4BJJB

Sfc1-sfc7 dimerization module
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
94
structure length
85
Chain Sequence
SLETDVENIVFQFQNSSLDFQSSDDFSILGIDQPHPIVRIGGMFFRGTWHQPIGTDIVVPSVNDGLVLCKRRLMLEQIRLVPKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR TAU SUBUNIT SFC1
publication title RNA Polymerase III-Specific General Transcription Factor Iiic Contains a Heterodimer Resembling Tfiif RAP30/RAP74.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 9
structure length 85
sequence length 94
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10419 TFIIIC_sub6 TFIIIC subunit triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.170 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bjjB00
4BJJB
chains in the Genus database with same CATH superfamily
3ORPA 2IVUA 3QD4A 3CBLA 3L9NA 2OJFE 3U8WA 4L01A 5AAEA 1SYKA 4Q5EA 3EYGA 4ENYA 3O51A 3G9NA 1UU9A 5FRIA 3CTQA 3VUKA 1KE7A 3ACKA 2PULA 5DOSA 4YTHA 4U7ZA 5L6OA 3E7VA 1FINA 1M7QA 4F08A 2Z02A 3IW8A 5G1XA 5KMJA 2QKWB 3Q53A 1UKIA 3DQXA 3QHWA 1VYWA 2R4BA 4B0GA 4DHFA 5IUGA 1YHWA 3E63A 1OECA 3DJ7A 5AM6A 2BFXA 3UC3A 4U97A 4PUZA 2X81A 3LCOA 3QGYA 2WIPA 2C1AA 2YM4A 4QDEA 4QQCA 3HV5A 3WF8A 4EHGA 4MD8E 2YN8A 3OTUA 2EXMA 4KBCA 4U45A 2XMYA 4RJ7A 4K18A 1WCCA 2BALA 4FSQA 2XJ1A 3F7WA 4LG4A 4ZLYA 1VR2A 3MPTA 4EUUA 3NCGA 2V62A 3NAXA 4CKJA 3LFEA 5HX6A 5FM3A 3I5NA 2XEYA 4LQMA 4IJ9A 4YC6A 3EN6A 4FX3A 5HD7A 3VULA 3WYXA 2VTPA 2XNPA 5BPYA 5JZJA 2VTMA 1IASA 3IO7A 4PMMA 3IGOA 2PMNX 5CXHA 3CD3A 3TT0A 4UZHA 5D41A 2OH4A 4CMTA 3I5ZA 4L3PA 5HICA 2XRUA 3SDJA 3E7OA 3VUHA 4OTDA 2R5TA 2J5FA 3ROCA 1REJA 1ZMVA 3NIZA 4QYEA 4ACCA 4PNKA 1Z5MA 4DEBA 4YLKA 4JX3A 3ZO4A 5C8KA 4ZSAA 3NGAA 3MA6A 5EM6A 3WILA 3FPMA 3KRWA 2RIOA 3AOXA 2PYWA 3R7UA 4BCJA 4YTCA 2CGXA 4UXQA 4ZTNA 4ARKA 3CJGA 5AIRA 3UOLA 3V5JA 2WU6A 2WTCA 4JRVA 4BVUA 3R1QA 5BVEA 2Q0NA 3NS9A 4BBEA 4MXXA 2CNQA 1P4FA 2GSFA 3LOKA 5F95A 5LQFA 2E9OA 1IG1A 3CGOA 3DK7A 3QD2B 1YXVA 4FKGA 5AM7A 2XKCA 4TXCA 4BC6A 1G8JA 3DLZA 2EUFB 3DFAA 3IKAA 4OTHA 4E4XA 1YOMA 3HMMA 5I9ZA 5HE2A 3PJ8A 3LFBA 4FKUA 1GIJA 2UW3A 2HYYA 4OTIA 1H0VA 4ORKA 3ANRA 4W4WA 4W4XA 4O91A 4DE4A 5A6OA 4FC0A 3ULZA 5M07A 1J7LA 4FNXA 2AUHA 3VHKA 1QCFA 1XH6A 3R1YA 4GYIA 3OZ6A 2XF0A 5HORA 2VNYA 3ULIA 3OCGA 3L8XA 4BDIA 2C0TA 4QMTA 1DAWA 3GU8A 4DGLC 4F4PA 4FEUA 4NM3A 3D4QA 4XLIA 4YPDA 4YZCA 4KS7A 4R7IA 4E4MA 5HE3A 5L8LA 4F6UA 3MS9A 3ORMA 3CTJA 1PXPA 3H9RA 2PVMA 3UP2A 3RMFA 3CGFA 4IANA 3E8CA 3PXFA 2Z7LA 3O8TA 2UZBA 4FZDB 5I9VA 5AMNA 3CQEA 4AXFA 5FD2A 5KMIA 3BCEA 3QTXA 4U79A 1R78A 1Q8YA 3PLSA 4D4RA 3P08A 3FLQA 4OGRA 3EQHA 1G8AA 3KRXA 1ZYLA 5EYKA 2NO3A 5AP5A 4I4FA 5E90A 2XM9A 3PZEA 2PZPA 3PRIA 3GI3A 3KC3A 4EJNA 5E8ZA 2QOBA 3L1SA 1UKHA 3OROA 3R0TA 4RZVA 4ZTLA 3UDZA 2PVFA 2OFUA 1YVJA 5CU4A 4DINA 3UG2A 4D55A 4AE6A 1QPDA 3F66A 3P4KA 3ZLXA 2W5BA 3BE2A 3C0IA 3PJ1A 3UDBA 2XKEA 5DFPA 3D7ZA 1W98A 3C1XA 2IZSA 3EQGA 4GW8A 3DV3A 4YZDA 2ITPA 4BZNA 3AD5A 2PVHA 2XBAA 2R0IA 3W8LA 5CENA 3ZXZA 5KKRC 2XJ0A 4G3FA 5LMKA 1SZMA 3TDVA 1DS5A 4G34A 2I7QA 3HMOA 4KIQA 4YP8A 2PUPA 2C69A 4TYHB 5CY3A 4BDDA 3S3IA 3B2WA 1IA9A 2C47A 2XM8A 4FSNA 1PMUA 2ONLC 1J1BA 3TNWA 4NSTA 3TUBA 4AN2A 4ASZA 4GVAA 2XP2A 1DAYA 4JDHA 3MVMA 4JJRA 4CTCA 4E20A 3QCSA 3RHXA 4I5CA 3BHHA 3MH2A 1JOWB 1V1KA 2V22A 1OL7A 2WFYA 5HG8A 2X6EA 3QU0A 4B99A 4DHJA 3R7VA 5E8SA 4P7EA 4BI0A 4PDSA 3C13A 4XOYA 3NUPA 2C3JA 4IZ5A 4KKEA 4XBRA 2C6KA 4BGHA 5L8KA 2GS7A 1Q3DA 3G90X 3MJ1A 5F4NA 5E1EA 5HESA 5KMKA 4ALWA 3I81A 4XG7A 2Z7SA 3ODZX 5IH5A 4S2ZA 2UZTA 1K9AA 3Q6WA 1DI9A 2A27A 3A61A 4JG6A 4BHNA 4C2WA 2F7XE 1ZYDA 2BIYA 4DDIA 4FKPA 3W2SA 2XK4A 1WAKA 4BJJA 4TWOA 5H8GA 4IB5A 3A7IA 5IA5A 4EH9A 1ST4A 3I6UA 4FZFB 5BYLA 4L53A 2QU5A 3NUSA 4IZYA 4M8TA 5DE2A 4DFNA 5HQ0A 5DR6A 4G6LA 3SG9A 4AAYA 2EU9A 5JGAA 3HDNA 4XV1A 4BTKA 4Y46A 3V8SA 2VV9A 3LCKA 1PYXA 4FT0A 2IPXA 4DFZE 1ZOEA 1R39A 4U3YA 3EH9A 3HA6A 4HGEA 3MFSA 3GU4A 4WA9A 4WG3A 1JWHA 3KMMA 1GAGA 2NRYA 1BL6A 4BJJB 4AA0A 4FVQA 1XH4A 2UW7A 4FSRA 3KGAA 2H6DA 4LFIA 4UXLA 3RM6A 4PDYA 3IDPA 2GQSA 4EQMA 2XARA 3HDMA 3PXKA 5T6KA 3BWJA 3VBYA 3REPA 4FE2A 3ERKA 4EH7A 5AV0A 4J53A 5AADA 1CKJA 3PVUA 2IW9A 4MXOA 3LLTA 5DRBA 3EZVA 5BVOA 3G9LX 2C68A 5A3XA 5L6PA 5EDQA 5EYDA 4I6FA 2BPMA 2OLCA 1CKPA 1H1QA 4XG8A 5LCKA 3K5VA 3KF4A 3MWUA 4HOKA 4JRNA 3UC4A 3ORXA 5J5SA 5J9LA 3E62A 2H34A 4F78A 3C0HA 5T3QA 2YAKA 4IWPA 1WBTA 2CMWA 2FB8A 3D0EA 3IECA 3JR1A 3NEWA 3EL8A 4I6LA 2YCQA 4FTOA 5FLFA 3U9CA 3VVHA 4RX9A 5JQ8A 4BCQA 3GCPA 2E9PA 1BX6A 3QXOA 4G5JA 4TYGA 4MD9E 2WEIA 1PMNA 4CKIA 4FV4A 1KSWA 1YOJA 2V5QA 2G2IA 4M68A 5BUJA 4AZEA 1J7UA 3E92A 3IDBA 3KA0A 4MBIA 3DAJA 2WTIA 1JKTA 2WZJA 3NNWA 4XRJA 4O6EA 1PMEA 3TV4A 4BCFA 3KL8A 3FMKA 3KRJA 3BLRA 3D15A 3Q9XA 4WT6A 2Z7QA 4C2VA 3WE8A 2WPAA 2F4JA 3E87A 3THBA 4CD0A 2ZVAA 4IWQA 1E1VA 4H1JA 5E8TA 2QOKA 5KHXA 2JIIA 3VW6A 3QKMA 2HXLA 3DXPA 1ZLTA 3I1AA 5DIAA 1ZOGA 1P14A 3PP0A 3BLHA 4RWJA 4AUAA 3R7EA 4EJ7A 3QYZA 4XMOA 4QTCA 1RW8A 2YIWA 3R01A 2OJGA 1F3MC 3OFMA 3DS6A 1IEPA 1NT2A 2ZAZA 4OBOA 4IM3A 4RSSA 3BGQA 3RCDA 2YABA 2C6TA 5IQEA 5EM7A 2BUJA 5LARA 2OIQA 3UZPA 4BCIA 4F9WA 4YTFA 