3NIZA 3VRZA 4FKPA 4D5KA 5J9YA 2CKEA 3ANRA 4X21A 4WG3A 5CNNA 2BDWA 4L7FA 4NSTA 5JZNA 3FXWA 4O38A 3HRBA 4M7IA 2C6DA 3MFTA 3F2RA 3PXRA 1Q8TA 5ETAA 3WI6A 3KMMA 3PZHA 4U97A 3ZO4A 5BVOA 5IQFA 4O7TA 3ZM9A 3ITZA 5EM6A 4YJPA 3IW8A 4NL0A 3E7OA 3HKOA 3R8PA 1X8BA 4CVAA 2OI4X 2R3OA 1FMKA 2WTVA 2YIQA 3C13A 3DKOA 3HL7A 3P86A 5HO7A 2W17A 5HE3A 2C6KA 4ERWA 4JS8A 4ZK5A 1JOWB 2PVHA 3OP5A 3W0OA 4XEYA 3VS7A 2W99B 2PMIA 3CXWA 4GCJA 3KN6A 4I5PA 4M13A 2EB2A 3LM5A 3ULIA 2C68A 3KKVA 3SXFA 3K5VA 3ODYX 4DHFA 4DFYA 5EKNA 3PY3A 5DWRA 5AUUA 2X9EA 4DBNA 3R83A 1WBSA 2OF2A 4G3EA 2VGPA 4C4GA 4F6SA 3C4CA 3FQHA 4QYYA 2R7BA 2HWPA 1J91A 3HVCA 4JVGA 3C51A 4L00A 4L8MA 4YPDA 3S95A 5AEPA 2OZAB 4FVQA 2UW5A 4WT6A 4UYAA 3BHYA 1WBWA 5JFSA 4O22A 1NXKA 2UW0A 4BDGA 3BHTA 5GJFA 3BE2A 4DFZE 4DGLC 3DCVA 4FZAB 2E9OA 5H2UA 4FTNA 3PIZA 2WO6A 2PZPA 3VUIA 4USFA 1Q41A 4QMLA 1FINA 3ORLA 3V5LA 4C02A 3P7BA 3IW4A 1JLUE 4AGWA 3OF0A 2XP2A 3NW6A 5BX0A 4PTCA 4FODA 4H3BA 3TWJA 4DHJA 4H39A 4XUFA 4FNYA 1YOLA 3I0OA 2VTHA 3QTQA 4I6LA 5CF4A 3EZVA 3E5AA 3HV7A 2XCHA 4IWQA 2QOHA 3UIBA 4B9DA 2RIOA 5LVOA 1PY5A 2BZIB 4EOLA 4BDAA 2QLQA 1M14A 4C0TA 1YXUA 5EI8A 4ZIMA 5DHJA 3QQFA 3WARA 2Z60A 3GC7A 5DIAA 4QNAA 5AWMA 3D7TA 4DINA 3NPCA 3TZ9A 5KZIA 3QRUA 3FY0A 3NDMA 3ZRMA 4YBJA 4B6LA 3MGYA 4OTHA 3RPSA 4YLLA 3TNHA 5FEEA 3ZU7A 5FM2A 4BDCA 1ZYDA 4ZMEA 4GIHA 2ZV9A 3UOKA 3QTXA 4J52A 2PVKA 4NK9A 4DEGA 1MRVA 1DI8A 3HMOA 4S30A 3MJ1A 4AG8A 4MCVA 3BPRA 3DKGA 2CNQA 3FKLA 3PVBA 4TNDA 3PTGA 4QTAA 2IG7A 3TM0A 3EYHA 5HGIA 1PMEA 3OUNB 5H8BA 1PHKA 1MQBA 3MTFA 4FI1A 3QTSA 5HIDA 1WBPA 2PZYA 4WD5A 3UO5A 2P3GX 1OKWA 2ITTA 2QODA 3FKNA 4GK2A 4GT4A 4UWCA 3RNIA 2WGJA 5C1QB 3KREA 5AAFA 1B6CB 1H25A 2VTRA 4G3FA 1UU7A 4I0TA 4ZAUA 5CTPA 3W2SA 3JYAA 4ZXTA 2XARA 3R22A 4D4SA 2GHMA 2NRYA 4F70A 2UVZA 2UW9A 3HUCA 4O0YA 5HTBA 5GINE 2BAQA 5GJDA 2PZ5A 1WAKA 1MUOA 5CALA 1H0VA 4FV0A 4R1VA 3BU5A 3SVVA 3TZMA 4RIXB 4HGEA 1WVXA 2ITVA 4BCIA 1NVQA 3AC2A 1OL1A 3SW7A 4RG0A 5TOZA 1CSNA 3NSZA 4FV4A 3ZYAA 3HV4A 5M44A 4IDTA 4B8LA 4HYSA 2BRGA 3RINA 3CE3A 4IANA 2YM6A 3IO7A 3F5XA 4X6QC 4FTOA 5FXSA 3MSSA 3V8TA 3MJ2A 3RAIA 1SVEA 4K2RA 2AUHA 3H9FA 4RJ8A 4AQKA 1YXSA 1MRYA 5CSHA 5M4CA 3VHEA 3REPA 4IVAA 3SG9A 2QOQA 4JG8A 2EB3A 3VHKA 1XH6A 4ZTLA 2J0LA 4MAOA 5HVJA 4CNHA 5E1EA 4RQVA 3RPRA 3IW7A 3CEKA 4NW6A 3UOHA 1OBGA 3DDPA 4FK3A 5CXHA 4FEVA 3AG9A 4IZ7A 3WF5A 3DPKA 4E6QA 5ETIA 4AAYA 3MFSA 2XM9A 4DGGA 3LCTA 4EYJA 3DJ6A 4QTDA 1GZNA 4U40A 4A7CA 2BZJA 3GU5A 4AXFA 2C0OA 3ODZX 3WE4A 5AV4A 3TNIA 4EI4A 4LRJA 4CFNA 3MBLA 4DITA 2Y8OA 2X1NA 3A7FA 4CKIA 1JVPP 3ZLXA 5CU4A 3FSFA 3ELJA 3I0QA 4W4WA 3UDZA 4EHVA 2ETRA 4O6LA 5AUWA 1V0PA 4PY1A 3UPXA 2HENA 2ITNA 3CGFA 2R64A 1CKJA 4HCTA 3RP9A 2IWIA 2WMBA 4F0FA 1OIUA 5EQYA 4C36A 5E8ZA 5KMKA 4N4SA 5DH3A 2BZHB 4Z9LA 5BVDA 4XBRA 2VTLA 3P23A 4G5PA 4MWIA 1WBTA 4JQ8A 4GMYA 3PWDA 2CKOA 2ITWA 3AT2A 3UOJA 4MXXA 4PTEA 5EYMA 4EJ7A 1W83A 4EORA 1GIJA 2VTIA 1ZZ2A 3QCSA 2J0IA 2JKQA 4Q5EA 3GOKA 5EM5A 4ACMA 3FMKA 1PXLA 3FLNC 4AE9A 3FI2A 1LEZA 1KWPA 2QOKA 3K3IA 4HCVA 3S0OA 3QZHA 1ZOGA 4EHGA 4YNOA 5DPVA 1WBVA 5DT3A 3O8TA 3HV3A 3IK3A 2QO2A 2XMYA 4G31A 4DLJA 3ZTXA 5A4CA 3HYHA 1NA7A 2WQMA 5D1JA 3UBDA 3TTIA 4APPA 4IW0A 4B4LA 4CZUA 2ZB0A 2E2BA 2GDOA 2RFNA 2VO6A 2GU8A 3LMHA 3Q6WA 5E8SA 5BVEA 4AXEA 3BYUA 3NZ0A 4FSUA 2YISA 5IQEA 3W2OA 3PWYA 2FYSA 3OMVA 4AA4A 3VWAA 4RVLA 4EKLA 1KV1A 3N4VA 1BL6A 3QD4A 4PDOA 2VGOA 4QEBA 4ZS4A 4DH3A 4QYFA 4DH5A 4NM7A 3F88A 3R02A 5DYJA 4AGCA 2PUUA 1OZ1A 1ZAOA 3DBEA 4FV9A 4WBOA 4EC8A 3GI3A 3GUBA 3MVMA 3HA6A 3QC9A 2Z7RA 3RPVA 3WF6A 1W0XC 3PG3A 3HGKA 1ATPE 4Q9SA 4ASEA 4BDDA 3KGAA 1FBNA 3D83A 3FZRA 3HDMA 2PE1A 3ORNA 1SMHA 3QHWA 3M42A 3EQGA 3QZFA 3ZZEA 3Q4TA 3DLSA 4AXAA 4YMJA 4L44A 4QRCA 5HE0A 3VUGA 1KSWA 3LXPA 4C61A 4ENYA 3NCGA 3OWJA 4C7TA 4F7SA 4R78A 5CF6A 1P2AA 3OC1A 4EQMA 5KMIA 4P5ZA 4H36A 4FICA 3OY3A 1OKZA 2RFEA 4TPTA 4L46A 1JPAA 1TQIA 5DG5A 2E9PA 2XKEA 3WE8A 4I94A 2C0TA 4MTAA 5HKMA 4F0GA 5JGBA 3BYSA 1H1RA 1V1KA 1BMKA 2J4ZA 2PHKA 4YZMA 4IVBA 3KL8A 3W16A 4IB3A 2X0GA 5E91A 3I5NA 2W9ZB 4GEOA 4XS2A 3FZSA 1PYXA 3OOMA 2OFUA 4FR4A 2R3RA 4YC8A 2BAJA 4JR3A 4MK0A 3RHXA 4C4JA 1H1QA 2WTJA 3UODA 3JVRA 3UO4A 3QCQA 1PMVA 4DYMA 5BYLA 4ANSA 3QD2B 3W0MA 5JK3A 1I44A 4NCTC 4MEDA 3D2KA 4RJ5A 3ZO3A 3DB8A 4AFEA 3UO6A 2LAVA 4RC4A 2JIUA 2QR7A 3HP2A 2LGCA 