4BJJB

Sfc1-sfc7 dimerization module
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
94
structure length
85
Chain Sequence
SLETDVENIVFQFQNSSLDFQSSDDFSILGIDQPHPIVRIGGMFFRGTWHQPIGTDIVVPSVNDGLVLCKRRLMLEQIRLVPKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR TAU SUBUNIT SFC1
publication title RNA Polymerase III-Specific General Transcription Factor Iiic Contains a Heterodimer Resembling Tfiif RAP30/RAP74.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 9
structure length 85
sequence length 94
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10419 TFIIIC_sub6 TFIIIC subunit triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.170 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bjjB00
4BJJB
chains in the Genus database with same CATH superfamily
4E73A 5EQEA 5HE2A 4AAYA 1BL7A 4I0SA 4IANA 4IWQA 2CCIA 1Q97A 2R9SA 3AC1A 3HYHA 2Q0NA 3NYVA 1A9UA 3V6SA 2CN8A 4AP7A 4FSQA 5EOLA 2WD1A 1Q24A 3S2PA 1DI8A 2V22A 4KAOA 2HY0A 4FIFA 4CRSA 3C13A 5JZNA 2QI8A 3IECA 5IPJA 3MY0A 3R8PA 3WARA 3GC9A 3ZRMA 4F4PA 3VBXA 1OL7A 5IQIA 3ZUTA 4FKTA 3R0TA 5E8VA 5J9YA 3TCPA 3GC0A 4LV8A 1Y8YA 2ZM4A 2QU6A 3BYMA 1VYZA 3VUDA 3B8RA 3OY3A 2NPQA 2XJ0A 4BDJA 4NJDA 4L46A 2C3JA 5TT7A 4F70A 5JT2A 3S0OA 4I41A 4IE9A 3QRUA 2CMWA 4FNWA 3ANQA 3KIOC 1IEPA 3G33A 4PRJA 3PXYA 4DITA 3M11A 5HG9A 3CCNA 3R7OA 4AXFA 4MH7A 4DH7A 4ZSLA 4AOTA 3SG9A 1PMVA 4JNWA 3OWPA 2PK9A 4IAYA 5AV4A 3G0FA 4HVDA 3D83A 4G3FA 2JIIA 3HP2A 4LMNA 4PF4A 3OCBA 4A9TA 1WBTA 5AAGA 4FSUA 2FSLX 3HNGA 4O0RA 1Y91A 5EI2A 4Y8DA 4DFLA 5IG1A 2ETKA 3ACJA 3EMGA 4XX9A 5GJFA 4FVPA 4CVAA 4CFXA 1JKLA 5K4JA 2QOIA 4BTFA 4CTCA 3NZ0A 3S00A 3KCFA 1ZARA 3OC1A 2OXXA 5ANJA 2OW3A 3RMFA 4KIPA 4TKSA 1Y6AA 3F88A 3P9JA 3UVPA 2B9JA 4UEUA 4NFNA 4WNMA 3D14A 3R9NA 4ERKA 4TYIA 4ARKA 4L68A 2XJ1A 3PIZA 4D5KA 4RQKA 4WD5A 3QTWA 1P4OA 2PZPA 2VWYA 1H27A 4L00A 3C7QA 1GY3A 4FUXA 5EHLA 4DG2E 3HA8A 4RVLA 2OGVA 3LE6A 5CANA 3C5IA 3NUAA 3ZBXA 5FM3A 5KBRA 3GU4A 3MH3A 3O5AA 2VTTA 4EYJA 2W9FB 2ESMA 3DQWA 5E1EA 3QTRA 4DBXA 3UOJA 3VVHA 2WMWA 4BBEA 3M1SA 5JRSA 3E7VA 2ACXA 4WKQA 4EH6A 5ITAA 3OXTA 5K5NA 4OTRA 4IC8A 4DE4A 1YDTE 2Y8OA 3R22A 4D1XA 3WE8A 3FKOA 3I81A 4AT4A 3PFYA 2OIQA 4EH8A 2J0MB 3HRFA 5M4FA 4UX9A 5H8EA 5C1QB 3CLYA 3DA6A 2XNOA 4DYMA 2CNVA 4FJVA 5JEBA 4YHJA 2YM5A 1WCCA 2F57A 4FOBA 1WVXA 1GZNA 4KIOA 3TG1A 5M51A 4JG7A 2IVSA 1H1RA 5AUWA 3BV3A 3IDCA 3II5A 4G9RA 1XKKA 2C4GA 2Y6MA 4Q5EA 4ZZNA 1Q99A 3ZSHA 4FKPA 2R3KA 4JJRA 4RX7A 5C8NA 5CU6A 3W2PA 5KZIA 4AAAA 3KXHA 4C37A 1H01A 3RAHA 3Q4CA 4NM0A 3HMOA 3O7LD 3M42A 3HUCA 3W55A 4C61A 3G9NA 4QMSA 4IHPA 4C0TA 4OR5A 4BDGA 3LQ5A 2GFCA 4I6LA 1Q8WA 4QTBA 4CLIA 3MB6A 3R28A 4H1JA 1H1SA 3V5WA 2W1FA 2WIPA 5CSPA 4RT7A 3R71A 4FTIA 2AC5A 4BDAA 4FKJA 2HENA 4JIAA 1FBNA 2PVNA 4IVAA 2XKFA 3LVPA 4OTHA 2BALA 5M4IA 3NAXA 5CAOA 5FXRA 1H25A 4NCTA 4UWCA 4IBMA 4A9RA 4AA4A 3PXKA 3WIGA 2UZVA 4OTIA 2XK9A 3R6XA 3ZSIA 4O0YA 5AP0A 2HZ0A 2NRYA 2IVVA 5E8ZA 2YWPA 4G31A 1S9IA 4GW8A 3UE4A 1IRKA 3NSZA 4EZ5A 3KXMA 5BMSA 4K9YA 5IH6A 3NRMA 4C4FA 1OL6A 4Z7HA 2E9NA 4D4YA 4K18A 3UOKA 4NU1A 2VUWA 3BHYA 4EEVA 1GZOA 1PJKA 2UW9A 2EU9A 3COHA 4YTHA 4CMUA 5JMSA 1BLXA 2OI4X 2P3GX 5FP6A 2F9GA 4NM5A 1PW2A 2PMOX 2G01A 3AC3A 2BDWA 3A7FA 4EORA 2E9UA 5G1XA 1M2RA 4J71A 3EQPA 5KKRB 5M08A 2HOGA 4JBPA 1DAWA 4WG5A 1W0XC 3CD8A 5AV2A 3W2OA 2C0TA 3ZXTA 3QFVA 2DQ7X 4W8DA 4V0GB 3W0QA 4CV8A 5CU3A 4F9BA 3POZA 2YAAA 4Z16A 5DR6A 5IMEA 4E6AA 3EN5A 3EN4A 5FM2A 1PYXA 3NFGB 3PXQA 1KSWA 2UW8A 3D5XA 3LXKA 4I5HA 4HCUA 2B9IA 5AWMA 3PJ1A 4DFZE 2R3QA 2RFSA 2IW6A 3EN7A 4GMYA 3ORKA 2VGPA 3I6UA 3PXRA 4ACGA 2O64A 3BGPA 5DN3A 4RIWA 3PVWA 4RIWB 4ZTQA 5I0BA 3EQRA 1VYWA 2W5BA 4MKCA 4JG6A 3QCYA 3R1NA 1JNKA 4FOCA 4FZ7A 4FTUA 3FL5A 4NH1A 3E92A 4TZRA 3DDPA 4QEBA 5IZFA 3BZ3A 4IVBA 5AP7A 4BDFA 3QLGA 3N4UA 4XHKB 3U6JA 2UZOA 4WNPA 4S2ZA 4Y5QA 5KO1A 2FVDA 2I0VA 2XK8A 3IO7A 2PMNX 4IIRA 4XBRA 2XKEA 4C36A 1M7QA 3IW6A 3CY2A 2BKKA 3KGAA 3HZTA 3ORZA 4FKQA 4JDHA 5FUTA 3TYKA 2R3NA 3C5UA 4ZSEA 3JR1A 3SW4A 5CEKA 4GV1A 4TTHB 5L2WA 3E87A 5T3QA 4YLJA 3C50A 5KZ0A 5LWNA 2ZMCA 3K5UA 3FSKA 1RJBA 3PE2A 4I6HA 3O0GA 4A07A 3MBLA 3HL7A 4DINA 3POOA 3Q4ZA 4UALA 5CEQA 1XH9A 2Z7SA 3H0ZA 3IPHA 5HZNA 1PXMA 4TWOA 2I0YA 5ANOA 3QZIA 3W0RA 3QZHA 4FT0A 5F4NA 3EJ1A 2WMAA 1Z9XA 4KBCA 4O7WA 3BLHA 4DGGA 1U46A 4DG0E 2JEDA 4IDVA 1QPJA 2O8YA 3QCXA 4ACMA 4O22A 2R4BA 4IJPA 4EOJA 3WOWA 4RVTA 2VO7A 2W5HA 4L44A 4C4HA 4HJOA 5LOHA 3ZXZA 2IO6A 3SHEA 2OO8X 5HNGA 4G6NA 4AFJA 5L8JA 3R8LA 4B9DA 3DKCA 4V05A 4YC6A 2GS7A 4F6UA 4IJ9A 2VTNA 4C38A 4Y46A 3P23A 5B7VA 4AW5A 2SRCA 4OTGA 2R3IA 2X0GA 3IW8A 5BVKA 3BEGA 2PPQA 3A7GA 3Q6UA 4NKSA 2JDSA 4E6CA 4Z55A 3ZEWA 2ONLC 5GJDA 4MXXA 1NVRA 4F0FA 5DA3A 2R7IA 1IG1A 5TOZA 2VTJA 3T8OA 4BBFA 1M17A 2JAMA 2PZYA 4RQVA 4YUQA 4KBKA 3QC4A 3LLTA 1MRUA 3LQ8A 5HGIA 4ZXTA 3EFLA 3EN6A 4LRJA 4MNFA 4QTCA 4BCJA 2PZIA 3SLSA 3V8WA 2I6LA 4QMLA 5EQYA 2WTKB 4O0XA 3BHTA 4QQCA 1IA8A 3VWAA 1QMZA 4FEXA 3GENA 3OW3A 3QYWA 2C68A 2WMVA 1RQQA 4FT5A 2CGVA 2XB7A 1IAHA 2P0CA 2JLDA 4EK8A 5JQ5A 3A7HA 3L8PA 5D10A 3CJGA 4TW9A 5HVJA 2IG7A 3DBDA 4K0YA 4RA5A 1WMKA 3KMUA 1MQBA 