4BJJB

Sfc1-sfc7 dimerization module
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
94
structure length
85
Chain Sequence
SLETDVENIVFQFQNSSLDFQSSDDFSILGIDQPHPIVRIGGMFFRGTWHQPIGTDIVVPSVNDGLVLCKRRLMLEQIRLVPKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Polymerase III-Specific General Transcription Factor Iiic Contains a Heterodimer Resembling Tfiif RAP30/RAP74.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR TAU SUBUNIT SFC1
total genus 9
structure length 85
sequence length 94
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10419 TFIIIC_sub6 TFIIIC subunit triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.170 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bjjB00
4BJJB
chains in the Genus database with same CATH superfamily
4HGEA 4BBEA 4HW7A 1M2QA 5ETCA 1IASA 2PMNX 2B7AA 2H8HA 5HE1A 3DOGA 5C9CA 5HZNA 3FSKA 4MXCA 3VONA 2Y0AA 3Q4CA 3DJ5A 2VO7A 3MJ2A 4X6QC 3E62A 3BEGA 1G8AA 2FYSA 4GVJA 4WHZA 4XG8A 2GFSA 4HVHA 2JFMA 4RA5A 4IIRA 2Z2WA 4XG9A 4AE6A 2W1IA 1XH8A 4L3PA 4R5YA 5H2UA 1H4LA 4GT5A 1Q8TA 4BDEA 4YJPA 4GJ2A 2QOCA 2W96B 5KE0A 1PJKA 3VBWA 4KS8A 3R7IA 3TN8A 2PMOX 1Q62A 5HNGA 5HO8A 3ZXZA 1KSWA 3A7GA 3QUDA 4MK0A 2YERA 5BVNA 5AUXA 3HNGA 2UW9A 4DC2A 5I9ZA 3U9NA 5GHVA 4U9AA 4FTJA 3GC0A 3NAXA 2CN5A 3H0YA 5ANOA 2CNQA 1IA9A 1MQ4A 4FMQA 4ONAA 4TWCA 5CLPA 4YSMA 5E8ZA 5H8GA 5BVOA 1RQQA 3NZ0A 5JK3A 2NO3A 2R3HA 4IDTA 3RAKA 2J5FA 1UU8A 4Y5HA 4DLJA 3DLSA 4MYGA 3OP5A 4CLJA 2WEIA 3SHEA 5C4KA 2XNEA 5AMNA 3TV6A 1GIHA 1WVXA 2WTWA 2GTNA 2IZSA 3KKVA 4U44A 5E8WA 4EH7A 3LCSA 3DZQA 2WO6A 3HGKA 3I0QA 5FEQA 4ZY5A 3GCVA 4HYSA 4J97A 2BDWA 3AC1A 2W06A 5CY3A 2BKZA 4ANQA 3OXTA 4RSSA 3WYXA 2JKKA 5EYKA 3CC6A 2C3KA 3UMWA 3KA0A 4M0ZA 3TIZA 4IC7A 3EIDA 2C30A 4UWBA 3HKOA 3CEKA 4OTQA 3MVLA 3OMVA 2J9MA 5HE0A 2LAVA 3TNWA 2I6LA 4HOKA 4M67A 5I9UA 4ANMA 3WZEA 3LW0A 4PMPA 5CENA 3AG9A 2WAJA 1PMNA 1ND4A 4K77A 4DFXE 5LVMA 3CKWA 3NW5A 3II5A 4BGHA 1QPDA 4WRGA 4ZTSA 2UZBA 3SXSA 4C33A 4CRLA 3UQCA 2EB3A 3QUPA 4CZUA 3KF7A 3MH2A 4AXCA 3FSFA 4DCEA 3UPXA 4EK3A 4EH4A 1YHWA 1V1KA 3NX8A 4R78A 4BB4A 5M53A 4DAWA 5FEDA 2HIWA 4B9DA 2A2AA 4F9WA 2FSLX 4MQ1A 4DHJA 2ZYBA 4YNEA 4J52A 2VTAA 5L2SA 4BCQA 4Y83A 2VZ6A 5J87A 2PE0A 2QQ7A 4BDCA 1K3AA 4ZS4A 3OBGA 3DQXA 3AGMA 3OWLA 3HMNA 5AV0A 1MQBA 3ZONA 4OR5A 3JVRA 4WUNA 2B9HA 5EW3A 4E6CA 2JBOA 1Y8YA 2XYNA 2BDJA 4O7NA 4K2RA 2BDFA 3L9MA 1Q5KA 4TWOA 4BDIA 4NUSA 3W1FA 3LFNA 2WEVA 2V55A 3AT4A 3BV2A 3CS9A 3PPJA 5C01A 5HORA 4O81A 2VX0A 3SOCA 3D83A 4QDEA 3LQ8A 3LMGA 4JS8A 5E1SA 4C2VA 4C3RA 4CG9A 5HX8A 3OXZA 1ZOGA 4ZAUA 4LOQA 4H36A 3RCDA 2AC3A 2PVRA 4FYOA 4EONA 5IQGA 4I6FA 4M15A 3ERKA 4H1MA 2VTTA 4OT6A 4L68A 5AX3A 5KMNA 3VUHA 5HIDA 3HAVA 4OBPA 5L6WL 5FDXA 2YA9A 5IA4A 5I9YA 4RZWA 3IS5A 1ZMVA 3QQHA 4AS0A 5FBNC 3GC8A 3Q9WA 3U4UA 1G8KA 3UP2A 2PVLA 2WQEA 2XM9A 5DRDA 5C03A 3TWJA 3QTSA 2ONLC 3DKCA 4YJSA 5H8EA 3MGYA 5KZ0A 3QLFA 5HG5A 4DE4A 2DS1A 3ZRLA 4BYIA 1H8FA 2YCFA 4W8DA 4L45A 3TIYA 3IDCA 3E3BX 3ORPA 4FZFB 3W16A 3DY7A 1BLXA 3QRIA 4D4VA 1PYEA 2ITPA 3ZLWA 3OROA 3EQCA 3GQLA 5M57A 3ENMA 3IO7A 5CEPA 3HDMA 2IWIA 2H9VA 3TZ8A 4DYMA 1K2PA 4M97A 4IANA 1PY5A 4R7HA 2QOFA 3QTZA 4WO5A 1F0QA 4O7ZA 4ZTQA 4DBNA 3DKGA 2XCKA 3ODYX 5AM6A 2O0UA 4EEVA 4EHZA 3K3JA 1OL1A 3FMHA 4E4NA 4C34A 4LRMA 2QR7A 4DEGA 2NRUA 3PTGA 4KNBA 4XOZA 3KXMA 4I0RA 1Q99A 2OO8X 4C3PA 4CKRA 4G3CA 2ITXA 3AC8A 2J51A 5IA5A 4FICA 3UODA 2QOBA 4WG3A 1YXSA 4RGJA 4B6LA 4FT7A 1NW1A 4FKUA 2O65A 3R1SA 3KCKA 4AE9A 1WCCA 3GU7A 3M1SA 3ZLYA 4IZ7A 1ZLTA 5I4NA 4P4CA 3KCFA 4H3BA 2VRXA 1PKGA 5AFVA 4XP0A 4E6QA 4EOOA 1R78A 2WTIA 2C69A 5JMSA 4UWYA 1KV2A 3TACA 4Z3VA 3QRUA 4M69B 4JOAA 1GZNA 2V7AA 3QYWA 4GVAA 5TOZA 3JUHA 2GS2A 3UOKA 2YJSA 5LCJA 5J1VA 5ACBC 4FZ6A 3HVCA 3NEWA 3PIZA 4HGSA 3QQKA 4NTSA 3W0SA 3MFUA 2CGVA 5CNOA 5HVYA 5EYDA 5IUHA 4IVDA 3ZXTA 2GNFA 5T68A 1FMOE 2J90A 2QLUA 4FEQA 3SRVA 5AA9A 3EKKA 1UWHA 4JR3A 2XEYA 2OZAB 3R7EA 5IF1A 5J8IA 2YDIA 3DLZA 1TVOA 2OXYA 2X6DA 3DNEA 4Z16A 5AJQA 4LDTA 4LL0A 3PLSA 5CAVA 5AP0A 2WMTA 4GSBA 2HENA 3BHVA 4GEOA 3PFYA 4R6VA 2QOQA 5EDPA 3QALE 3FKLA 3C0HA 3EKNA 3P4KA 3QZGA 3WF9A 3K54A 5HCXA 2NPQA 2GTMA 3ATTA 2R3OA 3C5IA 2WOTA 3BL9A 3PY3A 2BFXA 5IQEA 4YSJA 1REKA 2CGWA 3NUUA 2PU8A 5IUIA 2Q83A 1PXJA 1FVVA 4GW8A 4EZ5A 5CALA 3MYGA 2F49A 4FC0A 4PRJA 1P4FA 1W7HA 3F69A 1UNLA 2R3KA 4AXEA 4PP9A 4KSPA 4ALWA 3RMFA 3PA5A 5J9YA 2RFEA 4DFLA 4EUUA 4ERKA 4IX5A 4P2KA 5FD2A 2UW5A 3D5XA 4XEYA 4QP4A 4IX6A 4F0IA 2CHLA 4EOJA 4H05A 5CF8A 4YC3A 4RJ8A 3NGAA 1PXNA 3ORTA 4ZJIA 5JFXA 1XBCA 4FIJA 2VWYA 3NDMA 3HRBA 4BCGA 3VAPA 2XNBA 3QRJA 1VZOA 2J4ZA 2OF2A 3CKXA 4O7RA 5AP1A 1PKDA 3GU4A 2WMAA 1OBGA 3EQRA 1OMWA 2VTMA 2W1EA 2J0KA 2YIQA 3DA6A 4MCVA 3AKJA 3WE4A 1J1BA 1PW2A 5GJFA 4Q5EA 4QMSA 3MH3A 5BUEA 2Y6OA 4DHFA 5G1XA 3WYYA 2PMIA 2BTSA 4I21A 3EZVA 3RK9A 3EOCA 4IE9A 4O82A 4B99A 4BIBA 2B4SB 3A60A 5A6NA 4YP8A 3NS9A 3PA4A 5IA2A 2YFXA 3UVPA 4RJ4A 3UYSA 4FKWA 4OTFA 3QTQA 3BHHA 4QQCA 3M2WA 2F57A 3BHYA 3WZDA 4DFNA 2QHMA 5TF9A 3RKBA 4F7NA 3GU8A 2G2HA 3FV8A 3MWUA 2C6OA 5DWRA 3TUBA 3O8PA 4LUDA 2CNVA 4PDYA 3JY9A 4M12A 5KUPA 4WKQA 3QQJA 2R64A 3A8XA 