5HCXA 4RIXA 2R4BA 4CTBA 3P7AA 3KULB 3OZ6A 1OL2A 4BBFA 1QPEA 2VTPA 4FKQA 3TNWA 3GCPA 4D28A 3F6XA 4ZS0A 3HDNA 3HMNA 3U87A 4I3ZA 4JG6A 5J5SA 3H30A 4PNIA 4ZOGA 3EN6A 4I0RA 5K4JA 5EYKA 4DCAA 1BI7A 2E9VA 3DU8A 1A06A 3ALOA 3OS3A 5T68A 1YHVA 2UZWE 1PKDA 4BCFA 1PYEA 3GQLA 3HA8A 3KCKA 4RX8A 2C6OA 2UZUE 2OWBA 3Q9XA 4LM5A 4OTIA 2GSFA 3QU0A 2JDRA 3LM0A 4Q5HA 5L8JA 3ZRLA 4IX3A 2GQSA 4FEXA 4DEIA 4X2NA 3DV3A 3H4JA 4PNKA 4YTCA 4KSQA 1OPLA 4RGJA 4G34A 5EK7A 5BUJA 2RKUA 4DG3E 3EHAA 1B38A 3HMPA 2GCDA 2YFXA 4ASXA 3JY9A 2P2IA 3B8QA 2F7ZE 4XYFA 2GNHA 2GNIA 3MH0A 1RQQA 2WOUA 4D5HA 1Z57A 5E8UA 3WZJA 4AXCA 3ZRKA 2O63A 5IMEA 4YO6A 2ITPA 2FA2A 3VNTA 4KWPA 3PUPA 3RVGA 1IA8A 5CVFA 5HE2A 2IW8A 3KRJA 3D0EA 4EH4A 3PUFC 1Q4LA 3WZKA 4EK6A 2HAKA 5M07A 4QDEA 4RFYA 1XMLA 2BALA 5DE2A 3BL9A 2OIQA 1BI8A 3DFCB 4UWYA 3ET7A 2WEIA 4TKSA 3Q2JA 4JAIA 2VTTA 3A7JA 3F5GA 3PJCA 4LFIA 5CF8A 4F6WA 5L8LA 3ZUUA 1JKTA 4FZDB 3SAYA 4FUYA 3KC3A 3RMFA 5AM7A 4FKUA 4HGTA 3FMEA 4BDBA 2CHLA 5EYDA 1WMKA 4I22A 4YZ9A 3IW6A 4MXYA 5BNJA 3NVMB 3Q04A 2ERZE 4FZ7A 3F7WA 4FG8A 5JT2A 3V5PA 4IAZA 1XQZA 3LXNA 3HECA 4V01A 4NJ3A 4I6HA 3V3VA 5HBEA 2GMXA 3BLRA 3BWJA 5T6KA 4TYGA 3TYKA 1UA2A 2B52A 1G8SA 1ZY4A 2ZFYA 3F3TA 5AA8A 4OGRA 2RG5A 4GW8A 4A07A 2XNOA 2VV9A 3QYZA 3U51A 4CMUA 3QQJA 3AGLA 3QUEA 3NNWA 4FUXA 1OL6A 5FTOA 4FT0A 2QNJA 3NUAA 4D55A 3QQUA 3EQRA 4U9AA 2W7XA 4JI9A 4U79A 4AZWA 5AAEA 2VWVA 4WIHA 5DEYA 1Q97A 1TFFA 5J8IA 3BX5A 3OTVA 3HP5A 3ZDIA 3ZLWA 4ARKA 3UPZA 3AMYA 2ZM1A 3W0NA 3L9LA 4C4HA 3R01A 4MD7E 5B2LA 5LMBA 2QKRA 2XEZA 4DGNA 4TYIA 3HMMA 1U59A 3MVLA 5LCKA 5E1SA 4CT1A 5IDPA 3POOA 3R7VA 2GFSA 3E62A 5HQ0A 2WMRA 3EN7A 5KUPA 1AQ1A 3OROA 4NIFB 3W0PA 4K33A 4MBJA 5IH4A 5M56A 3R00A 1GZ8A 2XS0A 3ATSA 3C4FA 3L8XA 5FP6A 3FMLA 2W5BA 3VBYA 2Z7QA 4FOBA 3TUBA 3QCXA 2W1DA 1ZMUA 3D14A 3KK9A 2X81A 5HG8A 4F9WA 3O23A 4YZDA 3O7LD 2Y4IC 3G0EA 4FGBA 4KD1A 4ZY5A 4WNMA 1O6KA 3DKCA 3TUDA 4X6RA 4JQEA 5EOLA 5J1WA 5CQWA 1ST4A 4GVJA 2YITA 4X3FB 4S34A 1WBOA 1OVEA 3BEGA 3W1FA 2JLDA 4WNOA 4EOMA 4DH8A 2VUWA 4KINA 3EYGA 4QMOA 3P1AA 3ZS5A 4IAIA 3COKA 4FNWA 3UZPA 2FB8A 4MNEA 2HY81 3C0GA 4WNPA 4R3RA 2XNGA 3GFWA 3UMXA 3CKXA 2X2KA 4QP2A 3IQ7A 5I9WA 2C5NA 3OWPA 1OECA 3HZTA 5M09A 5LWNA 5LMKA 4O84A 3LFEA 3I4BA 2A2AA 4G3GA 4JXFA 4M0ZA 2V22A 4QMWA 5D41A 5A4TA 5GIOE 2XNBA 4ITHA 1R1WA 2XM8A 3GGFA 3MY1A 3FAAA 4KS8A 4NW5A 4YJRA 4D4YA 1KOBA 5HX6A 4FEUA 4Y72A 3CC6A 4Y8DA 4E8AA 1RW8A 5GJGA 5I9UA 1BUHA 4E1ZA 4GYIA 3LFDA 2O0UA 2DWBA 2QURA 3NUSA 2X4FA 4WRGA 3E8DA 3WILA 2WQOA 1UV5A 4E4LA 2V7OA 3ZC6A 4DFLA 4FVPA 4KKHA 4ZSJA 3EFLA 3TIZA 4RJ4A 1ZYSA 1XWSA 4D9UA 3NCZA 3Q9WA 3F3UA 1OITA 3VUHA 1UVRA 3BHHA 1IAJA 4FT9A 4NZWB 5E90A 1M2RA 2Y7JA 2P2HA 3R2YA 3FMMA 4LMNA 4QQJA 1TQPA 4EH5A 1G8KA 1PJKA 4JBOA 2F57A 1ZXEA 4FKWA 2BPMA 3VS3A 3DGKA 1R0PA 3R1SA 4O7WA 4F99A 2VWZA 3ZONA 1MP8A 4MBIA 1F5QA 4PDYA 1LEWA 4I23A 4TZRA 3HEGA 1ZY5A 4FSQA 3FI4A 3OT8A 3R04A 3UOLA 3V6SA 5IA2A 3I79A 2PL0A 3DBFA 3HMIA 4ZJJA 3NAXA 2BHHA 3KF7A 4I24A 4AN3A 4RIYB 1VJYA 4BCJA 5HD7A 4L7SA 4YC6A 2OK1A 3KEXA 3SQQA 5ANGA 4E6DA 5JGAA 4J95A 5HLPA 1URWA 3ERKA 3TDVA 3ROCA 3Q9ZA 3IG7A 2X2MA 1H01A 2Z7LA 2OIDA 5ACBC 3UVRA 3V01A 3PP0A 2I7QA 3FY2A 4Y73A 3QWJA 2VO3A 2JD5A 3TKHA 4L52A 5HU3A 5A14A 1Y91A 4FV5A 4Z3VA 4XG9A 5JRSA 1REJA 4FE2A 4PDPA 4PV0A 4HNIA 3D5WA 2XJ0A 3EL8A 4ASZA 4XV2A 4ZY6A 4BDEA 4XV3A 2F2CB 2BDJA 3V8WA 4FTMA 2XCKA 2YEXA 4JBQA 2GFCA 1Q3DA 3QTZA 1MRUA 5IUIA 2GHGA 4J99A 5KMLA 1R39A 1YWRA 2YERA 4HPUE 1W8CA 5IH6A 3ZSHA 4G3CA 4L68A 2OKRA 4YP8A 2C4GA 3G2FA 4YTFA 2C5OA 4DLIA 3MFUA 3QKLA 5E4HA 5C8NA 5J7HA 5CSVA 2BIKB 2I6LA 1A48A 1PXOA 4MNFA 4RZVA 5F1ZA 4EL9A 3LW0A 3QBNA 3R73A 4M69B 4DT9A 2RF9A 5A4LA 2C3LA 2HWOA 5C01A 4E5BA 3CTJA 2BHEA 5BYYA 5F20A 4O96A 4AZFA 4CCBA 4DTBA 4KB8A 3GC0A 3ZO1A 4X2GA 2J5FA 4OR5A 2CCHA 3F3ZA 3Q2MA 3Q4UA 1TVOA 3QXPA 4LL0A 5CZIA 5D10A 5DFPA 3TMOA 2CN5A 1JWHA 1OIRA 3DJ5A 4MXZA 5D7VA 5IQDA 2BUJA 2EXMA 5KHWA 3TUCA 4JLCA 5AV0A 4NFMA 5ANJA 2BR1A 3C4WA 3I81A 2B9IA 5IEVA 5BVFA 5T3QA 4GH2A 5HVYA 4ZJIA 3ETAA 3OVVA 5CVHA 3NNXA 4FKSA 4QP6A 2ACXA 4HW7A 3R7OA 2VO0A 2YWVA 4BCGA 3TZ8A 3TTJA 3UVQA 2UVXA 5HBHA 4C4IA 3BCEA 3WOWA 3UG1A 4AA5A 5EDPA 2BRHA 4YJOA 4TWCA 4MVFA 1KE8A 4XBUA 4BCHA 4XP2A 3TCPA 3UG2A 4JRNA 3U55A 2JC6A 4FTLA 4LUEA 3EQHA 3QRTA 1XBCA 4X3FA 3P5JC 5J87A 4EH9A 