4FC0A 4MF1A 4X3JA 1X8BA 2YA9A 4GIHA 4M12A 3W33A 2H34A 4P5ZA 5AV3A 5CT7A 3ML1A 4H3PA 1FVTA 4DEAA 4DEGA 1ZOHA 4IQ6A 4U3YA 3QZGA 3A4OX 3L9MA 1H08A 3Q9YA 4CZTA 2YDKA 3CTQA 5E8WA 3QXPA 4P90A 3ALNA 1I44A 3TZ8A 3IDBA 3ITZA 1O6LA 2BZKB 2X4FA 3QXOA 4YJTA 3SQQA 2JKKA 3QRKA 3TV7A 3VNTA 2XK7A 2VTRA 1UA2A 5K9IA 3AC5A 5CALA 2CSNA 4O21A 3GU7A 1YXVA 4U3ZA 2OIBA 5HESA 3WZKA 2BTSA 4UXQA 3PSBA 5DR2A 4KIQA 2QOLA 2YDJA 4B6LA 4UXLA 5KNJA 3RK5A 2WQEA 2C6KA 2R3HA 3MESA 3EZRA 2YERA 2C6LA 4FSNA 1ZY4A 4FV2A 3VUKA 4ALVA 1PF8A 3VUIA 3UIXA 4GYGA 4M68A 2QLQA 1P2AA 3BU5A 3ORPA 3WF8A 4RLLA 3W0MA 4EHGA 3HGKA 2X9EA 5L6PA 4XUFA 3U9NA 3NIZA 4AZFA 4O7SA 3QRIA 3QCSA 2A4LA 3CJFA 4M8TA 4XG4A 3UOLA 5I9WA 3EL8A 4IAIA 2FUMA 3FLSA 3UDTA 4J52A 5H8BA 3CQWA 2WTCA 3D94A 4O86A 4L53A 1OUYA 3QD2B 3R8MA 2XNPA 2C5VA 3UIUA 5BUEA 1YRPA 3ORLA 2X39A 5CAVA 3ODYX 2VU3A 3ORTA 1YXSA 2PVMA 4USFA 4UY9A 3E3BX 4HZRA 3ZEPA 3I0QA 3D2IA 3U9CA 2YIYA 2OZOA 3QTIA 5DE2A 3TUDA 4HNFA 2G2HA 2YEXA 2JD5A 3VONA 4I4FA 1L3RE 2CN5A 3HVCA 2VWIA 3O8TA 5E91A 2WQBA 2XIKA 3P08A 2ZV8A 1LUFA 3ZCLA 3ZU7A 5LWMA 4G3CA 1PXLA 2HYYA 2Z7LA 3JY9A 4O7ZA 2BZJA 3IG7A 3L8VA 4PWNA 3ZFYA 4FBXA 1XO2B 4XS2A 4EL9A 3AGMA 4E4XA 1T46A 5CLPA 2XAOA 5KBQA 1SMHA 5FXQA 1M14A 4FG7A 4FKIA 3IQ7A 3NEWA 2P55A 3MJ2A 4PMTA 3D5WA 4QMNA 4H3QA 3T9TA 3EWHA 4QMXA 3UJGA 3NR9A 5E92A 3KN6A 2WOTA 3TWJA 5H3QA 4ALWA 2AC3A 3E62A 3DPKA 3IOKA 2AEGA 4DA5A 4R1YA 3WZUA 3ZC5A 2FSOX 3FKLA 4ZY6A 3ZUVA 2OZAA 4XP3A 3PRFA 2OZAB 5IA3A 5AUUA 1FVRA 3RHXA 3ZRLA 3MYGA 2X2KA 4CRLA 2BFXA 4L01A 3GGFA 3OT3A 1XJDA 4JBVA 5I9YA 2OJGA 3TIYA 1UV5A 3TXOA 5LJJA 3NPCA 4FKGA 3ZM9A 4YTCA 4L3PA 4M0YA 4XOZA 3OFMA 1M7NA 2C6IA 2J7TA 1YHVA 2XP2A 3F9NA 3Q04A 4DC2A 3F69A 3LFQA 4CFVA 4YNOA 2WQOA 3ORIA 4QOXA 3I7CA 4F9WA 3EB0A 4CQEA 4RZVA 4GJ2A 3R73A 4I0RA 4UZDA 4NK9A 4ZTHA 3VQHA 4AGCA 4FTAA 2VNYA 4IAFA 1W83A 2XNNA 4Y83A 4JX3A 2GFSA 3C4CA 2GNGA 4MWHA 4RFMA 4Y85A 5ETFA 3UQGA 5IISA 3QQFA 3VF8A 4QMVA 4DH8A 1CKPA 4GU6A 5E8YA 2JDVA 4QDVA 5HVYA 3RM7A 5ANIA 3P5KA 2VWXA 3ZBFA 4BGQA 4ZSJA 2PVHA 4YTFA 3EHAA 4AGWA 3P78A 2ERZE 2YISA 4IFGA 4PTEA 1GNGA 5F9EA 5D7AA 4NT4A 5TR6A 3WZDA 4AA0A 4AE6A 3D7ZA 4RPVA 4QTDA 2JKQA 1OIUA 3IKAA 3MPAA 2CLQA 4FIEA 4C4EA 2XF0A 3NVMB 3W0SA 4KKEA 1DAYA 4I93A 4QP7A 4UYAA 5AMNA 1UU9A 5CVHA 4AQCA 3Q6WA 1OBDA 4FKLA 4FVRA 4ZTRA 3VJOA 3NUPA 4XYFA 3ETAA 5AA8A 3BYVA 2GHGA 3P7BA 4ZTSA 1PXPA 3NUNA 2A19B 3LCTA 3R1YA 3O50A 4WT6A 2JDRA 4HCTA 4HYIA 4MWIA 3R21A 4NYEA 5FGKA 5CEOA 2JKOA 4JT3A 3F7ZA 3FEGA 4JOAA 4O82A 3BPRA 5K3YA 3TMOA 3VJNA 5HLPA 2E9VA 2VTAA 4EJNA 4J1RA 3NS9A 4N70A 4TNBA 4TNDA 5EW9A 3C4EA 3MW1A 4FI1A 5CEIA 2BAJA 3FMLA 4J53A 3REPA 4IC7A 4O0WA 2QOFA 5A4TA 2WMSA 3GCSA 2NNWB 3VBTA 2C5OA 2ZAZA 5ACBC 5ANDA 3VULA 4BI1A 1FINA 4DHJA 4LOOA 2W1HA 4FTJA 3D5VA 4QNAA 1YDRE 3CKXA 1PXJA 3Q5ZA 2CHLA 3LM5A 5HD7A 4NJ3A 3MH2A 4I24A 5IH4A 3SD0A 4ITIA 3SKCA 1TQIA 1W82A 2PVRA 4X3FC 5ACKA 3NW6A 3TN8A 4IAZA 2YFXA 4MXAA 4QDEA 5FP5A 2CGXA 2DWBA 4XP0A 1WFCA 4EQCA 4AE9A 3KEXA 4LRMA 3P5JC 4RGJA 2A27A 2X8DA 3AD4A 3Q9XA 3G6HA 4BIEA 5L6OA 4OTWA 3BHUA 4OBQA 4CLJA 2C3LA 4O0TA 4RVKA 2IJMA 4GFOA 5HBHA 3THBA 3WIKA 3COIA 5IF1A 1MP8A 4XCUA 4E5WA 3EFJA 1O9UA 2J50A 1XHAA 1SYKA 3GOPA 2QHMA 4AA5A 2XS0A 3UIMA 4FODA 5CXZA 4D2RA 2O3PA 1NVSA 3RNYA 5AUTA 3ZLSA 3R9DA 3PVGA 2XIXA 5CSVA 4CEGA 2WAJA 2QQ7A 3PXFA 3VBQA 5HLWA 1H28A 3RAIA 4XP2A 5J1VA 3BLQA 5FBNC 3U6HA 3FYJX 4EKLA 1YQJA 1ZYLA 2OKRA 4JDJA 1ZZLA 4IZ5A 3QYZA 4C58A 4WSYA 4O7TA 3DXQA 2QOOA 4YJRA 4JQEA 5A4CA 4O27B 1LP4A 3MVJA 5ANGA 3K5VA 2Q83A 3QHRA 4OUCA 2OSCA 4USDA 2GCDA 4R3PA 2YCFA 3AT3A 3C0GA 2VTQA 4C33A 4L45A 3KXNA 2BRGA 4AXAA 4GG7A 2Y4IB 1IASA 2VWWA 4IDTA 1BKXA 2Z02A 5CEMA 1SVGA 3PDTA 4HGTA 4YPSA 5IQGA 5JN2A 5J5SA 4C02A 5I4NA 3O8PA 2J90A 4H05A 4GRBA 5DGZA 4MX9A 2JGZA 4AGUA 3NX8A 5JGBA 3O8UA 1IR3A 1H1WA 2O5KA 2UVYA 3R8ZA 3C9WA 4QNYA 1XBCA 4DCAA 2PSQA 3QQUA 2VRXA 2GTMA 2GQGA 1Q62A 3F5UA 3RTPA 4YHFA 4J8MA 1WBWA 3QQKA 4QMYA 4C2WA 2XRWA 3CC6A 3A99A 3MSSA 3MY1A 4RBLA 4H39A 2YJSA 2VWBA 4R1VA 4FTCA 5A54A 2XYNA 1R0EA 5CVFA 4PV0A 4D4SA 2BIYA 4QMMA 4G34A 4I3ZA 2VTHA 1Z57A 4PTGA 5ICPA 1IAJA 5EFQA 2GMXA 2EXCX 2ITNA 4GEOA 3I4BA 4KBAA 4NTTA 4PY1A 5EM6A 4EK3A 5KMNA 3R9HA 3TZ9A 3B2TA 2Z60A 4U43A 5FBOA 2J6MA 5CEPA 3T9IA 3RM6A 2YIXA 4E93A 5I9XA 3DS6A 4ASEA 5CZHA 4B8LA 2VO6A 2J0LA 5ANKA 2LGCA 4GKIA 4P7EA 2YCRA 4F65A 4I6FA 2VD5A 3I0OA 1OECA 3LMGA 4PDOA 4XV3A 3CTHA 2UW5A 3HMIA 4FL3A 2HXLA 4YZCA 3VO3A 4F7SA 5BUJA 2VZ6A 1TVOA 2C6TA 1J7LA 3B8QA 4O7RA 2QO9A 5E7RA 4BDEA 4BCIA 2CPKE 3ZH8A 2XBJA 5BYZA 5L3AA 3GP0A 4BKJA 3L8XA 3R01A 3GU5A 4X2FA 2C30A 3EQGA 4F7NA 4PQNA 2XK3A 2V0DA 2ZJWA 2YM3A 1AD5A 3TTJA 4ZLZA 2OIDA 1SVHA 4QQTA 3DU8A 1VLRA 2XNEA 3VS7A 3PSCA 3FZPA 3CY3A 3KMWA 2IVUA 4HOKA 4UV0A 3RINA 2WTJA 4ITHA 1M2PA 4NTSA 4EOSA 5LXMA 3BLAA 3UC4A 4HGLA 4XV9A 2JITA 5HCYA 4RWJA 2G2IA 4L7SA 2DYLA 3DJ5A 2QO7A 4TWCA 4FZFB 4MXOA 4ANSA 3MJ1A 3FMJA 1KUTA 3PVBA 4FZAB 4GG5A 1Q8ZA 3RPVA 3RPRA 1OL2A 4DEIA 4EYMA 2QC6A 4AW0A 4AS0A 1F5QA 1PMNA 4IX5A 4YJVA 3C51A 3E7OA 4ZIMA 3UDBA 3CQEA 2QOQA 2W5AA 3LKMA 4QYFA 4YJUA 4D1ZA 4F09A 5M06A 2HW6A 2BZHB 3FXWA 