3Q9XA 1R0PA 2OJJA 2OH0E 5CTPA 5BYYA 4B4LA 3NAYA 2B1PA 2WHBA 1FBNA 1QL6A 4CNHA 3ID6C 4F65A 2OFUA 4USEA 4HNIA 3Q3BA 4NK9A 3Q60A 3W2PA 4C59A 3S1HA 3R9HA 2I1MA 2RF9A 2BMCA 4AW0A 4FTKA 2JDRA 4LI5A 3RNYA 2CDZA 3ZDIA 5IQDA 5B0XA 1FOTA 3E5AA 3F2AA 3ZH8A 3I7CA 4GL9A 4QMLA 2ITWA 4QNYA 5EW9A 3AMYA 2EU9A 1YOLA 1SVGA 3PSDA 3QTIA 3IW5A 4I6LA 4XP3A 3VBXA 4DH3A 1LR4A 3GOPA 5IEXA 4R7IA 1ZOEA 3UOHA 5L6PA 1O6KA 5JFWA 3PVBA 2UVZA 4A06A 2C6TA 3NMUF 4FV0A 4EJ7A 4EHVA 5DIAA 4UZDA 2FSMX 3RI1A 5EQYA 3LKMA 4AN3A 4B0GA 2C1BA 1OGUA 2XH5A 4X2FA 3LMHA 5DLSA 4M7IA 3F2NA 3QTUA 3U6JA 1JSVA 3EB0A 4BCFA 1JVPP 1NY3A 2OWBA 2OXXA 3BQCA 3HP5A 4U80A 4IZAA 3VO3A 2BR1A 2QO2A 5KZIA 1FQ1B 4NKAA 3QCQA 5D9HA 3UIUA 3QHWA 3VBYA 5F95A 3PUPA 1PHKA 1KOBA 4KS7A 3MA6A 3CQUA 3QYZA 3DV3A 1YWNA 2UZEA 2XP2A 4RX8A 4XHKB 1FVRA 3UGCA 3ZC6A 1WMKA 2GDOA 2QOOA 3F7WA 2E9UA 4C4EA 3F2RA 1Q8WA 3W55A 3MIYA 1QPEA 3EQFA 4PMTA 3R0TA 2C6DA 4F9BA 3U55A 1B38A 2QU6A 4F78A 4GK2A 4DH7A 3NYOA 2PULA 3RJCA 3WF6A 3OD6X 2WQBA 3O17A 3O7LB 3QQGA 4JNWA 2RG5A 4MVFA 1F3MC 3PY0A 4II5A 4O38A 3NUYA 3PVUA 5FBOA 5EM7A 1RJBA 3MFSA 4TNDA 3PXFA 5LARA 1UNHA 3U8WA 3D15A 4RJ6A 2J5EA 4GFMA 4NJ3A 5DYJA 2UZLA 5E8YA 3OW3A 3FMLA 3V6SA 1JKTA 2X6EA 4CG8A 1JAMA 3QGWA 4WOVA 3NUAA 5AP2A 3P23A 5M06A 4E4XA 3C0GA 2PVNA 2PWLA 4YPSA 4DEEA 3NUSA 4F0FA 4DTKA 3LAUA 4AXAA 4E5BA 4KIOA 4ZY4A 4I5PA 1IG1A 2YEXA 3GXLA 4I5HA 4GRBA 2CSNA 2OJGA 3U51A 3W0PA 2QO7A 1HCKA 2OIQA 2JAVA 4OTRA 4Y8DA 1OIRA 5EM5A 2XIZA 5JFVA 4BR3A 3VS7A 5CF6A 4R5SA 1YWRA 3IOPA 5A4QA 5HGIA 5BVDA 4UB7A 3Q4ZA 4YJQA 1DS5A 4IC8A 3FZ1A 1H01A 5HO7A 4FSUA 4QP9A 4DH8A 2XK4A 3IW4A 3IGGA 5E8TA 3HL7A 2B55A 3R01A 4PDOA 4JXFA 4JIAA 3UO4A 3MH1A 3OOGA 4YTHA 4MBIA 3RAWA 3ZMMA 1YDSE 5HTCA 4E20A 1OIQA 4AZVA 3SGCA 4K6ZA 5A14A 4O27B 4IB5A 3EL8A 2PVMA 3R28A 4PMMA 3NWWA 3P5JC 3F66A 4D2SA 4EOPA 3P9JA 2CKOA 4O7SA 3FMMA 2DUVA 2HW7A 5T3QA 2BALA 2YISA 4ZSLA 5B2KA 3PIXA 5CU4A 4F09A 3E3PA 4U40A 1XR1A 4B7TA 3OXIA 5LJJA 4WD5A 4I23A 3OTVA 5F1ZA 2I7QA 5D41A 3FZOA 4FZAB 4F7SA 4YC8A 5ETAA 5AV2A 2XK8A 5JH6A 3BEAA 4AG8A 4D2RA 5HNIX 2Y4PA 3QC4A 4HVDA 4KABA 3TT0A 3SQQA 3QQFA 4HYIA 3AC5A 5HD7A 2OXDA 2WTKC 3FPMA 4ZJVA 3SV0A 3ACJA 3DK3A 5IISA 4J8MA 2HXQA 3HV3A 3BGZA 4FE2A 3DJ6A 3BYSA 3UVQA 2YM4A 4PL4A 3RGFA 2ETRA 3OW4A 4FVRA 3S95A 4C3FA 5E8UA 2YDKA 4IWQA 4ID7A 4AN2A 4AQCA 3DK7A 2J2IB 4MEDA 5DEWA 5B2MA 2HXLA 5AAGA 1KV1A 4AQKA 1YKRA 3RHXA 3VQUA 4EOSA 4L46A 2E9VA 4KINA 4RRVA 2OZAA 3QD2B 3SG8A 5I0BA 3WILA 4FEXA 4BCMA 3PVWA 3P7BA 3QUEA 5EHLA 4QMPA 4X3JA 4EHGA 5DG5A 4R7BA 2J0LA 2JITA 2OF4A 4WNPA 3SVVA 3QU0A 1YXVA 4O2PA 4CMOA 2R7IA 3COKA 3G90X 1ZWSA 2WMSA 2FA2A 2IVSA 3KEXA 4J71A 4WG5A 3V6RA 3VS1A 4AT5A 1O6YA 4FTCA 1FGIA 2ZV7A 4EUTA 3GU5A 3KULB 5BX0A 2JKQA 4TXCA 3I5NA 3RPOA 3ULZA 5A6OA 2R4BA 2YACA 2Z02A 5FQDC 4UXLA 4XRJA 3V04A 4C7TA 1U54B 1H1SA 3ORMA 3SRVB 2GHMA 5JGAA 4L3LA 3FI2A 4HYHA 3K5UA 1Q41A 2QVSE 3BHTA 4FSQA 4OTGA 4RC2A 1XH4A 4AGUA 4D28A 1H28A 5AP7A 1Y6AA 1VEBA 1ZXEA 3BGQA 2YZLA 1TQPA 2IVTA 2VWIA 5L3AA 2A27A 2B9FA 2V7OA 3PRIA 4WG4A 2OW3A 5AUWA 3ZDUA 3FC1X 3HZTA 4MWIA 4RJ7A 1SNUA 4PP7A 2GQSA 4DH5A 4APPA 1WBSA 4CCUA 3UNJA 2PMLX 4LV5A 4RVKA 5JQ8A 4LUEA 4DEHA 3TJCA 1OKWA 5CVHA 2OIBA 2RG6A 5FP6A 1BKXA 1XMMA 4F99A 4QOXA 1MUOA 3EQGA 3FL4A 4IJPA 2O5KA 2UUEA 3T9TA 5IH5A 1FPUA 2X4ZA 3UDSA 5HBHA 1LEZA 5LXMA 3ZLSA 5ICPA 3EQBA 3E8EA 4X2JA 3OHTA 1GY3A 3CE3A 4YU2A 2ITVA 2ZM4A 4FL1A 4MD9E 2JBPA 3GI3A 1PXPA 3KMMA 1PMEA 4EH2A 1KE5A 3CJFA 3ZS5A 2WIPA 2VTJA 4KAOA 3JS2A 4NFMA 3CSVA 3C4ZA 3R83A 5EI2A 4D1SA 5AUTA 1ERKA 4BTMA 3MVJA 1AQ1A 3CP9A 4HVGA 1OPJA 4FTRA 5EDRA 1J91A 2JIUA 3BQRA 2R3PA 2HCKA 4IB0A 3R73A 2XK3A 1U5RA 1SVEA 2HZ0A 2BAJA 3QKLA 5J1WA 3O96A 2YHVA 4C36A 5L8KA 4FK3A 1V0OA 4HCUA 3F5PA 3LCTA 4OTWA 4YJOA 3LPBA 4RQVA 5M56A 2Z8CA 5I9XA 4AAAA 3ZRKA 5DR2A 3S00A 4QP8A 2YIRA 1W98A 3NR9A 4QTCA 1NA7A 3KGAA 4G3FA 2R7BA 3VUDA 1GNGA 3LCOA 2J0JA 4A9UA 4FT5A 2OKRA 3F3WA 4C38A 4TZRA 3IECA 4OTHA 3VF8A 3SA0A 1F5QA 1SM2A 2XKFA 3UZPA 4TYHA 2BTRA 3RHKA 4L67A 4XH6A 2XIXA 3BV3A 4Z9LA 1U5QA 5C8KA 2WMWA 4IAZA 3RP9A 3KY2A 4ENYA 1XH5A 3Q6UA 2IZTA 3W2RA 3WF5A 4ASEA 1M7QA 2XNGA 3DU8A 4R3PA 3VS6A 3V8WA 3L1SA 2PZPA 3E88A 3TV4A 4YJUA 3ANQA 5M4IA 3WOWA 4RLLA 3TCPA 1GIIA 4F08A 1MRUA 1OUYA 4O7YA 3H10A 3C4EA 4ASXA 4BTFA 2GQRA 4BIEA 4WA9A 3S0OA 4FL2A 4GFOA 4YGAA 1YI4A 2E9OA 4FNYA 5BVKA 4IVAA 4BZDA 2B54A 4Y46A 3PJCA 4E6AA 1Y57A 3QA0A 4R1VA 3FZPA 1YHVA 4U0IA 1Q3WA 4UZHA 4XNEA 2W4OA 3PXZA 5CX9A 4BCKA 4Q9ZA 3LMIA 3QBNA 3R63A 4RZVA 2XBJA 1P5EA 5FXSA 3TL8A 4DEIA 3QF9A 3HV6A 1Z5MA 2P55A 3QX2A 4FBXA 4RPVA 2J50A 4GUEA 4CFVA 3R1QA 4IX3A 3N4TA 5K3YA 4FSRA 4ZTNA 3CXWA 3KK9A 2ZM3A 3EN6A 5K5NA 3OF0A 5AP4A 3ORKA 5D10A 2GS6A 1PXMA 3MS9A 2I0HA 4FYNA 4O96A 2WB8A 4C4JA 3GOKA 4AOJA 3MY0A 3QAME 5CQWA 1UV5A 1DI9A 4FG7A 3LXPA 2PVJA 3RAHA 3FQHA 3HA8A 4FTUA 2GMXA 3RWQA 3P1AA 4YLLA 5D11A 3EYGA 2UVXA 4OLIA 3LJ0A 3SW4A 2W1DA 3POZA 3AQVA 5HG8A 2BZJA 3EFWA 4O0YA 4QP7A 4YZNA 3S2PA 4QYYA 4ZTLA 4GUBA 3VS2A 2XK9A 2AUHA 3V5QA 4E1ZA 2VNWA 4NH1A 4C35A 5M51A 4RWLA 4E5AX 3QA8A 1KE9A 3WZKA 4BCPA 3KIOC 3F5GA 5IA1A 4AGCA 5GNKA 2UW7A 1APME 