2JEDA 3I6WA 4CCBA 3BL7A 4YJPA 4YHJA 1ERKA 1FMKA 2X1NA 4K2RA 2XIYA 3NPCA 4X2KA 3VC4A 4I0SA 5JGDA 1SVGA 2F7EE 1OUKA 2R9SA 4XX9A 3C4XA 3W0OA 3ZO1A 3C51A 4AOJA 3QWKA 4H58A 3F2AA 2I0YA 5AAFA 4LL0A 3RHKA 2XALA 5A46A 3WYYA 4S30A 3V6SA 5B7VA 5H9BA 4QMPA 1YWNA 1JNKA 3AC2A 5JRQA 3EIDA 3P9JA 2BZIB 4JX7A 2C6EA 4ZS0A 2JBOA 5DEWA 3RK5A 5HO8A 3ORLA 5H3QA 4E93A 3F69A 2PK9A 3RVGA 3QTRA 2JIVA 4UB7A 4WNKA 4XHKB 2VWXA 2J0IA 4X2NA 4EH2A 1OIRA 1K2PA 2QO9A 4RQKA 5HCYA 5EKNA 4RQVA 4UY9A 2PZYA 3HRFA 4R7HA 2XAOA 2X8EA 2XANA 4KD1A 2WB8A 3FSKA 4B8LA 2IO6A 3UBDA 5FBNC 1OMWA 2UZEA 3T9IA 4W4VA 3BYMA 3U6HA 2OKRA 4D1XA 1H0WA 2C4GA 5HD4A 1JSTA 3Q60A 4QP4A 2UUEA 5HBHA 4CGAA 2YM6A 2NYAA 1KE9A 4HZRA 1IAHA 4E4LA 5JT2A 3KMWA 3V5PA 5E8UA 3ZEWA 2H8HA 3LCTA 4O0YA 4O2ZA 3RM7A 3TEIA 3D7TA 4JBQA 4G3GA 4DFUA 3DB6A 1ZY4A 3VONA 4QPSA 4S32A 4L42A 3WE4A 2WMUA 4BR3A 4FSZA 3SOCA 3QZHA 4AGDA 4CG9A 4LUEA 3PSBA 4UWCA 3QRIA 4FZ6A 4E6QA 5J7HA 2QCSA 3MBLA 1PW2A 2GMXA 2WTWA 4YJRA 1JPAA 2OWBA 3QRJA 4M14A 2PVKA 4P5ZA 3LPBA 5GJFA 5JZNA 5TKDA 4CEGA 3I79A 4KSQA 2WMAA 4ZEGA 5HO7A 5M08A 4HCUA 5DI1A 3N4UA 4NTTA 4FV6A 2CLQA 5HG5A 1U5RA 4KS8A 4BZDA 4Q9ZA 4U0IA 2W05A 3RPYA 5M51A 4FUYA 3CLYA 4A7CA 2EB2A 2GQGA 4MWHA 3IG7A 5ICPA 2JKKA 3UVQA 4ITJA 5GHVA 3EQPA 3RNIA 2ZDTA 4CZUA 3NUNA 3LJ2A 4C37A 3R00A 1Q99A 2X2LA 4FIFA 4GT3A 4JS8A 4PP9A 4A4XA 2BRHA 2JDTA 3TG1A 4HJOA 3K5UA 4Z7HA 1O6YA 1W0XC 3ETAA 3M11A 4PTCA 3QD3A 5A54A 2QOLA 4LRJA 3OF0A 4TWPA 5DRDA 3F3TA 4BICA 3S1HA 4FKRA 4G9CA 2BAQA 4IADA 4A4OA 3COIA 2Q0BA 3E5AA 4RFYA 4O2PA 3PIXA 3LQ8A 5KBQA 1W83A 5FEQA 2OF4A 4RIYA 3PXYA 4II5A 4QMZA 1KV1A 5EKOA 4NJ3A 1PRYA 2WMBA 3DKOA 5B2KA 5AUUA 5LWMA 4JAIA 1OPLA 2VTTA 3AXWA 3NYNA 4AOIA 1YDTE 5IQAA 4E4NA 5CYIA 3ENHA 4NK9A 3N4TA 4JI9A 1XH5A 2PE0A 5AUWA 4W8EA 2R3JA 1R0PA 3PUFC 4AA4A 4F9CA 3VBXA 1SM2A 3R83A 3AC3A 3COMA 1T46A 4YGAA 4FIHA 3R1SA 4Q9SA 4K11A 2OJIA 2VTIA 3MB6A 5HVJA 3AT4A 2W9FB 1JKKA 4ZLOA 4ID7A 4F09A 4YSMA 4D2SA 5J8IA 4GL9A 4JQ7A 4X3FC 4E6CA 4R5SA 3GC9A 4X2GA 4RIYB 4OTRA 3G6GA 3V51A 4V04A 3QQKA 3HZTA 4JG7A 4EZ7A 4FTJA 5F9EA 2C3IB 3EN7A 4LGHA 5FBOA 3QQJA 5HHWA 2ITUA 5K4JA 2I0EA 4JL9A 3VAPA 3W2CA 2R3HA 4DH1A 2J51A 4I5MA 4NCTC 3ZDUA 4FTIA 1XKKA 5JK3A 2PE2A 4DG3E 2WOUA 4XUFA 4BBMA 4FICA 3W33A 4DTBA 4F1OA 2IJMA 3C7QA 4B4LA 2R2PA 5F1ZA 2Y0AA 4FSMA 4X2JA 5AUYA 4Y72A 4PMPA 4FTCA 2OW3A 2NPQA 3FHRA 5E1SA 1B39A 1I44A 5AP6A 2WMVA 3I7CA 5FTOA 3QF9A 5ETIA 2WMTA 4D9TA 5AAGA 4FT7A 4EH4A 2W7XA 3VS6A 1OKWA 3ZUTA 4FNYA 4EH6A 3GBZA 2NRUA 3PYYA 4DFBA 4DGNA 3Q4TA 2WQBA 1KOAA 4E73A 1H4LA 5AP0A 3NVMB 4M67A 1U46A 4KABA 1Q5KA 1TQMA 4YSJA 2VNWA 4OTWA 4L00A 3V04A 2BILB 4FKTA 4TZRA 4RLKA 3C4CA 1QL6A 5CQWA 4AXDA 2E9VA 4O27B 3BHTA 5BX0A 5FXSA 4IM2A 4BRXA 2GU8A 4XP2A 3TTIA 4KB8A 4IC7A 2VWWA 2ITVA 4L68A 2J2IB 3MH0A 1R1WA 2X6DA 3UMXA 5C1QB 3TIYA 1P4OA 2OIDA 4CLIA 4GSBA 4EWQA 4J1RA 4NYEA 5BVFA 2GNJA 3OTVA 2PZRA 1YXTA 3G51A 3GXLA 5CI6A 5EHYA 5IQDA 4YJVA 3U55A 4WO5A 1OVEA 4XLVA 4WBOA 3EQDA 4ZTSA 3SOAA 2B54A 3P7AA 4YBKA 3VUIA 2FUMA 4H3QA 4I0TA 2WOTA 1FBNA 5H2UA 3VBWA 1YHSA 5BYZA 3TM0A 1ST0A 4YPSA 4QTEA 5CEPA 4GVJA 4I22A 5JKGA 2C3KA 1M14A 2C0OA 3IPHA 2BRGA 5CU6A 5ANEA 3HRCA 3MI9A 5CVGA 5LMAA 1URCA 5A4EA 4G3EA 2VTNA 3IOKA 4O0XA 4W4YA 3LE6A 3ZBXA 3ZH8A 4BTFA 3EQFA 5HVYA 5AP4A 3VF8A 4AXEA 4WBBB 4ITHA 5C27A 2JIUA 3O7LD 1U54A 3QFVA 4BDBA 4RT7A 1XR1A 3LXKA 3ODYX 3CTHA 1OL2A 1HOWA 4KUJA 4MQ1A 1S9IA 5EI6A 3LCSA 4NIFB 3W0RA 5IQGA 4FEWA 4MBJA 1MQBA 3MH1A 2BVAA 4OBPA 4U42A 3VQHA 3WF5A 3OP5A 4M15A 4C3FA 2XNBA 3NUXA 3L9MA 4C58A 3B8QA 3C4ZA 1PXKA 3FI8A 3EHAA 4E5WA 1OL5A 2PVLA 2R3LA 2YACA 3S95A 3ZZWA 3E8NA 3PJCA 4RVLA 5KZ0A 5EW9A 4LMNA 1JSVA 3DGKA 1XH7A 3BQCA 2W1HA 3MY1A 4HGSA 2C6LA 2HENA 3D2KA 2AC3A 2O5KA 2X0GA 4HNFA 5CEQA 3PLAE 2ZV9A 4FV3A 4FL1A 4TTHB 5DA3A 5G6VA 5LOHA 3HLLA 3RPRA 2QHMA 4AQCA 5AUVA 5AP2A 4CFVA 5GNKA 2BZHB 4GKHA 4BIDA 3BU5A 5HG9A 3JVSA 5BQ0A 2J90A 3WARA 4QP6A 3UQFA 3ZRMA 4FI1A 1OKYA 4QOXA 4CQEA 4LOOA 2QOOA 4HCTA 5BNJA 5ETFA 3OCSA 5D7VA 4EYJA 3F82A 3FLNC 3UMWA 2QG7A 5LVPA 2HY81 4N57A 2W4JA 3VS2A 4BCHA 4KBAA 3BL9A 4KWPA 2XIKA 1UU8A 2P2IA 5CEIA 3WF6A 5BMSA 2XNGA 5M4CA 1PJKA 1H26A 2VO0A 2YM8A 4M69B 4D5HA 3KIOC 3U87A 4A4LA 3BGPA 4KAOA 4YZ9A 1H27A 1WVYA 3RKBA 4EHEA 1FMOE 2W1CA 3PVWA 5FXRA 5C8MA 2IWIA 3QLGA 2OK1A 3R63A 2GFSA 4FVRA 5B0XA 5EDPA 3L8SA 3LQ3A 3FC2A 4G6NA 3PY3A 5EM5A 3OEFX 1OBGA 2HWOA 3FC1X 4XNEA 2EXCX 2QOCA 3TV7A 5CNOA 2W1EA 5KO1A 4F0IA 5CVHA 4NM7A 4AZWA 1YW2A 4WUAA 4DH7A 4P2KA 3GFWA 1XMLA 3GOKA 2JDSA 3PIZA 5JGBA 4JR3A 2YZLA 4QNYA 3OS3A 2PMOX 5LMBA 3T3UA 4BTMA 2OSCA 3FZPA 2CGWA 3AC5A 4IACA 5GJDA 3KXHA 3IGGA 3Q52A 3SXFA 3KN6A 1FGKA 1GZNA 2G2HA 1V0BA 1YOLA 2JKQA 4TT7A 3AC1A 5D12A 3VS4A 5IZFA 3AT2A 1WMKA 3QWJA 3BLAA 2IVSA 2PVYA 3JY0A 5KBRA 5IA4A 5E8XA 3FYKX 3Q2MA 3EB0A 4XG3A 4AAAA 5FEDA 2GQRA 4XV9A 4K9YA 4FTQA 2JDVA 5CTPA 5AX9A 5HIBA 1OPJA 4TNDA 4FKQA 3R28A 2BFYA 2RG5A 1SNUA 4YUQA 1A9UA 3HRBA 3VWAA 2UZWE 4PQNA 4NZWB 3PJ3A 1NVQA 2XVDA 4E6DA 4RLLA 5L6WL 3EL7A 3I7BA 1W7HA 4FODA 3ZYAA 2XK7A 4WNMA 4KRDA 2ONLA 4IB1A 4QMLA 4IH8A 2Y4IC 2Y9QA 3TI1A 2QOQA 3PE1A 1JSUA 4O7SA 4ZY4A 