2CKQA 2BDFA 3HDNA 2QURA 4TRLA 3O71A 4KSQA 4CFMA 4FIGA 2QKWB 4YNEA 4C4GA 1JKKA 1JWHA 3RWQA 2UUEA 4E5BA 3DK6A 1MRVA 3NMUF 3MS9A 5FLFA 2QCSA 2ZM3A 4QYGA 2WTDA 4R3RA 3ZLYA 4D4VA 2GNLA 4MXYA 5CNOA 1TFFA 1WBVA 2W4JA 5ETIA 5BVNA 3UVRA 3AD6A 4I94A 4QMQA 2VTOA 4ZSGA 2XNGA 3EQHA 5G6VA 2ZM1A 4NZWB 4RIXA 3AXWA 3DXPA 4RIXB 2C47A 2XM9A 4ZP5A 1I09A 2KULA 1R0PA 4E20A 5HU9A 4AN2A 2VO0A 3TM0A 1OKZA 4QMPA 3O2MA 1YKRA 3LJ1A 3MVHA 1G8KA 5HORA 3Q96A 2X6DA 3LMHA 5IEVA 3PJ8A 4K77A 2CGUA 3QWJA 3CSVA 4XV2A 4U8ZA 4ZS4A 3BELA 5KHXA 3U55A 5CU0A 5LQFA 4GCJA 4ANQA 4BVUA 1GIHA 2ETMA 1VJYA 3OS3A 1P14A 3WZEA 2UZTA 3UODA 2PWLA 4IZAA 3PFQA 4CG9A 5AV0A 5AADA 5IMXA 3AC8A 4ZEGA 3H3CA 3LW0A 2YCSA 3ORNA 3TL8A 4AFEA 4DGLC 5ANEA 5AM6A 1XH7A 3QU0A 3AMAA 1XQZA 3AKKA 4GSBA 1G3NA 5JKGA 4F9YA 2J2IB 2W06A 1XH4A 4GU9A 4D1SA 4IEBA 3MVLA 4A9YA 2YN8A 1J1BA 3CTJA 4FNYA 4HPTE 4EQUA 4W8EA 4GK3A 2XA4A 2IPXA 1YWNA 2QLUA 2ITOA 3FQSA 3PP1A 5C9CA 4EH4A 4FMQA 3H4JA 3OHTA 4I4EA 4NM3A 3NLBA 1FGIA 3E5AA 3H30A 1ZYDA 5LCKA 4BC6A 4BDHA 4FR4A 4TN6A 4QP6A 4F1TA 1YOJA 1UNGA 5KMJA 3TEIA 3PJCA 2PTKA 1XWSA 5EYKA 2YIQA 3ODZX 4PTCA 3SV0A 2VTMA 4EH9A 4G6OA 3LCKA 3ENMA 1YXTA 4AXDA 4O7LA 1KE5A 3F2RA 4IAAA 3WYYA 2REIA 4M13A 5BVDA 5I9ZA 5IH5A 3UQFA 3U8WA 4D58A 4CKRA 3VIDA 1XMMA 4Z9LA 4PNIA 1QPDA 5JRQA 4O7VA 2E2BA 4EI4A 2FSTX 2J4ZA 3MA3A 4X6RA 3GOKA 1Q5KA 3TV6A 3P7CA 2ZV2A 3V5JA 4DEEA 5JFVA 4F78A 1OKVA 4PL5A 2RGPA 2F7XE 3A60A 4U97A 5HBEA 1TKIA 3FSFA 1OIYA 1YVJA 1XH6A 4ASXA 5HG8A 3WE4A 3ANRA 4QTAA 2C1BA 2IW8A 1U4DA 4GYIA 3HAVA 3GC7A 2PVJA 2QOBA 3O96A 3PPZA 3E3PA 3PY0A 4HYSA 4OTQA 3DOGA 3K3JA 4YPDA 5H2UA 3WZJA 4IH8A 2WTWA 4APCA 1KE7A 3KN5A 4DLJA 2C0OA 5KE0A 3C0HA 3F7WA 3ZO4A 2XIZA 3LMIA 5TF9A 5CWZA 3VW8A 4BCHA 5LMKA 3BKBA 5JFSA 3BRBA 1WBSA 1URWA 4U7ZA 3SVVA 1OKYA 3UO6A 4YP8A 3RALA 5IUHA 3HMNA 3UGCA 4CMTA 5LMAA 3TKIA 4JAIA 5F95A 2FO0A 2ZDUA 3FYKX 5HE1A 4ZY4A 3UYTA 4WNKA 3NDMA 4LMUA 4OT6A 4G2FA 2C6EA 5AUXA 2JBOA 1ZYCA 4LL5A 3TNQB 4ZZMA 4MBIA 4LOPA 2JC6A 3QBNA 4IZ7A 2GQRA 5BNJA 5HVKA 3GI3A 5T68A 5BPYA 4R5YA 3V5TA 3QQJA 3PZEA 2WB8A 4GH2A 3FMEA 4FKWA 4R7HA 4XH6A 3RNIA 3C0IA 2H9VA 4D9TA 1ZWSA 2C69A 1GZKA 2UZNA 4P4CA 5A46A 5KMKA 5L8KA 2UW4A 2RFEA 4BDIA 2VWUA 3FQHA 3WF7A 1J91A 3AMBA 1ZOEA 2IZSA 3NUYA 2FSMX 2E9PA 3EQBA 3F5GA 4BHNA 3WF5A 4K1BA 4E4LA 1V0PA 5KMOA 3AKLA 3FZOA 3VS4A 5HEZA 3BV2A 5FDPA 2OJFE 2YACA 3ZUUA 5E9EA 1ZXEA 2UVXA 3QQLA 1ZYSA 1K9AA 4IX3A 1OITA 2ZMDA 3E64A 4YJQA 3VS5A 3VS6A 2B1PA 2E9OA 2V55A 2X1NA 3KU2A 1W84A 3OOGA 3QX4A 2GPHA 5HCXA 1MQ4A 5CENA 3D9VA 1STCE 4IWPA 3VBYA 5CI7A 4C34A 5IA5A 5LVNA 4DH3A 2QG5A 4S34A 5LVPA 4RA4A 4W4VA 3DY7A 4FE2A 3K3IA 3MY5A 4JDIA 3LJ2A 4BCQA 3QRTA 4FK3A 3PP0A 4MEDA 2XCHA 2PUPA 2UVZA 3NGAA 4ALUA 2CGWA 5BYLA 2BDJA 3RVGA 4C59A 4D9UA 4CT1A 2ZDTA 4I20A 4EHVA 4P2KA 4HW7A 3AG9A 1JSUA 4JL9A 3OOMA 3FLYA 4FVQA 4RIYA 4RIYB 4E26A 2F4JA 5EW3A 4AXEA 3S1HA 3BWJA 5EI8A 2ITZA 1UU7A 3DZQA 3A8XA 2W1CA 3PWDA 3V6RA 4CG8A 3OEZA 2HZNA 1OGYA 3R2BA 3DJ7A 2R3MA 4DT8A 1FOTA 4B7TA 3A62A 1V0OA 5K4IA 3O7LB 1R78A 3LLAA 1UKIA 2C6OA 4YJOA 4OTFA 2YM7A 4EK5A 2C3IB 3DAJA 2PU8A 4GL9A 3IW4A 3W10A 3VN9A 4ZLOA 3Q53A 3QD4A 3I79A 2PULA 5I9VA 1GIIA 3UO4A 4EOQA 4X2KA 1P5EA 2GSFA 4I22A 3FI3A 3TUBA 1CSNA 1YI3A 3L9NA 3CR0A 2OXYA 3U6IA 3ACKA 3H10A 1H0WA 2RFNA 3UOHA 5D7VA 1FPUA 1OUKA 4FSMA 1NXKA 4AWIA 1L8TA 4QMZA 4KSPA 2ZFYA 3SC1A 4C62A 1M2QA 3FI2A 4MNEA 4MNEB 3QA0A 3NFFB 3CEKA 3A8WA 4RIOA 4F9AA 3C4FA 5FQDC 2VWVA 4CNHA 1A48A 1O6YA 3G9LX 1HCLA 3DBCA 4IVDA 4Q2AA 2JDOA 5F20A 3UVQA 4DTBA 2C5NA 3IGOA 1FMOE 2B52A 3LCOA 3Q9ZA 4LM5A 4S31A 4R5SA 4GIIA 4TPTA 4X7QA 2W7XA 3ID6C 3DBEA 4YTIA 4EH3A 2WZJA 3F3TA 5EDPA 4E5AX 1J1CA 3KF4A 3ZO1A 1GOLA 1T45A 3UZTA 3IK3A 2WQMA 1PXNA 4BCPA 5AUZA 4N6YA 3UG2A 4NM7A 2OG8A 3NNVA 5HO8A 3SXFA 3VC4A 4XG6A 4CT2A 4ZTLA 2Z7RA 4TYJA 2WTVA 4AF3A 5DH3A 3DAKA 3HKOA 3PPKA 4EH2A 1REKA 2PMIA 2GQSA 3A7JA 1PMEA 2EB2A 4UB7A 3EQDA 3Q2JA 5HNIX 4JS8A 4X6QC 3OD6X 4KKHA 5CXHA 1J7UA 4LV7A 2A1AB 4I0TA 4ACCA 4E6QA 2I0HA 3DNEA 1CKJA 4L6QA 3ZLXA 1Q61A 3ROCA 2HWOA 1URCA 1SNXA 1B39A 5CF4A 3BE2A 4YJNA 5HG7A 3W2RA 2Z7QA 4WBBB 2QVSE 3E8EA 4F7LA 3D15A 2VX3A 3DK7A 5GHVA 3EN9A 3MN3A 3PY3A 3QGYA 4WG4A 1UU3A 2UV2A 2WFYA 3W0NA 4XG7A 3H9OA 3UDZA 1ZMVA 4N0SA 4L3LA 3ZDIA 4GK4A 4BB4A 2I1MA 1G8SA 4NW6A 3ZZEA 3TJCA 2WO6A 4RJ7A 2J0IA 3MFTA 4FUYA 4O83A 3SDJA 1PXOA 3F2NA 2VV9A 2PZ5A 4GVJA 5D41A 3I1AA 3GCVA 5BVFA 2J5FA 3RPOA 3QF9A 5CASA 3OCTA 3ZHPC 2WHBA 3PUPA 2IZUA 2HCKA 5CI6A 3G15A 2Z2WA 4C3FA 4EK4A 3BLRA 3FC1X 3D7TA 3D7TB 1E9HA 4FZ6A 4CXAA 2R0IA 1BMKA 2WIHA 2X8IA 2XH5A 4XG8A 3TJDA 4D28A 5CAUA 1CDKA 5AIKA 4BGGA 2GS6A 2Y6OA 3DTWA 4JBQA 1BI7A 4PDPA 4HNIA 3V8TA 5FDXA 4O0UA 4Y95A 5A4EA 3JYAA 3MPMA 3RCDA 5BQ0A 4WRGA 1ZZ2A 1H1PA 4FSWA 4IB3A 3MB7A 2BRNA 3OWKA 4BF2A 4CCBA 3KRRA 3DK3A 3I60A 3UIBA 3VS1A 3GBZA 3V01A 4ZMEA 4NFMA 4KA3A 4GK2A 3U87A 5CAPA 5CY3A 3FWQA 4LG4A 2O65A 3QQGA 4A4OA 2XNMA 4MXZA 2GU8A 2RFDA 3CKWA 3BQCA 5FRIA 3EQCA 3CBLA 3PWYA 4LDTA 4B8MA 4EH5A 4M97A 4FTMA 5BVOA 4BZOA 3GXLA 5JGDA 3TZ7A 4YURA 1U59A 3ZO2A 2PVLA 2C5XA 1ZYJA 3HP5A 3HUBA 4HVHA 5HD4A 2VTPA 3FMDA 1Y57A 4P5QA 