2C0IA 2C1AA 4JAIA 3QZFA 1M7NA 4ZIMA 3UG1A 3T3UA 1WZYA 2VX3A 4G34A 5EYCA 3ALNA 4O2ZA 1H0WA 3EYHA 2PK9A 4IX4A 4FNZA 2VTSA 4MD8E 4ZMEA 4HZRA 1XBBA 3REPA 4LQMA 5KBRA 1QPCA 5HU3A 5B2LA 4NSTA 3MI9A 3TNIA 1URCA 3UQFA 4QMZA 5CS6A 3UIXA 4G17A 4P7EA 3O8UA 3ZO3A 2R0UA 1XO2B 2CLQA 3ETAA 3RPYA 4RWKA 3ZUUA 4FKTA 4G3DA 2G01A 4FEUA 2QHNA 2WZJA 3P7CA 2YCSA 4WUAA 5J95A 1YOMA 5I9VA 3G9LX 3QKKA 4Y85A 4YJNA 3FXZA 4OW8A 2C5VA 4V0GA 5CYIA 4LMNA 3I6UA 5DEYA 3Q4TA 4I20A 3UDZA 4XX9A 3UQGA 4X0MA 2YABA 4FZDB 4IMYA 1ZZLA 3DBCA 4AZEA 2Z60A 3LM5A 3FLNC 3OEFX 3QTWA 3EH9A 3NCZA 5EM8A 5L8LA 1FMKA 3A7IA 3PZHA 1EH4A 3Q5IA 5AUYA 3RK7A 5LVPA 4MNEA 5EDQA 4O0UA 4CQEA 1ZARA 1WBWA 2PY3A 4CSVA 1CMKE 4FKIA 3MPTA 4EHEA 3QCSA 2R2PA 5M09A 3DT1A 4MXAA 5TT7A 3TKUA 2VTQA 3C4FA 2DYLA 4KWPA 3BWJA 4A7CA 1Z9XA 3BU6A 4OBOA 4CZTA 3L9LA 3ZFXA 3S4QA 4EZ7A 3E8CA 1ZZ2A 4X6RA 3UNZA 2YM6A 1XJDA 3VBQA 2BZIB 5L2WA 2XYUA 4MTAA 5CZHA 3DXNA 1UWJA 4GT4A 2BVAA 3CTJA 4JJRA 3TTIA 2WU7A 4BDAA 3I79A 3S3IA 3ULIA 4ZS0A 2F9GA 5F94A 4AXFA 5LWNA 2QOKA 1G8JA 4WNMA 3AT3A 2P4IA 4F64A 5E92A 5HQ0A 4G5JA 2AEGA 4W8EA 3Q52A 3ZZWA 3SLSA 2A19B 2PUNA 4QTBA 3OWPA 5DGZA 4DH1A 4I6BA 5AAEA 3VUMA 5JZNA 3CQEA 2Y4IC 4V0GB 4BI0A 2YAAA 4QTDA 4BKJA 4Z7HA 3NCGA 3PJ2A 1VYZA 4FVQA 2Z7LA 3SAYA 1OKZA 3JY0A 2WQOA 4I5CA 5IEYA 2YWVA 3CR0A 1IRKA 3UVRA 1TQMA 3R22A 4EOMA 2F2CB 3C1XA 3WE8A 1OL2A 2VGOA 3IW8A 4MXOA 4X21A 3GFWA 4LL5A 1OBDA 4X3FC 3FLYA 3FZRA 4A07A 4EQCA 4FV1A 2X7FA 5J7HA 4CMTA 4BJJA 3AKLA 2PPQA 1XHAA 2NP8A 4PL5A 4S2ZA 4X2GA 5CF4A 4TYHB 5ETIA 1H1RA 2C68A 4FSWA 5IEVA 2G15A 3TJDA 5AWMA 1YVJA 3PDTA 3SX9A 3LXLA 3DFAA 3PE2A 4KIPA 3A62A 4UV0A 4TWNA 4XLVA 3VS0A 5HBJA 1YHSA 4IHPA 3COMA 2W1ZA 2ZV9A 3BYMA 3VW8A 1H08A 5L2TA 5CT0A 2PUIA 3FAAA 2VD5A 4FKVA 4JBOA 2WELA 3N4UA 4QMUA 5M55A 3V8TA 2CLXA 4H58A 4CV8A 2EXCX 3VUKA 5FXQA 3UZRA 4RMZA 5HI2A 4L01A 4FKLA 4EYJA 5IPJA 3UDTA 2HELA 4UY9A 4U97A 2UZVA 3KXHA 3R00A 4KRCA 1BYGA 4EJNA 5FTQA 4FT3A 3ZC5A 4TYJA 5H3QA 3KVWA 4BCNA 4XRLA 5IQHA 3ORXA 4EOKA 3F3ZA 4LRKA 5FGKA 4DLIA 5IA3A 1LUFA 5CVGA 4EOQA 1W8CA 3A4PA 4D0XA 3C7QA 4R1YA 3AMBA 3PRFA 2IN6A 2JDTA 4RJ3A 3JVSA 3F3TA 4DG3E 3V51A 1NVRA 4AGWA 5K4JA 1JOWB 3OEZA 5KBQA 3LHJA 2JEDA 5KMLA 3L9PA 5FTOA 4TKSA 3UMXA 3FPQA 3BYUA 4FKPA 1GOLA 1W82A 4JL9A 3FKOA 3MA3A 5HICA 3WF8A 3A7JA 4YTIA 4FTIA 1Q4LA 3QD0A 3PSCA 5LMAA 3G5DA 3VWAA 4ZLOA 4I6QA 4YTFA 3FI8A 2YM5A 3ALOA 4V01A 4H1JA 2J7TA 3TXOA 3FJQE 5ANEA 5JRQA 3UPZA 4FJVA 3WF7A 3U87A 1SYKA 5HBEA 2BCJA 3IONA 5EOBA 4QMWA 4AWIA 1XWSA 5CF5A 4KBKA 2X4FA 3CJGA 4D4RA 4U3YA 4G6LA 3I81A 1OGYA 1V0PA 1WBVA 4L7FA 3OS3A 4RVLA 2JDVA 4JQ7A 3GCQA 1R0EA 2BRHA 3VRZA 3IG7A 4S34A 4U41A 5C1QB 3ROYA 3MIAA 3UOLA 3FQEA 5E90A 3EQIA 5KNJA 1ZY4A 3FXWA 3N51A 3PWYA 2DWBA 2WTKB 3D14A 4AFJA 2QO9A 2YAKA 4RIYA 3E7OA 1E1VA 2JDOA 5DH3A 4FIFA 4HNFA 2QCSA 1I09A 5IQAA 3H0ZA 2F7XE 3L8XA 4JG6A 4P90A 4QP3A 2C3JA 2BIYA 4NU1A 3C4WA 3DKOA 1XKKA 4QMXA 2B53A 5HE3A 3R7VA 4D9UA 4F6UA 4PDPA 3U9CA 5J9ZA 2FSOX 4O0WA 5A4CA 4IB1A 4KBAA 1TFFA 2RFNA 3O0GA 4L8MA 4DG2E 5GJDA 4IVBA 4LOPA 3BYOA 5LOHA 3UO5A 1Q8ZA 2DQ7X 2P33A 4ZSAA 3QWJA 2X2LA 3BHUA 4J98A 4IM3A 1BL7A 5DR6A 2KTYA 3G15A 4RWIA 4QMNA 3R1NA 3D2KA 3OVVA 4F9CA 1OL5A 3KK8A 4UYAA 3NUPA 4AW5A 4PNIA 2XZSA 2IW6A 3PG3A 1PF8A 1U59A 2OSCA 4BGQA 3AOXA 5G6VA 2ZJWA 2XB7A 1H07A 2ITZA 4EK8A 1SVHA 3DAJA 3CLYA 2YCQA 3EN9A 4RFZA 4O91A 3W0NA 3PFQA 3A4OX 3KRLA 4PQNA 3AC2A 4O0XA 4QMVA 3W18A 4XV2A 2XBAA 3DXPA 3FDNA 4AFEA 4GYIA 4ACHA 4EL9A 4JBQA 5M4CA 3TM0A 2VX1A 3L8SA 2Y4IB 5E8SA 3C0IA 5FP5A 3R04A 3ORIA 3D0EA 3GUBA 4ZP5A 5EKOA 3R7YA 4XBRA 2NRYA 2W5HA 3UIBA 1Y8GA 1ZYDA 5E8XA 5EHYA 2R3LA 5IA0A 3KB7A 2WXVA 2BRNA 4HVSA 2YZAA 3D4QA 2RKUA 5IDPA 2R5TA 2HY81 3COIA 4O86A 1WAKA 3G0FA 1KE8A 4GG7A 2XKDA 4QMOA 4O0RA 4CTBA 3VIDA 2GHLA 1H27A 1KE6A 4QP6A 1PRYA 2QG5A 3AXWA 3H9FA 4QNAA 2CJMA 2ERKA 5DA3A 1LP4A 5HG9A 4D58A 3PE1A 4H3QA 2VAGA 2W5AA 3DB8A 2R3MA 2C5NA 2QLQA 2VTRA 4ITIA 2VWVA 4O6EA 5BVEA 3VW6A 3ZLXA 3HX4A 4G9RA 4JBPA 5CU3A 2IW8A 3LQ5A 2ITTA 3ORZA 1J1CA 4YMJA 5CSPA 4XV9A 4JQEA 4AZSA 2XCHA 3LJ2A 4XG6A 5BYLA 5A46A 3NLBA 3OUNB 3CPCA 2NNWB 3GNIB 2SRCA 4CT2A 4GJ3A 5CEIA 4DFUA 2FH9A 3P08A 4G3EA 4TYIA 3FWQA 4NW6A 3ZFYA 4L9IA 4TYGA 3UO6A 5AUZA 4HGTA 1RDQE 4MX9A 4ZK5A 5BUJA 2QNJA 4DDGA 5IU2A 4H39A 3QD3A 4QDVA 4U81A 4FZ7A 2ETMA 5EYMA 4I0TA 5AA8A 3TNHA 5JQ5A 5AEPA 1T45A 4AA4A 1B6CB 1Q97A 4FG8A 4U42A 3CGOA 3CTQA 3MBLA 5KMMA 2R3IA 4FGRA 3R7UA 3ZRMA 2BAKA 2XRWA 3BELA 3Q96A 2PUPA 3GB2A 5T6KA 4YO4A 3O23A 5D1JA 1URWA 3GCSA 3NW7A 4U8ZA 3VS5A 2NYAA 1L3RE 2PE1A 2X39A 3R1YA 4AZWA 1W84A 1YOJA 3B2WA 2YM8A 3F3UA 2QI8A 4C4FA 5IUGA 3CPBA 3D7TA 3SXFA 3NUNA 4FNWA 5EI6A 4NTTA 3SG9A 4J53A 2ZV8A 1JSUA 4F1OA 4PWNA 5DR9A 1FGKA 3GP0A 4FTTA 4I3ZA 4MNEB 3AC3A 2XJ0A 4EQMA 3Q9ZA 1ZMUA 3IW6A 3W8LA 5KMOA 5J9LA 2GSFA 4JG8A 2VWZA 3FQSA 2WNTA 3MY1A 4H3PA 4D5HA 4BDJA 5HU9A 3FI4A 4R3RA 4APCA 4JIKA 3I4BA 3VHEA 3MH0A 4BDHA 5DNRA 2RFDA 4BDBA 1J7IA 1NXKA 4QPAA 4GK4A 3QTRA 3CTHA 3VULA 4TY1A 1GZOA 3ATSA 4GT3A 4QP2A 2HZ4A 3HA6A 3RTPA 4ASZA 2CCIA 2VTPA 4GYGA 3VNTA 2R3QA 3HEGA 3BLQA 4FKQA 1E9HA 2HY0A 2RFSA 1ZRZA 4K1BA 1BX6A 