5M06A

Crystal structure of mycobacterium tuberculosis pkni kinase domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
245
Chain Sequence
MALASGVTFAGYTVVRMLGCSAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHRDVNPANVVLTSRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDRSLQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PknI
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Signaling protein
total genus 75
structure length 245
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m06A01
2JITA 2UW3A 5M55A 4BZDA 3D7ZA 3MIAA 3NUAA 2YIXA 3KXZA 3F3ZA 2GHLA 5EKNA 1ZYCA 4HVGA 4X6RA 1XBCA 1H08A 3TV6A 4EH3A 1DAWA 1P2AA 2ZYBA 2X6DA 3TV4A 2C5YA 3VNTA 3ACKA 2J6MA 3MFRA 3FI4A 2CPKE 3OBJA 4TYHA 3IDCA 3LQ3A 3HUCA 3GQIA 4CRLA 5E8TA 2J0JA 4BCMA 2XNEA 1WFCA 3KRWA 4YBJA 3D5VA 3W8QA 1CTPE 4BZOA 5AIKA 5IQEA 4LG4A 3JVRA 2BTSA 4YNEA 2UV2A 3P0MA 3KXXA 3QRTA 3NSZA 5I9UA 4HZSA 5AWMA 2VGPA 3DBDA 4O96A 2OJ9A 4J98A 4K11A 4S33A 3F5PA 3LAUA 2ZV8A 1BI7A 3VS3A 3QTRA 3EN6A 4C37A 2XCKA 3UPZA 4O7LA 5EQPA 3MB7A 2O65A 4JNWA 4D4RA 2ETKA 5BVNA 4QMUA 2UZLA 2F2UA 3HYHA 4G17A 2W05A 2RL5A 4J96A 4EI4A 2Y6OA 3NGAA 3FY2A 3R1SA 5KMIA 2XEZA 2O64A 4C62A 3LQ8A 5HVJA 3AC5A 1BLXA 4MD9E 4ZP5A 4C3PA 3OCBA 5K3YA 4F7SA 2C47A 4J52A 5EG3A 3C4ZA 2BMCA 3D14A 3OXTA 3ENHA 4KINA 3DA6A 4CZTA 1OKWA 5DEWA 5EDPA 3G9LX 5LWNA 4BI1A 4GUBA 5EQYA 4FSNA 2HIWA 4Y5HA 5CWZA 4AU8A 4C61A 5AX9A 5CAOA 3CJFA 2V7AA 4RA5A 2W9ZB 3MWUA 5KZIA 1OIRA 2WIPA 4G6NA 2VV9A 3QUEA 4I23A 4X2GA 3HNGA 2W1ZA 3CP9A 4WT6A 1V0PA 5BPYA 2WTCA 1QPJA 5M4FA 1KV2A 3RK5A 4RFYA 3ZHPC 3FXWA 4AT4A 4OTWA 2QI8A 3WARA 2OFUA 3MVJA 4LUEA 3KC3A 3NNWA 3BWFA 3KQ7A 2UW8A 1RE8A 4GKHA 4K0YA 2W99B 4QP2A 4YHJA 4C36A 3EQFA 2W96B 4IX6A 3IGOA 5TF9A 3WF9A 1W84A 1K9AA 3CQUA 1UWJA 5F1ZA 5I5ZA 3BLHA 3OCTA 3UG1A 3UOJA 4QYGA 1OZ1A 4N6YA 5TKDA 4M84A 5CI7A 5CNOA 4BDFA 5B2LA 2YJSA 5ETFA 4E7WA 3C4CA 4ZZOA 4G3EA 3I6WA 5JZJA 4A07A 2OBJA 3FXXA 1WBPA 3R73A 4FEWA 5KMOA 1ZYSA 4R78A 2UZEA 5BUIA 2I40A 5D11A 4BIBA 3PIXA 3D2KA 4QMTA 3ROYA 5AA8A 5IQIA 1QPEA 1FBNA 3ORLA 4LRMA 4QT1A 4PF4A 4FV8A 5M08A 3MTLA 2QD9A 4OBQA 3KREA 1PXJA 4HPUE 2RFEA 3Q9XA 3TDWA 4BCHA 1Z5MA 5JK3A 4L43A 4M13A 4PDYA 4X6QC 1VYZA 3NNXA 2VRXA 3IW4A 3QQKA 4GT3A 1PHKA 4JVGA 4KBKA 1URWA 2JLDA 4DYMA 5ANOA 4EHEA 1LUFA 1Q8WA 5EM7A 4K18A 4WBBB 2UZOA 4H3BA 