4AT5A 3AT4A 5BUIA 1PXIA 2YWVA 4FEQA 4XMOA 1ZMUA 5LVMA 3TIZA 4F6SA 3PSDA 1BUHA 1S9JA 5FEDA 1A06A 3ULZA 2HZIA 2BRBA 2W4OA 5CU4A 3R30A 2IW9A 3DAEA 4FKSA 4B4LA 5B2MA 5EK7A 4C35A 4DTKA 3CS9A 3LFNA 1CKIA 3NUUA 3GB2A 2JIVA 4C7TA 4NW5A 4N57A 3SGCA 4RX9A 1OL1A 3C4ZA 1CMKE 3F66A 4MCVA 2XZSA 3PG3A 5DT0A 5C27A 5IEYA 4IB1A 2UW6A 4U81A 3V5QA 4F99A 4FV1A 4RFZA 4RSSA 4DG3E 2Y9QA 4DFUA 2ITPA 1K3AA 3BBWA 3IOPA 2B7AA 2GTNA 3BX5A 2CNUA 3HV5A 3ULIA 1LPUA 3TDWA 2XEYA 4XLIA 3KA0A 5DI1A 4CKIA 5AP3A 1GZ8A 3DKFA 1W8CA 4R77A 3OT8A 4PDSA 4ZTNA 4AW1A 4U5JA 3ERKA 1E1VA 1K2PA 4F0GA 2H6DA 3DB6A 5AX3A 1R3CA 4WHZA 4G1WA 5IQHA 1JSTA 4ZK5A 5GIOE 4O0SA 4AGDA 1W98A 1O6KA 4U6RA 4U41A 4E1ZA 2WEIA 5M4UA 4EOIA 3OWLA 3U4UA 4MK0A 3UG1A 5DHJA 4PUZA 4BTKA 3CPBA 2QR8A 3HX4A 4GS6A 4IM2A 4L3JA 4ONAA 4UZHA 1G8AA 3EZVA 4KRDA 5EI6A 3PZHA 4EC9A 4H36A 2ZB0A 3NNWA 4BCOA 1JPAA 3W0OA 4BIBA 4DT9A 4K33A 5FTOA 2VX0A 3ORMA 3G5DA 4FIHA 3NWWA 4RJ5A 1Q8TA 4BY9E 4ZAUA 4HPUE 2R64A 5FD2A 1R1WA 3RAWA 4A4LA 2QOCA 3AC4A 5BVEA 1PHKA 1XBAA 2XUUA 4GT4A 4M0ZA 5KCVA 5DOSA 3LQ3A 5AUYA 4LRKA 4GUEA 4QP3A 4JIKA 1KOBA 2OLCA 4IFCA 4ZY5A 5LVOA 2NO3A 2XANA 3R63A 3G6GA 5HIEA 2ONLA 5CSWA 4G16A 3KRJA 4BCNA 1FGKA 5BYYA 3F5XA 4I1ZA 5DR9A 1P4FA 3PTGA 1LEWA 5M55A 4ASDA 5A14A 3QUDA 4BRXA 3ZRKA 5EKOA 2IN6A 3OZ6A 4OGRA 4BCGA 4K6ZA 3UP7A 2XK4A 4JBOA 4YZMA 2Z8CA 1FVVA 1WBOA 4QP1A 3KXZA 3DQXA 4FTNA 4UWBA 1LEZA 4NCTC 3W8QA 4A4XA 5M57A 2C6DA 2BKZA 2C3KA 4EUTA 1QL6A 4YMJA 5FEEA 3OY1A 2YM8A 4QT1A 5LVLA 4BBMA 3R2YA 4Q9SA 4ZLYA 2P2HA 3RK7A 1ERKA 2YZAA 5L6WL 5J8IA 3VBVA 3W2QA 3I5NA 4X2GA 5C4KA 4OT5A 5I5ZA 4DEHA 1E1XA 2IZTA 2UW0A 4RG0A 2X7FA 3GCPA 4E4NA 4MHAA 4X0MA 3H0YA 3SX9A 2ITVA 5IA4A 4DGMA 3MGYA 4C4JA 3Q4UA 2QR7A 5EH0A 3CD3A 1M52A 5HLNA 4AG8A 4AZTA 1YXXA 2W17A 3DB8A 4XG9A 4PMPA 2HIWA 1YDSE 3KC3A 5IEXA 5AA9A 1NA7A 5KKRC 4LUDA 4EK6A 3HECA 3K54A 5DFPA 3SW7A 4BI0A 3F5PA 4FV4A 3FLZA 1YOLA 3FZTA 1WBNA 4E6DA 4MXCA 4D0WA 3QTUA 2OF4A 3KREA 4FNXA 2EVAA 3OROA 4ENYA 3QD3A 4D4RA 2QO2A 4PMSA 2JFMA 3BI6A 4FKUA 5DPVA 4G3EA 5DT4A 3MFUA 5JSMA 2QOHA 3E8NA 4PDYA 5CTPA 4FT9A 3PLAE 5C26A 1KV1A 4GT5A 2G9XA 3AKJA 3CGFA 4MUQA 2WMBA 3BU3A 2OK1A 3NW5A 1RE8A 1Q3DA 5DEYA 4HVSA 3VS0A 4WIHA 1U54A 2OH4A 2OICA 1U54B 4RRVA 3CGOA 3COKA 4JR7A 3N9XA 4DAWA 2BPMA 2B0QA 3LAUA 4FSTA 4I5PA 4JLCA 4IADA 4U42A 4PP9A 2PUNA 4TXCA 2FH9A 2W99B 4EHZA 2RF9A 5A6NA 4RJ8A 5B2LA 2QNJA 1DM2A 5CAQA 3R8VA 4EOLA 4Y5HA 4FIJA 4WUNA 4ACDA 4TL0A 3FMNA 1LR4A 2OBJA 5C4LA 1SVEA 3UQCA 4W4XA 3UNKA 5EHOA 2UW7A 3DZOA 4QP9A 4EWQA 3EYHA 2OJ9A 4YLKA 4OBPA 3EFWA 3PA3A 3CE3A 5CQWA 3NCGA 2I40A 4XLVA 2WMTA 3UPZA 3FZSA 3PLSA 4EZ3A 4LQMA 3OCGA 1PKGA 1XR1A 4ASZA 4MD7E 1ZLTA 4DDGA 4O84A 4WOVA 1H24A 4FSYA 2UZUE 3FI8A 5TKDA 4G5PA 4WA9A 1Y8GA 2CKOA 2BHHA 3F3ZA 5AP5A 5E8TA 4AOJA 5DT3A 3U4WA 3OBJA 4RX8A 3A7IA 1Q3WA 4M7IA 3HAMA 2W1GA 2GNHA 1OKWA 2RKUA 1EH4A 3ET7A 4F08A 3FJQE 3PRIA 3Q5IA 4F63A 5JFWA 2HK5A 3FL4A 1YWVA 4A7CA 3Q2MA 1H07A 4HGEA 3VF9A 5IA1A 4XG3A 4CD0A 5JK3A 4JMQA 3I5ZA 2YIRA 2PE1A 4UWYA 4YZDA 2R3OA 3NIEA 3FDNA 1BX6A 4TT7A 5AAEA 4AACA 2R5TA 4AZSA 4IWDA 4G3DA 4M84A 3QHWA 3UNJA 3LFEA 3NUSA 4MD9E 4G3GA 1G5SA 3DBFA 1YOMA 2R3JA 3F3WA 3QZFA 1GIJA 3SOCA 4U80A 4APPA 5HNBA 3P0MA 1SNUA 2R3FA 3BHHA 4FV8A 3R9RA 4AW2A 4MBJA 3FV8A 5LMBA 2QKRA 4L67A 3S3IA 3ZYAA 4ANLA 5LCJA 3AGLA 4TWNA 4IZYA 4LL0A 3LFAA 2ZV7A 5J1WA 1UU8A 5FG8A 4XOYA 4O6EA 2WGJA 3TNPC 4BYIA 4RVMA 1UWHA 3RZBA 4DHFA 5EKNA 5IUGA 2WTKC 2OWBA 3OCSA 3T3VA 5IQEA 4QMTA 5BV3A 3ZM4A 3VW6A 2GNJA 2YCQA 1MRYA 2YHVA 2PMLX 2XIRA 2PY3A 4QYYA 2UZLA 3KK9A 4O38A 2YAKA 2HXQA 2OU7A 3HV6A 3ZDUA 4HZSA 2WMXA 3OG7A 4I21A 5H8GA 4X21A 5HI2A 3ZOSA 1WVYA 2VWZA 3FMMA 4R7BA 4JAJA 4J7BA 3IW5A 4I23A 4QPSA 3ZMMA 5CF5A 1BI8A 4ID7A 2W1ZA 3E8CA 3LCDA 4EOPA 3R7UA 4EWHA 2VN9A 3PVUA 3MFSA 2W4KA 2QOKA 4MD8E 4M3QA 4U44A 2ETRA 5IQBA 4CV9A 3E8DA 3WF6A 1YI4A 3FXXA 1OBGA 4J96A 3R1SA 2BVAA 3KL8A 4GUBA 2R3PA 4H3BA 4DFYA 5HO7A 4AOIA 3EIDA 5BMMA 2RG5A 2C6MA 3DT1A 3DNDA 1ZAOA 2KTYA 3HMPA 4ZMFA 2GDOA 4YSMA 4TYHA 2OFUA 4TYHB 2YDIA 3BYUA 3FHIA 2WKMA 2O2UA 3DV3A 4FYOA 3W18A 4KWPA 4YC3A 1B6CB 1PYEA 2ZYBA 4PL4A 3QTQA 4EBWA 3QLFA 2GHMA 4RJ4A 2R3RA 3LOKA 5CZIA 5KMMA 4FGRA 4FEUA 3AD5A 4I5CA 1JOWB 2J5EA 4LUEA 4F1OA 3KB7A 2IVTA 1SM2A 1Q8YA 2XKCA 3SRVA 3SRVB 4AN3A 4BDCA 4CKJA 4KKGA 4ZJIA 3QUEA 1YHWA 4R6VA 2HW7A 3QKKA 2BILB 5TO8A 3UDSA 4FA2A 5HHWA 2BAKA 3Q4TA 3Q9WA 2YM6A 3MH0A 3EYGA 4BDKA 3OWJA 3QALE 4FIIA 3WBLA 4EUUA 4FTLA 4Y72A 3RKBA 5FTGA 2W96B 2XRUA 4QPAA 4FV7A 5HBJA 1Q4LA 4ACHA 4QRCA 4BCFA 2NYAA 4O2ZA 4WG3A 4YHTA 5CF8A 3D2KA 1F0QA 4JG8A 2QD9A 2QHNA 2XEZA 3GQLA 4IX6A 4YZBA 3G51A 4MYGA 5L2SA 4X3FA 1GAGA 4X3FB 1U5RA 3AC2A 1VZOA 4AXCA 4OBOA 4A06A 4DN5A 5GIPE 5AP4A 4BICA 1Q8UA 4M67A 3SXRA 3OUKA 4PX6A 5CVGA 4YR8A 4BTMA 2BR1A 3L9LA 3PPJA 5DVRA 5IQFA 2CKEA 4UBAA 5IQCA 3BHVA 4RC2A 1GJOA 4ANMA 1ST0A 3R9OA 4JXFA 3NVKI 4BCMA 4KNBA 1UWJA 5D1JA 3BL7A 3C4WA 4KS7A 4F1MA 4FKVA 1OB3A 2R7BA 4BYJA 4AT3A 4EHEA 4FL1A 4QQ5A 2IWIA 1KV2A 4NUSA 2R2PA 2BCJA 2X2MA 4EZ7A 4S30A 3FLNC 3VS2A 1WVWA 3GU8A 3OBGA 4G5JA 1OZ1A 3MFRA 3IDPA 5ETCA 4YZ9A 2F7EE 1JKTA 4ORKA 1UKHA 