3BYVA 5JRSA 2UW0A 2ZM4A 3EFWA 5DGZA 1S9JA 3DZOA 4IB0A 5A4QA 3QUDA 5BVNA 3LMIA 1LEWA 1IRKA 2YITA 4F1MA 2CNVA 3EQCA 3G5DA 5AP7A 2ETMA 3H3CA 2O8YA 5KKRB 3V01A 3LFQA 5KZIA 3ZS5A 3ZLYA 2W0JA 1XJDA 4K8AA 3RNYA 2HIWA 4PL4A 4F9YA 1CMKE 3FMLA 2NP8A 4PL3A 4BDEA 1PHKA 4GFOA 4ZY5A 5M4IA 1Q8WA 4AZSA 4R6VA 3R8LA 2YCRA 3IW4A 5M4FA 5BMMA 3OEZA 3ZO2A 4O81A 3Q32A 4FL2A 4JXFA 3QRTA 4FKLA 3DXQA 2ZM3A 4NKAA 4TPTA 5D9HA 3WZEA 2BKZA 5A6NA 3TNQB 1Q8UA 3CS9A 4U80A 3KRLA 3ZRLA 1RE8A 4N4SA 5HE1A 3W2QA 4F9BA 3HNGA 4IIRA 2EVAA 3FI4A 5HLPA 2X8DA 4RVMA 3R7OA 3FE3A 3OY1A 3OG7A 1ZY5A 2W9ZB 2Y6OA 4ZK5A 4DEGA 3FAAA 5IDNA 2JAMA 2FSOX 1OL6A 4ASEA 3UNJA 3RINA 1NXKA 4AXAA 1MQ4A 1T45A 2HY0A 4K33A 4KBKA 2BZKB 4PTEA 1ZXEA 1UNHA 3F61A 4QMWA 3U6IA 4ENXA 5EQEA 3FWQA 3QTUA 5IEYA 3DB8A 1ZYSA 4C0TA 4YMJA 5CALA 3OHTA 4TYEA 4I1ZA 2AYPA 2W1FA 4J99A 4OBQA 5EHOA 1WVXA 3LMHA 2IN6A 3QYWA 4CFXA 5ANIA 1F5QA 4X6RA 2FH9A 3BI6A 4FIGA 3I4BA 3ZEPA 3ALNA 3ZUUA 2C1BA 2CKEA 3QQGA 4D4SA 2VWUA 4FV9A 3EZRA 2WNTA 4QPAA 2WQNA 2E9NA 3R04A 3TYKA 3QTSA 4ZJJA 3T8OA 2JLDA 2QURA 4HVSA 3M2WA 3MVHA 3V5TA 1Q41A 3A7HA 3HV6A 5ANKA 4U8ZA 4HZSA 5CF8A 1GZKA 3RZBA 1W8CA 3SLSA 4PV0A 4DH5A 2DYLA 5I4NA 3QGWA 2A2AA 3GCSA 3TUCA 3KMUA 3LLAA 4V05A 4QMYA 1KV2A 3Q9YA 3VBVA 4BCKA 4QMMA 3OWKA 2HOGA 3BPRA 5D1JA 3F3WA 4Y83A 2BTSA 4YC3A 3NDMA 5IMEA 3R22A 4BI2A 2GNLA 3HV3A 1BMKA 3FZSA 3MFUA 4FNWA 3VS7A 4DFXE 3WI6A 4ZMEA 4L7SA 5B2MA 5HU3A 3MSSA 5IISA 4QMQA 2XIRA 5JH6A 5M57A 2JITA 1SMHA 3EKNA 2ZJWA 5AX3A 2VD5A 3EQRA 4XG4A 4C59A 3MA3A 4QMVA 4Y73A 3VS3A 4I23A 1O6LA 4IFGA 4E6AA 3EN4A 2WIHA 3O8UA 4K6ZA 2BDFA 2JKOA 3VUGA 3W32A 5I9YA 4IW0A 4RIXA 5HNGA 4M3QA 3QAME 4NL0A 3P5KA 3QCYA 1SVEA 4ZZMA 4AW0A 4IAYA 3PPJA 4A9RA 2W4KA 4PX6A 4E8AA 4CG8A 4GJ3A 4OR5A 2J7TA 2FYSA 1V0OA 3D83A 2UZNA 3NNVA 4L3JA 4MVFA 3UDTA 2CCIA 4XP3A 1NA7A 2IVVA 3ZTXA 1LPUA 1LEZA 4BIEA 3HKOA 4X3JA 5AV1A 3FPQA 4U44A 1RQQA 3DY7A 3FEGA 4MHAA 2C6IA 4C62A 3FMHA 1BKXA 3R71A 4PY1A 1WVWA 3KXMA 3PTGA 4ZTMA 3P79A 4K0YA 3I0QA 3MFTA 1FOTA 3GCVA 4MXYA 3K3JA 2ITZA 4MAOA 4NUSA 2J0MB 2YCFA 3PIYA 5IA2A 4RIXB 2YERA 4FKOA 4L45A 3RAIA 1Z9XA 2YA9A 3GCQA 2ZB0A 3LHJA 4KIPA 3FUPA 5HE0A 3V5WA 3VRYA 4R7BA 4ITIA 4FG9A 3FXWA 3PUPA 3PXRA 2O64A 3W2PA 4LYNA 2VTOA 3A4PA 5CAPA 5LWNA 2BROA 2CNUA 1TKIA 4UWBA 3UQGA 4FV5A 4GG5A 2WO6A 4FTUA 4JT3A 3ZZEA 3AG9A 3PXQA 4U9AA 4W8DA 2CCHA 2Q83A 5EG3A 3PWDA 4D28A 5HI2A 4Y8DA 2GNFA 4A07A 3P0MA 3UTOA 1K3AA 5FM2A 2F57A 4A9SA 5FTQA 4E5BA 3O8PA 1H00A 2WTKB 1H8FA 2XUUA 3CY2A 5EYCA 3DJ6A 4YHFA 3K2LA 2HZIA 5EDRA 3RPOA 3NYVA 1Y6BA 4RG0A 4F0GA 3BGZA 4ZTHA 2ZMDA 4C61A 1BI8A 2V55A 3HV4A 3ATSA 4FR4A 3R6XA 4M0YA 5A14A 4XBUA 4YURA 1LP4A 1NVSA 3GUBA 3HV7A 5LCJA 4KNBA 2JDRA 2YIXA 3BHVA 3UE4A 2YISA 2HZNA 3TNPC 3UIUA 1OL1A 3L8PA 4UYNA 5C03A 3DBQA 3WIGA 3ORIA 2I1MA 2XAMA 2XKDA 5I9XA 3PY1A 4LM5A 2OFVA 2WMRA 4JDJA 5IA0A 4G5PA 4YNOA 3GQLA 3OD6X 2W99B 2XYNA 5CSWA 3C4FA 5BUIA 3NFGB 1E1XA 2VN9A 3A7JA 4JBOA 5D7AA 3RAKA 1WBSA 4BYJA 3U6JA 2ETKA 3BHYA 2ZV7A 1JBPE 4QNAA 5M55A 2UZDA 1ZYCA 1J1CA 4F6WA 1U5QA 4FKSA 4MQ2A 1YHVA 3D5WA 3BWFA 2X9FA 3F5UA 4QMUA 4GH2A 3VS0A 3FMEA 4IAKA 4TRLA 2UW6A 3AMYA 3LVPA 5LMKC 4FTLA 3V8TA 5DPVA 3P1AA 4EZ5A 4BN1A 4CNHA 3C5UA 3QTIA 4GK3A 5HLWA 5IQHA 2CLXA 4D1SA 1SVHA 3GEQA 4IAFA 3C50A 4UZDA 4YO4A 4X21A 4ZS4A 3GQIA 4FSWA 2GCDA 4GT5A 2YWPA 3R8PA 2R3MA 3CSVA 3KREA 1CDKA 1STCE 2W5AA 1MRUA 3LAUA 4QP9A 3KXNA 2YM5A 4EWHA 4O21A 5JSMA 1PXOA 4YLJA 2BIKB 5CSXA 3U51A 4D4YA 5JEBA 4NW6A 2X4FA 3DFCB 4L3LA 3UYTA 2UW5A 4NT4A 4IAIA 4O7WA 4KKHA 5DT4A 4ZSLA 2JFMA 3HECA 3ML1A 5EK7A 4AZFA 4C4FA 3D5UA 3L9LA 2WU7A 2VWZA 2IVTA 5AUZA 1ZRZA 5FXQA 1CKIA 2ITYA 2OGVA 5FQDC 2JGZA 4G6OA 4QP8A 3NLBA 4FNZA 5JN2A 1H08A 4OT6A 4PP7A 4DAWA 3MIAA 4JG8A 4MYGA 5AA9A 3OWJA 4Q5HA 5AP1A 4QTDA 4Z9LA 5E8WA 4I5PA 5FDPA 3DKCA 5IA1A 4ASDA 3F6XA 3LXLA 3UVRA 2PVRA 2X2MA 3NCZA 3UGCA 3G6HA 4L43A 3VJNA 3FMJA 4AW1A 3UIMA 4GS6A 2DWBA 3MPAA 2QLUA 4DT8A 5CZIA 3RK7A 5TF9A 2CHLA 3QHRA 3QQHA 4JQ8A 4QDVA 3DBDA 4O7LA 4C4JA 3ET7A 2IZRA 3UIBA 4ZJVA 3P7BA 2XB7A 2YM7A 3OWLA 4JMQA 3A7GA 4Y5HA 2J0KA 5AV3A 3R8ZA 2A19B 1Q97A 3NX8A 4TYIA 3OVVA 3CQUA 4M13A 2QI8A 3BIZA 1I09A 4O38A 4XG6A 5GINE 3IDCA 4ZSJA 4BB4A 2WEVA 4UYAA 1J3HA 4MH7A 4I94A 4ZXTA 3ZFMA 5CF4A 5DVRA 3AKLA 4JNWA 3DBFA 1SNXA 2WTVA 4TWNA 4CFUA 4ZMFA 3EFJA 4OTGA 5DWRA 3TZMA 2XS0A 4FGBA 2G1TA 2VO6A 2J4ZA 4IVBA 4Y85A 3H4JA 5KUPA 3U4WA 2G2FA 4GYGA 3H10A 1OKVA 3VRZA 4X3FA 2JC6A 5KHWA 4EKLA 2X9EA 1Z57A 3PPZA 1BUHA 3TN8A 2X2KA 3BBWA 3FYJX 3JUHA 4HGLA 1VJYA 3UNZA 3EMGA 4BDFA 4CFNA 3CPCA 4HPTE 4IAZA 4XG9A 4O0VA 3TIZA 4E1ZA 2O65A 2A4LA 3P7CA 4Z3VA 4CMOA 5CLPA 3F3ZA 3A4OX 3IQ7A 3TNHA 3IOPA 4UALA 4FOBA 4EK6A 1BI7A 1RDQE 4DTAA 4N6YA 1JQHA 3UO4A 4MX9A 3EFKA 4ZIMA 3FMMA 3PG1A 4OW8A 4UWYA 4EOOA 4MUQA 4GMYA 2H9VA 5IPJA 3DA6A 4OTFA 4PMSA 5C9CA 4HVGA 2AC5A 2KTYA 2R3NA 2PL0A 3C0GA 3HMPA 3W10A 3EFLA 3QTWA 1BLXA 3ELJA 1PYEA 5HZNA 1ZYJA 3QTZA 4DDGA 1OUYA 2GHGA 3LFAA 3NW5A 4EBVA 3D7TB 2CGUA 2QOHA 3PG3A 4RIOA 4AX8A 4BDAA 5AUTA 1GNGA 5L3AA 3UPZA 3OC1A 4RBLA 5CXZA 2RL5A 4FTRA 3ALOA 4IBMA 4ZAUA 4BY9E 3AMAA 4R1VA 3SD0A 3NMUF 4BGQA 3PE2A 