4I41A 1WVYA 4YBKA 4EH8A 1YRPA 4S30A 3NVKI 3WZUA 3VF9A 1ZYCA 2XEZA 3KF4A 3G33A 2FSTX 3BRBA 4IWDA 4RBLA 4YHTA 3T9IA 3THBA 2BILB 5DT4A 4QMQA 2LGCA 3DBFA 2ZOQA 4YJRA 4X2NA 3DPKA 4FTAA 2PYWA 3NNXA 2BZKB 2VV9A 3BZ3A 3HP2A 3KMWA 1YW2A 2EUFB 4IH8A 3W2CA 3ZOSA 2G2IA 4AZTA 3BLHA 5HD4A 5EQPA 1IAJA 4RVMA 3R9OA 2GNJA 4FUYA 3OC1A 3OCBA 1XQZA 4C02A 2VGPA 2CMWA 3C5UA 1JKKA 2W5BA 4FV6A 4O7VA 3MVHA 5I9WA 1JPAA 3AD6A 5ANJA 5J5SA 4IWPA 4IM2A 4L3JA 5HCZA 4P5ZA 2OI4X 3E8DA 4QMYA 4YHFA 3DTCA 4FV4A 5TKDA 5EHOA 4AOIA 1M52A 5L2IA 1P14A 1H1PA 3QGYA 3PIYA 4DA5A 5IMXA 4QMTA 4QYFA 4YZMA 4KKEA 2PSQA 3BIZA 5F4NA 1DAWA 2I0EA 1HOWA 3BU5A 5H8BA 4EH9A 3LOKA 4HVIA 5F20A 5BPYA 5TO8A 3SW7A 4XG2A 2HK5A 2V22A 4CFMA 4NCTC 3IK3A 4YPDA 5B7VA 4HPUE 5IMEA 4RFYA 3FI3A 3FLQA 5BUIA 5HLWA 5KMJA 1S9IA 5CI6A 4AXDA 2HYYA 3VHKA 3NNVA 2X81A 4HCTA 4O0TA 1BUHA 4L53A 4RVTA 1KE7A 4TT7A 1WBTA 5IQIA 2QOIA 3TYKA 4G1WA 4LOOA 3RPSA 4P5QA 5JSMA 4MAOA 1CKJA 2C6EA 1UNGA 3A7FA 3P0MA 5BQ0A 2WTCA 2HWOA 3KXNA 4L44A 1OVEA 3EJ1A 3KRWA 4G31A 3V5LA 4UYNA 5DPVA 5HTBA 4EH6A 2CKEA 5JRSA 4MH7A 5FG8A 4W4VA 2JLDA 3P7AA 4E73A 4RWJA 5IQFA 2ZVAA 5DRBA 3ZTXA 5AUUA 4NM3A 2PE2A 4XOYA 4L42A 4V05A 2ACXA 3F6XA 3PG1A 5D7AA 3GCUA 1BI7A 2XF0A 4AA5A 2OK1A 4XG7A 1O9UA 3RPVA 2PVKA 4WIHA 4EK5A 1G5SA 4NJDA 5CSHA 4FV7A 2P3GX 2R0IA 5CXZA 2UZDA 4J8NA 2R3GA 4AT4A 4BI2A 3NIEA 3AD5A 3H3CA 2A1AB 1Q61A 4M14A 4RFMA 5AV3A 4FA2A 5FRIA 5ACKA 1ZY5A 3HV5A 3R21A 4RX7A 3TG1A 5AP3A 4AUAA 2W9FB 2WMUA 3LCKA 3UC3A 2X0GA 5JZJA 2EVAA 2WMQA 4MD7E 4O6LA 1WBOA 4JLCA 3NYXA 5FLFA 4XV3A 5DOSA 4F6SA 1JKLA 2XJ1A 4NW5A 3ACKA 4JT3A 4FEVA 3KMUA 4LM5A 3TZ7A 3I1AA 2WD1A 3HDNA 4QP1A 2ESMA 3HRCA 3QFVA 3R2YA 5CI7A 3HRFA 3JYAA 2UZOA 3SOAA 2VTLA 3F61A 4M68A 3MJ1A 3NPCA 4OTIA 3V5JA 3D5UA 5CEQA 4ACGA 3TKIA 3NRMA 3UC4A 4A9TA 3CY3A 4A4XA 4JG7A 3TV7A 3AD4A 2IW9A 1BMKA 1BL6A 3ZSGA 4AOTA 4FTQA 4WNOA 5GJGA 4FV8A 4MWHA 4WT6A 3IQ7A 2ZMCA 4QQTA 2C6IA 4FODA 2YJRA 4CFFA 2BAQA 3QL8A 4DEBA 4FSTA 2XA4A 4O7LA 4I92A 2VWXA 2RGPA 5M4UA 5EH0A 4Y5QA 2GS7A 4IWOA 4FEWA 1ZYLA 4UWCA 2R3NA 3I6WA 3DFCB 1OM1A 3NFGB 2IVVA 5HVJA 1WBPA 3H9OA 1DAYA 3V3VA 3HMPA 3OTUA 2IPXA 4QTEA 4KUJA 2JIVA 3K5VA 4XS2A 3D5VA 4F9AA 1ST0A 5CT7A 1R39A 4ANSA 2B9IA 3SD0A 4EOLA 3OFMA 4FIHA 3ZZEA 2C6LA 4XV1A 3NSZA 4WSYA 4YO6A 3OT8A 4CT1A 1Z57A 4LV7A 4TW9A 5BNJA 2J0MB 2X8IA 3FEGA 4FI1A 4IAFA 3H9RA 2E9PA 4JRNA 4U79A 4YJTA 4ZSJA 4A9SA 4E4MA 4RQKA 1JQHA 3P5KA 2QOLA 4CFUA 4IM0A 3U54A 3HUCA 3ROCA 3F5XA 2WGJA 2Q0BA 3ENHA 4AAYA 5M4FA 4WRSA 3OWKA 5C26A 4JBVA 4C4GA 4I1ZA 1OZ1A 2C3LA 3DB6A 3FMNA 4FOCA 4FSYA 4YHJA 3VQHA 2XS0A 3KREA 2C5YA 3BBWA 3W32A 1L8TA 4DGNA 4F0GA 3EQPA 2XM8A 5M08A 4N6YA 3R30A 5LWMA 3FMEA 4NT4A 4ALUA 3Q5ZA 2CN8A 1LPUA 3HV4A 3O71A 2G9XA 4GIHA 5KHXA 1ZYJA 2P0CA 3D2IA 3M11A 2UW3A 3NVMB 3UDBA 1UKHA 3L8PA 5ANGA 3GBZA 3H30A 3MN3A 4PV0A 5FUTA 2C5XA 3V5PA 1BI8A 1ZMWA 2I40A 3MFTA 4EQUA 3EN5A 3CD3A 2ZFYA 4FKGA 4FVPA 4W4YA 2ZDUA 2ZB0A 5CEMA 2Y8OA 2XIYA 1OIYA 2GNLA 1TQIA 3RVGA 4BTKA 5HCYA 5IG1A 4FSZA 4E8AA 4BJJB 3Q32A 4AF3A 2PVHA 5KX8A 4I93A 3OCTA 3R8PA 4RG0A 3IGOA 1A06A 3NYVA 3F9NA 4FOBA 1YI3A 3DBEA 4GG5A 3W0QA 1UVRA 3POOA 1KUTA 3FZTA 4I94A 3FLWA 4IAYA 4FR4A 4EORA 4F7JA 3Q53A 5FM2A 5AP6A 1I44A 4ARKA 3O51A 2XKEA 4IB3A 2H6DA 2HOGA 3PY1A 4XG3A 3ZO1A 2RIOA 2PVFA 1PXLA 2XNMA 3DS6A 2W7XA 4IFGA 2F7EE 3LLAA 1PXOA 4BZOA 3FLZA 4KSQA 1GJOA 4QMMA 3VS3A 4EYMA 5CANA 2OICA 3VUGA 3OT3A 4BGGA 4V04A 3O50A 4FIIA 3TNPC 4O21A 2ERZE 4FSNA 1LEWA 1PXIA 4F1MA 4F70A 2C0OA 2FGIA 2PL0A 4Q5HA 4O0SA 4E5WA 4F4PA 4ZTRA 5HX6A 5JFSA 3D9VA 4W4XA 1O6LA 2X2MA 5CSVA 4FUXA 1J3HA 4U7ZA 3CCNA 4JDJA 4F6WA 2CGXA 5EW8A 4WBBB 4M84A 5CWZA 4FNXA 4I22A 3BE9A 4U45A 2O63A 1JSTA 2ZB1A 2BHHA 3LJ1A 3BI6A 3HLLA 4GFGA 3Q2JA 4JDIA 5ANIA 2XNOA 1S9JA 5CAPA 2VTOA 3W8QA 2XK7A 3LXNA 4IAKA 4O22A 5HG7A 4RT7A 4QPSA 4UN0C 4BBFA 3BLRA 5C4LA 3TI1A 4D0WA 3BX5A 5DBXA 4JX7A 3W0MA 1YXUA 4OTDA 3ET7A 1RE8A 2BUJA 3DNDA 1NVSA 2C3IB 3C50A 3WZJA 1JNKA 1W83A 2ZMDA 2BRBA 4F1TA 4FKJA 3BBTB 5HKMA 4AW2A 2B52A 4CFXA 2GFCA 2JDSA 2WU6A 4GMYA 4RLKA 3KRJA 3W10A 4RIWA 4Z55A 5CAQA 2OG8A 3B8QA 4CEGA 2FUMA 5HLPA 5LVNA 3KXZA 4K33A 3R8MA 2WTDA 3PXRA 4GKIA 4DEAA 3LXKA 4JMQA 2A4LA 1ST4A 4MNFA 4Y73A 2VUWA 4BVUA 3TMOA 4FV3A 3OOMA 1M17A 5HNBA 3A99A 3R02A 2JKMA 3ZFMA 4FIEA 4Y72A 3U6IA 3VJOA 2AC5A 2V0DA 4FKRA 3BPRA 3M42A 2BRGA 1CDKA 4IAAA 5E9EA 2W05A 2I0YA 3I60A 4X7QA 3KU2A 5JGBA 2HAKA 5CVFA 1M2RA 3OWJA 1RW8A 4PNKA 4KD1A 3D7ZA 2QOHA 2HWPA 3W0OA 3CBLA 2UW0A 4PMSA 1G3NA 1G8SA 3N4VA 1M14A 4FKOA 5CXHA 3LIJA 3DK6A 5A4TA 3DAEA 4JDKA 2W99B 3WBLA 4BI1A 2C5OA 4F63A 3NUXA 4AT3A 4MHAA 4EOIA 3QZIA 4HCVA 3EN4A 4DCAA 4ITJA 1GZKA 3Q4UA 4KKGA 4PY1A 4GH2A 5A4LA 3PVGA 3O5AA 4AX8A 3ZUVA 3LM0A 2PHKA 4LV8A 3JPVA 2JFLA 4KBCA 3TKHA 3TZMA 4BTJA 4XUFA 4CXAA 5BV3A 2JIIA 4HPTE 1VYWA 4JRVA 4OUCA 2WMBA 3TDVA 3E63A 3OCSA 3G6HA 4YZDA 4AW1A 2GU8A 4CLIA 4GK3A 3ZEWA 4J95A 4X3FB 3K2LA 3R6XA 4YTCA 3QRKA 3AMAA 4CVAA 3RWPA 3U6HA 1STCE 2GNIA 2HW6A 4HYUA 4RC3A 4GV1A 2KULA 4ENXA 4ZTMA 1DI8A 2C6MA 5I5ZA 3QQUA 3CQWA 3Q9YA 4DGGA 4DN5A 3RM7A 3EZRA 2VWUA 5DE2A 4FT0A 4PF4A 2JC6A 4BHNA 4DT8A 