4DFNA 2PYWA 3RAKA 2W9ZB 3GQIA 5KMIA 1QPEA 2BAQA 2BZIB 4IW0A 3ELJA 1FQ1B 4RWIA 2EWAA 4JDKA 3R83A 4XJ0A 5CNNA 4FZDB 4V0GA 5J9ZA 2VTIA 2AYPA 3FE3A 1SZMA 2RL5A 2UZDA 5DIAA 5FTQA 1TQMA 4DHIB 4DTAA 5HG5A 3VQUA 4FG9A 1J3HA 3QKLA 2PVKA 5IU2A 2QONA 2Y7JA 5EYDA 5CQUA 5LARA 4S33A 4RMZA 3RI1A 4FKRA 1PRYA 5D12A 4KS8A 2WXVA 5DYJA 3T3UA 3TV4A 3VRYA 3WI6A 4ENXA 3TKUA 4D5HA 3BL9A 2GS2A 3DKOA 5AP2A 3V8SA 3L1SA 2ITTA 4TWPA 4ZOGA 4YO4A 4NKAA 2V62A 3SOAA 4IM0A 5EYCA 2XJ2A 4W4WA 5HKMA 3GVUA 3TI1A 3GFEA 3EQFA 3UMWA 1KE9A 2VTSA 4FV9A 4U45A 3KXGA 1ZOGA 4NIFB 5M44A 4O2PA 3TUCA 1V1KA 3CP9A 4EH7A 5DLSA 4YGAA 3C1XA 1UNHA 2PVFA 3OW4A 3F6XA 3IS5A 4R7IA 4DFXE 5IDPA 4XG2A 4FEWA 3UP2A 4I5MA 2G2FA 4HVGA 1UVRA 3QCQA 3S4QA 4C2VA 5D11A 3CPCA 4RC4A 2F2CB 4ZTMA 1XH5A 3DJ6A 3M2WA 3MH1A 4EC8A 3BGQA 4CFNA 2XARA 5AJQA 3TZMA 4WBOA 3UZPA 3TNWA 2V5QA 4MVFA 3RWPA 2FB8A 2ZB1A 3FBVA 4QP2A 4S32A 4JQ8A 2CJMA 5FXSA 2B54A 2W1IA 3BWFA 3TACA 3FY0A 3KVWA 4CMOA 1WZYA 3BYSA 3MI9A 4IX4A 3O23A 4IB0A 4USEA 2P2IA 3ATTA 5IA0A 4DBNA 5IQDA 2W05A 4W4YA 3RJCA 1DI9A 5CX9A 4YJSA 3ZC6A 3GFWA 4DH5A 4EOKA 3HV4A 2J0JA 1REJA 5L2TA 2W1DA 1NT2A 5A9UA 3A2CA 3TKHA 3NNUA 3P7AA 1DS5A 3OMVA 3I7BA 5JZJA 4O96A 2YABA 3UPXA 5IDNA 2XKDA 3HEGA 4HVIA 3GNIB 2XMYA 3F2AA 4YC8A 5ETAA 4CZUA 5A4LA 2X7OA 5M09A 4O81A 4OW8A 3TT0A 3HDMA 4QQJA 3R7IA 2YM4A 3D4QA 2W1EA 1CM8A 3NAYA 5EDRA 1JAMA 3JUHA 5T6KA 4ZJVA 3QGWA 5HQ0A 4RFYA 4RLKA 4TYEA 3TNHA 4RX5A 2UW3A 5CYIA 2WELA 1ZMWA 3OF0A 3KF7A 1H00A 2NRUA 2GNIA 3DGKA 4EOOA 3Q60A 3GEQA 3NW7A 4X2JA 3JVSA 3V04A 2DS1A 2JIUA 5J7HA 4J97A 4WO5A 1ND4A 3W1FA 2WPAA 3K2LA 4KUJA 4GKHA 2Y4PA 3SXSA 2W0JA 2NP8A 4QMWA 4L8MA 5AX9A 5HE3A 3DBQA 4CTBA 5HCZA 4QMOA 2H8HA 3WF9A 4EOMA 4EQMA 3BBTB 4FX3A 5FEQA 3OVVA 2XCKA 2OH0E 4BDDA 4Z3VA 2ITXA 3LXPA 3Q52A 5EDQA 2BRMA 4EKKA 5CF6A 3F82A 3HLLA 4M15A 2B4SB 3PYYA 4OTDA 5L8LA 4RC3A 4LGHA 4QMUA 5AM7A 3AT2A 3RK9A 4U9AA 3QWKA 3R7EA 2PZRA 3GCQA 3LJ0A 4MQ2A 3NYOA 3ZSGA 1OM1A 4AN9A 4AZWA 4U40A 2BUJA 4B0GA 1H1QA 1OVEA 3LIJA 4MQ1A 3MIAA 4UYNA 3UBDA 2F7ZE 2PE0A 4J99A 1UNLA 4WUAA 4A9SA 3TNIA 4YO6A 1AQ1A 4KB8A 3KK8A 4G6LA 4O0VA 5M07A 2ITUA 2ZVAA 5C03A 4F0IA 3KULA 4NL0A 3KULB 4OLIA 4QYEA 3PE1A 3F3VA 3CXWA 4R78A 3R1QA 3ORXA 1R39A 4YU2A 1WBPA 1RW8A 3EQIA 1H8FA 3QAME 4FTRA 4N6ZA 3V51A 5J9LA 2EB3A 3FPQA 3QUPA 4D0XA 3ZLWA 2O63A 5J87A 5GNKA 3MWUA 2VO3A 3MTFA 5M56A 4DGOA 2RG6A 5DWRA 4E4MA 4ZJJA 1CTPE 1QPCA 1YWRA 2HZ4A 2WMQA 2ERKA 3PJ2A 2J51A 5IA2A 5EYMA 5DEWA 4BGHA 5C8KA 1Z5MA 2EXMA 3ATSA 4J98A 2QG7A 3BGZA 2Y4IC 3L8SA 3EOCA 4M14A 1ATPE 2AUHA 2JFLA 2OXDA 2QU5A 3H9RA 1BYGA 4YBKA 5E90A 5H9BA 3RCJA 1Q41A 3NYNA 1H26A 2VTLA 3JPVA 4DF3A 4PL3A 3KMMA 5GINE 2X81A 3LXLA 3P79A 3PY1A 4RWLA 4ERWA 3LZBA 3O17A 3OTVA 4BZNA 3BYOA 2FYSA 4M69B 5A6OA 3V5LA 3G90X 4YJPA 3MIYA 5J95A 5KHWA 2H96A 1MUOA 3FLWA 3KXXA 2QODA 3KQ7A 3W0PA 5HIDA 3ENHA 5HIBA 4BN1A 3VUHA 2BROA 4DH1A 4K2RA 1V0BA 3AMYA 4DHZA 2GNFA 3W2CA 3SG8A 4DFBA 4UN0C 2JBPA 4KABA 5CU2A 2VNWA 5AFVA 2YIWA 1JKSA 2JAVA 1YI6A 1RDQE 5JQ8A 3UYSA 3NUXA 3EKNA 3AQVA 4JR3A 3QTSA 1NW1A 4L43A 1VEBA 1YW2A 3DCVA 3IONA 3FKNA 2WMRA 4FEVA 4FYNA 4FTKA 3PXZA 2I7QA 2X7GA 4TY1A 2J0KA 5CT0A 3V3VA 2XVDA 2BTRA 4LGGA 3IW7A 2CKPA 4V04A 5A3XA 1OGUA 3GU6A 4FV0A 4FSRA 4KD1A 4Y73A 2BFYA 4IWOA 3FZRA 3W32A 4BHZA 4GFGA 2P33A 2ZV9A 4QP4A 4YZNA 5EG3A 4F64A 2YITA 3P86A 3EL7A 2V7AA 1OPKA 3HV3A 3N4TA 3U54A 4WNOA 4AZVA 2PL0A 4Q9ZA 2YZLA 3UC3A 2C5YA 4N4SA 1OIRA 2X9FA 3FI4A 5EM7A 3KKVA 1PMUA 5E8SA 4G9CA 5M53A 1PKDA 3FUPA 4Q5HA 4LI5A 1NVQA 2C1AA 3ZFXA 5KUPA 3LFFA 2XK6A 3AOXA 3DFCB 3KCKA 4BCKA 4O7NA 2R3GA 3IGGA 5AAFA 3NYXA 3ZZWA 5DNRA 4QP8A 1KE8A 3PUFC 3B2WA 3ZONA 4CCUA 3WYXA 5DRBA 2WQNA 4GFMA 2B53A 4LOQA 3PG1A 3PA4A 5HTBA 3DXNA 1JLUE 3MPTA 2VX1A 5KX8A 3QRJA 3H9FA 4U79A 4L7FA 3VAPA 4V01A 3SA0A 4JQ7A 2I0EA 2XYUA 3KY2A 5DBXA 4DCEA 2BHEA 4BR3A 3EKKA 1YHSA 2XIYA 3EFKA 3BEAA 4I92A 2A2AA 4MAOA 3VHEA 2WOUA 3JY0A 4AX8A 5D9HA 4F9CA 5CS6A 3OTUA 5F1ZA 5JH6A 3OEFX 5A4QA 3PIYA 3D5UA 3MVMA 2XALA 4XRJA 3A4PA 3QX2A 2WU6A 1XMLA 1ST4A 3OXZA 4GJ3A 2Q0BA 4GT3A 1G8JA 3R7YA 4FL2A 1APME 5HTCA 3FMHA 2YJRA 3BE9A 5L2IA 2UZEA 2UZWE 2F49A 3MV5A 5HU3A 1OPJA 3F61A 3GUBA 3I6WA 3VBWA 3W8LA 3P1AA 4HYUA 4LV5A 2OJJA 3DFAA 3LPBA 5EW8A 2ZOQA 3RHKA 2OF2A 1HCKA 3KRWA 2XAMA 3QD0A 1KWPA 4DLIA 2PVYA 4IM3A 2B9FA 2VAGA 5K5XA 3LFDA 4IMYA 5HE0A 2X8EA 3LM0A 4D2SA 5IUIA 1KOAA 3GT8A 2PUIA 4Z7GA 2BIKB 4WRSA 4XEYA 4XNEA 4FV5A 3GC8A 3Q32A 3R7VA 1J7IA 3KRLA 4J8NA 5AIRA 2FGIA 3EH9A 3QTXA 3RP9A 5HICA 5KMLA 3DLSA 2CCHA 2PHKA 4O6LA 1HOWA 3WILA 4FG8A 3ALOA 2WU7A 5EHYA 3RGFA 3CQUA 5E4HA 4D55A 4DDIA 2O0UA 3BU6A 3UMXA 2J9MA 3DDQA 3KRXA 4O91A 1JVPP 3RPSA 5DG5A 1YXUA 3JXWA 2VGOA 1H4LA 4YSJA 2JDTA 1OL5A 1OPLA 2XNBA 5EM5A 5HX8A 3BIZA 4HYHA 3NNXA 4IAKA 3UTOA 5DRDA 4CFFA 3R04A 4BTJA 5CSXA 4L9IA 2HWPA 5AV1A 5AP1A 1QCFA 3R02A 4L52A 5C8MA 2P4IA 3ZO3A 3BCEA 4XRLA 5BVWA 2GHLA 4II5A 3ZFMA 5M4CA 3ZTXA 1PXKA 3E93A 3UZRA 4PP7A 1JSVA 2R0UA 4C3PA 3VS3A 1BL6A 2OJIA 3GCUA 4DEBA 1WAKA 3C4XA 3OP5A 4FV3A 2XBAA 2LAVA 4ANBA 4CFWA 4I6BA 5CSHA 2X6EA 1FMKA 4FK6A 5BX0A 3QC9A 4LFIA 4AZEA 3COMA 1IA9A 2OFVA 3FC2A 