2X8DA 3Q53A 3OY1A 3PYYA 5L6PA 1ZYJA 3FZPA 4LGHA 4MD9E 4RLLA 4JQ7A 2WB8A 3MDYA 1ERKA 2OXDA 2A0CX 4FIHA 3A8XA 3DBQA 4BF2A 4EOPA 2GS6A 3QLGA 3MV5A 2PMOX 2UV2A 2XEYA 3UGCA 4EZ5A 4G9RA 2XANA 1NY3A 3MPAA 2XAOA 3NVKI 2GNFA 4C4EA 4ITIA 5IQBA 4AN9A 5E8VA 2OJGA 2V62A 5AP1A 4MH7A 2J6MA 4PMSA 2FVDA 3EQPA 2QKWB 3F7ZA 2UZLA 4QTCA 3S00A 4D2SA 4I5CA 5C4KA 4JAJA 3DOGA 3AGMA 4BIDA 4IC8A 5C4LA 1OPJA 2PULA 1FVRA 2YM3A 2HZNA 4V04A 1BLXA 4RJ3A 3V5WA 5IMXA 5C26A 4FL1A 3DTWA 2IVSA 3PFYA 4AOTA 2B9HA 3QD3A 2WMQA 2WXVA 4PUZA 5AMNA 3KB7A 4MYGA 1YWNA 4B7TA 2WAJA 2HW6A 4L42A 4EKKA 4MXAA 2CKPA 1YI6A 4EOIA 4TW9A 4ORKA 5BVWA 2WU6A 3QZIA 3FI8A 3PA5A 4IC7A 3EQBA 3GP0A 4IFGA 1SZMA 3L9PA 2XB7A 3MFRA 4FMQA 4I5HA 2QI8A 1IASA 4H1JA 4K18A 4ZSLA 4C3PA 4J71A 3TDWA 3IW5A 2B0QA 2W0JA 4JNWA 2AC3A 2WMAA 3COMA 3G6HA 5FEDA 5AUYA 4L53A 4ZEGA 4F4PA 1IR3A 1PXPA 3LFCA 3GC8A 2XVDA 2BDFA 2Z02A 5IH5A 2R3NA 2WMXA 2CNVA 4AW5A 2CSNA 3EZRA 4EONA 4BI1A 1F0QA 4AQCA 4RIYA 5BUIA 3E8EA 4N0SA 3LHJA 3CQEA 3OWKA 1PW2A 2R0UA 4KAOA 2C1BA 4FNXA 3KQ7A 5AX9A 3BU3A 3QRJA 4IACA 4OLIA 3S3IA 4FYNA 4NKAA 5C9CA 1XBAA 4ZLZA 4TTHB 2O64A 3SV0A 3VC4A 4EH3A 4DTAA 4FNZA 1QL6A 4FTUA 2PUPA 2C3KA 1PXNA 5HU9A 4L67A 5IZFA 3FBVA 5HICA 2VWUA 3O5AA 1J1BA 5FBNC 2YIRA 1NVSA 3MY5A 4U41A 1REKA 3LCOA 4XV1A 4A06A 2R7IA 5CQUA 2G1TA 1VZOA 3OT3A 3H0YA 5EDRA 3TJCA 5L2IA 5L3AA 5HLNA 2QLUA 2OO8X 2XBJA 4UXLA 4DEEA 2W1GA 1H07A 3I6WA 5LVPA 1JKLA 4BR3A 3HLLA 2ESMA 2YACA 4YNEA 3Q5ZA 4DA5A 1PF8A 2H8HA 3FZ1A 5ACKA 2W1CA 2CMWA 1M7QA 3OW4A 3ZEPA 4XHKB 3O7LB 3Q3BA 3AMBA 5AP6A 2ERKA 5J9ZA 3TKIA 2XNMA 2QQ7A 2YJSA 2V5QA 1CTPE 4JDKA 1GJOA 4BDKA 4KBAA 4C35A 2HXLA 4DGOA 4XCUA 5G1XA 1ZARA 4NT4A 2PK9A 2WELA 4BIBA 4DEBA 3D4QA 4CKRA 4IM0A 4E20A 2PUIA 2QOOA 4DEDA 1JSVA 2O3PA 3P5KA 4CZTA 2C1AA 3D15A 4XP0A 4WO5A 4ALWA 3PSBA 2W9FB 2UW7A 3KRXA 5IISA 4ONAA 3MPMA 4QQCA 3TG1A 5AP4A 5KBQA 3O2MA 3PA4A 1Y57A 4KIPA 4PDSA 4WG4A 4YUQA 5IU2A 1HCKA 3FWQA 3QWKA 1CKPA 4G6NA 4GK3A 4G17A 3G90X 3F61A 4E6AA 4WNKA 1VYWA 3G6GA 3A99A 2FSLX 3HAVA 4R3PA 3NUNA 4F7LA 3LJ2A 3GB2A 2HELA 2QG5A 4LYNA 4DDIA 1YWVA 2XYUA 4OTGA 4R6VA 3FSKA 1GZKA 1JKSA 4KUJA 4E4MA 3DXQA 2XYNA 4IAAA 2NPQA 4ZZNA 3BYMA 5EQPA 3FXXA 3KXGA 3ROYA 2FSTX 2JDOA 3U6JA 5JKGA 2X2LA 1XH9A 4O7RA 1ZYCA 4D4VA 3LCDA 4QMUA 2HOGA 2RGPA 1J7IA 4CQEA 4M14A 2SRCA 5IA1A 5AUZA 4HNFA 2JAMA 4U44A 4FKTA 3V5TA 4AOIA 4FV1A 2YAAA 4MWHA 4H05A 3C5UA 3W8LA 4DE4A 3K3JA 3F2NA 1O9UA 4MBLA 4O2PA 2OFVA 1G3NA 3BRBA 2EU9A 4JDHA 2VWBA 4FTKA 4XX9A 2QHNA 3UZTA 1URCA 3BI6A 4O0RA 4QMQA 3M11A 4YZCA 2R3FA 5BVKA 2YM8A 3QQKA 3T9IA 4U80A 3ZM4A 3AC5A 4KABA 4QMXA 4D4RA 4QMPA 1YDSE 5HG7A 3ZLSA 2V55A 5JQ8A 3DNEA 4O0SA 4ZY4A 3GXLA 1OPKA 3U9CA 3IKAA 3R6XA 4HZSA 4QP8A 2C0IA 3LZBA 2DS1A 3UZRA 3N4TA 1W82A 5A54A 1Q8YA 4M97A 2X6EA 5HLWA 4QYGA 5LCJA 3RZBA 3PJ8A 4JX3A 2BROA 4I5MA 5CY3A 5IQCA 3LLTA 5BQ0A 4E4XA 4KSPA 5KBRA 3KVXA 3R8LA 2WTIA 3VBWA 4UX9A 4V0GB 4FKVA 1Q61A 4BYIA 5DRDA 4F9CA 5BMSA 3MWUA 4GKIA 3DAJA 4RFZA 4ZTMA 3WF9A 3BQRA 3LXLA 4IAYA 5JSMA 1YHSA 4YHFA 2OZAA 4G5JA 5DI1A 2VWIA 4CFWA 4BCPA 2Q0NA 3NYNA 3PSDA 2JFMA 5HORA 4JMQA 5IPJA 3R7UA 2QOCA 4BCMA 3E92A 2HCKA 3MB6A 3AD6A 4FZ6A 4QMZA 5FXRA 3EB0A 4GG5A 3AD4A 2WEVA 4U3YA 3VONA 3R7YA 2H96A 4AT3A 4TY1A 4YGAA 3RPYA 1BX6A 3CGOA 3MB7A 1NW1A 4E6CA 3H3CA 3ORPA 4R1YA 4XNEA 5L8KA 5M55A 1OUKA 3PXZA 5H8EA 5I9YA 3NX8A 1WZYA 4F1MA 4O0UA 2WMSA 4W4VA 3IECA 4C33A 3P0MA 4G1WA 5CENA 3OXIA 5CXZA 4L6QA 1QPJA 3W2PA 4AW0A 3NGAA 2PTKA 3W10A 3I60A 2XK9A 3LOKA 2EUFB 4FIIA 4GUBA 3SG8A 2W06A 4GK4A 1CKIA 4FSYA 5CEPA 3GU7A 5EOBA 4A9YA 4PX6A 1Q8UA 3W0SA 2OIBA 2QC6A 4O7NA 3V6RA 5CZHA 2JGZA 3JUHA 4U8ZA 4F65A 5M57A 5HEZA 4FIGA 3Q4CA 4P7EA 3C9WA 3VQHA 4FSTA 4IEBA 4Z16A 2G2FA 4TYJA 5FEQA 1ZMVA 4M3QA 3U54A 1FGKA 2QHMA 4H1MA 4K0YA 2DYLA 3E7VA 4GG7A 3GEQA 4U3ZA 4K9YA 4ACGA 3UDSA 2PU8A 1U54B 5TKDA 5CSPA 4Y83A 4G3DA 4FL3A 4L3JA 4FT5A 2QR8A 1FMOE 1M2QA 3C5IA 1ST0A 4BICA 3NUYA 3UP2A 2XK3A 3NUUA 2CJMA 3PE2A 3VS2A 4G2FA 1YXVA 4QQ5A 4D1ZA 5I0BA 2ZM4A 2WQBA 5LVNA 2Y4IB 3U6HA 5IUHA 5L6OA 5HG5A 3FYKX 3KXMA 5HBJA 4ERKA 5JFXA 5FGKA 4P4CA 2BILB 4L9IA 2FH9A 2OXXA 4FEWA 2IZRA 2VAGA 2XNNA 3EFJA 2JAVA 1XH4A 4C2WA 1J1CA 4E26A 4BTMA 5H9BA 4PL5A 3LQ3A 4NKSA 1XH7A 4IB0A 4KKGA 5CYIA 4Z7GA 3GCVA 2CLQA 4WRSA 4CXAA 3E8CA 2RFSA 1M7NA 4IVCA 5CT0A 4B0GA 