3GENA 4XV2A 3UDSA 3BRBA 2CGVA 3QD0A 4EL9A 1AGWA 4IWOA 3V5QA 1J7IA 4IX3A 4NKSA 4B8MA 3DKFA 5IQBA 5LVMA 4LRKA 4AACA 4AE9A 4E5AX 3QLFA 5A4CA 3RPSA 4AN3A 5HGIA 2R3GA 3R2YA 4C4IA 4CRLA 2YIYA 5JFWA 4EK3A 3ID6C 3BBTB 1FVTA 4FL3A 2QOIA 3M1SA 4YZBA 3KY2A 3SQQA 1V0PA 2NNWB 3P23A 4ERWA 4I92A 5J1VA 3OWPA 4C02A 2PUIA 5M06A 2Y6MA 4LUDA 3LKMA 1G8KA 2BMCA 3Q4UA 1PKGA 3NFFB 1MRVA 4QYHA 2P3GX 1VYZA 4IX4A 3QQUA 3QUPA 4RZWA 3Q4CA 3HUBA 4YC8A 3WZUA 4ZZOA 3PDTA 1WFCA 4LMUA 3ZLSA 3GB2A 1KE5A 1O6KA 1KE6A 4YO6A 3ZRKA 3ZSGA 4EH3A 2I40A 2ZV2A 4V01A 1GZ8A 1OIQA 2VRXA 4I3ZA 3ZU7A 1KWPA 3CIKA 4APCA 5CAUA 5HX8A 2ZFYA 3F7ZA 4BGGA 5HNBA 1FQ1B 2XJ2A 2XBJA 2WGJA 5H8EA 4CXAA 4EC8A 3R21A 2W5HA 3S00A 2FSLX 4RJ6A 3WZKA 1PMVA 3S0OA 1QPJA 2X7OA 5F20A 5IDPA 4IAAA 4C4HA 2VTLA 2JDOA 3E88A 5AIKA 1M2QA 1AQ1A 2XYUA 3FL5A 4L7FA 4TN6A 4XV3A 4Y95A 5CZHA 3UOKA 1UA2A 3WF7A 2UZLA 4AU8A 4D1ZA 4XP0A 3WZDA 4HYUA 4IFCA 3UIXA 3UZRA 4ACMA 1ZAOA 3HL7A 4PNIA 3DK3A 4KINA 2WTJA 3VO3A 3BYUA 5JQ5A 3UP7A 4YTIA 1OZ1A 2RFEA 4RA5A 4FTKA 4C34A 2HZ4A 2VUWA 4V0GA 4PL5A 2QHNA 4ANLA 2XK9A 4M97A 1ATPE 4KRCA 2YHVA 3C9WA 3QUEA 4FOCA 3GT8A 3PY0A 5HVKA 4WUNA 4ASXA 2Z8CA 3PXZA 3DNEA 4PMTA 5CAVA 3FHIA 3TKIA 4R77A 1YXSA 1PXNA 4AQKA 4QP2A 2ZYBA 3NW6A 2XNMA 4G3CA 2GS2A 2GDOA 4CFFA 3BX5A 3GC8A 2JAVA 2W17A 3NUAA 3QBNA 4XOZA 4XEYA 3QKKA 4PF4A 4EOPA 1PXIA 4BKJA 4N6ZA 1YI6A 3MN3A 4LV8A 4BDJA 1YDSE 1G8SA 2BZJA 2UV2A 3MY0A 4NW5A 4V0GB 3TJCA 4DA5A 4EORA 3C4WA 4RMZA 4UX9A 1F0QA 3DDQA 3EN9A 4H05A 3FY0A 1Y8GA 3PWYA 4O0SA 4C36A 2CKOA 3PVGA 4IZ7A 4WHZA 3A99A 4X0MA 4YZNA 3UG1A 1Q3WA 3CY3A 1AD5A 2YIQA 3DCVA 3N51A 1G3NA 3V5LA 4E7WA 4RX8A 2FSTX 2RFSA 3OUKA 4FKJA 4P4CA 4WOVA 4MBLA 3F3UA 2YDKA 3HGKA 3SW4A 2LGCA 2P0CA 5BYYA 3FXZA 1WBPA 3OY3A 3R30A 4DTKA 4I93A 2QR8A 1UWHA 5C26A 3C5IA 3D94A 3W0SA 4QP7A 4BCNA 5K5NA 5CAQA 4FG8A 3ZBFA 1OPKA 1M2PA 5JFSA 1JKLA 3GVUA 2VGPA 4BCOA 4R3RA 3ZM9A 5AWMA 4LV5A 5KCVA 3VN9A 2PE1A 2BAJA 1OI9A 4IC8A 1QPCA 3CR0A 3PA3A 5J9YA 2QONA 3D9VA 3QC9A 4G3DA 3W8QA 3CJFA 3KCFA 4O84A 3WOWA 4EOMA 3FLSA 4G1WA 5BVKA 4HW7A 4EQUA 5I5ZA 4NM5A 3HEGA 4R3PA 3VNTA 5CU0A 4KSPA 1URWA 3OXIA 4F0FA 4RWKA 2VTRA 4FGRA 4EOQA 4AZVA 2W1IA 4FTNA 4Z16A 1PKDA 2HAKA 3FLZA 4BYIA 4D9UA 1Q8TA 1GIIA 2VGOA 3UQCA 2R3IA 4D0XA 3HMNA 3O7LB 3RALA 3KF7A 3BV3A 3Q4ZA 4KA3A 3G0FA 3PP1A 4M12A 2C6DA 5I9UA 5IMXA 1U54B 3LIJA 3NRMA 5GJGA 2AEGA 1H01A 4DEAA 3RPVA 4U43A 2B53A 3CD8A 3TNIA 4TL0A 4FZAB 4IJPA 5CEOA 5JFXA 3F5GA 2QD9A 3KK9A 3RK9A 3RAHA 1BYGA 3JPVA 3Q5ZA 3ITZA 4FKWA 3G15A 5CEKA 4WG4A 4FEXA 1XBBA 1XHAA 5KMNA 3UO5A 3F88A 4RA4A 4JIAA 4ZP5A 2BRNA 3DQWA 3AKJA 5HIEA 1FPUA 4O83A 2QVSE 4G9RA 4QP1A 4A9YA 2VWYA 1XWSA 2PU8A 4X6QC 5HLNA 3OBJA 3ZCLA 3LQ5A 3ZSHA 3HMIA 2C5VA 4AOTA 4C3RA 1U59A 5FGKA 4N0SA 3K54A 4WIHA 4MXZA 2QLQA 4HYHA 5AJQA 1MP8A 2B7AA 3OMVA 4IWDA 1LUFA 2O63A 3QX2A 1NY3A 3CP9A 3UODA 3ENMA 4O22A 4KKGA 2ZM1A 3TZ9A 3MIYA 4U6RA 2UW9A 3GC7A 3UZTA 4FT5A 3IW6A 3T3VA 5L2SA 3SVVA 2DQ7X 2ERKA 3AC4A 4GUEA 5CT0A 5J1WA 3FL4A 2C6MA 2OJ9A 1XBAA 5DT3A 3TUDA 1VLRA 3ZC6A 3B2TA 2OH0E 3MESA 3DPKA 5CI7A 3Q6UA 5LVLA 1UNLA 4P5QA 2GHLA 5ITAA 1H28A 4EK5A 3UNKA 2C30A 5KMMA 2OXXA 4HPUE 1OKZA 4RGJA 1FVVA 4Z7GA 3OXTA 1Y6AA 3BU3A 5HTBA 4DLIA 3JVRA 2CKPA 1CTPE 2P2HA 2YFXA 2DUVA 2REIA 2FGIA 3FY2A 4LI5A 4N70A 5DEYA 4AGCA 2BHEA 2YDJA 4CV8A 4C4GA 4MNFA 3DOGA 3MVLA 3ZHPC 1YI3A 2BDJA 2ZOQA 3CKXA 2B9HA 5FP6A 4EYMA 3OT3A 1JKSA 4LOQA 2GNHA 4FZ7A 4JBVA 1WZYA 3A8XA 4MWIA 3FQSA 4DG0E 2PPQA 3TACA 3VS5A 2ITTA 4DFLA 5L2WA 4ZTRA 3NVKI 1TFFA 5HG7A 4CKRA 3AC8A 3AT3A 2C0IA 4EOSA 4YJOA 1CSNA 3Q2JA 4GKIA 2BCJA 5GIOE 3NR9A 1Q4LA 2A1AB 4G17A 2UVYA 3HAMA 3DDPA 4DH8A 2OI4X 4USDA 3G2FA 1Y57A 4NTSA 4ACGA 2VX3A 2A0CX 3FKLA 3TZ7A 2ZV8A 4QTAA 3LFCA 4UEUA 4FTMA 4YJQA 4ANMA 5CASA 5EQYA 5DLSA 1Y8YA 5EI8A 1GOLA 5CEMA 4QQ5A 3FI2A 2VTAA 3SGCA 4NH1A 5TR6A 4LL5A 4ZSEA 5ANGA 2RFDA 4O6LA 3DXNA 3DU8A 4WRGA 4EK8A 2ERZE 3TTJA 4I6BA 5CQUA 2PZIA 3W16A 2QKRA 3BLQA 4DEEA 3I60A 5A4LA 1XO2B 2OJJA 2VX1A 3NNUA 3GU6A 1Q24A 2PHKA 2W96B 4I6QA 4J95A 2C5NA 4RJ4A 4FTTA 5ACBC 2Z60A 3P5JC 5L2IA 2QNJA 1XMMA 3CKWA 5ETCA 2JKMA 3H30A 2C5YA 2O3PA 3PJ2A 4HNIA 3SC1A 5IQCA 1BL7A 1RJBA 2VWIA 2WHBA 1KE8A 3VS1A 3M42A 2HXQA 3UOHA 5K4IA 5TT7A 4M84A 2GPHA 3OW4A 2B55A 5EQPA 2OXYA 1OBDA 1HCKA 2ESMA 3GNIB 3KB7A 2R3KA 4H3PA 4IDTA 4O7VA 5EM8A 1ZMWA 3SXRA 2WXVA 3R73A 2F9GA 4NFMA 4DCAA 5M09A 3OCBA 4QO9A 1GZOA 2OIBA 1KOBA 4J98A 3QTQA 1FVRA 3LFFA 1YDRE 5FEEA 3RWPA 3EN5A 4F6SA 3RWQA 4I0RA 4FT3A 1JLUE 3AD4A 2P4IA 4GRBA 4R5YA 2W06A 3GP0A 5K5XA 4EUTA 3BE9A 2PWLA 3QC4A 4FBXA 2RF9A 4U3ZA 2G9XA 3W0PA 3ORKA 5ACKA 1UU3A 4F7NA 3R9OA 3TV6A 1ZZLA 4RVTA 4BCMA 4RWIA 3GFEA 3DAKA 5E8VA 4G16A 1QPEA 2XK8A 1UWJA 3V6RA 1ZZ2A 2PUNA 2RGPA 2PVNA 4QT1A 4USFA 3UOJA 3LM5A 4XS2A 2I6LA 2R3PA 4EQCA 2XRWA 3B8RA 3QALE 4BCPA 2C5XA 3Q96A 2Z2WA 1TVOA 4YJUA 4R3CA 3R1NA 1W84A 3Q9WA 3QQFA 4QRCA 4TYHA 3VHEA 1XH8A 2XZSA 3VUMA 3MTLA 4PDOA 4RC2A 4ZSGA 4DHZA 3GU7A 2VAGA 2UW4A 5HNIX 2WMSA 3FQHA 3FZTA 5CF5A 3QA0A 3DBCA 4AN9A 1OGYA 2QQ7A 3DT1A 4DN5A 3LXPA 3QCQA 3ZFXA 3F3VA 4CV9A 5BVWA 4L8MA 5C8NA 5BUEA 4S31A 2GHMA 3PA5A 4FYNA 4IE9A 