4KINA 5F94A 4JVGA 3V5PA 2XM8A 4YLLA 4AQKA 4O7YA 4L42A 3LXNA 3BQRA 5I9UA 2B9HA 4CSVA 3OUNB 4IB5A 4HGSA 4BDBA 3E63A 4HCVA 2UZBA 5EOBA 2HELA 2WNTA 1NY3A 1Y6BA 4BJJA 4K11A 4J95A 2V7OA 5AUVA 4BJJB 5GJGA 5EM8A 1TQPA 4FV6A 3LCSA 2X2LA 2A0CX 1H0VA 4RJ3A 5B0XA 4IVCA 4JRVA 4F7JA 2B55A 3G2FA 2R3LA 1OIQA 4H1MA 5AEPA 2CLXA 3HV7A 5C01A 2C0IA 2BRHA 3QQHA 4FICA 5E8XA 4C4IA 3R00A 4ZS0A 3QTZA 1JBPE 5EQPA 4DEDA 4CGAA 4EONA 4E8AA 4XBUA 3ZS5A 2WEVA 3L9PA 1XBBA 4F6WA 5HX6A 3FZ1A 3QKMA 4FNZA 1OI9A 4GVAA 3FLQA 4ZSAA 1ZRZA 4DGNA 4E7WA 4G17A 3UNZA 4EJ7A 3Q3BA 3DKGA 4XV1A 4RWKA 5AP6A 3FQEA 4MBLA 4EBVA 3FPMA 3DTCA 3FMKA 5E8UA 4C3RA 3TDVA 3S95A 3VHKA 1U5QA 2G15A 4FTQA 2WMUA 3PIXA 4FTOA 4R3CA 4ZZOA 4X2NA 1F3MC 4NSTA 4RZWA 3HMMA 3N4VA 3DLZA 3F3UA 3LFBA 3VRZA 5E1SA 2DUVA 3O51A 3D0EA 4JRNA 4RJ6A 4CFUA 5LMKC 2RIOA 2X4ZA 3KFAA 3N51A 4H58A 2EUFB 2HAKA 3G0EA 4FSZA 4LYNA 4TYGA 2PUUA 1W7HA 1XH8A 3VUGA 4MTAA 2CDZA 3FHRA 4QO9A 4FGBA 3QL8A 4JX7A 1AGWA 3MTLA 3E88A 2FA2A 2ITWA 4FKOA 4KRCA 4I6QA 5JFXA 4B99A 3MA6A 3HRBA 4K8AA 3LFSA 2ITYA 4FT7A 3OXIA 1KE6A 4JI9A 3FXZA 3TTIA 5JGAA 3JVRA 3LHJA 3MDYA 3U51A 2JKMA 3CIKA 3ROYA 3JS2A 3FAAA 1OMWA 2F2UA 3HRCA 3QA8A 4BI2A 3A61A 4BZDA 1PY5A 4U0IA 2BMCA 4BIDA 1ZY5A 3SAYA 4PNKA 2PE2A 3NCZA 4IACA 3W2SA 3VUMA 4AU8A 2IZRA 2Y0AA 3HA6A 4QTEA 2HY81 1VR2A 2ITQA 5IQAA 3LFCA 4AUAA 2G1TA 3P4KA 2CNQA 3PA5A 4FT3A 3FY2A 4ITJA 4NWMA 4PMMA 4QYHA 4FTTA 3R8UA 2WTIA 3UO5A 3PJ3A 1JQHA 4YBJA 3W16A 4A9UA 5B2KA 3RPYA 1B38A 3KVXA
chains in the Genus database with same CATH topology
4E73A 5EQEA 5HE2A 4AAYA 1BL7A 4I0SA 4IANA 4IWQA 2CCIA 1Q97A 2R9SA 3AC1A 3HYHA 2Q0NA 3NYVA 1A9UA 3V6SA 2CN8A 4AP7A 4FSQA 5EOLA 2WD1A 1Q24A 3S2PA 1DI8A 2V22A 4KAOA 2HY0A 4FIFA 4CRSA 3C13A 5JZNA 2QI8A 3IECA 5IPJA 3MY0A 3R8PA 3WARA 3GC9A 3ZRMA 4F4PA 3VBXA 1OL7A 5IQIA 3ZUTA 4FKTA 3R0TA 5E8VA 5J9YA 3TCPA 3GC0A 4LV8A 1Y8YA 2ZM4A 2QU6A 3BYMA 1VYZA 3VUDA 3B8RA 3OY3A 2NPQA 2XJ0A 4BDJA 4NJDA 4L46A 2C3JA 5TT7A 4F70A 5JT2A 3S0OA 4I41A 4IE9A 3QRUA 2CMWA 4FNWA 3ANQA 3KIOC 1IEPA 3G33A 4PRJA 3PXYA 4DITA 3M11A 5HG9A 3CCNA 3R7OA 4AXFA 4MH7A 4DH7A 4ZSLA 4AOTA 3SG9A 1PMVA 4JNWA 3OWPA 2PK9A 4IAYA 5AV4A 3G0FA 4HVDA 3D83A 4G3FA 2JIIA 3HP2A 4LMNA 4PF4A 3OCBA 4A9TA 1WBTA 5AAGA 4FSUA 2FSLX 3HNGA 4O0RA 1Y91A 5EI2A 4Y8DA 4DFLA 5IG1A 2ETKA 3ACJA 3EMGA 4XX9A 5GJFA 4FVPA 4CVAA 4CFXA 1JKLA 5K4JA 2QOIA 4BTFA 4CTCA 3NZ0A 3S00A 3KCFA 1ZARA 3OC1A 2OXXA 5ANJA 2OW3A 3RMFA 4KIPA 4TKSA 1Y6AA 3F88A 3P9JA 3UVPA 2B9JA 4UEUA 4NFNA 4WNMA 3D14A 3R9NA 4ERKA 4TYIA 4ARKA 4L68A 2XJ1A 3PIZA 4D5KA 4RQKA 4WD5A 3QTWA 1P4OA 2PZPA 2VWYA 1H27A 4L00A 3C7QA 1GY3A 4FUXA 5EHLA 4DG2E 3HA8A 4RVLA 2OGVA 3LE6A 5CANA 3C5IA 3NUAA 3ZBXA 5FM3A 5KBRA 3GU4A 3MH3A 3O5AA 2VTTA 4EYJA 2W9FB 2ESMA 3DQWA 5E1EA 3QTRA 4DBXA 3UOJA 3VVHA 2WMWA 4BBEA 3M1SA 5JRSA 3E7VA 2ACXA 4WKQA 4EH6A 5ITAA 3OXTA 5K5NA 4OTRA 4IC8A 4DE4A 1YDTE 2Y8OA 3R22A 4D1XA 3WE8A 3FKOA 3I81A 4AT4A 3PFYA 2OIQA 4EH8A 2J0MB 3HRFA 5M4FA 4UX9A 5H8EA 5C1QB 3CLYA 3DA6A 2XNOA 4DYMA 2CNVA 4FJVA 5JEBA 4YHJA 2YM5A 1WCCA 2F57A 4FOBA 1WVXA 1GZNA 4KIOA 3TG1A 5M51A 4JG7A 2IVSA 1H1RA 5AUWA 3BV3A 3IDCA 3II5A 4G9RA 1XKKA 2C4GA 2Y6MA 4Q5EA 4ZZNA 1Q99A 3ZSHA 4FKPA 2R3KA 4JJRA 4RX7A 5C8NA 5CU6A 3W2PA 5KZIA 4AAAA 3KXHA 4C37A 1H01A 3RAHA 3Q4CA 4NM0A 3HMOA 3O7LD 3M42A 3HUCA 3W55A 4C61A 3G9NA 4QMSA 4IHPA 4C0TA 4OR5A 4BDGA 3LQ5A 2GFCA 4I6LA 1Q8WA 4QTBA 4CLIA 3MB6A 3R28A 4H1JA 1H1SA 3V5WA 2W1FA 2WIPA 5CSPA 4RT7A 3R71A 4FTIA 2AC5A 4BDAA 4FKJA 2HENA 4JIAA 1FBNA 2PVNA 4IVAA 2XKFA 3LVPA 4OTHA 2BALA 5M4IA 3NAXA 5CAOA 5FXRA 1H25A 4NCTA 4UWCA 4IBMA 4A9RA 4AA4A 3PXKA 3WIGA 2UZVA 4OTIA 2XK9A 3R6XA 3ZSIA 4O0YA 5AP0A 2HZ0A 2NRYA 2IVVA 5E8ZA 2YWPA 4G31A 1S9IA 4GW8A 3UE4A 1IRKA 3NSZA 4EZ5A 3KXMA 5BMSA 4K9YA 5IH6A 3NRMA 4C4FA 1OL6A 4Z7HA 2E9NA 4D4YA 4K18A 3UOKA 4NU1A 2VUWA 3BHYA 4EEVA 1GZOA 1PJKA 2UW9A 2EU9A 3COHA 4YTHA 4CMUA 5JMSA 1BLXA 2OI4X 2P3GX 5FP6A 2F9GA 4NM5A 1PW2A 2PMOX 2G01A 3AC3A 2BDWA 3A7FA 4EORA 2E9UA 5G1XA 1M2RA 4J71A 3EQPA 5KKRB 5M08A 2HOGA 4JBPA 1DAWA 4WG5A 1W0XC 3CD8A 5AV2A 3W2OA 2C0TA 3ZXTA 3QFVA 2DQ7X 4W8DA 4V0GB 3W0QA 4CV8A 5CU3A 4F9BA 3POZA 2YAAA 4Z16A 5DR6A 5IMEA 4E6AA 3EN5A 3EN4A 5FM2A 1PYXA 3NFGB 3PXQA 1KSWA 2UW8A 3D5XA 3LXKA 4I5HA 4HCUA 2B9IA 5AWMA 3PJ1A 4DFZE 2R3QA 2RFSA 2IW6A 3EN7A 4GMYA 3ORKA 2VGPA 3I6UA 3PXRA 4ACGA 2O64A 3BGPA 5DN3A 4RIWA 3PVWA 4RIWB 4ZTQA 5I0BA 3EQRA 1VYWA 2W5BA 4MKCA 4JG6A 3QCYA 3R1NA 1JNKA 4FOCA 4FZ7A 4FTUA 3FL5A 4NH1A 3E92A 4TZRA 3DDPA 4QEBA 5IZFA 3BZ3A 4IVBA 5AP7A 4BDFA 3QLGA 3N4UA 4XHKB 3U6JA 2UZOA 4WNPA 4S2ZA 4Y5QA 5KO1A 2FVDA 2I0VA 2XK8A 3IO7A 2PMNX 4IIRA 4XBRA 2XKEA 4C36A 1M7QA 3IW6A 3CY2A 2BKKA 3KGAA 3HZTA 3ORZA 4FKQA 4JDHA 5FUTA 3TYKA 2R3NA 3C5UA 4ZSEA 3JR1A 3SW4A 5CEKA 4GV1A 4TTHB 5L2WA 3E87A 5T3QA 4YLJA 3C50A 5KZ0A 5LWNA 2ZMCA 3K5UA 3FSKA 1RJBA 3PE2A 4I6HA 3O0GA 4A07A 3MBLA 3HL7A 4DINA 3POOA 3Q4ZA 4UALA 5CEQA 1XH9A 2Z7SA 3H0ZA 3IPHA 5HZNA 1PXMA 4TWOA 2I0YA 5ANOA 3QZIA 3W0RA 3QZHA 4FT0A 5F4NA 3EJ1A 2WMAA 1Z9XA 4KBCA 4O7WA 3BLHA 4DGGA 1U46A 4DG0E 2JEDA 4IDVA 1QPJA 2O8YA 3QCXA 4ACMA 4O22A 2R4BA 4IJPA 4EOJA 