1QMZA 2XIXA 5HESA 4NCTA 2BRBA 3FEGA 5CEKA 4IHPA 2XIZA 1U4DA 3AKKA 2AC5A 1ND4A 4QMMA 5KE0A 2OW3A 4HJOA 2IVTA 3COHA 2YAKA 3VO3A 5E7RA 5BYZA 3ULZA 2W1EA 2W1ZA 3BU6A 3G9NA 2FGIA 3E88A 3FMHA 2GS7A 4GS6A 4GKHA 4BI2A 3I6UA 4RIWB 2OH0E 2ZAZA 3O50A 5J95A 3EQIA 5TO8A 4DFNA 4NU1A 5LVMA 3S1HA 3CTQA 2XK7A 4L45A 2I1MA 5TT7A 3KN5A 3BLQA 4IVDA 5ETFA 3V5QA 5IF1A 5A46A 3E87A 4RWKA 4R5SA 4E5AX 4NM0A 3R21A 4EK4A 1SVHA 3DQWA 5AP2A 1BKXA 4FVRA 5HVKA 1U5RA 2V0DA 2Y0AA 3ZSGA 3DK6A 2HIWA 4BDIA 4QQTA 2ZB1A 5CANA 3AKLA 4HZRA 2C6LA 3LXKA 3M1SA 4KRCA 4GUEA 4EOQA 3QAME 4EH7A 1KUTA 4V05A 2IN6A 3P78A 4HOKA 5J9LA 5DGZA 4XH6A 3BEAA 3NUXA 4MKCA 5HZNA 4TN6A 3FLSA 4O91A 2PVNA 1LUFA 5FM3A 3CIKA 4M15A 1LR4A 3SRVB 5BV3A 3KK8A 2GNGA 4CTCA 5M4UA 3PSCA 4IDVA 4N6YA 2REIA 3SLSA 2IO6A 4FC0A 3U8WA 3EQDA 3HRCA 1XR1A 2OJIA 3A7IA 2BRNA 1SNUA 5BPYA 2Z7SA 4GJ2A 4P2KA 3BV2A 4HVIA 3AOXA 5DVRA 3FJQE 4V0GA 4FTRA 4Q2AA 4UWBA 4R7IA 5LWMA 2CGWA 4FYOA 4BCQA 5ITAA 2ONLA 3FLZA 3O96A 2BMCA 5FP5A 5CI6A 4RMZA 4YLJA 4FGRA 3TJDA 4F7JA 3SDJA 2YM4A 2W5HA 3CY2A 3WIGA 3N51A 4MUQA 4RT7A 2JIVA 2Q0BA 2YIXA 1G8AA 2I40A 3ENHA 4IZ5A 4JDJA 4IBMA 2HYYA 4L43A 4MXCA 1RE8A 1E1VA 3OW3A 4AZSA 3NEWA 3K54A 2GQRA 4PP7A 3IOKA 2J9MA 4N6ZA 4ZP5A 5C8MA 3CPBA 3PY1A 4IIRA 2I0HA 3TV7A 1KV2A 3EL7A 4G16A 2J51A 3OCSA 4J1RA 3ANQA 4U6RA 1R3CA 3BQCA 4C38A 3ENMA 3C4EA 5ETCA 2CKQA 4BKJA 3GNIB 4YPSA 5IA3A 5FXQA 3UDBA 1Q8ZA 3NR9A 4YSJA 2W4KA 3C0HA 3QHRA 2PWLA 2VX0A 1XKKA 1FVTA 3RPOA 4BVUA 2UZBA 5DT4A 3R1NA 3D94A 2GHLA 3NW7A 4LL5A 5LVLA 4QMNA 2ZJWA 2QONA 3VBXA 5F94A 5FDXA 4CFFA 3PJ2A 3RJCA 2OGVA 2XZSA 3MTLA 4I92A 3W2QA 3CS9A 1ZOEA 3LFAA 3Q6UA 5CASA 2VTSA 3FHIA 3NFGB 4LI5A 4TWNA 5KKRC 3LVPA 4GL9A 2CGUA 3A2CA 3OXZA 4DDGA 4A9SA 3W0QA 3FKOA 2OF4A 4BDHA 1FPUA 4NFNA 4IMYA 5EM7A 2ZDTA 1QCFA 3DLZA 3UIMA 4HYUA 3L8SA 2ITZA 5AAGA 3KMWA 2QOLA 5E8XA 5JFVA 4J8MA 4FKRA 4GVAA 3JXWA 3R63A 2UW6A 3ZC5A 4CFVA 3ORZA 4GIIA 4LV5A 4BCKA 4GT3A 4ZTQA 3MVJA 3ORXA 5I9ZA 4QYEA 2VWXA 1OGYA 1YVJA 4B99A 4O7ZA 4BYJA 1WVYA 4RRVA 3UIUA 1XMMA 4FG9A 4OBPA 5HD4A 4EWQA 2ITXA 3FI3A 2W4JA 4K1BA 3C7QA 1OB3A 2UW3A 2YDJA 3Q32A 3CY3A 4JIAA 4R3CA 5DBXA 4BN1A 3DJ7A 3AT4A 4S33A 4BZDA 4D1XA 4HVHA 5TR6A 2UZEA 5DA3A 3UC4A 3FLQA 1BL7A 4NM3A 4OTDA 4JX7A 4PL3A 4WKQA 4C3FA 4FSMA 4XOZA 3MIAA 3TXOA 3KU2A 3D2IA 3KULA 4IAKA 1H28A 1NVRA 2PZRA 1CMKE 5D7AA 3GQIA 4D0WA 3R9NA 1DAYA 1SYKA 1UU3A 1PXKA 1UNGA 3PLSA 1PXJA 2QO9A 5ANKA 3RK7A 4FIJA 4FSRA 4K8AA 4ZTHA 4DG0E 4U43A 4DFBA 5I9XA 4XOYA 5A4QA 4XG3A 3KXNA 3RCJA 4BC6A 3VF9A 3FPQA 3C0IA 4FSNA 4RIWA 5LMKC 2QVSE 2ZYBA 3ZBXA 3HRFA 5HG9A 3R8UA 3IGOA 3A4OX 3PVGA 4C58A 1UNLA 2CDZA 4FG7A 1H00A 2XKCA 2CLXA 5IEXA 3RTPA 3F3WA 2PE0A 4OBQA 3WZEA 2PSQA 5E8YA 3R28A 2OG8A 3PRFA 4LOOA 4ENXA 2UZOA 4IX5A 4NM5A 2X7OA 4JRVA 2YABA 4BBEA 2J0JA 3RGFA 2O5KA 3R30A 3W2CA 1KE5A 3UYTA 1H1SA 4QOXA 1WFCA 4O2ZA 5AV3A 1ZZLA 4FKJA 5HE1A 3QUDA 2R3LA 2VTNA 2UVYA 3SA0A 5EHYA 2O2UA 2C6MA 3P7CA 3DFAA 2XK8A 3ZHPC 1SNXA 3Q96A 3BYVA 4PL4A 3UQCA 2YZAA 3DT1A 4FX3A 3W55A 4AX8A 2VD5A 4U5JA 5A9UA 5KMJA 4PP9A 2XAMA 4ACDA 3ACJA 3C1XA 3LQ8A 3AXWA 3KY2A 1J3HA 3VN9A 4W8EA 5HHWA 4WHZA 3AC4A 1YW2A 2WZJA 4OT6A 2XK4A 3ML1A 3PLAE 4FKLA 3PVWA 5DEWA 2PYWA 4I4EA 3QCYA 4FKGA 4XG6A 4EZ7A 3D9VA 4ZTSA 3UJGA 5CEIA 1ZWSA 3SX9A 4A4XA 4F1TA 3N4UA 4EEVA 3GCUA 4IZYA 4LG4A 4QDVA 3SOAA 2YWPA 4JDIA 3QA8A 4M0YA 4O7VA 4ZJVA 3RWQA 4KBKA 1Q24A 2XUUA 4FV8A 4XLVA 3RALA 2WFYA 3U6IA 4XV9A 4AACA 5I5ZA 2WTCA 5FTGA 1ZLTA 2ZM3A 3UQFA 5B0XA 4F1OA 3LJ0A 3TN8A 4O21A 2UW4A 3ZEWA 4CV8A 4NTTA 4Y95A 3BHVA 4DHIB 2XH5A 4G6OA 4MQ1A 2HZ0A 2ZDUA 4KRDA 1ZRZA 4L01A 2YDIA 2J0KA 2W05A 3FHRA 5DR9A 1Q62A 3QQLA 3RNYA 4ITJA 2NO3A 3O8UA 5CI7A 3QQGA 5A6NA 3WF8A 3A62A 2BKZA 5FUTA 4LV7A 4ZLOA 2BRMA 4KIOA 4EYMA 3A4PA 3DB6A 4IFCA 5EHOA 4C37A 3FYJX 3FV8A 4KNBA 3MYGA 4LRKA 3GVUA 3UMWA 3THBA 1OIYA 4AW1A 3GCQA 3L9NA 2CPKE 2BZKB 5FD2A 1JSTA 3C4ZA 5CNOA 4DN5A 2R9SA 3CLYA 3EKKA 1H4LA 2HW7A 3FL4A 5E8WA 5IA4A 2IVUA 1V0BA 2QG7A 2R3HA 4FKIA 4I6BA 2WTKC 2HZ4A 3PE1A 2F49A 1JAMA 1JSUA 2X39A 5C8KA 3OXTA 4HYHA 4BRXA 4BZNA 5CSXA 3FL5A 3H9RA 4I20A 4O7YA 5CU6A 1GNGA 5JRQA 2G2IA 3LFSA 2VTAA 4LOPA 3UTOA 3WZDA 4F08A 4IM2A 2J5EA 4QMTA 3SW4A 3SXSA 2JDVA 3E63A 4FEQA 3HV6A 5CAUA 3AQVA 5LMAA 5AIRA 3P9JA 2XNEA 3PY0A 3VIDA 4HVDA 2R5TA 4UXQA 4U0IA 3ZDUA 3PRIA 3DXPA 