3VIDA 2OBJA 3PFQA 4GFMA 3COKA 3I0OA 4QTBA 2VU3A 4J8MA 4QEBA 2LAVA 4DGGA 1Y91A 4Z55A 2B1PA 3LFSA 4DF3A 5AA8A 4UBAA 4U40A 4DEHA 4B9DA 2Y7JA 2O0UA 5ETAA 4X2FA 4S33A 2HCKA 3PZHA 3U4UA 2OG8A 2R3OA 4AT3A 4DYMA 1M52A 3TMOA 5AEPA 2GTNA 4RRVA 4CCUA 4FV0A 3P78A 4UN0C 4ZJIA 4AW2A 1ND4A 4O7YA 4DITA 4GK4A 4AFEA 2XNEA 5C4LA 4WD5A 3F5PA 2XK3A 4AT4A 3OCTA 3KN5A 4UV0A 3SXSA 2YJRA 5EHLA 3FKNA 2VWBA 4O86A 1TQPA 4BHZA 2VWVA 2OXDA 4EOKA 2BRBA 4H39A 2V7AA 4I21A 3FSFA 2XEZA 2XNNA 3IONA 4GV1A 3OXZA 4D2RA 1G5SA 3F2RA 4LV7A 4S34A 4APPA 5FP5A 4BDKA 4YJSA 4DLJA 3ORNA 4XJ0A 1OM1A 4FSTA 4DFYA 4H36A 4F7JA 1OB3A 3TWJA 2W4OA 3BU6A 3LMGA 2J6MA 5CWZA 1VEBA 2V0DA 4D4VA 3PRFA 2CJMA 5CS6A 4TY1A 4MKCA 5AV2A 3RCJA 2WQOA 4NFNA 2OF2A 3GU5A 4FKVA 4AFJA 1OITA 2P33A 5CU2A 3QQLA 2X8IA 3L8VA 4EZ3A 3NUUA 4QQTA 3GOPA 3A2CA 3DZQA 3TZ8A 2WAJA 3BV2A 3IW5A 1OIUA 3KEXA 3OOGA 4YNEA 3R7IA 3ZOSA 4EHVA 4U81A 4AG8A 1O9UA 4MCVA 1ZARA 2J0JA 5DR9A 4CRSA 1DI8A 5M56A 4L67A 4ALVA 2VTJA 4DH3A 4HVIA 5J87A 1IR3A 3ANQA 5AP3A 4CTBA 4EI4A 1W82A 4L6QA 2XIZA 4GU9A 5KMOA 3LFDA 3AQVA 1CM8A 3A62A 3W0NA 2EB3A 5EW8A 4DCEA 2KULA 2QOFA 4AS0A 4EH5A 4M0ZA 2CDZA 3QX4A 5CNNA 5KMLA 5M44A 3AGLA 2UZVA 4FV1A 5FTGA 2P55A 4AZTA 3DTWA 5F94A 4J7BA 2IZUA 4GT4A 4AT5A 4F70A 1PXJA 3S4QA 4WNOA 4HVHA 5IF1A 3R9NA 1NW1A 1YKRA 1KUTA 4QYFA 5CT7A 4KIOA 1Q61A 3FLWA 2ZMCA 2I0VA 3GCUA 3QZGA 4TKSA 4IM0A 2CN8A 5CANA 3EQBA 4FEQA 3S2PA 1APME 4D58A 5ANDA 4LGGA 4FIEA 3T9TA 4A9UA 4J96A 4TWCA 5IH6A 1PXMA 2PMIA 3D5VA 2YCSA 3KCKA 4RX7A 2WMWA 3TJDA 4F9AA 4GEOA 3E64A 2WKMA 4PRJA 2R3QA 2WD1A 4I4EA 4JLCA 2QR7A 5D11A 3SHEA 5ANJA 4CT1A 3FQEA 3CXWA 4BI1A 5DHJA 2B4SB 3OBGA 3PSDA 4OUCA 4GJ2A 4DGMA 1TQIA 4PTGA 1P2AA 4FK6A 2UVXA 3ORZA 4FT9A 2BTRA 1B6CB 3F9NA 5CSPA 2YZAA 3SA0A 3WBLA 4CLJA 4C3PA 4RC4A 3G33A 3KRRA 1L3RE 4X7QA 4EOJA 1UNGA 1ZWSA 3VUDA 4CVAA 3E3PA 3VJOA 1YQJA 4ALUA 2ACXA 3E8EA 4ANSA 4FTAA 4H1MA 5LXMA 1H25A 3II5A 4LRMA 1H1WA 4O0RA 4FV2A 4JBPA 4IHPA 4QYYA 3ATTA 2PUUA 3TKUA 4ZTQA 5IEVA 3BELA 4MD7E 4GCJA 1OIYA 3R9DA 4C35A 4BBFA 2FO0A 2GS6A 1E9HA 5EW3A 4DBXA 2DS1A 2YEXA 4H3BA 3FJQE 3R9RA 5CSVA 2VO7A 4R1YA 5L2TA 2CN5A 3BEGA 5AV4A 4FEVA 4EOIA 2UVZA 5DG5A 4E26A 2UZOA 1H1PA 2HELA 4JQEA 4GU6A 4ZLZA 5IQFA 3Q9ZA 4MEDA 4YZMA 3E93A 4AWIA 3FMDA 3MV5A 4L46A 3NNXA 3WIKA 3R8MA 2WTKC 2C6OA 1R0EA 4YU2A 4FA2A 4XYFA 3FXXA 2UZUE 5DN3A 4WG5A 5IH4A 5K3YA 1J91A 4EH8A 2QU6A 4FJVA 4MTAA 4ACHA 4ZY6A 1JAMA 3EQIA 4RFZA 2B9JA 3FV8A 4FSUA 5HCXA 2SRCA 2GFCA 5A4TA 5EFQA 2PSQA 4QMNA 3KULA 4PWNA 4YR8A 3QZIA 4RC3A 5LVOA 4FMQA 3D2IA 5DYJA 3KVWA 2E2BA 4AF3A 1MUOA 1ZOHA 4TNBA 3WZJA 2R7IA 4A06A 4ANQA 2G01A 2ZB1A 2ZDUA 5KE0A 4DT9A 3A7FA 1UU7A 3MYGA 2CKQA 3U54A 2GTMA 4JDKA 3RTPA 4DBNA 3EJ1A 5H8BA 1HCLA 3O50A 2R0UA 4IVCA 5CSHA 3KK8A 4CZTA 4FVPA 3NZ0A 4RX5A 2XIXA 3FMNA 2WQEA 4J97A 5M4UA 2HW6A 2VTHA 4O96A 4IZAA 3KFAA 3DAEA 1DM2A 2QG5A 2XH5A 3MGYA 4EEVA 3O23A 4L52A 3QCXA 2IW8A 3DJ5A 3NSZA 1GJOA 4NCTA 4EK4A 5C4KA 2QO7A 4J8NA 5E92A 1R3CA 4J71A 3TDWA 5DR2A 3U9NA 4BIBA 4F63A 3C4EA 5E4HA 3Q04A 5K9IA 1H24A 1YWVA 3KULB 3O0GA 5CF6A 5KNJA 3QZFA 2XKFA 3FDNA 3O2MA 3MW1A 4CFWA 3AMBA 1GIHA 2W1DA 4JOAA 5AFVA 4AP7A 5T68A 5KX8A 4GK2A 3ZC5A 4X3FB 4BDGA 4IDVA 5E7RA 4BF2A 4GIHA 2BRMA 2X39A 3FZRA 3TKHA 4F64A 3OW3A 4IEBA 3G0EA 4K1BA 1WBNA 4MK0A 4DG2E 4OTQA 2E9UA 3ZFYA 3IW7A 5E8YA 3UVPA 5E9EA 4CFMA 3RGFA 1H07A 3QKLA 4EONA 3N4VA 4WSYA 4BDHA 3TL8A 4CMUA 1Q62A 3H9OA 4EC9A 4O7ZA 4YJNA 4A9TA 3ORTA 4JVGA 4K77A 4AGWA 3TCPA 2F2UA 3KQ7A 5HIDA 3KKVA 3MDYA 3MVJA 4I20A 2FVDA 3W2RA 5HKMA 3QXPA 2ITWA 4F99A 3HVCA 1FGIA 3RI1A 2VTSA 4GG7A 2JD5A 2XA4A 4HYSA 4NU1A 1H1SA 1M17A 2RFNA 3PVBA 4DEIA 2XK6A 3H0ZA 3FZ1A 3N9XA 2BR1A 3L9PA 3ZLWA 3VF9A 4DC2A 5IEXA 1OGUA 3CEKA 3KU2A 3AKKA 3IS5A 3VW8A 3NIEA 2XCHA 3PSCA 3MPMA 2ITXA 4MXAA 3BHUA 5A9UA 5BV3A 3LFNA 3ROYA 4JR7A 3E8DA 2V7OA 4GUBA 5IUHA 3O5AA 4U5JA 3UO6A 4O7TA 2ITNA 4IX5A 1B38A 4HCVA 2R3RA 1Q8ZA 5GIPE 3W0QA 3HP5A 5HCZA 2B9IA 4O82A 4LOPA 2PMLX 2CSNA 2B52A 4XG2A 2OICA 1QMZA 4NJDA 5JFVA 2QC6A 1A48A 3KXXA 3R7YA 1PY5A 5CAOA 2WMQA 4QQJA 4C33A 4EOLA 3NW7A 3ZSIA 4B7TA 3CC6A 3RAWA 3O71A 4DHIB 4RJ5A 4QP3A 3QRKA 2HZ0A 3MJ2A 5CVFA 1WBVA 3DK6A 5EI2A 4XH6A 1JVPP 5HBEA 2CPKE 3SG8A 4YLLA 1NVRA 3BYOA 2B9FA 4O0WA 4OLIA 3W55A 2PZ5A 2F2CB 2HK5A 3JY9A 5B2LA 4WNPA 2QODA 4JDIA 2H96A 2PY3A 3DTCA 3JYAA 1PF8A 3NYOA 4IB3A 4O0TA 3MB7A 2YIRA 5DNRA 5I0BA 4ERKA 2RKUA 3CCNA 1YI4A 5E91A 2J9MA 2ITQA 3DKGA 3POZA 3AD6A 2GNIA 4QMXA 2J50A 3EKKA 4Q2AA 1A06A 3SV0A 3JS2A 3ACJA 3F2NA 3EWHA 4QYGA 4DEDA 4U41A 4L44A 4RJ3A 5FG8A 1M7NA 1U4DA 2X7FA 2Y8OA 3FZOA 3LZBA 3MH3A 3O17A 4YJTA 3VBTA 4F7SA 2PTKA 2WTDA 3GGFA 3ZDIA 3PA4A 3GC0A 3RP9A 3QA8A 3PFYA 2ITOA 3HAVA 1WBWA 3BZ3A 5HEZA 2C5OA 5J95A 3SKCA 1LR4A 4WRSA 3SW7A 4P90A 4RFMA 4ZZNA 5HTCA 3BKBA 3FLYA 2OO8X 3NYXA 3R2BA 4FKIA 2OZAA 4FG7A 3SRVA 4QMOA 4RPVA 2YWVA 3W1FA 2IG7A 3DBEA 3H9FA 3H0YA 2C3LA 4FK3A 2RG6A 3HA8A 4C4EA 4F65A 1YRPA 3D5XA 4HVDA 3LJ0A 3FBVA 3BYSA 2XNOA 3HUCA 1M2RA 4RIWA 3SX9A 1PXLA 4XCUA 4FSYA 4ACDA 5EOBA 1L8TA 5IG1A 5IUIA 4FYOA 3P86A 4BDCA 2WQMA 1GY3A 4FUXA 4IVDA 3VBQA 3R8UA 1EH4A 3V8WA 4B6LA 1WBOA 