3WOWA 4RVTA 2VO7A 2W5HA 4L44A 4C4HA 4HJOA 5LOHA 3ZXZA 2IO6A 3SHEA 2OO8X 5HNGA 4G6NA 4AFJA 5L8JA 3R8LA 4B9DA 3DKCA 4V05A 4YC6A 2GS7A 4F6UA 4IJ9A 2VTNA 4C38A 4Y46A 3P23A 5B7VA 4AW5A 2SRCA 4OTGA 2R3IA 2X0GA 3IW8A 5BVKA 3BEGA 2PPQA 3A7GA 3Q6UA 4NKSA 2JDSA 4E6CA 4Z55A 3ZEWA 2ONLC 5GJDA 4MXXA 1NVRA 4F0FA 5DA3A 2R7IA 1IG1A 5TOZA 2VTJA 3T8OA 4BBFA 1M17A 2JAMA 2PZYA 4RQVA 4YUQA 4KBKA 3QC4A 3LLTA 1MRUA 3LQ8A 5HGIA 4ZXTA 3EFLA 3EN6A 4LRJA 4MNFA 4QTCA 4BCJA 2PZIA 3SLSA 3V8WA 2I6LA 4QMLA 5EQYA 2WTKB 4O0XA 3BHTA 4QQCA 1IA8A 3VWAA 1QMZA 4FEXA 3GENA 3OW3A 3QYWA 2C68A 2WMVA 1RQQA 4FT5A 2CGVA 2XB7A 1IAHA 2P0CA 2JLDA 4EK8A 5JQ5A 3A7HA 3L8PA 5D10A 3CJGA 4TW9A 5HVJA 2IG7A 3DBDA 4K0YA 4RA5A 1WMKA 3KMUA 1MQBA 4FC0A 4MF1A 4X3JA 1X8BA 2YA9A 4GIHA 4M12A 3W33A 2H34A 4P5ZA 5AV3A 5CT7A 3ML1A 4H3PA 1FVTA 4DEAA 4DEGA 1ZOHA 4IQ6A 4U3YA 3QZGA 3A4OX 3L9MA 1H08A 3Q9YA 4CZTA 2YDKA 3CTQA 5E8WA 3QXPA 4P90A 3ALNA 1I44A 3TZ8A 3IDBA 3ITZA 1O6LA 2BZKB 2X4FA 3QXOA 4YJTA 3SQQA 2JKKA 3QRKA 3TV7A 3VNTA 2XK7A 2VTRA 1UA2A 5K9IA 3AC5A 5CALA 2CSNA 4O21A 3GU7A 1YXVA 4U3ZA 2OIBA 5HESA 3WZKA 2BTSA 4UXQA 3PSBA 5DR2A 4KIQA 2QOLA 2YDJA 4B6LA 4UXLA 5KNJA 3RK5A 2WQEA 2C6KA 2R3HA 3MESA 3EZRA 2YERA 2C6LA 4FSNA 1ZY4A 4FV2A 3VUKA 4ALVA 1PF8A 3VUIA 3UIXA 4GYGA 4M68A 2QLQA 1P2AA 3BU5A 3ORPA 3WF8A 4RLLA 3W0MA 4EHGA 3HGKA 2X9EA 5L6PA 4XUFA 3U9NA 3NIZA 4AZFA 4O7SA 3QRIA 3QCSA 2A4LA 3CJFA 4M8TA 4XG4A 3UOLA 5I9WA 3EL8A 4IAIA 2FUMA 3FLSA 3UDTA 4J52A 5H8BA 3CQWA 2WTCA 3D94A 4O86A 4L53A 1OUYA 3QD2B 3R8MA 2XNPA 2C5VA 3UIUA 5BUEA 1YRPA 3ORLA 2X39A 5CAVA 3ODYX 2VU3A 3ORTA 1YXSA 2PVMA 4USFA 4UY9A 3E3BX 4HZRA 3ZEPA 3I0QA 3D2IA 3U9CA 2YIYA 2OZOA 3QTIA 5DE2A 3TUDA 4HNFA 2G2HA 2YEXA 2JD5A 3VONA 4I4FA 1L3RE 2CN5A 3HVCA 2VWIA 3O8TA 5E91A 2WQBA 2XIKA 3P08A 2ZV8A 1LUFA 3ZCLA 3ZU7A 5LWMA 4G3CA 1PXLA 2HYYA 2Z7LA 3JY9A 4O7ZA 2BZJA 3IG7A 3L8VA 4PWNA 3ZFYA 4FBXA 1XO2B 4XS2A 4EL9A 3AGMA 4E4XA 1T46A 5CLPA 2XAOA 5KBQA 1SMHA 5FXQA 1M14A 4FG7A 4FKIA 3IQ7A 3NEWA 2P55A 3MJ2A 4PMTA 3D5WA 4QMNA 4H3QA 3T9TA 3EWHA 4QMXA 3UJGA 3NR9A 5E92A 3KN6A 2WOTA 3TWJA 5H3QA 4ALWA 2AC3A 3E62A 3DPKA 3IOKA 2AEGA 4DA5A 4R1YA 3WZUA 3ZC5A 2FSOX 3FKLA 4ZY6A 3ZUVA 2OZAA 4XP3A 3PRFA 2OZAB 5IA3A 5AUUA 1FVRA 3RHXA 3ZRLA 3MYGA 2X2KA 4CRLA 2BFXA 4L01A 3GGFA 3OT3A 1XJDA 4JBVA 5I9YA 2OJGA 3TIYA 1UV5A 3TXOA 5LJJA 3NPCA 4FKGA 3ZM9A 4YTCA 4L3PA 4M0YA 4XOZA 3OFMA 1M7NA 2C6IA 2J7TA 1YHVA 2XP2A 3F9NA 3Q04A 4DC2A 3F69A 3LFQA 4CFVA 4YNOA 2WQOA 3ORIA 4QOXA 3I7CA 4F9WA 3EB0A 4CQEA 4RZVA 4GJ2A 3R73A 4I0RA 4UZDA 4NK9A 4ZTHA 3VQHA 4AGCA 4FTAA 2VNYA 4IAFA 1W83A 2XNNA 4Y83A 4JX3A 2GFSA 3C4CA 2GNGA 4MWHA 4RFMA 4Y85A 5ETFA 3UQGA 5IISA 3QQFA 3VF8A 4QMVA 4DH8A 1CKPA 4GU6A 5E8YA 2JDVA 4QDVA 5HVYA 3RM7A 5ANIA 3P5KA 2VWXA 3ZBFA 4BGQA 4ZSJA 2PVHA 4YTFA 3EHAA 4AGWA 3P78A 2ERZE 2YISA 4IFGA 4PTEA 1GNGA 5F9EA 5D7AA 4NT4A 5TR6A 3WZDA 4AA0A 4AE6A 3D7ZA 4RPVA 4QTDA 2JKQA 1OIUA 3IKAA 3MPAA 2CLQA 4FIEA 4C4EA 2XF0A 3NVMB 3W0SA 4KKEA 1DAYA 4I93A 4QP7A 4UYAA 5AMNA 1UU9A 5CVHA 4AQCA 3Q6WA 1OBDA 4FKLA 4FVRA 4ZTRA 3VJOA 3NUPA 4XYFA 3ETAA 5AA8A 3BYVA 2GHGA 3P7BA 4ZTSA 1PXPA 3NUNA 2A19B 3LCTA 3R1YA 3O50A 4WT6A 2JDRA 4HCTA 4HYIA 4MWIA 3R21A 4NYEA 5FGKA 5CEOA 2JKOA 4JT3A 3F7ZA 3FEGA 4JOAA 4O82A 3BPRA 5K3YA 3TMOA 3VJNA 5HLPA 2E9VA 2VTAA 4EJNA 4J1RA 3NS9A 4N70A 4TNBA 4TNDA 5EW9A 3C4EA 3MW1A 4FI1A 5CEIA 2BAJA 3FMLA 4J53A 3REPA 4IC7A 4O0WA 2QOFA 5A4TA 2WMSA 3GCSA 2NNWB 3VBTA 2C5OA 2ZAZA 5ACBC 5ANDA 3VULA 4BI1A 1FINA 4DHJA 4LOOA 2W1HA 4FTJA 3D5VA 4QNAA 1YDRE 3CKXA 1PXJA 3Q5ZA 2CHLA 3LM5A 5HD7A 4NJ3A 3MH2A 4I24A 5IH4A 3SD0A 4ITIA 3SKCA 1TQIA 1W82A 2PVRA 4X3FC 5ACKA 3NW6A 3TN8A 4IAZA 2YFXA 4MXAA 4QDEA 5FP5A 2CGXA 2DWBA 4XP0A 1WFCA 4EQCA 4AE9A 3KEXA 4LRMA 3P5JC 4RGJA 2A27A 2X8DA 3AD4A 3Q9XA 3G6HA 4BIEA 5L6OA 4OTWA 3BHUA 4OBQA 4CLJA 2C3LA 4O0TA 4RVKA 2IJMA 4GFOA 5HBHA 3THBA 3WIKA 3COIA 5IF1A 1MP8A 4XCUA 4E5WA 3EFJA 1O9UA 2J50A 1XHAA 1SYKA 3GOPA 2QHMA 4AA5A 2XS0A 3UIMA 4FODA 5CXZA 4D2RA 2O3PA 1NVSA 3RNYA 5AUTA 3ZLSA 3R9DA 3PVGA 2XIXA 5CSVA 4CEGA 2WAJA 2QQ7A 3PXFA 3VBQA 5HLWA 1H28A 3RAIA 4XP2A 5J1VA 3BLQA 5FBNC 3U6HA 3FYJX 4EKLA 1YQJA 1ZYLA 2OKRA 4JDJA 1ZZLA 4IZ5A 3QYZA 4C58A 4WSYA 4O7TA 3DXQA 2QOOA 4YJRA 4JQEA 5A4CA 4O27B 1LP4A 3MVJA 5ANGA 3K5VA 2Q83A 3QHRA 4OUCA 2OSCA 4USDA 2GCDA 4R3PA 2YCFA 3AT3A 3C0GA 2VTQA 4C33A 4L45A 3KXNA 2BRGA 4AXAA 4GG7A 2Y4IB 1IASA 2VWWA 4IDTA 1BKXA 2Z02A 5CEMA 1SVGA 3PDTA 4HGTA 4YPSA 5IQGA 5JN2A 5J5SA 4C02A 5I4NA 3O8PA 2J90A 4H05A 4GRBA 5DGZA 4MX9A 2JGZA 4AGUA 3NX8A 5JGBA 3O8UA 1IR3A 1H1WA 2O5KA 2UVYA 3R8ZA 3C9WA 4QNYA 1XBCA 4DCAA 2PSQA 3QQUA 2VRXA 2GTMA 2GQGA 1Q62A 3F5UA 3RTPA 4YHFA 4J8MA 1WBWA 3QQKA 4QMYA 4C2WA 2XRWA 3CC6A 3A99A 3MSSA 3MY1A 4RBLA 4H39A 2YJSA 2VWBA 4R1VA 4FTCA 5A54A 2XYNA 1R0EA 5CVFA 4PV0A 4D4SA 2BIYA 4QMMA 4G34A 4I3ZA 2VTHA 1Z57A 4PTGA 5ICPA 1IAJA 5EFQA 2GMXA 2EXCX 2ITNA 4GEOA 3I4BA 4KBAA 4NTTA 4PY1A 5EM6A 4EK3A 5KMNA 3R9HA 3TZ9A 3B2TA 2Z60A 4U43A 5FBOA 2J6MA 5CEPA 3T9IA 3RM6A 2YIXA 4E93A 5I9XA 3DS6A 4ASEA 5CZHA 4B8LA 2VO6A 2J0LA 5ANKA 2LGCA 4GKIA 4P7EA 2YCRA 4F65A 4I6FA 2VD5A 3I0OA 1OECA 