1SVGA 1H24A 4RIOA 2XA4A 4HGLA 3QL8A 2QOIA 3PPJA 2ITUA 3AKJA 4BI0A 4E4NA 2WMVA 3UNZA 4KA3A 3POZA 1KE6A 2QCSA 2QOFA 2WQEA 4J53A 4ZTRA 2GQGA 4PMPA 4IX4A 5FTQA 4ZLYA 4AT4A 3I7CA 3IDCA 4GU9A 1O6LA 1V0OA 3II5A 5F95A 3T3VA 4EWHA 3TV6A 4GT5A 4FIEA 2YZLA 1YRPA 3A8WA 4OTFA 2G15A 4YJVA 5HCYA 3RAKA 4E7WA 3R2BA 1E9HA 4OT5A 5M08A 3KMUA 4PF4A 4BY9E 2VWYA 2JITA 3V5JA 3PPKA 1Q99A 3ZXTA 2UZNA 1IA9A 3FC2A 3IS5A 3TL8A 2PMNX 3EJ1A 2FUMA 4K11A 3BE9A 4W8DA 2GNLA 4TWPA 2YA9A 4QTBA 3RAHA 4AZTA 4DT8A 3OCTA 3ORTA 3FQSA 4WUAA 2HK5A 3KCFA 4OBOA 4JIKA 2VNWA 4PMMA 3BWFA 1WVWA 3LFNA 4AGUA 2Z2WA 5AUXA 4RSSA 5M4IA 5EFQA 3QX4A 2R3IA 1J7UA 3OEFX 4S32A 3LMIA 3T8OA 5AX3A 3VF8A 3R9RA 3BLHA 4R7BA 3TI1A 4ASDA 5IG1A 4U42A 2VNYA 2YJRA 4FIFA 4QMSA 4O27B 1YOMA 5AP3A 4MD8E 4MXOA 2XKFA 2ITYA 3PG1A 1PXIA 2XRUA 4EOSA 1VLRA 4DHZA 3VRYA 1YI4A 2VZ6A 4KKEA 2YIWA 2BAKA 2B53A 4TT7A 5GHVA 1PMNA 4IZAA 5G6VA 2PE2A 1KE9A 3SC1A 2C6TA 5FQDC 3VS0A 4ZSGA 4ANMA 2JDTA 2OJFE 5HI2A 2JBPA 3AC3A 4RWJA 4YC3A 5L6WL 4AA0A 4BBMA 4AZEA 5KNJA 3DBCA 1CM8A 3DAEA 2XIKA 1RJBA 3QRKA 4GU6A 2YM7A 5ANIA 4CFUA 5L2TA 2J50A 2OLCA 3MA6A 4X2KA 3VUDA 4IWDA 4CV9A 5AUTA 1E1XA 4WUNA 4RVTA 4ALUA 2PVMA 4TXCA 2A27A 5FRIA 5L2WA 2CCIA 5KMNA 4TYEA 4RFMA 5CAPA 3U4WA 1IEPA 3B2WA 4BHNA 3O17A 4XG2A 4APCA 1H26A 3PFQA 4FTAA 4YO4A 5JZJA 2C47A 4DH7A 1YKRA 4FTIA 1F3MC 4JL9A 3RKBA 4IJPA 5EI6A 4AP7A 2OJJA 4E93A 5M53A 5DNRA 3MH1A 3PJ1A 4RVKA 4XG4A 4MX9A 4ACHA 5ANEA 5B7VA 4QYHA 5IUGA 5J1VA 3RM6A 3NYVA 3OOGA 4OUCA 5EDQA 4M12A 4BZOA 4J8NA 3KIOC 3ALNA 4XRJA 5CLPA 3A7GA 4FZFB 3WIKA 4AUAA 2W5AA 3IGGA 1J7LA 3D5XA 3H10A 4PTGA 4AN2A 3LQ5A 1TQMA 5CU3A 1VR2A 4YHJA 3PZEA 5EG3A 3RWPA 2ETMA 2UZTA 3NUPA 5EM8A 4KBCA 4YR8A 5CAQA 1KOAA 4N70A 3R8VA 3L1SA 4Y5HA 3TEIA 5KX8A 3NNUA 4B8MA 4CSVA 2AYPA 3BBTB 3CQUA 4Y85A 5IQGA 5CT7A 4ANBA 1ZYLA 3QTWA 4ACCA 3QFVA 1W84A 1XHAA 2H34A 2R2PA 3B8RA 3BLAA 3GENA 3S2PA 5DR6A 2A1AB 2IJMA 3DY7A 5AADA 1G5SA 2F4JA 5K4IA 1FOTA 4CG9A 4JBPA 3MVHA 4EH6A 3NRMA 4LGGA 1QPCA 4RX9A 3BYOA 1XH8A 3VS1A 3QZGA 4FV2A 4EOKA 3TT0A 5AP5A 4KS7A 1GAGA 5JEBA 3HX4A 1M52A 4FTCA 3LPBA 4EHEA 4TL0A 4FJVA 1XBBA 2UZVA 3NYOA 4X2JA 4Y5QA 2PVFA 5AIKA 4GFMA 4FT7A 1XJDA 2C5YA 3MY0A 3SKCA 1Q3WA 2BKKA 3EN5A 3F5UA 5ANDA 1UWHA 4NH1A 5HCZA 4DGMA 5KMOA 3EFKA 3QQHA 4YLKA 2OJ9A 4YJSA 2Q83A 4Q9ZA 4X2FA 3CBLA 3OG7A 3DQXA 4A4OA 3NIEA 3QF9A 3MH3A 2QO7A 2X6DA 2WTWA 4USEA 5B2KA 3WF7A 4NTSA 1QPDA 3LIJA 2BVAA 5F9EA 1G8JA 4H58A 3FQEA 1L8TA 4RX7A 1OGUA 3ORMA 4YSMA 3BZ3A 3LLAA 4K77A 3LCSA 5A3XA 1UU8A 4RC3A 2IW6A 1H1PA 2WTDA 1L3RE 4X0MA 5DT0A 4A9RA 2C5XA 2ZV8A 2IZTA 4QT1A 3ACKA 3LAUA 2WOTA 5H8GA 3S4QA 2X9FA 4BGGA 4WBBB 5KHXA 4GRBA 3AC1A 3ZOSA 2JBOA 3I7BA 3CD8A 3KRLA 2XJ1A 4O0XA 3E3PA 4QNYA 1Y8GA 1BYGA 3DZQA 1OBDA 4QP4A 4AZVA 1PRYA 3QRIA 3TIYA 2J7TA 1FVVA 2BFYA 3DXNA 3F3VA 4RVMA 3VS5A 2AEGA 4Y46A 3Q4ZA 2JKKA 2PVJA 3UE4A 2KULA 4H3QA 5K5NA 5K5XA 4N57A 2J0MB 4IH8A 5M51A 2PUNA 3TKUA 3HAMA 5FLFA 4IE9A 3F66A 3ZMMA 4UEUA 3BGQA 5CU2A 4S31A 1IRKA 3UP7A 4DFUA 4GFGA 3TZ7A 4P5QA 1O6YA 3VULA 3EKNA 3LFQA 3JVSA 4RA4A 3V51A 4X7QA 3ZSIA 2W1HA 3MN3A 1XH5A 3CTHA 4O7SA 4I21A 4I93A 1TKIA 2BCJA 3DKFA 4WG5A 5DR2A 2XRWA 3DNDA 3UDTA 3C4XA 4A4LA 3COIA 4F9BA 3MIYA 4I41A 3RCDA 5GIPE 5AUVA 3EQCA 2XBAA 1FGIA 4ZZOA 4G6LA 1WCCA 2C69A 3QGWA 3HUBA 3BL7A 3GU8A 3VBTA 3L8PA 3R0TA 4O7LA 5M06A 2O65A 3EFWA 4EH8A 3A61A 3OWLA 2ITQA 2IW9A 3TV4A 2F7XE 5CVGA
chains in the Genus database with same CATH topology
5D9HA 4DC2A 3F9NA 3Q9YA 3D5VA 3EQFA 4P90A 2H6DA 4M84A 4UALA 4JG7A 4TYHB 4II5A 3R7EA 5IA5A 3F69A 3UNKA 1JQHA 3KF4A 3O0GA 2X7GA 3QLFA 3ZFYA 5FG8A 2WQNA 4DTKA 4EBWA 3NWWA 4CCUA 4XLIA 3FLWA 2HZIA 4LUDA 2YCFA 3QC4A 5CEMA 4ZZMA 4EH2A 4A9UA 3DA6A 3VVHA 4CD0A 4EJNA 2WPAA 1OMWA 3IOPA 4YJNA 3VS6A 4AT5A 4AW2A 2XF0A 3M2WA 2XIYA 3OTUA 4XG8A 4ZSEA 2FO0A 2YIYA 4J98A 2VX1A 1UKHA 4QPSA 2BIYA 3CP9A 4YZBA 4DAWA 2OBJA 3WBLA 1GIIA 5KKRB 1DM2A 1YXXA 2Z8CA 3FC1X 5HIEA 4K6ZA 4FV7A 3DK7A 4U7ZA 2EXCX 3ZCLA 2QD9A 1IG1A 3L9MA 4XRLA 5A4EA 2W96B 3QALE 3GBZA 2DQ7X 5ICPA 4NWMA 2C30A 2Y9QA 2CGVA 4IQ6A 2BTRA 2X8IA 4R77A 2WMWA 3NAYA 1JBPE 4ANLA 2IVVA 4USDA 1HOWA 2WHBA 3FPMA 2WNTA 5D12A 3QUPA 3U9NA 3UC3A 3WZUA 2CN8A 3FXZA 4PQNA 3P08A 5LXMA 4BJJB 5A6OA 4DF3A 5LOHA 3VUKA 4PRJA 4Z7HA 2NYAA 3GFEA 5LARA 1LPUA 3LFBA 3OBGA 4UV0A 5H3QA 1UNHA 