2W1GA 4HGTA 3Q5IA 4I6HA 3QL8A 4GFGA 2F7ZE 3COHA 4NM0A 5HBJA 2OZAB 4ZOGA 3KVXA 2R7BA 4GIIA 5L8JA 2ETRA 2YAAA 1XQZA 2BAKA 3KXGA 4AXCA 3NUYA 3SRVB 2UW8A 3ZMMA 4XRLA 3W0MA 5FUTA 4Y5QA 3E3BX 2BDWA 1YXUA 2W1ZA 3BEAA 4IMYA 4IVAA 2HW7A 2JFLA 4LDTA 3AGMA 4IQ6A 4RIWB 3CPBA 4OT5A 3UYSA 3ZUVA 2VZ6A 3HX4A 1XBCA 3FKOA 2Z7RA 4C38A 4EBWA 2OZOA 2PVJA 2IW6A 5EH0A 5EOLA 5IA3A 3Q3BA 5D10A 1YWRA 3OUNB 3WF9A 2X7GA 2VX0A 3LCDA 4ONAA 4USEA 3CE3A 4PDPA 3NWWA 2IZTA 2WELA 4NWMA 2OU7A 4FV8A 3DLSA 2F49A 5BVDA 4MF1A 3ZXTA 4RWLA 5J9ZA 3LW0A 5CX9A 4YBJA 2JBPA 4I5HA 3VQUA 3EOCA 3LM0A 2J0LA 3R02A 4WKQA 3W18A 4JAJA 4TW9A 2X4ZA 2YM3A 4FIJA 3TXOA 4I41A 3UPXA 4EKKA 4EHZA 2I0HA 4FV7A 5ANOA 5LJJA 4C7TA 3R9HA 2FSMX 5TOZA 3UJGA 1YXXA 4JIKA 3KXZA 4YHTA 1MRYA 3ZO3A 3O96A 5LVNA 3OT8A 2WMXA 2Y4PA 5DH3A 5AUXA 3JXWA 3NAYA 4BTJA 4QMSA 3LJ1A 2QO2A 5TO8A 4AA5A 3ZM4A 4R78A 3IK3A 2G15A 4CSVA 2YDIA 1UVRA 5HU9A 5IQIA 1H1RA 3MTFA 4F1TA 5M53A 5FDXA 2EWAA 2BKKA 3MY5A 4D5KA 3D14A 2BHHA 4MNEA 3W2OA 3OOMA 5DT0A 3V3VA 1UV5A 2Y4IB 3BQRA 3DNDA 5I9WA 2B0QA 4G2FA 1VZOA 3EYHA 4MXCA 4L9IA 3HYHA 3F5XA 5EYMA 5IU2A 1REKA 2O2UA 2VO3A 3POOA 4ANBA 2GNGA 4O0UA 4RJ8A 5DBXA 2R3FA 2J5EA 3RJCA 1ZMUA 4O7RA 4D0WA 4CT2A 3FI3A 3A8WA 3CQWA 3PPKA 5CU3A 3HP2A 3LXNA 2VTQA 4IX6A 4O7NA 3SAYA 1X8BA 2R64A 4M7IA 4I24A 3MFRA 4AGUA 4F7LA 1IA8A 4G31A 3A60A 4HYIA 2XCKA 1XH9A 4J52A 5C01A 2YJSA 1P5EA 4RVKA 3R8VA 1IAJA 4BCGA 4AW5A 4BZOA 5JMSA 4TYJA 4MNEB 3ZONA 3QRUA 4FIIA 3K3IA 4DGOA 2FA2A 2HWPA
chains in the Genus database with same CATH topology
3ORPA 2IVUA 3QD4A 3CBLA 3L9NA 2OJFE 3U8WA 4L01A 5AAEA 1SYKA 4Q5EA 3EYGA 4ENYA 3O51A 3G9NA 1UU9A 5FRIA 3CTQA 3VUKA 1KE7A 3ACKA 2PULA 5DOSA 4YTHA 4U7ZA 5L6OA 3E7VA 1FINA 1M7QA 4F08A 2Z02A 3IW8A 5G1XA 5KMJA 2QKWB 3Q53A 1UKIA 3DQXA 3QHWA 1VYWA 2R4BA 4B0GA 4DHFA 5IUGA 1YHWA 3E63A 1OECA 3DJ7A 5AM6A 2BFXA 3UC3A 4U97A 4PUZA 2X81A 3LCOA 3QGYA 2WIPA 2C1AA 2YM4A 4QDEA 4QQCA 3HV5A 3WF8A 4EHGA 4MD8E 2YN8A 3OTUA 2EXMA 4KBCA 4U45A 2XMYA 4RJ7A 4K18A 1WCCA 2BALA 4FSQA 2XJ1A 3F7WA 4LG4A 4ZLYA 1VR2A 3MPTA 4EUUA 3NCGA 2V62A 3NAXA 4CKJA 3LFEA 5HX6A 5FM3A 3I5NA 2XEYA 4LQMA 4IJ9A 4YC6A 3EN6A 4FX3A 5HD7A 3VULA 3WYXA 2VTPA 2XNPA 5BPYA 5JZJA 2VTMA 1IASA 3IO7A 4PMMA 3IGOA 2PMNX 5CXHA 3CD3A 3TT0A 4UZHA 5D41A 2OH4A 4CMTA 3I5ZA 4L3PA 5HICA 2XRUA 3SDJA 3E7OA 3VUHA 4OTDA 2R5TA 2J5FA 3ROCA 1REJA 1ZMVA 3NIZA 4QYEA 4ACCA 4PNKA 1Z5MA 4DEBA 4YLKA 4JX3A 3ZO4A 5C8KA 4ZSAA 3NGAA 3MA6A 5EM6A 3WILA 3FPMA 3KRWA 2RIOA 3AOXA 2PYWA 3R7UA 4BCJA 4YTCA 2CGXA 4UXQA 4ZTNA 4ARKA 3CJGA 5AIRA 3UOLA 3V5JA 2WU6A 2WTCA 4JRVA 4BVUA 3R1QA 5BVEA 2Q0NA 3NS9A 4BBEA 4MXXA 2CNQA 1P4FA 2GSFA 3LOKA 5F95A 5LQFA 2E9OA 1IG1A 3CGOA 3DK7A 3QD2B 1YXVA 4FKGA 5AM7A 2XKCA 4TXCA 4BC6A 1G8JA 3DLZA 2EUFB 3DFAA 3IKAA 4OTHA 4E4XA 1YOMA 3HMMA 5I9ZA 5HE2A 3PJ8A 3LFBA 4FKUA 1GIJA 2UW3A 2HYYA 4OTIA 1H0VA 4ORKA 3ANRA 4W4WA 4W4XA 4O91A 4DE4A 5A6OA 4FC0A 3ULZA 5M07A 1J7LA 4FNXA 2AUHA 3VHKA 1QCFA 1XH6A 3R1YA 4GYIA 3OZ6A 2XF0A 5HORA 2VNYA 3ULIA 3OCGA 3L8XA 4BDIA 2C0TA 4QMTA 1DAWA 3GU8A 4DGLC 4F4PA 4FEUA 4NM3A 3D4QA 4XLIA 4YPDA 4YZCA 4KS7A 4R7IA 4E4MA 5HE3A 5L8LA 4F6UA 3MS9A 3ORMA 3CTJA 1PXPA 3H9RA 2PVMA 3UP2A 3RMFA 3CGFA 4IANA 3E8CA 3PXFA 2Z7LA 3O8TA 2UZBA 4FZDB 5I9VA 5AMNA 3CQEA 4AXFA 5FD2A 5KMIA 3BCEA 3QTXA 4U79A 1R78A 1Q8YA 3PLSA 4D4RA 3P08A 3FLQA 4OGRA 3EQHA 1G8AA 3KRXA 1ZYLA 5EYKA 2NO3A 5AP5A 4I4FA 5E90A 2XM9A 3PZEA 2PZPA 3PRIA 3GI3A 3KC3A 4EJNA 5E8ZA 2QOBA 3L1SA 1UKHA 3OROA 3R0TA 4RZVA 4ZTLA 3UDZA 2PVFA 2OFUA 1YVJA 5CU4A 4DINA 3UG2A 4D55A 4AE6A 1QPDA 3F66A 3P4KA 3ZLXA 2W5BA 3BE2A 3C0IA 3PJ1A 3UDBA 2XKEA 5DFPA 3D7ZA 1W98A 3C1XA 2IZSA 3EQGA 4GW8A 3DV3A 4YZDA 2ITPA 4BZNA 3AD5A 2PVHA 2XBAA 2R0IA 3W8LA 5CENA 3ZXZA 5KKRC 2XJ0A 4G3FA 5LMKA 1SZMA 3TDVA 1DS5A 4G34A 2I7QA 3HMOA 4KIQA 4YP8A 2PUPA 2C69A 4TYHB 5CY3A 4BDDA 3S3IA 3B2WA 1IA9A 2C47A 2XM8A 4FSNA 1PMUA 2ONLC 1J1BA 3TNWA 4NSTA 3TUBA 4AN2A 4ASZA 4GVAA 2XP2A 1DAYA 4JDHA 3MVMA 4JJRA 4CTCA 4E20A 3QCSA 3RHXA 4I5CA 3BHHA 3MH2A 1JOWB 1V1KA 2V22A 1OL7A 2WFYA 5HG8A 2X6EA 3QU0A 4B99A 4DHJA 3R7VA 5E8SA 4P7EA 4BI0A 4PDSA 3C13A 4XOYA 3NUPA 2C3JA 4IZ5A 4KKEA 4XBRA 2C6KA 4BGHA 5L8KA 2GS7A 1Q3DA 3G90X 3MJ1A 5F4NA 5E1EA 5HESA 5KMKA 4ALWA 3I81A 4XG7A 2Z7SA 3ODZX 5IH5A 4S2ZA 2UZTA 1K9AA 3Q6WA 1DI9A 2A27A 3A61A 4JG6A 4BHNA 4C2WA 2F7XE 1ZYDA 2BIYA 4DDIA 4FKPA 3W2SA 2XK4A 1WAKA 4BJJA 4TWOA 5H8GA 4IB5A 3A7IA 5IA5A 4EH9A 1ST4A 3I6UA 4FZFB 5BYLA 4L53A 2QU5A 3NUSA 4IZYA 4M8TA 5DE2A 4DFNA 5HQ0A 5DR6A 4G6LA 3SG9A 4AAYA 2EU9A 5JGAA 3HDNA 4XV1A 4BTKA 4Y46A 3V8SA 2VV9A 3LCKA 1PYXA 4FT0A 2IPXA 4DFZE 1ZOEA 1R39A 4U3YA 3EH9A 3HA6A 4HGEA 3MFSA 3GU4A 4WA9A 4WG3A 1JWHA 3KMMA 1GAGA 2NRYA 1BL6A 4BJJB 4AA0A 4FVQA 1XH4A 2UW7A 4FSRA 3KGAA 2H6DA 4LFIA 4UXLA 3RM6A 4PDYA 3IDPA 2GQSA 4EQMA 2XARA 3HDMA 3PXKA 5T6KA 3BWJA 3VBYA 3REPA 4FE2A 3ERKA 4EH7A 5AV0A 4J53A 5AADA 1CKJA 3PVUA 2IW9A 4MXOA 3LLTA 5DRBA 3EZVA 5BVOA 3G9LX 2C68A 5A3XA 5L6PA 5EDQA 5EYDA 4I6FA 2BPMA 2OLCA 1CKPA 1H1QA 4XG8A 5LCKA 3K5VA 3KF4A 3MWUA 4HOKA 4JRNA 3UC4A 3ORXA 5J5SA 5J9LA 3E62A 2H34A 4F78A 3C0HA 5T3QA 2YAKA 4IWPA 1WBTA 