3LMGA 4PDOA 4XV3A 3CTHA 2UW5A 3HMIA 4FL3A 2HXLA 4YZCA 3VO3A 4F7SA 5BUJA 2VZ6A 1TVOA 2C6TA 1J7LA 3B8QA 4O7RA 2QO9A 5E7RA 4BDEA 4BCIA 2CPKE 3ZH8A 2XBJA 5BYZA 5L3AA 3GP0A 4BKJA 3L8XA 3R01A 3GU5A 4X2FA 2C30A 3EQGA 4F7NA 4PQNA 2XK3A 2V0DA 2ZJWA 2YM3A 1AD5A 3TTJA 4ZLZA 2OIDA 1SVHA 4QQTA 3DU8A 1VLRA 2XNEA 3VS7A 3PSCA 3FZPA 3CY3A 3KMWA 2IVUA 4HOKA 4UV0A 3RINA 2WTJA 4ITHA 1M2PA 4NTSA 4EOSA 5LXMA 3BLAA 3UC4A 4HGLA 4XV9A 2JITA 5HCYA 4RWJA 2G2IA 4L7SA 2DYLA 3DJ5A 2QO7A 4TWCA 4FZFB 4MXOA 4ANSA 3MJ1A 3FMJA 1KUTA 3PVBA 4FZAB 4GG5A 1Q8ZA 3RPVA 3RPRA 1OL2A 4DEIA 4EYMA 2QC6A 4AW0A 4AS0A 1F5QA 1PMNA 4IX5A 4YJVA 3C51A 3E7OA 4ZIMA 3UDBA 3CQEA 2QOQA 2W5AA 3LKMA 4QYFA 4YJUA 4D1ZA 4F09A 5M06A 2HW6A 2BZHB 3FXWA 2CKQA 2BDFA 3HDNA 2QURA 4TRLA 3O71A 4KSQA 4CFMA 4FIGA 2QKWB 4YNEA 4C4GA 1JKKA 1JWHA 3RWQA 2UUEA 4E5BA 3DK6A 1MRVA 3NMUF 3MS9A 5FLFA 2QCSA 2ZM3A 4QYGA 2WTDA 4R3RA 3ZLYA 4D4VA 2GNLA 4MXYA 5CNOA 1TFFA 1WBVA 2W4JA 5ETIA 5BVNA 3UVRA 3AD6A 4I94A 4QMQA 2VTOA 4ZSGA 2XNGA 3EQHA 5G6VA 2ZM1A 4NZWB 4RIXA 3AXWA 3DXPA 4RIXB 2C47A 2XM9A 4ZP5A 1I09A 2KULA 1R0PA 4E20A 5HU9A 4AN2A 2VO0A 3TM0A 1OKZA 4QMPA 3O2MA 1YKRA 3LJ1A 3MVHA 1G8KA 5HORA 3Q96A 2X6DA 3LMHA 5IEVA 3PJ8A 4K77A 2CGUA 3QWJA 3CSVA 4XV2A 4U8ZA 4ZS4A 3BELA 5KHXA 3U55A 5CU0A 5LQFA 4GCJA 4ANQA 4BVUA 1GIHA 2ETMA 1VJYA 3OS3A 1P14A 3WZEA 2UZTA 3UODA 2PWLA 4IZAA 3PFQA 4CG9A 5AV0A 5AADA 5IMXA 3AC8A 4ZEGA 3H3CA 3LW0A 2YCSA 3ORNA 3TL8A 4AFEA 4DGLC 5ANEA 5AM6A 1XH7A 3QU0A 3AMAA 1XQZA 3AKKA 4GSBA 1G3NA 5JKGA 4F9YA 2J2IB 2W06A 1XH4A 4GU9A 4D1SA 4IEBA 3MVLA 4A9YA 2YN8A 1J1BA 3CTJA 4FNYA 4HPTE 4EQUA 4W8EA 4GK3A 2XA4A 2IPXA 1YWNA 2QLUA 2ITOA 3FQSA 3PP1A 5C9CA 4EH4A 4FMQA 3H4JA 3OHTA 4I4EA 4NM3A 3NLBA 1FGIA 3E5AA 3H30A 1ZYDA 5LCKA 4BC6A 4BDHA 4FR4A 4TN6A 4QP6A 4F1TA 1YOJA 1UNGA 5KMJA 3TEIA 3PJCA 2PTKA 1XWSA 5EYKA 2YIQA 3ODZX 4PTCA 3SV0A 2VTMA 4EH9A 4G6OA 3LCKA 3ENMA 1YXTA 4AXDA 4O7LA 1KE5A 3F2RA 4IAAA 3WYYA 2REIA 4M13A 5BVDA 5I9ZA 5IH5A 3UQFA 3U8WA 4D58A 4CKRA 3VIDA 1XMMA 4Z9LA 4PNIA 1QPDA 5JRQA 4O7VA 2E2BA 4EI4A 2FSTX 2J4ZA 3MA3A 4X6RA 3GOKA 1Q5KA 3TV6A 3P7CA 2ZV2A 3V5JA 4DEEA 5JFVA 4F78A 1OKVA 4PL5A 2RGPA 2F7XE 3A60A 4U97A 5HBEA 1TKIA 3FSFA 1OIYA 1YVJA 1XH6A 4ASXA 5HG8A 3WE4A 3ANRA 4QTAA 2C1BA 2IW8A 1U4DA 4GYIA 3HAVA 3GC7A 2PVJA 2QOBA 3O96A 3PPZA 3E3PA 3PY0A 4HYSA 4OTQA 3DOGA 3K3JA 4YPDA 5H2UA 3WZJA 4IH8A 2WTWA 4APCA 1KE7A 3KN5A 4DLJA 2C0OA 5KE0A 3C0HA 3F7WA 3ZO4A 2XIZA 3LMIA 5TF9A 5CWZA 3VW8A 4BCHA 5LMKA 3BKBA 5JFSA 3BRBA 1WBSA 1URWA 4U7ZA 3SVVA 1OKYA 3UO6A 4YP8A 3RALA 5IUHA 3HMNA 3UGCA 4CMTA 5LMAA 3TKIA 4JAIA 5F95A 2FO0A 2ZDUA 3FYKX 5HE1A 4ZY4A 3UYTA 4WNKA 3NDMA 4LMUA 4OT6A 4G2FA 2C6EA 5AUXA 2JBOA 1ZYCA 4LL5A 3TNQB 4ZZMA 4MBIA 4LOPA 2JC6A 3QBNA 4IZ7A 2GQRA 5BNJA 5HVKA 3GI3A 5T68A 5BPYA 4R5YA 3V5TA 3QQJA 3PZEA 2WB8A 4GH2A 3FMEA 4FKWA 4R7HA 4XH6A 3RNIA 3C0IA 2H9VA 4D9TA 1ZWSA 2C69A 1GZKA 2UZNA 4P4CA 5A46A 5KMKA 5L8KA 2UW4A 2RFEA 4BDIA 2VWUA 3FQHA 3WF7A 1J91A 3AMBA 1ZOEA 2IZSA 3NUYA 2FSMX 2E9PA 3EQBA 3F5GA 4BHNA 3WF5A 4K1BA 4E4LA 1V0PA 5KMOA 3AKLA 3FZOA 3VS4A 5HEZA 3BV2A 5FDPA 2OJFE 2YACA 3ZUUA 5E9EA 1ZXEA 2UVXA 3QQLA 1ZYSA 1K9AA 4IX3A 1OITA 2ZMDA 3E64A 4YJQA 3VS5A 3VS6A 2B1PA 2E9OA 2V55A 2X1NA 3KU2A 1W84A 3OOGA 3QX4A 2GPHA 5HCXA 1MQ4A 5CENA 3D9VA 1STCE 4IWPA 3VBYA 5CI7A 4C34A 5IA5A 5LVNA 4DH3A 2QG5A 4S34A 5LVPA 4RA4A 4W4VA 3DY7A 4FE2A 3K3IA 3MY5A 4JDIA 3LJ2A 4BCQA 3QRTA 4FK3A 3PP0A 4MEDA 2XCHA 2PUPA 2UVZA 3NGAA 4ALUA 2CGWA 5BYLA 2BDJA 3RVGA 4C59A 4D9UA 4CT1A 2ZDTA 4I20A 4EHVA 4P2KA 4HW7A 3AG9A 1JSUA 4JL9A 3OOMA 3FLYA 4FVQA 4RIYA 4RIYB 4E26A 2F4JA 5EW3A 4AXEA 3S1HA 3BWJA 5EI8A 2ITZA 1UU7A 3DZQA 3A8XA 2W1CA 3PWDA 3V6RA 4CG8A 3OEZA 2HZNA 1OGYA 3R2BA 3DJ7A 2R3MA 4DT8A 1FOTA 4B7TA 3A62A 1V0OA 5K4IA 3O7LB 1R78A 3LLAA 1UKIA 2C6OA 4YJOA 4OTFA 2YM7A 4EK5A 2C3IB 3DAJA 2PU8A 4GL9A 3IW4A 3W10A 3VN9A 4ZLOA 3Q53A 3QD4A 3I79A 2PULA 5I9VA 1GIIA 3UO4A 4EOQA 4X2KA 1P5EA 2GSFA 4I22A 3FI3A 3TUBA 1CSNA 1YI3A 3L9NA 3CR0A 2OXYA 3U6IA 3ACKA 3H10A 1H0WA 2RFNA 3UOHA 5D7VA 1FPUA 1OUKA 4FSMA 1NXKA 4AWIA 1L8TA 4QMZA 4KSPA 2ZFYA 3SC1A 4C62A 1M2QA 3FI2A 4MNEA 4MNEB 3QA0A 3NFFB 3CEKA 3A8WA 4RIOA 4F9AA 3C4FA 5FQDC 2VWVA 4CNHA 1A48A 1O6YA 3G9LX 1HCLA 3DBCA 4IVDA 4Q2AA 2JDOA 5F20A 3UVQA 4DTBA 2C5NA 3IGOA 1FMOE 2B52A 3LCOA 3Q9ZA 4LM5A 4S31A 4R5SA 4GIIA 4TPTA 4X7QA 2W7XA 3ID6C 3DBEA 4YTIA 4EH3A 2WZJA 3F3TA 5EDPA 4E5AX 1J1CA 3KF4A 3ZO1A 1GOLA 1T45A 3UZTA 3IK3A 2WQMA 1PXNA 4BCPA 5AUZA 4N6YA 3UG2A 4NM7A 2OG8A 3NNVA 5HO8A 3SXFA 3VC4A 4XG6A 4CT2A 4ZTLA 2Z7RA 4TYJA 2WTVA 4AF3A 5DH3A 3DAKA 3HKOA 3PPKA 4EH2A 1REKA 2PMIA 2GQSA 3A7JA 1PMEA 2EB2A 4UB7A 3EQDA 3Q2JA 5HNIX 4JS8A 4X6QC 3OD6X 4KKHA 5CXHA 1J7UA 4LV7A 2A1AB 4I0TA 4ACCA 4E6QA 2I0HA 3DNEA 1CKJA 4L6QA 3ZLXA 1Q61A 3ROCA 2HWOA 1URCA 1SNXA 1B39A 5CF4A 3BE2A 4YJNA 5HG7A 3W2RA 2Z7QA 4WBBB 2QVSE 3E8EA 4F7LA 3D15A 2VX3A 3DK7A 5GHVA 3EN9A 3MN3A 3PY3A 3QGYA 4WG4A 1UU3A 2UV2A 2WFYA 3W0NA 4XG7A 3H9OA 3UDZA 1ZMVA 4N0SA 4L3LA 3ZDIA 4GK4A 4BB4A 2I1MA 1G8SA 4NW6A 3ZZEA 3TJCA 2WO6A 4RJ7A 2J0IA 3MFTA 4FUYA 4O83A 3SDJA 1PXOA 3F2NA 2VV9A 2PZ5A 4GVJA 5D41A