4IQ6A 3ODZX 4FV9A 4DINA 3W33A 3E7VA 4C0TA 4M8TA 2XK6A 4QRCA 2YM3A 4NL0A 4BRXA 4NIFB 4DGLC 1REJA 4FX3A 4D55A 1XH9A 4DFYA 2G1TA 5GIOE 1IAHA 1OIUA 2BRMA 2VO0A 4I4FA 4XMOA 4EC8A 4C62A 3FY2A 3OCGA 4MUQA 4DF3A 4FTMA 4JX3A 2YIYA 2JGZA 3OZ6A 4ZSEA 2C6KA 3ZU7A 3VN9A 4UALA 3EL7A 3L9NA 5ANKA 1SNXA 1OL6A 2E9NA 2A0CX 3UIMA 2PZ5A 4AN9A 4GKHA 4USDA 2GNHA 1PXKA 1YXXA 3HV7A 4TWPA 4UX9A 1YXTA 2XIRA 2Y9QA 3GVUA 2OJ9A 4PTCA 2OJFE 5E91A 3R9RA 5K9IA 2XNPA 2C0TA 3IPHA 1PYXA 4AU8A 4ZY6A 3UBDA 4X3FA 5KO1A 1J7LA 3EN7A 1OECA 2H34A 2VTNA 4LRJA 4U43A 3U4WA 2X9FA 2P2IA 2BKKA 3D94A 3R71A 2BZHB 4S31A 5K5XA 3OBJA 4FT9A 4IDVA 3LFEA 2C47A 2CPKE 4PTEA 4TNBA 4A9RA 4W4WA 3EWHA 3SKCA 4LG4A 4B8LA 4YNOA 3BLAA 4EK6A 2W17A 1OPKA 3RZBA 4JR7A 2CGUA 3KL8A 4WNKA 1X8BA 3QZHA 4XJ0A 4ACCA 4KA3A 5EOLA 3GFEA 3EQDA 4BDGA 4JQ8A 4CMUA 3C4XA 2QKWB 4QEBA 3QHRA 2VTHA 4K8AA 5C8MA 3F82A 5A3XA 5F9EA 3P79A 2WQNA 2OLCA 2XKCA 1YDRE 5AV1A 2WTJA 4K18A 2CKPA 3AGLA 1OKVA 3DJ7A 3UJGA 2O2UA 4EWQA 3GC9A 4E4LA 4IFCA 5DN3A 3DTWA 3D7TB 1MRVA 3QCYA 2VO3A 4FTLA 3KRXA 3LLTA 3VVHA 3LFSA 4BCJA 4FKSA 2VO6A 5ITAA 4E6DA 3TUCA 4O83A 4DEDA 1FVTA 4OBQA 2IVUA 5AV4A 5A54A 4QO9A 4C4IA 3MESA 3PP1A 2OU7A 4ZXTA 3VS4A 3UOJA 3QCXA 4ERWA 4EH5A 3LZBA 5IH4A 3BL7A 5CZIA 4TYEA 5AIKA 1P2AA 3LFCA 4ZLYA 3CY2A 4ACDA 3VBTA 5CNNA 2ZM1A 2B9JA 3PXQA 5EQEA 5HHWA 5CASA 3O8TA 4XLIA 1OPLA 5IDNA 2ITYA 1R3CA 5EM6A 3DKFA 1YQJA 2OIDA 4ZMFA 3DDPA 3PA3A 1SZMA 3LFQA 3R9NA 4FG9A 4QYEA 1TKIA 5L6OA 4XCUA 3KN6A 3A61A 1U54A 3GCPA 2ITUA 2ITOA 2X2KA 4DTAA 3MPAA 5DFPA 2ITQA 4CV9A 3EHAA 3ORNA 4ANBA 1R1WA 3FMDA 1Q3DA 4DITA 4B8MA 4BCIA 5KCVA 2W9ZB 4FV2A 4LFIA 2QONA 4YZBA 2R3RA 4ZLZA 4K11A 4DHZA 2GHGA 2W4JA 3JXWA 1NT2A 4RX9A 2X9EA 4CRSA 5CSXA 2UZTA 3R2BA 2HZNA 4OGRA 3MW1A 3SXRA 4IZ5A 5CU0A 2G2FA 4D1XA 1T46A 3ZO2A 1HCLA 1WVWA 2ZAZA 3Q6WA 4IJ9A 1XMLA 4ORKA 3RPRA 3KN5A 3VRYA 4BBMA 3JR1A 4IBMA 3O2MA 1JBPE 3EQHA 4L7SA 4DHIB 2W1FA 5A9UA 4BDFA 3VC4A 2OFVA 4BY9E 1CKPA 3PYYA 3K3IA 2UVYA 3DXQA 3FL5A 1UU7A 4C61A 1Y91A 2UW8A 4TL0A 5GINE 2WMXA 1U46A 4LGHA 2V5QA 2QC6A 3WI6A 1PMVA 3OY1A 4IACA 4LYNA 4N4SA 4NYEA 3PJ3A 3LE6A 1QCFA 2PZYA 5JN2A 4NKSA 3DGKA 3NW6A 5FTGA 4TPTA 1H1WA 3E8NA 4MF1A 2WMRA 3DAKA 4YZCA 3ANRA 1Q24A 3E92A 2CCHA 1YWVA 4GU6A 2ZV2A 1JWHA 2R9SA 3BU3A 4L52A 4TTHB 3TUDA 4XP2A 5A4EA 2QU5A 3ELJA 3FXXA 4YC6A 4RIYB 4ZTHA 4GIIA 5C27A 1QPJA 5HVKA 3PJ8A 1JLUE 5DHJA 3HUBA 5BMSA 3OG7A 5LVLA 3QKMA 4D9TA 3MFRA 4KIQA 2UZUE 3FE3A 5FEEA 2IJMA 4ZJJA 4QQJA 3ZO4A 4KB8A 4CD0A 5CEOA 5AUVA 3CD8A 4A9YA 2W0JA 4ZZNA 1CTPE 2XALA 4AP7A 5K4IA 2WKMA 4J7BA 4BN1A 2O8YA 1GAGA 1GIJA 4DT9A 1QMZA 4EC9A 4UBAA 3R9DA 3RK5A 5M44A 2GPHA 5ETFA 2XRUA 3KRRA 3L8VA 5EI8A 5AADA 1P4OA 3V5TA 1PMUA 2BROA 1H0VA 4PDSA 1MP8A 4KKHA 1IA8A 5IQCA 3PJ1A 2R3JA 4RIXB 3C4CA 3LFDA 3QXOA 3R8ZA 3PPZA 4C4HA 4D5KA 3RAIA 2F4JA 3SC1A 4C58A 4HZSA 3TDWA 2X7GA 4BC6A 4BZNA 3P86A 3UP7A 2OZOA 5JKGA 3UYTA 1NVQA 4BICA 1XH7A 2WFYA 3NFFB 3C51A 1VR2A 4YZ9A 4DGOA 2JD5A 2C4GA 2QURA 2I0VA 3E64A 3R8LA 4D4SA 3G2FA 4O7WA 2W1GA 3A7HA 3FKNA 1OL7A 4MBJA 4ASDA 5KKRB 4NZWB 5LCKA 2ETKA 2XVDA 3N9XA 3IDPA 3TTJA 2PTKA 3E87A 5BVFA 3NIZA 3PP0A 3GQIA 1FINA 4FK6A 4F9YA 1AD5A 2VNYA 3BCEA 3B2TA 3G9NA 4FL3A 4HJOA 5BYZA 4FSMA 1H26A 3UG2A 3PSBA 3WARA 3SDJA 3QRTA 4AZFA 4YR8A 2XMYA 3I5ZA 5DI1A 4HGLA 2YIXA 4DBXA 4I5MA 3T8OA 1OKYA 3BGPA 1ZOHA 3ML1A 5DT0A 4DDIA 1YDTE 3QD4A 4J1RA 1Q8UA 5HE2A 4G16A 2Q0NA 4EH3A 4LMUA 3ZM4A 3DDQA 3F5UA 3FBVA 3T3VA 1H00A 1Y6BA 4RIXA 2W1CA 4A4LA 2QR8A 4JI9A 4CCBA 3Q2MA 3RCJA 3ZCLA 1GZ8A 4A4OA 2WMVA 4S33A 5IZFA 1IEPA 3O7LD 3HAMA 5L8JA 3BWFA 1OUKA 4M3QA 4I24A 4NCTA 3ZEPA 2PZRA 3ZSIA 4DG0E 2J0IA 4X2KA 3HMOA 4BHZA 5LMKC 4N6ZA 2OJIA 4MQ2A 2CNUA 2IZRA 2ZDTA 4BF2A 2JKOA 3MB6A 3MB7A 3FC2A 3KQ7A 3LVPA 1CSNA 3IOKA 4CKIA 3V8SA 5AM7A 3UZTA 2PVYA 3NYNA 3LQ3A 5FM3A 4G2FA 5E4HA 2VWWA 4YBJA 1UU9A 3FY0A 4N57A 1H1QA 4XYFA 5E7RA 4GCJA 3MDYA 2VWBA 3VJNA 2YCRA 5AIRA 4MBLA 4S32A 1A9UA 5D12A 1A48A 2O3PA 2W4KA 4ACMA 4TN6A 3KC3A 5D7VA 4MXZA 3KXXA 5LMKA 3FHRA 5TR6A 1M2PA 3ITZA 3W2OA 2XARA 4BYJA 4I6HA 2H96A 2FB8A 3EMGA 3I0OA 4MKCA 4AGDA 4UEUA 4PL3A 5FXRA 4IVCA 5IH6A 3F88A 3RINA 4DFZE 3AT2A 1DM2A 1AGWA 5KMIA 3GC7A 2VTIA 1J7UA 3MPMA 3ZYAA 2JAMA 1ZAOA 1E1XA 1H25A 2IO6A 3FYJX 3MTLA 4Z7GA 4F7LA 1H24A 3QQLA 3HYHA 3ZM9A 2J6MA 1UKIA 3I7BA 3ZBXA 2W1HA 3PZEA 5DT3A 2X8DA 5IQBA 3QX4A 3R8VA 5EG3A 2OGVA 3AKKA 4RX5A 2O64A 1XBAA 4G6OA 4E26A 3ZUTA 4K9YA 2BPMA 3QLGA 2VN9A 4FTNA 4L6QA 3FZSA 1UA2A 4I4EA 5HESA 4CFNA 5EK7A 2XNNA 3QXPA 4E93A 3E93A 2F7ZE 2BHEA 4JVGA 4QYHA 3MV5A 5KKRC 1YI6A 2YWPA 5HIEA 5HEZA 3GT8A 4IAIA 3WIGA 5CSWA 5E8VA 4CTCA 4NFNA 4EBVA 2WPAA 5CU2A 3DBDA 3UNKA 4D4YA 3G6GA 1B39A 3EFJA 1ATPE 5ANDA 2HZIA 3QC9A 4PX6A 2EXMA 1OB3A 4U5JA 4NM5A 5GIPE 5AX9A 2YIWA 4DTBA 3UTOA 3FYKX 4IW0A 4IADA 4MXXA 2B0QA 3H4JA 3QTXA 1JKSA 2EWAA 4R77A 2ITNA 2OBJA 3DQWA 2GQGA 2UV2A 3EFLA 3P78A 4EZ3A 4ZSGA 3IKAA 4D1ZA 3NNWA 3MVMA 5BMMA 5CU6A 4EI4A 5CQUA 5JT2A 4YUQA 3PXYA 4IZYA 3DZOA 2Y6MA 3RNIA 2REIA 3F3VA 4XBUA 4OT5A 1KOAA 5HLNA 3KVXA 3ZBFA 1VJYA 3OY3A 4CKJA 2Z7RA 4TRLA 4XG4A 3R7OA 4NWMA 3KULA 3FMKA 4WBOA 2RL5A 4BDKA 3Q04A 