2CMWA 2FB8A 3D0EA 3IECA 3JR1A 3NEWA 3EL8A 4I6LA 2YCQA 4FTOA 5FLFA 3U9CA 3VVHA 4RX9A 5JQ8A 4BCQA 3GCPA 2E9PA 1BX6A 3QXOA 4G5JA 4TYGA 4MD9E 2WEIA 1PMNA 4CKIA 4FV4A 1KSWA 1YOJA 2V5QA 2G2IA 4M68A 5BUJA 4AZEA 1J7UA 3E92A 3IDBA 3KA0A 4MBIA 3DAJA 2WTIA 1JKTA 2WZJA 3NNWA 4XRJA 4O6EA 1PMEA 3TV4A 4BCFA 3KL8A 3FMKA 3KRJA 3BLRA 3D15A 3Q9XA 4WT6A 2Z7QA 4C2VA 3WE8A 2WPAA 2F4JA 3E87A 3THBA 4CD0A 2ZVAA 4IWQA 1E1VA 4H1JA 5E8TA 2QOKA 5KHXA 2JIIA 3VW6A 3QKMA 2HXLA 3DXPA 1ZLTA 3I1AA 5DIAA 1ZOGA 1P14A 3PP0A 3BLHA 4RWJA 4AUAA 3R7EA 4EJ7A 3QYZA 4XMOA 4QTCA 1RW8A 2YIWA 3R01A 2OJGA 1F3MC 3OFMA 3DS6A 1IEPA 1NT2A 2ZAZA 4OBOA 4IM3A 4RSSA 3BGQA 3RCDA 2YABA 2C6TA 5IQEA 5EM7A 2BUJA 5LARA 2OIQA 3UZPA 4BCIA 4F9WA 4YTFA 2JEDA 3I6WA 4CCBA 3BL7A 4YJPA 4YHJA 1ERKA 1FMKA 2X1NA 4K2RA 2XIYA 3NPCA 4X2KA 3VC4A 4I0SA 5JGDA 1SVGA 2F7EE 1OUKA 2R9SA 4XX9A 3C4XA 3W0OA 3ZO1A 3C51A 4AOJA 3QWKA 4H58A 3F2AA 2I0YA 5AAFA 4LL0A 3RHKA 2XALA 5A46A 3WYYA 4S30A 3V6SA 5B7VA 5H9BA 4QMPA 1YWNA 1JNKA 3AC2A 5JRQA 3EIDA 3P9JA 2BZIB 4JX7A 2C6EA 4ZS0A 2JBOA 5DEWA 3RK5A 5HO8A 3ORLA 5H3QA 4E93A 3F69A 2PK9A 3RVGA 3QTRA 2JIVA 4UB7A 4WNKA 4XHKB 2VWXA 2J0IA 4X2NA 4EH2A 1OIRA 1K2PA 2QO9A 4RQKA 5HCYA 5EKNA 4RQVA 4UY9A 2PZYA 3HRFA 4R7HA 2XAOA 2X8EA 2XANA 4KD1A 2WB8A 3FSKA 4B8LA 2IO6A 3UBDA 5FBNC 1OMWA 2UZEA 3T9IA 4W4VA 3BYMA 3U6HA 2OKRA 4D1XA 1H0WA 2C4GA 5HD4A 1JSTA 3Q60A 4QP4A 2UUEA 5HBHA 4CGAA 2YM6A 2NYAA 1KE9A 4HZRA 1IAHA 4E4LA 5JT2A 3KMWA 3V5PA 5E8UA 3ZEWA 2H8HA 3LCTA 4O0YA 4O2ZA 3RM7A 3TEIA 3D7TA 4JBQA 4G3GA 4DFUA 3DB6A 1ZY4A 3VONA 4QPSA 4S32A 4L42A 3WE4A 2WMUA 4BR3A 4FSZA 3SOCA 3QZHA 4AGDA 4CG9A 4LUEA 3PSBA 4UWCA 3QRIA 4FZ6A 4E6QA 5J7HA 2QCSA 3MBLA 1PW2A 2GMXA 2WTWA 4YJRA 1JPAA 2OWBA 3QRJA 4M14A 2PVKA 4P5ZA 3LPBA 5GJFA 5JZNA 5TKDA 4CEGA 3I79A 4KSQA 2WMAA 4ZEGA 5HO7A 5M08A 4HCUA 5DI1A 3N4UA 4NTTA 4FV6A 2CLQA 5HG5A 1U5RA 4KS8A 4BZDA 4Q9ZA 4U0IA 2W05A 3RPYA 5M51A 4FUYA 3CLYA 4A7CA 2EB2A 2GQGA 4MWHA 3IG7A 5ICPA 2JKKA 3UVQA 4ITJA 5GHVA 3EQPA 3RNIA 2ZDTA 4CZUA 3NUNA 3LJ2A 4C37A 3R00A 1Q99A 2X2LA 4FIFA 4GT3A 4JS8A 4PP9A 4A4XA 2BRHA 2JDTA 3TG1A 4HJOA 3K5UA 4Z7HA 1O6YA 1W0XC 3ETAA 3M11A 4PTCA 3QD3A 5A54A 2QOLA 4LRJA 3OF0A 4TWPA 5DRDA 3F3TA 4BICA 3S1HA 4FKRA 4G9CA 2BAQA 4IADA 4A4OA 3COIA 2Q0BA 3E5AA 4RFYA 4O2PA 3PIXA 3LQ8A 5KBQA 1W83A 5FEQA 2OF4A 4RIYA 3PXYA 4II5A 4QMZA 1KV1A 5EKOA 4NJ3A 1PRYA 2WMBA 3DKOA 5B2KA 5AUUA 5LWMA 4JAIA 1OPLA 2VTTA 3AXWA 3NYNA 4AOIA 1YDTE 5IQAA 4E4NA 5CYIA 3ENHA 4NK9A 3N4TA 4JI9A 1XH5A 2PE0A 5AUWA 4W8EA 2R3JA 1R0PA 3PUFC 4AA4A 4F9CA 3VBXA 1SM2A 3R83A 3AC3A 3COMA 1T46A 4YGAA 4FIHA 3R1SA 4Q9SA 4K11A 2OJIA 2VTIA 3MB6A 5HVJA 3AT4A 2W9FB 1JKKA 4ZLOA 4ID7A 4F09A 4YSMA 4D2SA 5J8IA 4GL9A 4JQ7A 4X3FC 4E6CA 4R5SA 3GC9A 4X2GA 4RIYB 4OTRA 3G6GA 3V51A 4V04A 3QQKA 3HZTA 4JG7A 4EZ7A 4FTJA 5F9EA 2C3IB 3EN7A 4LGHA 5FBOA 3QQJA 5HHWA 2ITUA 5K4JA 2I0EA 4JL9A 3VAPA 3W2CA 2R3HA 4DH1A 2J51A 4I5MA 4NCTC 3ZDUA 4FTIA 1XKKA 5JK3A 2PE2A 4DG3E 2WOUA 4XUFA 4BBMA 4FICA 3W33A 4DTBA 4F1OA 2IJMA 3C7QA 4B4LA 2R2PA 5F1ZA 2Y0AA 4FSMA 4X2JA 5AUYA 4Y72A 4PMPA 4FTCA 2OW3A 2NPQA 3FHRA 5E1SA 1B39A 1I44A 5AP6A 2WMVA 3I7CA 5FTOA 3QF9A 5ETIA 2WMTA 4D9TA 5AAGA 4FT7A 4EH4A 2W7XA 3VS6A 1OKWA 3ZUTA 4FNYA 4EH6A 3GBZA 2NRUA 3PYYA 4DFBA 4DGNA 3Q4TA 2WQBA 1KOAA 4E73A 1H4LA 5AP0A 3NVMB 4M67A 1U46A 4KABA 1Q5KA 1TQMA 4YSJA 2VNWA 4OTWA 4L00A 3V04A 2BILB 4FKTA 4TZRA 4RLKA 3C4CA 1QL6A 5CQWA 4AXDA 2E9VA 4O27B 3BHTA 5BX0A 5FXSA 4IM2A 4BRXA 2GU8A 4XP2A 3TTIA 4KB8A 4IC7A 2VWWA 2ITVA 4L68A 2J2IB 3MH0A 1R1WA 2X6DA 3UMXA 5C1QB 3TIYA 1P4OA 2OIDA 4CLIA 4GSBA 4EWQA 4J1RA 4NYEA 5BVFA 2GNJA 3OTVA 2PZRA 1YXTA 3G51A 3GXLA 5CI6A 5EHYA 5IQDA 4YJVA 3U55A 4WO5A 1OVEA 4XLVA 4WBOA 3EQDA 4ZTSA 3SOAA 2B54A 3P7AA 4YBKA 3VUIA 2FUMA 4H3QA 4I0TA 2WOTA 1FBNA 5H2UA 3VBWA 1YHSA 5BYZA 3TM0A 1ST0A 4YPSA 4QTEA 5CEPA 4GVJA 4I22A 5JKGA 2C3KA 1M14A 2C0OA 3IPHA 2BRGA 5CU6A 5ANEA 3HRCA 3MI9A 5CVGA 5LMAA 1URCA 5A4EA 4G3EA 2VTNA 3IOKA 4O0XA 4W4YA 3LE6A 3ZBXA 3ZH8A 4BTFA 3EQFA 5HVYA 5AP4A 3VF8A 4AXEA 4WBBB 4ITHA 5C27A 2JIUA 3O7LD 1U54A 3QFVA 4BDBA 4RT7A 1XR1A 3LXKA 3ODYX 3CTHA 1OL2A 1HOWA 4KUJA 4MQ1A 1S9IA 5EI6A 3LCSA 4NIFB 3W0RA 5IQGA 4FEWA 4MBJA 1MQBA 3MH1A 2BVAA 4OBPA 4U42A 3VQHA 3WF5A 3OP5A 4M15A 4C3FA 2XNBA 3NUXA 3L9MA 4C58A 3B8QA 3C4ZA 1PXKA 3FI8A 3EHAA 4E5WA 1OL5A 2PVLA 2R3LA 2YACA 3S95A 3ZZWA 3E8NA 3PJCA 4RVLA 5KZ0A 5EW9A 4LMNA 1JSVA 3DGKA 1XH7A 3BQCA 2W1HA 3MY1A 4HGSA 2C6LA 2HENA 3D2KA 2AC3A 2O5KA 2X0GA 4HNFA 5CEQA 3PLAE 2ZV9A 4FV3A 4FL1A 4TTHB 5DA3A 5G6VA 5LOHA 3HLLA 3RPRA 2QHMA 4AQCA 5AUVA 5AP2A 4CFVA 5GNKA 2BZHB 4GKHA 4BIDA 3BU5A 5HG9A 3JVSA 5BQ0A 2J90A 3WARA 4QP6A 3UQFA 3ZRMA 4FI1A 1OKYA 4QOXA 4CQEA 4LOOA 2QOOA 4HCTA 5BNJA 5ETFA 3OCSA 5D7VA 4EYJA 3F82A 3FLNC 3UMWA 2QG7A 5LVPA 2HY81 4N57A 2W4JA 3VS2A 4BCHA 4KBAA 3BL9A 4KWPA 2XIKA 1UU8A 2P2IA 5CEIA 3WF6A 5BMSA 2XNGA 5M4CA 1PJKA 1H26A 2VO0A 2YM8A 4M69B 4D5HA 3KIOC 3U87A 4A4LA 3BGPA 4KAOA 4YZ9A 1H27A 1WVYA 3RKBA 4EHEA 1FMOE 2W1CA 3PVWA 5FXRA 5C8MA 2IWIA 3QLGA 2OK1A 3R63A 2GFSA 4FVRA 5B0XA 5EDPA 3L8SA 3LQ3A 3FC2A 4G6NA 3PY3A 5EM5A 3OEFX 1OBGA 2HWOA 