5DRBA 5HO8A 4CLIA 3R9HA 1IAHA 1PXMA 3QGYA 5B2MA 2VTOA 3D5UA 5IQIA 3OFMA 2GNJA 3BGZA 2B7AA 4C59A 4O81A 4M68A 3ATTA 3KVWA 4E73A 4CFXA 2W1IA 4BB4A 3AD5A 4GJ3A 2HXQA 3Q52A 4MNEB 3RK5A 1OUYA 4EBVA 4F7NA 5JFWA 1MQ4A 4CG8A 4CEGA 4HVSA 3O8PA 4XMOA 4C2VA 5GNKA 2B54A 2B1PA 4RWLA 3ZUVA 4ALVA 3KRRA 2R3GA 2YDKA 2P55A 3PA3A 3RAWA 3W32A 3KXXA 3QX2A 4RC2A 4FTJA 2A4LA 1Y8YA 4OTRA 3IDPA 4QP7A 4CMOA 3VW8A 1LP4A 4EK3A 5AM6A 4BGQA 5CF5A 4JJRA 2VU3A 1Y6BA 4O83A 3N9XA 4WSYA 5EQEA 3T9TA 3ZXZA 5FDPA 5IA0A 2R3QA 3TACA 1Z9XA 3CR0A 4AWIA 4OTQA 4O0WA 2J2IB 1AD5A 3E93A 4ID7A 4RJ6A 4IB1A 4EQCA 1GIHA 2VN9A 3LMGA 5BVNA 2XKDA 2XIRA 3FUPA 3CCNA 5CAOA 1Q8WA 3E3BX 3PIYA 5TF9A 2WKMA 5CS6A 2O8YA 1AGWA 2VWWA 4UZHA 2R3KA 4QTEA 1M2PA 4PWNA 4F09A 4I0SA 5I4NA 2WMUA 5CU0A 3NW5A 1H8FA 4I6QA 1OKVA 4YJUA 4D58A 3H0ZA 5E92A 3PJ3A 2OXYA 3FLYA 2I0EA 3LE6A 4DG2E 2FSMX 2R3PA 3R8ZA 3F82A 3L8VA 4JBVA 4YZNA 1APME 2OZOA 2WU7A 4J7BA 5D11A 4Z55A 4IX6A 4CKJA 3ZH8A 5KO1A 4AF3A 3K2LA 4FTTA 3OHTA 4ZMFA 5IEYA 4EQUA 4YJQA 4LV8A 3NNVA 4TRLA 2P4IA 2JEDA 4BCOA 5LJJA 4GFOA 2ONLC 2C3IB 4O82A 5HIBA 3NLBA 3R1QA 5CEQA 4AE6A 1OL5A 3E8NA 2HY0A 3EIDA 4EUUA 2PPQA 3WYXA 2UUEA 3P4KA 1T46A 3QXOA 5C03A 3R9DA 1I09A 3SXRA 4D0XA 4UN0C 4IWPA 3HNGA 1S9JA 4IB5A 5HNGA 2E9NA 4CT2A 2OH4A 4RLKA 4TYHA 5ANOA 3BELA 2XK6A 3IPHA 3E64A 3QA0A 1YQJA 3BIZA 4XP3A 4A9TA 4O0TA 4RJ7A 5AV2A 1STCE 3FMDA 1PMUA 3C50A 3KA0A 2ZMDA 4O86A 5EH0A 2G9XA 2ETKA 2YHVA 2EWAA 2A19B 4HYIA 2ZOQA 3NFFB 1S9IA 5FBOA 2IPXA 1OL7A 3QTRA 3ORIA 3MI9A 3MS9A 5AV1A 5JH6A 3PXKA 4AAAA 3PDTA 4YHTA 3BGPA 4IADA 2VO7A 3D7ZA 4W4YA 2X4ZA 3SOCA 4HCUA 2W1FA 4UYNA 3OCBA 4QP1A 3W2RA 4I6FA 2OU7A 2XJ2A 4CLJA 2JIIA 1UU9A 3HV5A 4EC9A 4EUTA 3R71A 3MH2A 5E9EA 4YBKA 3VS4A 1RDQE 3LKMA 5CSWA 5EW3A 4BGHA 2ZV7A 3VJOA 4F0IA 4BHZA 1KE7A 4BTKA 2WTKB 3BKBA 5CX9A 4IJ9A 4G9CA 1U54A 3QYWA 4BDJA 2PY3A 4DH1A 2VX3A 4WA9A 1T45A 3F5PA 2C6IA 2QU6A 3JR1A 3VJNA 2DUVA 4CFMA 4FT3A 4QPAA 2UW8A 3OCGA 3TNPC 1K3AA 3CPCA 3LJ1A 4ZTNA 3W33A 4O0VA 4R5YA 3FE3A 2IZSA 4TWOA 5EI2A 2C6EA 1U46A 4QMVA 3R1YA 4BCNA 5AA9A 4BTJA 1YDRE 3GU4A 3G5DA 5C27A 3G51A 3R7IA 2XALA 3JS2A 5EHLA 5KMMA 1PKGA 2Y6OA 4BJJA 3MPTA 4FL2A 4FK6A 3W8QA 3FZTA 3O71A 4UBAA 3SHEA 3PVUA 5DOSA 4D1SA 5CAVA 5EKOA 3ZFMA 5DN3A 4GV1A 3GT8A 2BFXA 2Y4PA 3KXZA 2WMTA 5DLSA 4L3LA 4C62A 3V8SA 2E9UA 4D9TA 4JR7A 4RA5A 4YU2A 3ZZWA 4GSBA 3PXYA 4QMYA 3LCKA 2I0VA 4LMUA 2R3MA 3G15A 5EYCA 3VBVA 2J90A 4JOAA 2RFDA 3AT3A 3QTIA 3CJFA 1EH4A 2QOBA 3PP1A 4F6UA 4IAFA 3W0RA 4F9AA 4OW8A 3A7HA 3VBQA 3PXFA 3PXQA 4AFJA 3GCSA 4IM3A 3G33A 3NS9A 3DS6A 3GU6A 4O6EA 5I9VA 5BMMA 3UIXA 3CD3A 2IZUA 1W98A 4R7HA 2B9JA 1OI9A 2QU5A 3DAKA 4J97A 4JT3A 4QO9A 1Y6AA 3ZBFA 3RM7A 3CSVA 2V7AA 4WOVA 5EW9A 4KIQA 4UY9A 3CJGA 2XNPA 3BV3A 3AMAA 4AXDA 1CDKA 4FA2A 4J96A 1YHWA 4YURA 1ZMWA 2Y6MA 4AU8A 1XO2B 1K2PA 1VEBA 4W4XA 3VAPA 4EK8A 2B55A 5CWZA 4EZ3A 5HNBA 3UQGA 4YJTA 2F2UA 2P33A 2JKMA 4HPTE 3SRVA 2CNUA 5JMSA 3I1AA 3LFFA 1R78A 3KXHA 4U45A 2G01A 3EOCA 1U5QA 1DI9A 4MF1A 3CQWA 2ITOA 3T3UA 3VW6A 2GS2A 3OEZA 4S2ZA 4LOQA 2G2HA 2B4SB 2WD1A 5AFVA 4IWOA 4L3PA 1P4OA 1OIQA 3ZO2A 3QTUA 3PPZA 4FBXA 2I0YA 3R9OA 1H27A 4RPVA 5BUEA 2YM5A 1K9AA 2FSOX 1NT2A 3B2TA 2PVRA 4DEHA 4M67A 2VTQA 1P14A 2EVAA 3KFAA 3MA3A 4E5WA 4LQMA 2ZV2A 3EWHA 3OD6X 4FKOA 5JQ5A 3OUKA 1VYZA 1H08A 4AGDA 5IQAA 3BHUA 1R0EA 2JDSA 1WBNA 1OKYA 3Q60A 2PZIA 2C3JA 2ZMCA 1GOLA 2GPHA 1GY3A 2YCQA 3K5UA 3MW1A 3W18A 4AS0A 4BDFA 4CRLA 4YTIA 5L2SA 1YOJA 4NUSA 4UB7A 3VUMA 4ANQA 2NNWB 3RI1A 4PMTA 4X3JA 4GYGA 3DK3A 2P0CA 3A60A 5JGDA 1H1WA 5IQHA 2RG6A 4ZSAA 4XG7A 3RK9A 2R3JA 4DBXA 4FOCA 4EOJA 2BTSA 5AP7A 4D2RA 2PVLA 4RZWA 2RL5A 4I1ZA 3NMUF 3DDQA 3DTCA 3G0FA 3GC9A 3TNQB 4XJ0A 4HVGA 5LQFA 4DFXE 4C34A 4DEAA 2H9VA 1ZOHA 1YXTA 4EHZA 3PIXA 3IONA 5KCVA 1GZOA 4EOOA 4FV6A 3D7TB 3GOPA 3UVPA 4FV3A 2ZVAA 3OBJA 3VQUA 4UZDA 4RBLA 3QD0A 1SM2A 2JKOA 1B39A 2F7EE 3FMNA 5K9IA 4BIEA 5CEOA 1YI3A 2X8EA 5AP0A 2CGXA 2VRXA 1P5EA 2WIPA 3FDNA 1Z5MA 5IDNA 3SD0A 1UKIA 3IDBA 2VTJA 4MHAA 4FTQA 4YTHA 2X7FA 2C5VA 3EN4A 2NRUA 4F64A 2B9FA 3EN9A 4DCEA 4QP3A 1A9UA 3H9OA 4M8TA 4QP9A 4CMTA 5HX8A 2UZDA 1DS5A 3CKWA 3KRWA 2GTMA 2YCRA 1OM1A 3JY0A 5KZ0A 1HCLA 5AJQA 2W4OA 3O51A 4FSWA 3QKMA 4NYEA 4C3RA 4C4FA 5JN2A 4FSZA 3ZUTA 2F9GA 2YN8A 4LDTA 4HGSA 2OICA 5HTCA 3RHKA 1UWJA 2PMLX 3DBDA 3UYSA 2R0IA 