5M07A 3VBVA 3MTFA 4DFBA 5KHWA 2YN8A 4U6RA 3LFFA 4BIDA 4GU9A 4ZOGA 5C8NA 2UW6A 1V0BA 3FMJA 4K0YA 5AP5A 3TZ9A 4QTAA 4RIWB 5H9BA 3W0RA 2PZIA 3GU6A 3LFBA 4ZZMA 4ANLA 5LQFA 3OUKA 3GENA 3PPKA 2UZNA 4M0YA 1ZYSA 4KRDA 4JDHA 4EKLA 4ZEGA 3V01A 1WFCA 3VUIA 2GNGA 4EK4A 1W0XC 3MY5A 1OI9A 2Z7QA 4N0SA 3PLAE 5AAFA 4L43A 4U3ZA 3PXKA 5EKNA 4UXQA 1Q8YA 2X8EA 3A2CA 4QQ5A 4C2WA 4EBWA 4EKKA 3G51A 4O84A 4EWHA 2IG7A 2BIKB 4BDDA 3CIKA 4LGGA 3B8RA 4RJ5A 4AACA 3COHA 3DCVA 1UU3A 3KFAA 5FDPA 3GGFA 4Q9SA 5CAOA 2E2BA 3BYVA 2PUUA 3TEIA 4Q2AA 4FV5A 1WBNA 2XAMA 3NNUA 2EB2A 4C37A 2ONLA 2YDJA 4PUZA 1KWPA 2YM7A 3C13A 3D5WA 4FTOA 3W2QA 4ITHA 4NM7A 4G9CA 3UE4A 4E7WA 2X7OA 1MRYA 4G5PA 4PTGA 4BCOA 2GCDA 3BE2A 3TNQB 1SMHA 4YJVA 2FO0A 5LVOA 2QD9A 1CKIA 4MXYA 3ZSHA 5EFQA 4CFWA 2FVDA 5CAUA 2IZUA 2Y7JA 3LCDA 3ORLA 1U4DA 4G3GA 4J96A 4RIOA 3WIKA 2XAOA 4QT1A 4NM0A 4IEBA 1CM8A 3IDBA 1K9AA 2WTVA 3ZHPC 3MSSA 2WQMA 4AA0A 3R8UA 4CGAA 4L00A 4O0VA 2QG7A 4O7TA 4USFA 4BCHA 2XANA 1XH6A 4RA4A 5HIBA 2QODA 2XIKA 3LFAA 4QYGA 4I0SA 2P2HA 2YITA 3F7ZA 3EFKA 4GS6A 3FLSA 3HECA 2R3FA 5DVRA 4N70A 5JGDA 2X1NA 5KMKA 4YLKA 2WIHA 2VU3A 2WOUA 4G6NA 2BFYA 5BVWA 3RM6A 2OH4A 3W2SA 3G0EA 2CKQA 5CEKA 2XJ2A 1VLRA 3CGFA 3IW7A 5LMBA 1IR3A 4ALVA 3PWDA 2F2UA 2Z7SA 4M13A 3RALA 4FIGA 4RC4A 4YLJA 3C9WA 3PUFC 4R3CA 2QKRA 1OITA 4Y95A 3BKBA 4FGBA 3GEQA 3FHIA 2V62A 2UW4A 4YURA 5E1EA 2XUUA 3DBQA 3AC4A 3V5WA 5JEBA 2UZWE 4JAJA 2AYPA 3FUPA 3KXGA 3QWKA 3HMMA 4DGMA 3HMIA 3A8WA 4J99A 4ZZOA
chains in the Genus database with same CATH topology
4HGEA 4BBEA 4HW7A 1M2QA 5ETCA 1IASA 2PMNX 2B7AA 2H8HA 5HE1A 3DOGA 5C9CA 5HZNA 3FSKA 4MXCA 3VONA 2Y0AA 3Q4CA 3DJ5A 2VO7A 3MJ2A 4X6QC 3E62A 3BEGA 1G8AA 2FYSA 4GVJA 4WHZA 4XG8A 2GFSA 4HVHA 2JFMA 4RA5A 4IIRA 2Z2WA 4XG9A 4AE6A 2W1IA 1XH8A 4L3PA 4R5YA 5H2UA 1H4LA 4GT5A 1Q8TA 4BDEA 4YJPA 4GJ2A 2QOCA 2W96B 5KE0A 1PJKA 3VBWA 4KS8A 3R7IA 3TN8A 2PMOX 1Q62A 5HNGA 5HO8A 3ZXZA 1KSWA 3A7GA 3QUDA 4MK0A 2YERA 5BVNA 5AUXA 3HNGA 2UW9A 4DC2A 5I9ZA 3U9NA 5GHVA 4U9AA 4FTJA 3GC0A 3NAXA 2CN5A 3H0YA 5ANOA 2CNQA 1IA9A 1MQ4A 4FMQA 4ONAA 4TWCA 5CLPA 4YSMA 5E8ZA 5H8GA 5BVOA 1RQQA 3NZ0A 5JK3A 2NO3A 2R3HA 4IDTA 3RAKA 2J5FA 1UU8A 4Y5HA 4DLJA 3DLSA 4MYGA 3OP5A 4CLJA 2WEIA 3SHEA 5C4KA 2XNEA 5AMNA 3TV6A 1GIHA 1WVXA 2WTWA 2GTNA 2IZSA 3KKVA 4U44A 5E8WA 4EH7A 3LCSA 3DZQA 2WO6A 3HGKA 3I0QA 5FEQA 4ZY5A 3GCVA 4HYSA 4J97A 2BDWA 3AC1A 2W06A 5CY3A 2BKZA 4ANQA 3OXTA 4RSSA 3WYXA 2JKKA 5EYKA 3CC6A 2C3KA 3UMWA 3KA0A 4M0ZA 3TIZA 4IC7A 3EIDA 2C30A 4UWBA 3HKOA 3CEKA 4OTQA 3MVLA 3OMVA 2J9MA 5HE0A 2LAVA 3TNWA 2I6LA 4HOKA 4M67A 5I9UA 4ANMA 3WZEA 3LW0A 4PMPA 5CENA 3AG9A 2WAJA 1PMNA 1ND4A 4K77A 4DFXE 5LVMA 3CKWA 3NW5A 3II5A 4BGHA 1QPDA 4WRGA 4ZTSA 2UZBA 3SXSA 4C33A 4CRLA 3UQCA 2EB3A 3QUPA 4CZUA 3KF7A 3MH2A 4AXCA 3FSFA 4DCEA 3UPXA 4EK3A 4EH4A 1YHWA 1V1KA 3NX8A 4R78A 4BB4A 5M53A 4DAWA 5FEDA 2HIWA 4B9DA 2A2AA 4F9WA 2FSLX 4MQ1A 4DHJA 2ZYBA 4YNEA 4J52A 2VTAA 5L2SA 4BCQA 4Y83A 2VZ6A 5J87A 2PE0A 2QQ7A 4BDCA 1K3AA 4ZS4A 3OBGA 3DQXA 3AGMA 3OWLA 3HMNA 5AV0A 1MQBA 3ZONA 4OR5A 3JVRA 4WUNA 2B9HA 5EW3A 4E6CA 2JBOA 1Y8YA 2XYNA 2BDJA 4O7NA 4K2RA 2BDFA 3L9MA 1Q5KA 4TWOA 4BDIA 4NUSA 3W1FA 3LFNA 2WEVA 2V55A 3AT4A 3BV2A 3CS9A 3PPJA 5C01A 5HORA 4O81A 2VX0A 3SOCA 3D83A 4QDEA 3LQ8A 3LMGA 4JS8A 5E1SA 4C2VA 4C3RA 4CG9A 5HX8A 3OXZA 1ZOGA 4ZAUA 4LOQA 4H36A 3RCDA 2AC3A 2PVRA 4FYOA 4EONA 5IQGA 4I6FA 4M15A 3ERKA 4H1MA 2VTTA 4OT6A 4L68A 5AX3A 5KMNA 3VUHA 5HIDA 3HAVA 4OBPA 5L6WL 5FDXA 2YA9A 5IA4A 5I9YA 4RZWA 3IS5A 1ZMVA 3QQHA 4AS0A 5FBNC 3GC8A 3Q9WA 3U4UA 1G8KA 3UP2A 2PVLA 2WQEA 2XM9A 5DRDA 5C03A 3TWJA 3QTSA 2ONLC 3DKCA 4YJSA 5H8EA 3MGYA 5KZ0A 3QLFA 5HG5A 4DE4A 2DS1A 3ZRLA 4BYIA 1H8FA 2YCFA 4W8DA 4L45A 3TIYA 3IDCA 3E3BX 3ORPA 4FZFB 3W16A 3DY7A 1BLXA 3QRIA 4D4VA 1PYEA 2ITPA 3ZLWA 3OROA 3EQCA 3GQLA 5M57A 3ENMA 3IO7A 5CEPA 3HDMA 2IWIA 2H9VA 3TZ8A 4DYMA 1K2PA 4M97A 4IANA 1PY5A 4R7HA 2QOFA 3QTZA 4WO5A 1F0QA 4O7ZA 4ZTQA 4DBNA 3DKGA 2XCKA 3ODYX 5AM6A 2O0UA 4EEVA 4EHZA 3K3JA 1OL1A 3FMHA 4E4NA 4C34A 4LRMA 2QR7A 4DEGA 2NRUA 3PTGA 4KNBA 4XOZA 3KXMA 4I0RA 1Q99A 2OO8X 4C3PA 4CKRA 4G3CA 2ITXA 3AC8A 2J51A 5IA5A 4FICA 3UODA 2QOBA 4WG3A 1YXSA 4RGJA 4B6LA 4FT7A 1NW1A 4FKUA 2O65A 3R1SA 3KCKA 4AE9A 1WCCA 3GU7A 3M1SA 3ZLYA 4IZ7A 1ZLTA 5I4NA 4P4CA 3KCFA 4H3BA 2VRXA 1PKGA 5AFVA 4XP0A 4E6QA 4EOOA 1R78A 2WTIA 2C69A 5JMSA 4UWYA 1KV2A 3TACA 4Z3VA 3QRUA 4M69B 4JOAA 1GZNA 2V7AA 3QYWA 4GVAA 5TOZA 3JUHA 2GS2A 3UOKA 2YJSA 5LCJA 5J1VA 5ACBC 4FZ6A 3HVCA 3NEWA 3PIZA 4HGSA 3QQKA 4NTSA 3W0SA 3MFUA 2CGVA 5CNOA 5HVYA 5EYDA 5IUHA 4IVDA 3ZXTA 2GNFA 5T68A 1FMOE 2J90A 2QLUA 4FEQA 3SRVA 5AA9A 3EKKA 1UWHA 4JR3A 2XEYA 2OZAB 3R7EA 5IF1A 5J8IA 2YDIA 3DLZA 1TVOA 2OXYA 2X6DA 3DNEA 4Z16A 5AJQA 4LDTA 4LL0A 3PLSA 5CAVA 5AP0A 2WMTA 4GSBA 2HENA 3BHVA 4GEOA 3PFYA 4R6VA 2QOQA 5EDPA 3QALE 3FKLA 3C0HA 3EKNA 3P4KA 3QZGA 3WF9A 3K54A 5HCXA 2NPQA 2GTMA 3ATTA 2R3OA 3C5IA 2WOTA 3BL9A 3PY3A 2BFXA 5IQEA 4YSJA 1REKA 2CGWA 3NUUA 2PU8A 5IUIA 2Q83A 1PXJA 1FVVA 4GW8A 4EZ5A 5CALA 3MYGA 2F49A 4FC0A 4PRJA 1P4FA 1W7HA 3F69A 1UNLA 2R3KA 4AXEA 4PP9A 4KSPA 4ALWA 3RMFA 3PA5A 5J9YA 