3FC1X 4XNEA 2EXCX 2QOCA 3TV7A 5CNOA 2W1EA 5KO1A 4F0IA 5CVHA 4NM7A 4AZWA 1YW2A 4WUAA 4DH7A 4P2KA 3GFWA 1XMLA 3GOKA 2JDSA 3PIZA 5JGBA 4JR3A 2YZLA 4QNYA 3OS3A 2PMOX 5LMBA 3T3UA 4BTMA 2OSCA 3FZPA 2CGWA 3AC5A 4IACA 5GJDA 3KXHA 3IGGA 3Q52A 3SXFA 3KN6A 1FGKA 1GZNA 2G2HA 1V0BA 1YOLA 2JKQA 4TT7A 3AC1A 5D12A 3VS4A 5IZFA 3AT2A 1WMKA 3QWJA 3BLAA 2IVSA 2PVYA 3JY0A 5KBRA 5IA4A 5E8XA 3FYKX 3Q2MA 3EB0A 4XG3A 4AAAA 5FEDA 2GQRA 4XV9A 4K9YA 4FTQA 2JDVA 5CTPA 5AX9A 5HIBA 1OPJA 4TNDA 4FKQA 3R28A 2BFYA 2RG5A 1SNUA 4YUQA 1A9UA 3HRBA 3VWAA 2UZWE 4PQNA 4NZWB 3PJ3A 1NVQA 2XVDA 4E6DA 4RLLA 5L6WL 3EL7A 3I7BA 1W7HA 4FODA 3ZYAA 2XK7A 4WNMA 4KRDA 2ONLA 4IB1A 4QMLA 4IH8A 2Y4IC 2Y9QA 3TI1A 2QOQA 3PE1A 1JSUA 4O7SA 4ZY4A 3BYVA 5JRSA 2UW0A 2ZM4A 3EFWA 5DGZA 1S9JA 3DZOA 4IB0A 5A4QA 3QUDA 5BVNA 3LMIA 1LEWA 1IRKA 2YITA 4F1MA 2CNVA 3EQCA 3G5DA 5AP7A 2ETMA 3H3CA 2O8YA 5KKRB 3V01A 3LFQA 5KZIA 3ZS5A 3ZLYA 2W0JA 1XJDA 4K8AA 3RNYA 2HIWA 4PL4A 4F9YA 1CMKE 3FMLA 2NP8A 4PL3A 4BDEA 1PHKA 4GFOA 4ZY5A 5M4IA 1Q8WA 4AZSA 4R6VA 3R8LA 2YCRA 3IW4A 5M4FA 5BMMA 3OEZA 3ZO2A 4O81A 3Q32A 4FL2A 4JXFA 3QRTA 4FKLA 3DXQA 2ZM3A 4NKAA 4TPTA 5D9HA 3WZEA 2BKZA 5A6NA 3TNQB 1Q8UA 3CS9A 4U80A 3KRLA 3ZRLA 1RE8A 4N4SA 5HE1A 3W2QA 4F9BA 3HNGA 4IIRA 2EVAA 3FI4A 5HLPA 2X8DA 4RVMA 3R7OA 3FE3A 3OY1A 3OG7A 1ZY5A 2W9ZB 2Y6OA 4ZK5A 4DEGA 3FAAA 5IDNA 2JAMA 2FSOX 1OL6A 4ASEA 3UNJA 3RINA 1NXKA 4AXAA 1MQ4A 1T45A 2HY0A 4K33A 4KBKA 2BZKB 4PTEA 1ZXEA 1UNHA 3F61A 4QMWA 3U6IA 4ENXA 5EQEA 3FWQA 3QTUA 5IEYA 3DB8A 1ZYSA 4C0TA 4YMJA 5CALA 3OHTA 4TYEA 4I1ZA 2AYPA 2W1FA 4J99A 4OBQA 5EHOA 1WVXA 3LMHA 2IN6A 3QYWA 4CFXA 5ANIA 1F5QA 4X6RA 2FH9A 3BI6A 4FIGA 3I4BA 3ZEPA 3ALNA 3ZUUA 2C1BA 2CKEA 3QQGA 4D4SA 2VWUA 4FV9A 3EZRA 2WNTA 4QPAA 2WQNA 2E9NA 3R04A 3TYKA 3QTSA 4ZJJA 3T8OA 2JLDA 2QURA 4HVSA 3M2WA 3MVHA 3V5TA 1Q41A 3A7HA 3HV6A 5ANKA 4U8ZA 4HZSA 5CF8A 1GZKA 3RZBA 1W8CA 3SLSA 4PV0A 4DH5A 2DYLA 5I4NA 3QGWA 2A2AA 3GCSA 3TUCA 3KMUA 3LLAA 4V05A 4QMYA 1KV2A 3Q9YA 3VBVA 4BCKA 4QMMA 3OWKA 2HOGA 3BPRA 5D1JA 3F3WA 4Y83A 2BTSA 4YC3A 3NDMA 5IMEA 3R22A 4BI2A 2GNLA 3HV3A 1BMKA 3FZSA 3MFUA 4FNWA 3VS7A 4DFXE 3WI6A 4ZMEA 4L7SA 5B2MA 5HU3A 3MSSA 5IISA 4QMQA 2XIRA 5JH6A 5M57A 2JITA 1SMHA 3EKNA 2ZJWA 5AX3A 2VD5A 3EQRA 4XG4A 4C59A 3MA3A 4QMVA 4Y73A 3VS3A 4I23A 1O6LA 4IFGA 4E6AA 3EN4A 2WIHA 3O8UA 4K6ZA 2BDFA 2JKOA 3VUGA 3W32A 5I9YA 4IW0A 4RIXA 5HNGA 4M3QA 3QAME 4NL0A 3P5KA 3QCYA 1SVEA 4ZZMA 4AW0A 4IAYA 3PPJA 4A9RA 2W4KA 4PX6A 4E8AA 4CG8A 4GJ3A 4OR5A 2J7TA 2FYSA 1V0OA 3D83A 2UZNA 3NNVA 4L3JA 4MVFA 3UDTA 2CCIA 4XP3A 1NA7A 2IVVA 3ZTXA 1LPUA 1LEZA 4BIEA 3HKOA 4X3JA 5AV1A 3FPQA 4U44A 1RQQA 3DY7A 3FEGA 4MHAA 2C6IA 4C62A 3FMHA 1BKXA 3R71A 4PY1A 1WVWA 3KXMA 3PTGA 4ZTMA 3P79A 4K0YA 3I0QA 3MFTA 1FOTA 3GCVA 4MXYA 3K3JA 2ITZA 4MAOA 4NUSA 2J0MB 2YCFA 3PIYA 5IA2A 4RIXB 2YERA 4FKOA 4L45A 3RAIA 1Z9XA 2YA9A 3GCQA 2ZB0A 3LHJA 4KIPA 3FUPA 5HE0A 3V5WA 3VRYA 4R7BA 4ITIA 4FG9A 3FXWA 3PUPA 3PXRA 2O64A 3W2PA 4LYNA 2VTOA 3A4PA 5CAPA 5LWNA 2BROA 2CNUA 1TKIA 4UWBA 3UQGA 4FV5A 4GG5A 2WO6A 4FTUA 4JT3A 3ZZEA 3AG9A 3PXQA 4U9AA 4W8DA 2CCHA 2Q83A 5EG3A 3PWDA 4D28A 5HI2A 4Y8DA 2GNFA 4A07A 3P0MA 3UTOA 1K3AA 5FM2A 2F57A 4A9SA 5FTQA 4E5BA 3O8PA 1H00A 2WTKB 1H8FA 2XUUA 3CY2A 5EYCA 3DJ6A 4YHFA 3K2LA 2HZIA 5EDRA 3RPOA 3NYVA 1Y6BA 4RG0A 4F0GA 3BGZA 4ZTHA 2ZMDA 4C61A 1BI8A 2V55A 3HV4A 3ATSA 4FR4A 3R6XA 4M0YA 5A14A 4XBUA 4YURA 1LP4A 1NVSA 3GUBA 3HV7A 5LCJA 4KNBA 2JDRA 2YIXA 3BHVA 3UE4A 2YISA 2HZNA 3TNPC 3UIUA 1OL1A 3L8PA 4UYNA 5C03A 3DBQA 3WIGA 3ORIA 2I1MA 2XAMA 2XKDA 5I9XA 3PY1A 4LM5A 2OFVA 2WMRA 4JDJA 5IA0A 4G5PA 4YNOA 3GQLA 3OD6X 2W99B 2XYNA 5CSWA 3C4FA 5BUIA 3NFGB 1E1XA 2VN9A 3A7JA 4JBOA 5D7AA 3RAKA 1WBSA 4BYJA 3U6JA 2ETKA 3BHYA 2ZV7A 1JBPE 4QNAA 5M55A 2UZDA 1ZYCA 1J1CA 4F6WA 1U5QA 4FKSA 4MQ2A 1YHVA 3D5WA 3BWFA 2X9FA 3F5UA 4QMUA 4GH2A 3VS0A 3FMEA 4IAKA 4TRLA 2UW6A 3AMYA 3LVPA 5LMKC 4FTLA 3V8TA 5DPVA 3P1AA 4EZ5A 4BN1A 4CNHA 3C5UA 3QTIA 4GK3A 5HLWA 5IQHA 2CLXA 4D1SA 1SVHA 3GEQA 4IAFA 3C50A 4UZDA 4YO4A 4X21A 4ZS4A 3GQIA 4FSWA 2GCDA 4GT5A 2YWPA 3R8PA 2R3MA 3CSVA 3KREA 1CDKA 1STCE 2W5AA 1MRUA 3LAUA 4QP9A 3KXNA 2YM5A 4EWHA 4O21A 5JSMA 1PXOA 4YLJA 2BIKB 5CSXA 3U51A 4D4YA 5JEBA 4NW6A 2X4FA 3DFCB 4L3LA 3UYTA 2UW5A 4NT4A 4IAIA 4O7WA 4KKHA 5DT4A 4ZSLA 2JFMA 3HECA 3ML1A 5EK7A 4AZFA 4C4FA 3D5UA 3L9LA 2WU7A 2VWZA 2IVTA 5AUZA 1ZRZA 5FXQA 1CKIA 2ITYA 2OGVA 5FQDC 2JGZA 4G6OA 4QP8A 3NLBA 4FNZA 5JN2A 1H08A 4OT6A 4PP7A 4DAWA 3MIAA 4JG8A 4MYGA 5AA9A 3OWJA 4Q5HA 5AP1A 4QTDA 4Z9LA 5E8WA 4I5PA 5FDPA 3DKCA 5IA1A 4ASDA 3F6XA 3LXLA 3UVRA 2PVRA 2X2MA 3NCZA 3UGCA 3G6HA 4L43A 3VJNA 3FMJA 4AW1A 3UIMA 4GS6A 2DWBA 3MPAA 2QLUA 4DT8A 5CZIA 3RK7A 5TF9A 2CHLA 3QHRA 3QQHA 4JQ8A 4QDVA 3DBDA 4O7LA 4C4JA 3ET7A 2IZRA 3UIBA 4ZJVA 3P7BA 2XB7A 2YM7A 3OWLA 4JMQA 3A7GA 4Y5HA 2J0KA 5AV3A 3R8ZA 2A19B 1Q97A 3NX8A 4TYIA 3OVVA 3CQUA 4M13A 2QI8A 3BIZA 1I09A 4O38A 4XG6A 5GINE 3IDCA 4ZSJA 4BB4A 2WEVA 4UYAA 1J3HA 4MH7A 4I94A 4ZXTA 3ZFMA 5CF4A 5DVRA 3AKLA 4JNWA 3DBFA 1SNXA 2WTVA 4TWNA 4CFUA 4ZMFA 3EFJA 4OTGA 5DWRA 3TZMA 2XS0A 4FGBA 2G1TA 2VO6A 2J4ZA 4IVBA 4Y85A 3H4JA 5KUPA