3Q5IA 3P79A 4CGAA 4BTFA 2KTYA 2GTNA 4H3PA 1W7HA 3WYYA 1YDTE 3DZOA 5K3YA 5F4NA 5E8TA 3EH9A 4RWIA 4MQ2A 1DAWA 2NP8A 3ZFXA 5EW8A 4LRMA 3SGCA 4X3FC 3I5ZA 3AC8A 3V04A 3R8MA 3NYXA 3FZOA 3QKKA 1M17A 4RQKA 3U4UA 3ID6C 4NJDA 4F63A 5HNIX 4AOJA 3MESA 5M4FA 3FMJA 3BBWA 2YCSA 4EK5A 4U81A 2WIHA 2VTMA 1Q5KA 3F2AA 3JPVA 4CRSA 1P4FA 3G9LX 1H0WA 4F78A 4RX5A 4I4FA 2OSCA 3EMGA 4TNBA 1FQ1B 2PVYA 3ZLYA 3ORKA 2JFLA 1JKKA 4F9YA 4OTWA 1JNKA 3UNJA 3NIZA 3VRZA 4FKPA 4D5KA 5J9YA 2CKEA 3ANRA 4X21A 4WG3A 5CNNA 2BDWA 4L7FA 4NSTA 5JZNA 3FXWA 4O38A 3HRBA 4M7IA 2C6DA 3MFTA 3F2RA 3PXRA 1Q8TA 5ETAA 3WI6A 3KMMA 3PZHA 4U97A 3ZO4A 5BVOA 5IQFA 4O7TA 3ZM9A 3ITZA 5EM6A 4YJPA 3IW8A 4NL0A 3E7OA 3HKOA 3R8PA 1X8BA 4CVAA 2OI4X 2R3OA 1FMKA 2WTVA 2YIQA 3C13A 3DKOA 3HL7A 3P86A 5HO7A 2W17A 5HE3A 2C6KA 4ERWA 4JS8A 4ZK5A 1JOWB 2PVHA 3OP5A 3W0OA 4XEYA 3VS7A 2W99B 2PMIA 3CXWA 4GCJA 3KN6A 4I5PA 4M13A 2EB2A 3LM5A 3ULIA 2C68A 3KKVA 3SXFA 3K5VA 3ODYX 4DHFA 4DFYA 5EKNA 3PY3A 5DWRA 5AUUA 2X9EA 4DBNA 3R83A 1WBSA 2OF2A 4G3EA 2VGPA 4C4GA 4F6SA 3C4CA 3FQHA 4QYYA 2R7BA 2HWPA 1J91A 3HVCA 4JVGA 3C51A 4L00A 4L8MA 4YPDA 3S95A 5AEPA 2OZAB 4FVQA 2UW5A 4WT6A 4UYAA 3BHYA 1WBWA 5JFSA 4O22A 1NXKA 2UW0A 4BDGA 3BHTA 5GJFA 3BE2A 4DFZE 4DGLC 3DCVA 4FZAB 2E9OA 5H2UA 4FTNA 3PIZA 2WO6A 2PZPA 3VUIA 4USFA 1Q41A 4QMLA 1FINA 3ORLA 3V5LA 4C02A 3P7BA 3IW4A 1JLUE 4AGWA 3OF0A 2XP2A 3NW6A 5BX0A 4PTCA 4FODA 4H3BA 3TWJA 4DHJA 4H39A 4XUFA 4FNYA 1YOLA 3I0OA 2VTHA 3QTQA 4I6LA 5CF4A 3EZVA 3E5AA 3HV7A 2XCHA 4IWQA 2QOHA 3UIBA 4B9DA 2RIOA 5LVOA 1PY5A 2BZIB 4EOLA 4BDAA 2QLQA 1M14A 4C0TA 1YXUA 5EI8A 4ZIMA 5DHJA 3QQFA 3WARA 2Z60A 3GC7A 5DIAA 4QNAA 5AWMA 3D7TA 4DINA 3NPCA 3TZ9A 5KZIA 3QRUA 3FY0A 3NDMA 3ZRMA 4YBJA 4B6LA 3MGYA 4OTHA 3RPSA 4YLLA 3TNHA 5FEEA 3ZU7A 5FM2A 4BDCA 1ZYDA 4ZMEA 4GIHA 2ZV9A 3UOKA 3QTXA 4J52A 2PVKA 4NK9A 4DEGA 1MRVA 1DI8A 3HMOA 4S30A 3MJ1A 4AG8A 4MCVA 3BPRA 3DKGA 2CNQA 3FKLA 3PVBA 4TNDA 3PTGA 4QTAA 2IG7A 3TM0A 3EYHA 5HGIA 1PMEA 3OUNB 5H8BA 1PHKA 1MQBA 3MTFA 4FI1A 3QTSA 5HIDA 1WBPA 2PZYA 4WD5A 3UO5A 2P3GX 1OKWA 2ITTA 2QODA 3FKNA 4GK2A 4GT4A 4UWCA 3RNIA 2WGJA 5C1QB 3KREA 5AAFA 1B6CB 1H25A 2VTRA 4G3FA 1UU7A 4I0TA 4ZAUA 5CTPA 3W2SA 3JYAA 4ZXTA 2XARA 3R22A 4D4SA 2GHMA 2NRYA 4F70A 2UVZA 2UW9A 3HUCA 4O0YA 5HTBA 5GINE 2BAQA 5GJDA 2PZ5A 1WAKA 1MUOA 5CALA 1H0VA 4FV0A 4R1VA 3BU5A 3SVVA 3TZMA 4RIXB 4HGEA 1WVXA 2ITVA 4BCIA 1NVQA 3AC2A 1OL1A 3SW7A 4RG0A 5TOZA 1CSNA 3NSZA 4FV4A 3ZYAA 3HV4A 5M44A 4IDTA 4B8LA 4HYSA 2BRGA 3RINA 3CE3A 4IANA 2YM6A 3IO7A 3F5XA 4X6QC 4FTOA 5FXSA 3MSSA 3V8TA 3MJ2A 3RAIA 1SVEA 4K2RA 2AUHA 3H9FA 4RJ8A 4AQKA 1YXSA 1MRYA 5CSHA 5M4CA 3VHEA 3REPA 4IVAA 3SG9A 2QOQA 4JG8A 2EB3A 3VHKA 1XH6A 4ZTLA 2J0LA 4MAOA 5HVJA 4CNHA 5E1EA 4RQVA 3RPRA 3IW7A 3CEKA 4NW6A 3UOHA 1OBGA 3DDPA 4FK3A 5CXHA 4FEVA 3AG9A 4IZ7A 3WF5A 3DPKA 4E6QA 5ETIA 4AAYA 3MFSA 2XM9A 4DGGA 3LCTA 4EYJA 3DJ6A 4QTDA 1GZNA 4U40A 4A7CA 2BZJA 3GU5A 4AXFA 2C0OA 3ODZX 3WE4A 5AV4A 3TNIA 4EI4A 4LRJA 4CFNA 3MBLA 4DITA 2Y8OA 2X1NA 3A7FA 4CKIA 1JVPP 3ZLXA 5CU4A 3FSFA 3ELJA 3I0QA 4W4WA 3UDZA 4EHVA 2ETRA 4O6LA 5AUWA 1V0PA 4PY1A 3UPXA 2HENA 2ITNA 3CGFA 2R64A 1CKJA 4HCTA 3RP9A 2IWIA 2WMBA 4F0FA 1OIUA 5EQYA 4C36A 5E8ZA 5KMKA 4N4SA 5DH3A 2BZHB 4Z9LA 5BVDA 4XBRA 2VTLA 3P23A 4G5PA 4MWIA 1WBTA 4JQ8A 4GMYA 3PWDA 2CKOA 2ITWA 3AT2A 3UOJA 4MXXA 4PTEA 5EYMA 4EJ7A 1W83A 4EORA 1GIJA 2VTIA 1ZZ2A 3QCSA 2J0IA 2JKQA 4Q5EA 3GOKA 5EM5A 4ACMA 3FMKA 1PXLA 3FLNC 4AE9A 3FI2A 1LEZA 1KWPA 2QOKA 3K3IA 4HCVA 3S0OA 3QZHA 1ZOGA 4EHGA 4YNOA 5DPVA 1WBVA 5DT3A 3O8TA 3HV3A 3IK3A 2QO2A 2XMYA 4G31A 4DLJA 3ZTXA 5A4CA 3HYHA 1NA7A 2WQMA 5D1JA 3UBDA 3TTIA 4APPA 4IW0A 4B4LA 4CZUA 2ZB0A 2E2BA 2GDOA 2RFNA 2VO6A 2GU8A 3LMHA 3Q6WA 5E8SA 5BVEA 4AXEA 3BYUA 3NZ0A 4FSUA 2YISA 5IQEA 3W2OA 3PWYA 2FYSA 3OMVA 4AA4A 3VWAA 4RVLA 4EKLA 1KV1A 3N4VA 1BL6A 3QD4A 4PDOA 2VGOA 4QEBA 4ZS4A 4DH3A 4QYFA 4DH5A 4NM7A 3F88A 3R02A 5DYJA 4AGCA 2PUUA 1OZ1A 1ZAOA 3DBEA 4FV9A 4WBOA 4EC8A 3GI3A 3GUBA 3MVMA 3HA6A 3QC9A 2Z7RA 3RPVA 3WF6A 1W0XC 3PG3A 3HGKA 1ATPE 4Q9SA 4ASEA 4BDDA 3KGAA 1FBNA 3D83A 3FZRA 3HDMA 2PE1A 3ORNA 1SMHA 3QHWA 3M42A 3EQGA 3QZFA 3ZZEA 3Q4TA 3DLSA 4AXAA 4YMJA 4L44A 4QRCA 5HE0A 3VUGA 1KSWA 3LXPA 4C61A 4ENYA 3NCGA 3OWJA 4C7TA 4F7SA 4R78A 5CF6A 1P2AA 3OC1A 4EQMA 5KMIA 4P5ZA 4H36A 4FICA 3OY3A 1OKZA 2RFEA 