2RFEA 4DFLA 4EUUA 4ERKA 4IX5A 4P2KA 5FD2A 2UW5A 3D5XA 4XEYA 4QP4A 4IX6A 4F0IA 2CHLA 4EOJA 4H05A 5CF8A 4YC3A 4RJ8A 3NGAA 1PXNA 3ORTA 4ZJIA 5JFXA 1XBCA 4FIJA 2VWYA 3NDMA 3HRBA 4BCGA 3VAPA 2XNBA 3QRJA 1VZOA 2J4ZA 2OF2A 3CKXA 4O7RA 5AP1A 1PKDA 3GU4A 2WMAA 1OBGA 3EQRA 1OMWA 2VTMA 2W1EA 2J0KA 2YIQA 3DA6A 4MCVA 3AKJA 3WE4A 1J1BA 1PW2A 5GJFA 4Q5EA 4QMSA 3MH3A 5BUEA 2Y6OA 4DHFA 5G1XA 3WYYA 2PMIA 2BTSA 4I21A 3EZVA 3RK9A 3EOCA 4IE9A 4O82A 4B99A 4BIBA 2B4SB 3A60A 5A6NA 4YP8A 3NS9A 3PA4A 5IA2A 2YFXA 3UVPA 4RJ4A 3UYSA 4FKWA 4OTFA 3QTQA 3BHHA 4QQCA 3M2WA 2F57A 3BHYA 3WZDA 4DFNA 2QHMA 5TF9A 3RKBA 4F7NA 3GU8A 2G2HA 3FV8A 3MWUA 2C6OA 5DWRA 3TUBA 3O8PA 4LUDA 2CNVA 4PDYA 3JY9A 4M12A 5KUPA 4WKQA 3QQJA 2R64A 3A8XA 3Q9XA 1R0PA 2OJJA 2OH0E 5CTPA 5BYYA 4B4LA 3NAYA 2B1PA 2WHBA 1FBNA 1QL6A 4CNHA 3ID6C 4F65A 2OFUA 4USEA 4HNIA 3Q3BA 4NK9A 3Q60A 3W2PA 4C59A 3S1HA 3R9HA 2I1MA 2RF9A 2BMCA 4AW0A 4FTKA 2JDRA 4LI5A 3RNYA 2CDZA 3ZDIA 5IQDA 5B0XA 1FOTA 3E5AA 3F2AA 3ZH8A 3I7CA 4GL9A 4QMLA 2ITWA 4QNYA 5EW9A 3AMYA 2EU9A 1YOLA 1SVGA 3PSDA 3QTIA 3IW5A 4I6LA 4XP3A 3VBXA 4DH3A 1LR4A 3GOPA 5IEXA 4R7IA 1ZOEA 3UOHA 5L6PA 1O6KA 5JFWA 3PVBA 2UVZA 4A06A 2C6TA 3NMUF 4FV0A 4EJ7A 4EHVA 5DIAA 4UZDA 2FSMX 3RI1A 5EQYA 3LKMA 4AN3A 4B0GA 2C1BA 1OGUA 2XH5A 4X2FA 3LMHA 5DLSA 4M7IA 3F2NA 3QTUA 3U6JA 1JSVA 3EB0A 4BCFA 1JVPP 1NY3A 2OWBA 2OXXA 3BQCA 3HP5A 4U80A 4IZAA 3VO3A 2BR1A 2QO2A 5KZIA 1FQ1B 4NKAA 3QCQA 5D9HA 3UIUA 3QHWA 3VBYA 5F95A 3PUPA 1PHKA 1KOBA 4KS7A 3MA6A 3CQUA 3QYZA 3DV3A 1YWNA 2UZEA 2XP2A 4RX8A 4XHKB 1FVRA 3UGCA 3ZC6A 1WMKA 2GDOA 2QOOA 3F7WA 2E9UA 4C4EA 3F2RA 1Q8WA 3W55A 3MIYA 1QPEA 3EQFA 4PMTA 3R0TA 2C6DA 4F9BA 3U55A 1B38A 2QU6A 4F78A 4GK2A 4DH7A 3NYOA 2PULA 3RJCA 3WF6A 3OD6X 2WQBA 3O17A 3O7LB 3QQGA 4JNWA 2RG5A 4MVFA 1F3MC 3PY0A 4II5A 4O38A 3NUYA 3PVUA 5FBOA 5EM7A 1RJBA 3MFSA 4TNDA 3PXFA 5LARA 1UNHA 3U8WA 3D15A 4RJ6A 2J5EA 4GFMA 4NJ3A 5DYJA 2UZLA 5E8YA 3OW3A 3FMLA 3V6SA 1JKTA 2X6EA 4CG8A 1JAMA 3QGWA 4WOVA 3NUAA 5AP2A 3P23A 5M06A 4E4XA 3C0GA 2PVNA 2PWLA 4YPSA 4DEEA 3NUSA 4F0FA 4DTKA 3LAUA 4AXAA 4E5BA 4KIOA 4ZY4A 4I5PA 1IG1A 2YEXA 3GXLA 4I5HA 4GRBA 2CSNA 2OJGA 3U51A 3W0PA 2QO7A 1HCKA 2OIQA 2JAVA 4OTRA 4Y8DA 1OIRA 5EM5A 2XIZA 5JFVA 4BR3A 3VS7A 5CF6A 4R5SA 1YWRA 3IOPA 5A4QA 5HGIA 5BVDA 4UB7A 3Q4ZA 4YJQA 1DS5A 4IC8A 3FZ1A 1H01A 5HO7A 4FSUA 4QP9A 4DH8A 2XK4A 3IW4A 3IGGA 5E8TA 3HL7A 2B55A 3R01A 4PDOA 4JXFA 4JIAA 3UO4A 3MH1A 3OOGA 4YTHA 4MBIA 3RAWA 3ZMMA 1YDSE 5HTCA 4E20A 1OIQA 4AZVA 3SGCA 4K6ZA 5A14A 4O27B 4IB5A 3EL8A 2PVMA 3R28A 4PMMA 3NWWA 3P5JC 3F66A 4D2SA 4EOPA 3P9JA 2CKOA 4O7SA 3FMMA 2DUVA 2HW7A 5T3QA 2BALA 2YISA 4ZSLA 5B2KA 3PIXA 5CU4A 4F09A 3E3PA 4U40A 1XR1A 4B7TA 3OXIA 5LJJA 4WD5A 4I23A 3OTVA 5F1ZA 2I7QA 5D41A 3FZOA 4FZAB 4F7SA 4YC8A 5ETAA 5AV2A 2XK8A 5JH6A 3BEAA 4AG8A 4D2RA 5HNIX 2Y4PA 3QC4A 4HVDA 4KABA 3TT0A 3SQQA 3QQFA 4HYIA 3AC5A 5HD7A 2OXDA 2WTKC 3FPMA 4ZJVA 3SV0A 3ACJA 3DK3A 5IISA 4J8MA 2HXQA 3HV3A 3BGZA 4FE2A 3DJ6A 3BYSA 3UVQA 2YM4A 4PL4A 3RGFA 2ETRA 3OW4A 4FVRA 3S95A 4C3FA 5E8UA 2YDKA 4IWQA 4ID7A 4AN2A 4AQCA 3DK7A 2J2IB 4MEDA 5DEWA 5B2MA 2HXLA 5AAGA 1KV1A 4AQKA 1YKRA 3RHXA 3VQUA 4EOSA 4L46A 2E9VA 4KINA 4RRVA 2OZAA 3QD2B 3SG8A 5I0BA 3WILA 4FEXA 4BCMA 3PVWA 3P7BA 3QUEA 5EHLA 4QMPA 4X3JA 4EHGA 5DG5A 4R7BA 2J0LA 2JITA 2OF4A 4WNPA 3SVVA 3QU0A 1YXVA 4O2PA 4CMOA 2R7IA 3COKA 3G90X 1ZWSA 2WMSA 2FA2A 2IVSA 3KEXA 4J71A 4WG5A 3V6RA 3VS1A 4AT5A 1O6YA 4FTCA 1FGIA 2ZV7A 4EUTA 3GU5A 3KULB 5BX0A 2JKQA 4TXCA 3I5NA 3RPOA 3ULZA 5A6OA 2R4BA 2YACA 2Z02A 5FQDC 4UXLA 4XRJA 3V04A 4C7TA 1U54B 1H1SA 3ORMA 3SRVB 2GHMA 5JGAA 4L3LA 3FI2A 4HYHA 3K5UA 1Q41A 2QVSE 3BHTA 4FSQA 4OTGA 4RC2A 1XH4A 4AGUA 4D28A 1H28A 5AP7A 1Y6AA 1VEBA 1ZXEA 3BGQA 2YZLA 1TQPA 2IVTA 2VWIA 5L3AA 2A27A 2B9FA 2V7OA 3PRIA 4WG4A 2OW3A 5AUWA 3ZDUA 3FC1X 3HZTA 4MWIA 4RJ7A 1SNUA 4PP7A 2GQSA 4DH5A 4APPA 1WBSA 4CCUA 3UNJA 2PMLX 4LV5A 4RVKA 5JQ8A 4LUEA 4DEHA 3TJCA 1OKWA 5CVHA 2OIBA 2RG6A 5FP6A 1BKXA 1XMMA 4F99A 4QOXA 1MUOA 3EQGA 3FL4A 4IJPA 2O5KA 2UUEA 3T9TA 5IH5A 1FPUA 2X4ZA 3UDSA 5HBHA 1LEZA 5LXMA 3ZLSA 5ICPA 3EQBA 3E8EA 4X2JA 3OHTA 1GY3A 3CE3A 4YU2A 2ITVA 2ZM4A 4FL1A 4MD9E 2JBPA 3GI3A 1PXPA 3KMMA 1PMEA 4EH2A 1KE5A 3CJFA 3ZS5A 2WIPA 2VTJA 4KAOA 3JS2A 4NFMA 3CSVA 3C4ZA 3R83A 5EI2A 4D1SA 5AUTA 1ERKA 4BTMA 3MVJA 1AQ1A 3CP9A 4HVGA 1OPJA 4FTRA 5EDRA 1J91A 2JIUA 3BQRA 2R3PA 2HCKA 4IB0A 3R73A 2XK3A 1U5RA 1SVEA 2HZ0A 2BAJA 3QKLA 5J1WA 3O96A 2YHVA 4C36A 5L8KA 4FK3A 1V0OA 4HCUA 3F5PA 3LCTA 4OTWA 4YJOA 3LPBA 4RQVA 5M56A 2Z8CA 5I9XA 4AAAA 3ZRKA 5DR2A 3S00A 4QP8A 2YIRA 1W98A 3NR9A 4QTCA 1NA7A 3KGAA 4G3FA 2R7BA 3VUDA 1GNGA 3LCOA 2J0JA 4A9UA 4FT5A 2OKRA 3F3WA 4C38A 4TZRA 3IECA 4OTHA 3VF8A 3SA0A 1F5QA 1SM2A 2XKFA 3UZPA 4TYHA 2BTRA 3RHKA 4L67A 4XH6A 2XIXA 3BV3A 4Z9LA 1U5QA 5C8KA 2WMWA 4IAZA 3RP9A 3KY2A 4ENYA 1XH5A 3Q6UA 2IZTA 3W2RA 3WF5A 4ASEA 1M7QA 2XNGA 3DU8A 4R3PA 3VS6A 3V8WA 3L1SA 2PZPA 3E88A 3TV4A 4YJUA 3ANQA 5M4IA 3WOWA 4RLLA 3TCPA 1GIIA 4F08A 1MRUA 1OUYA 4O7YA 3H10A 3C4EA 4ASXA 4BTFA 2GQRA 4BIEA 4WA9A 3S0OA 4FL2A 4GFOA 4YGAA 1YI4A 2E9OA 4FNYA 5BVKA 4IVAA 4BZDA 2B54A 4Y46A 