4TPTA 4L46A 1JPAA 1TQIA 5DG5A 2E9PA 2XKEA 3WE8A 4I94A 2C0TA 4MTAA 5HKMA 4F0GA 5JGBA 3BYSA 1H1RA 1V1KA 1BMKA 2J4ZA 2PHKA 4YZMA 4IVBA 3KL8A 3W16A 4IB3A 2X0GA 5E91A 3I5NA 2W9ZB 4GEOA 4XS2A 3FZSA 1PYXA 3OOMA 2OFUA 4FR4A 2R3RA 4YC8A 2BAJA 4JR3A 4MK0A 3RHXA 4C4JA 1H1QA 2WTJA 3UODA 3JVRA 3UO4A 3QCQA 1PMVA 4DYMA 5BYLA 4ANSA 3QD2B 3W0MA 5JK3A 1I44A 4NCTC 4MEDA 3D2KA 4RJ5A 3ZO3A 3DB8A 4AFEA 3UO6A 2LAVA 4RC4A 2JIUA 2QR7A 3HP2A 2LGCA 5HCXA 4RIXA 2R4BA 4CTBA 3P7AA 3KULB 3OZ6A 1OL2A 4BBFA 1QPEA 2VTPA 4FKQA 3TNWA 3GCPA 4D28A 3F6XA 4ZS0A 3HDNA 3HMNA 3U87A 4I3ZA 4JG6A 5J5SA 3H30A 4PNIA 4ZOGA 3EN6A 4I0RA 5K4JA 5EYKA 4DCAA 1BI7A 2E9VA 3DU8A 1A06A 3ALOA 3OS3A 5T68A 1YHVA 2UZWE 1PKDA 4BCFA 1PYEA 3GQLA 3HA8A 3KCKA 4RX8A 2C6OA 2UZUE 2OWBA 3Q9XA 4LM5A 4OTIA 2GSFA 3QU0A 2JDRA 3LM0A 4Q5HA 5L8JA 3ZRLA 4IX3A 2GQSA 4FEXA 4DEIA 4X2NA 3DV3A 3H4JA 4PNKA 4YTCA 4KSQA 1OPLA 4RGJA 4G34A 5EK7A 5BUJA 2RKUA 4DG3E 3EHAA 1B38A 3HMPA 2GCDA 2YFXA 4ASXA 3JY9A 2P2IA 3B8QA 2F7ZE 4XYFA 2GNHA 2GNIA 3MH0A 1RQQA 2WOUA 4D5HA 1Z57A 5E8UA 3WZJA 4AXCA 3ZRKA 2O63A 5IMEA 4YO6A 2ITPA 2FA2A 3VNTA 4KWPA 3PUPA 3RVGA 1IA8A 5CVFA 5HE2A 2IW8A 3KRJA 3D0EA 4EH4A 3PUFC 1Q4LA 3WZKA 4EK6A 2HAKA 5M07A 4QDEA 4RFYA 1XMLA 2BALA 5DE2A 3BL9A 2OIQA 1BI8A 3DFCB 4UWYA 3ET7A 2WEIA 4TKSA 3Q2JA 4JAIA 2VTTA 3A7JA 3F5GA 3PJCA 4LFIA 5CF8A 4F6WA 5L8LA 3ZUUA 1JKTA 4FZDB 3SAYA 4FUYA 3KC3A 3RMFA 5AM7A 4FKUA 4HGTA 3FMEA 4BDBA 2CHLA 5EYDA 1WMKA 4I22A 4YZ9A 3IW6A 4MXYA 5BNJA 3NVMB 3Q04A 2ERZE 4FZ7A 3F7WA 4FG8A 5JT2A 3V5PA 4IAZA 1XQZA 3LXNA 3HECA 4V01A 4NJ3A 4I6HA 3V3VA 5HBEA 2GMXA 3BLRA 3BWJA 5T6KA 4TYGA 3TYKA 1UA2A 2B52A 1G8SA 1ZY4A 2ZFYA 3F3TA 5AA8A 4OGRA 2RG5A 4GW8A 4A07A 2XNOA 2VV9A 3QYZA 3U51A 4CMUA 3QQJA 3AGLA 3QUEA 3NNWA 4FUXA 1OL6A 5FTOA 4FT0A 2QNJA 3NUAA 4D55A 3QQUA 3EQRA 4U9AA 2W7XA 4JI9A 4U79A 4AZWA 5AAEA 2VWVA 4WIHA 5DEYA 1Q97A 1TFFA 5J8IA 3BX5A 3OTVA 3HP5A 3ZDIA 3ZLWA 4ARKA 3UPZA 3AMYA 2ZM1A 3W0NA 3L9LA 4C4HA 3R01A 4MD7E 5B2LA 5LMBA 2QKRA 2XEZA 4DGNA 4TYIA 3HMMA 1U59A 3MVLA 5LCKA 5E1SA 4CT1A 5IDPA 3POOA 3R7VA 2GFSA 3E62A 5HQ0A 2WMRA 3EN7A 5KUPA 1AQ1A 3OROA 4NIFB 3W0PA 4K33A 4MBJA 5IH4A 5M56A 3R00A 1GZ8A 2XS0A 3ATSA 3C4FA 3L8XA 5FP6A 3FMLA 2W5BA 3VBYA 2Z7QA 4FOBA 3TUBA 3QCXA 2W1DA 1ZMUA 3D14A 3KK9A 2X81A 5HG8A 4F9WA 3O23A 4YZDA 3O7LD 2Y4IC 3G0EA 4FGBA 4KD1A 4ZY5A 4WNMA 1O6KA 3DKCA 3TUDA 4X6RA 4JQEA 5EOLA 5J1WA 5CQWA 1ST4A 4GVJA 2YITA 4X3FB 4S34A 1WBOA 1OVEA 3BEGA 3W1FA 2JLDA 4WNOA 4EOMA 4DH8A 2VUWA 4KINA 3EYGA 4QMOA 3P1AA 3ZS5A 4IAIA 3COKA 4FNWA 3UZPA 2FB8A 4MNEA 2HY81 3C0GA 4WNPA 4R3RA 2XNGA 3GFWA 3UMXA 3CKXA 2X2KA 4QP2A 3IQ7A 5I9WA 2C5NA 3OWPA 1OECA 3HZTA 5M09A 5LWNA 5LMKA 4O84A 3LFEA 3I4BA 2A2AA 4G3GA 4JXFA 4M0ZA 2V22A 4QMWA 5D41A 5A4TA 5GIOE 2XNBA 4ITHA 1R1WA 2XM8A 3GGFA 3MY1A 3FAAA 4KS8A 4NW5A 4YJRA 4D4YA 1KOBA 5HX6A 4FEUA 4Y72A 3CC6A 4Y8DA 4E8AA 1RW8A 5GJGA 5I9UA 1BUHA 4E1ZA 4GYIA 3LFDA 2O0UA 2DWBA 2QURA 3NUSA 2X4FA 4WRGA 3E8DA 3WILA 2WQOA 1UV5A 4E4LA 2V7OA 3ZC6A 4DFLA 4FVPA 4KKHA 4ZSJA 3EFLA 3TIZA 4RJ4A 1ZYSA 1XWSA 4D9UA 3NCZA 3Q9WA 3F3UA 1OITA 3VUHA 1UVRA 3BHHA 1IAJA 4FT9A 4NZWB 5E90A 1M2RA 2Y7JA 2P2HA 3R2YA 3FMMA 4LMNA 4QQJA 1TQPA 4EH5A 1G8KA 1PJKA 4JBOA 2F57A 1ZXEA 4FKWA 2BPMA 3VS3A 3DGKA 1R0PA 3R1SA 4O7WA 4F99A 2VWZA 3ZONA 1MP8A 4MBIA 1F5QA 4PDYA 1LEWA 4I23A 4TZRA 3HEGA 1ZY5A 4FSQA 3FI4A 3OT8A 3R04A 3UOLA 3V6SA 5IA2A 3I79A 2PL0A 3DBFA 3HMIA 4ZJJA 3NAXA 2BHHA 3KF7A 4I24A 4AN3A 4RIYB 1VJYA 4BCJA 5HD7A 4L7SA 4YC6A 2OK1A 3KEXA 3SQQA 5ANGA 4E6DA 5JGAA 4J95A 5HLPA 1URWA 3ERKA 3TDVA 3ROCA 3Q9ZA 3IG7A 2X2MA 1H01A 2Z7LA 2OIDA 5ACBC 3UVRA 3V01A 3PP0A 2I7QA 3FY2A 4Y73A 3QWJA 2VO3A 2JD5A 3TKHA 4L52A 5HU3A 5A14A 1Y91A 4FV5A 4Z3VA 4XG9A 5JRSA 1REJA 4FE2A 4PDPA 4PV0A 4HNIA 3D5WA 2XJ0A 3EL8A 4ASZA 4XV2A 4ZY6A 4BDEA 4XV3A 2F2CB 2BDJA 3V8WA 4FTMA 2XCKA 2YEXA 4JBQA 2GFCA 1Q3DA 3QTZA 1MRUA 5IUIA 2GHGA 4J99A 5KMLA 1R39A 1YWRA 2YERA 4HPUE 1W8CA 5IH6A 3ZSHA 4G3CA 4L68A 2OKRA 4YP8A 2C4GA 3G2FA 4YTFA 2C5OA 4DLIA 3MFUA 3QKLA 5E4HA 5C8NA 5J7HA 5CSVA 2BIKB 2I6LA 1A48A 1PXOA 4MNFA 4RZVA 5F1ZA 4EL9A 3LW0A 3QBNA 3R73A 4M69B 4DT9A 2RF9A 5A4LA 2C3LA 2HWOA 5C01A 4E5BA 3CTJA 2BHEA 5BYYA 5F20A 4O96A 4AZFA 4CCBA 4DTBA 4KB8A 3GC0A 3ZO1A 4X2GA 2J5FA 4OR5A 2CCHA 3F3ZA 3Q2MA 3Q4UA 1TVOA 3QXPA 4LL0A 5CZIA 5D10A 5DFPA