3PJCA 4E6AA 1Y57A 3QA0A 4R1VA 3FZPA 1YHVA 4U0IA 1Q3WA 4UZHA 4XNEA 2W4OA 3PXZA 5CX9A 4BCKA 4Q9ZA 3LMIA 3QBNA 3R63A 4RZVA 2XBJA 1P5EA 5FXSA 3TL8A 4DEIA 3QF9A 3HV6A 1Z5MA 2P55A 3QX2A 4FBXA 4RPVA 2J50A 4GUEA 4CFVA 3R1QA 4IX3A 3N4TA 5K3YA 4FSRA 4ZTNA 3CXWA 3KK9A 2ZM3A 3EN6A 5K5NA 3OF0A 5AP4A 3ORKA 5D10A 2GS6A 1PXMA 3MS9A 2I0HA 4FYNA 4O96A 2WB8A 4C4JA 3GOKA 4AOJA 3MY0A 3QAME 5CQWA 1UV5A 1DI9A 4FG7A 3LXPA 2PVJA 3RAHA 3FQHA 3HA8A 4FTUA 2GMXA 3RWQA 3P1AA 4YLLA 5D11A 3EYGA 2UVXA 4OLIA 3LJ0A 3SW4A 2W1DA 3POZA 3AQVA 5HG8A 2BZJA 3EFWA 4O0YA 4QP7A 4YZNA 3S2PA 4QYYA 4ZTLA 4GUBA 3VS2A 2XK9A 2AUHA 3V5QA 4E1ZA 2VNWA 4NH1A 4C35A 5M51A 4RWLA 4E5AX 3QA8A 1KE9A 3WZKA 4BCPA 3KIOC 3F5GA 5IA1A 4AGCA 5GNKA 2UW7A 1APME 2C0IA 2C1AA 4JAIA 3QZFA 1M7NA 4ZIMA 3UG1A 3T3UA 1WZYA 2VX3A 4G34A 5EYCA 3ALNA 4O2ZA 1H0WA 3EYHA 2PK9A 4IX4A 4FNZA 2VTSA 4MD8E 4ZMEA 4HZRA 1XBBA 3REPA 4LQMA 5KBRA 1QPCA 5HU3A 5B2LA 4NSTA 3MI9A 3TNIA 1URCA 3UQFA 4QMZA 5CS6A 3UIXA 4G17A 4P7EA 3O8UA 3ZO3A 2R0UA 1XO2B 2CLQA 3ETAA 3RPYA 4RWKA 3ZUUA 4FKTA 4G3DA 2G01A 4FEUA 2QHNA 2WZJA 3P7CA 2YCSA 4WUAA 5J95A 1YOMA 5I9VA 3G9LX 3QKKA 4Y85A 4YJNA 3FXZA 4OW8A 2C5VA 4V0GA 5CYIA 4LMNA 3I6UA 5DEYA 3Q4TA 4I20A 3UDZA 4XX9A 3UQGA 4X0MA 2YABA 4FZDB 4IMYA 1ZZLA 3DBCA 4AZEA 2Z60A 3LM5A 3FLNC 3OEFX 3QTWA 3EH9A 3NCZA 5EM8A 5L8LA 1FMKA 3A7IA 3PZHA 1EH4A 3Q5IA 5AUYA 3RK7A 5LVPA 4MNEA 5EDQA 4O0UA 4CQEA 1ZARA 1WBWA 2PY3A 4CSVA 1CMKE 4FKIA 3MPTA 4EHEA 3QCSA 2R2PA 5M09A 3DT1A 4MXAA 5TT7A 3TKUA 2VTQA 3C4FA 2DYLA 4KWPA 3BWJA 4A7CA 1Z9XA 3BU6A 4OBOA 4CZTA 3L9LA 3ZFXA 3S4QA 4EZ7A 3E8CA 1ZZ2A 4X6RA 3UNZA 2YM6A 1XJDA 3VBQA 2BZIB 5L2WA 2XYUA 4MTAA 5CZHA 3DXNA 1UWJA 4GT4A 2BVAA 3CTJA 4JJRA 3TTIA 2WU7A 4BDAA 3I79A 3S3IA 3ULIA 4ZS0A 2F9GA 5F94A 4AXFA 5LWNA 2QOKA 1G8JA 4WNMA 3AT3A 2P4IA 4F64A 5E92A 5HQ0A 4G5JA 2AEGA 4W8EA 3Q52A 3ZZWA 3SLSA 2A19B 2PUNA 4QTBA 3OWPA 5DGZA 4DH1A 4I6BA 5AAEA 3VUMA 5JZNA 3CQEA 2Y4IC 4V0GB 4BI0A 2YAAA 4QTDA 4BKJA 4Z7HA 3NCGA 3PJ2A 1VYZA 4FVQA 2Z7LA 3SAYA 1OKZA 3JY0A 2WQOA 4I5CA 5IEYA 2YWVA 3CR0A 1IRKA 3UVRA 1TQMA 3R22A 4EOMA 2F2CB 3C1XA 3WE8A 1OL2A 2VGOA 3IW8A 4MXOA 4X21A 3GFWA 4LL5A 1OBDA 4X3FC 3FLYA 3FZRA 4A07A 4EQCA 4FV1A 2X7FA 5J7HA 4CMTA 4BJJA 3AKLA 2PPQA 1XHAA 2NP8A 4PL5A 4S2ZA 4X2GA 5CF4A 4TYHB 5ETIA 1H1RA 2C68A 4FSWA 5IEVA 2G15A 3TJDA 5AWMA 1YVJA 3PDTA 3SX9A 3LXLA 3DFAA 3PE2A 4KIPA 3A62A 4UV0A 4TWNA 4XLVA 3VS0A 5HBJA 1YHSA 4IHPA 3COMA 2W1ZA 2ZV9A 3BYMA 3VW8A 1H08A 5L2TA 5CT0A 2PUIA 3FAAA 2VD5A 4FKVA 4JBOA 2WELA 3N4UA 4QMUA 5M55A 3V8TA 2CLXA 4H58A 4CV8A 2EXCX 3VUKA 5FXQA 3UZRA 4RMZA 5HI2A 4L01A 4FKLA 4EYJA 5IPJA 3UDTA 2HELA 4UY9A 4U97A 2UZVA 3KXHA 3R00A 4KRCA 1BYGA 4EJNA 5FTQA 4FT3A 3ZC5A 4TYJA 5H3QA 3KVWA 4BCNA 4XRLA 5IQHA 3ORXA 4EOKA 3F3ZA 4LRKA 5FGKA 4DLIA 5IA3A 1LUFA 5CVGA 4EOQA 1W8CA 3A4PA 4D0XA 3C7QA 4R1YA 3AMBA 3PRFA 2IN6A 2JDTA 4RJ3A 3JVSA 3F3TA 4DG3E 3V51A 1NVRA 4AGWA 5K4JA 1JOWB 3OEZA 5KBQA 3LHJA 2JEDA 5KMLA 3L9PA 5FTOA 4TKSA 3UMXA 3FPQA 3BYUA 4FKPA 1GOLA 1W82A 4JL9A 3FKOA 3MA3A 5HICA 3WF8A 3A7JA 4YTIA 4FTIA 1Q4LA 3QD0A 3PSCA 5LMAA 3G5DA 3VWAA 4ZLOA 4I6QA 4YTFA 3FI8A 2YM5A 3ALOA 4V01A 4H1JA 2J7TA 3TXOA 3FJQE 5ANEA 5JRQA 3UPZA 4FJVA 3WF7A 3U87A 1SYKA 5HBEA 2BCJA 3IONA 5EOBA 4QMWA 4AWIA 1XWSA 5CF5A 4KBKA 2X4FA 3CJGA 4D4RA 4U3YA 4G6LA 3I81A 1OGYA 1V0PA 1WBVA 4L7FA 3OS3A 4RVLA 2JDVA 4JQ7A 3GCQA 1R0EA 2BRHA 3VRZA 3IG7A 4S34A 4U41A 5C1QB 3ROYA 3MIAA 3UOLA 3FQEA 5E90A 3EQIA 5KNJA 1ZY4A 3FXWA 3N51A 3PWYA 2DWBA 2WTKB 3D14A 4AFJA 2QO9A 2YAKA 4RIYA 3E7OA 1E1VA 2JDOA 5DH3A 4FIFA 4HNFA 2QCSA 1I09A 5IQAA 3H0ZA 2F7XE 3L8XA 4JG6A 4P90A 4QP3A 2C3JA 2BIYA 4NU1A 3C4WA 3DKOA 1XKKA 4QMXA 2B53A 5HE3A 3R7VA 4D9UA 4F6UA 4PDPA 3U9CA 5J9ZA 2FSOX 4O0WA 5A4CA 4IB1A 4KBAA 1TFFA 2RFNA 3O0GA 4L8MA 4DG2E 5GJDA 4IVBA 4LOPA 3BYOA 5LOHA 3UO5A 1Q8ZA 2DQ7X 2P33A 4ZSAA 3QWJA 2X2LA 3BHUA 4J98A 4IM3A 1BL7A 5DR6A 2KTYA 3G15A 4RWIA 4QMNA 3R1NA 3D2KA 3OVVA 4F9CA 1OL5A 3KK8A 4UYAA 3NUPA 4AW5A 4PNIA 2XZSA 2IW6A 3PG3A 1PF8A 1U59A 2OSCA 4BGQA 3AOXA 5G6VA 2ZJWA 2XB7A 1H07A 2ITZA 4EK8A 1SVHA 3DAJA 3CLYA 2YCQA 3EN9A 4RFZA 4O91A 3W0NA 3PFQA 3A4OX 3KRLA 4PQNA 3AC2A 4O0XA 4QMVA 3W18A 4XV2A 2XBAA 3DXPA 3FDNA 4AFEA 4GYIA 4ACHA 4EL9A 4JBQA 5M4CA 3TM0A 2VX1A 3L8SA 2Y4IB 5E8SA 3C0IA 5FP5A 3R04A 3ORIA 3D0EA 3GUBA 4ZP5A 5EKOA 3R7YA 4XBRA 2NRYA 2W5HA 3UIBA 1Y8GA 1ZYDA 5E8XA 5EHYA 2R3LA 5IA0A 3KB7A 2WXVA 2BRNA 4HVSA 2YZAA 3D4QA 2RKUA 5IDPA 2R5TA 2HY81 3COIA 4O86A 1WAKA 3G0FA 1KE8A 4GG7A 2XKDA 4QMOA 4O0RA 4CTBA 3VIDA 2GHLA 1H27A 1KE6A 4QP6A 1PRYA 2QG5A 3AXWA 3H9FA 4QNAA 2CJMA 2ERKA 5DA3A 1LP4A 5HG9A 4D58A 3PE1A 4H3QA 2VAGA 2W5AA 3DB8A 2R3MA 2C5NA 2QLQA 2VTRA 4ITIA 2VWVA 4O6EA 5BVEA 3VW6A 3ZLXA 3HX4A 4G9RA 4JBPA 5CU3A 2IW8A 3LQ5A 2ITTA 3ORZA 1J1CA 4YMJA 5CSPA 4XV9A 4JQEA 4AZSA 2XCHA 3LJ2A 4XG6A 5BYLA 5A46A 3NLBA 3OUNB 3CPCA 2NNWB 3GNIB 2SRCA 4CT2A 4GJ3A 5CEIA 4DFUA 2FH9A 3P08A 4G3EA 4TYIA 3FWQA 4NW6A 3ZFYA 4L9IA 4TYGA 3UO6A 5AUZA 4HGTA 1RDQE 4MX9A 4ZK5A 5BUJA 2QNJA 4DDGA 5IU2A 4H39A 3QD3A 4QDVA 4U81A 4FZ7A 2ETMA 5EYMA 4I0TA 5AA8A 3TNHA 5JQ5A 5AEPA 1T45A 4AA4A 1B6CB 1Q97A 4FG8A</