3A7HA 3Q5ZA 2I0VA 3QX4A 4EKKA 5KO1A 3W16A 2UZVA 4BKJA 2HZ4A 3NYNA 3D9VA 3HZTA 5HBJA 3F82A 4FC0A 2WQMA 3ZMMA 4YU2A 2W1DA 2OH4A 3LW0A 3EQDA 3VO3A 4KIOA 2JDTA 3CCNA 4ENXA 4C38A 1ZYJA 4U40A 4EH8A 2BFYA 4FKUA 4XJ0A 2BDWA 3DQXA 2CNUA 4HCUA 2REIA 5E8VA 4RZVA 4I4FA 3CS9A 2YIRA 1DM2A 4D0WA 3QZIA 4AZWA 4GK2A 4E26A 1YW2A 4W4YA 5D9HA 2QOHA 5IMEA 1Y8YA 5FXRA 1Y91A 3EL8A 4KRDA 5KUPA 4LGHA 4EOLA 2YDJA 2UZNA 2WQOA 3UG2A 4AA5A 4AN3A 5AP5A 4FYOA 3ZFXA 4PUZA 2IW8A 5HORA 2JDSA 3PVBA 5C9CA 2BIYA 2CLXA 5C8KA 2DUVA 5JZNA 1OITA 2OXXA 3L9LA 5HD4A 5J1VA 3DK3A 3REPA 4EEVA 3ANRA 3CD3A 4RFZA 1M2RA 1GIIA 2QO7A 3AC2A 4BDAA 5CAPA 3PLSA 3R9RA 3UZTA 4RMZA 4XG9A 4X3JA 4J95A 4ZJIA 3BGPA 4AFJA 2PZIA 1OVEA 3QYZA 1H0WA 2WHBA 4TWNA 4AOIA 2ZB1A 3IW5A 1R1WA 3TIZA 4E4MA 5JGAA 4KNBA 3ZDUA 4F1OA 2PE0A 2P2IA 4IJ9A 5AX3A 1NVSA 2PZ5A 4EC8A 4I22A 3NUNA 4FSQA 4U79A 5EI2A 4H58A 4EUTA 3TZMA 4C4JA 2W7XA 2A0CX 3E7OA 5LQFA 4FTKA 5LARA 4C0TA 5JFVA 2CGWA 4YZDA 3JR1A 4U97A 5LMAA 3CGOA 2A2AA 2BILB 4DG2E 2R3OA 4BTJA 3R6XA 4NJDA 3GC8A 3GEQA 4XV2A 2VNWA 4PL5A 3A7FA 4QNYA 3LCDA 3UPXA 4MNEB 4BY9E 3U87A 3QFVA 3P7AA 4BYJA 4U45A 4DEHA 2HW6A 3PXRA 4M0ZA 1M17A 2O2UA 1HOWA 3KY2A 3L9PA 4NFMA 5KHXA 2XKCA 5KMJA 4DH8A 4FG8A 3HMOA 3QKMA 4F9WA 5IU2A 3FLNC 5HU9A 1ZMVA 3EIDA 4R7BA 2GTNA 5D12A 3OXIA 4FTQA 3PFQA 4RBLA 2IN6A 4HOKA 2OKRA 2QR8A 2WTKB 3KXMA 2C3KA 2XRWA 3QBNA 5LMKA 4BR3A 3HDNA 1M52A 3TEIA 3V8SA 5BVOA 3QTXA 3PPZA 4PDSA 4IWDA 3ANQA 4PL3A 5CEIA 4JT3A 5CVFA 3R8UA 2B4SB 1Q97A 2VTIA 4IM3A 3EQHA 3OF0A 3D4QA 5IA0A 4MK0A 3TJCA 3W2RA 4NIFB 3HA8A 5EW8A 4ZTRA 3Q6UA 4L67A 4LMUA 3HGKA 4EC9A 4ZY5A 4FMQA 4FSWA 3UC3A 5JSMA 1CM8A 2X7FA 4O7TA 3EFWA 4JR3A 2RFSA 3FAAA 4YC3A 4IAFA 5CAQA 3RAIA 1IA8A 3FMNA 2XB7A 3OBGA 1OGUA 4JJRA 5C01A 4FBXA 4M14A 3UDBA 3ZEWA 2OJGA 3FKLA 4QMNA 4RC3A 2XK3A 2XIYA 3OS3A 3VW6A 1IAHA 3LFBA 2VX1A 3CY2A 4FT7A 4UYAA 1NW1A 1FVTA 2WIHA 2ERZE 3IECA 3DJ5A 3DNEA 5E8YA 3DB8A 4PMPA 5CSPA 5I9YA 3QAME 1OIUA 3QQUA 3QTUA 3CKWA 4YSMA 4D28A 1V0BA 4LL0A 4AZEA 4CG8A 4U9AA 4D1SA 4QO9A 3F66A 4BCFA 3R01A 3T9TA 3BV3A 4P4CA 4DCEA 3L8XA 1PKDA 1Q4LA 1Q99A 4FL3A 4A9TA 1HCKA 4DFUA 2VTNA 2OO8X 3V5JA 2OICA 4ALUA 1W82A 3ZBXA 2VWUA 2X0GA 3POZA 3UVRA 5HTBA 2CGVA 1H1RA 1OPJA 2B0QA 4I4EA 4QMVA 3I1AA 4TWPA 5FEEA 4USEA 3POOA 3RWQA 5FM3A 1XH8A 1JKSA 2EWAA 2UW7A 3G9NA 5EH0A 2QOKA 4OTQA 3SAYA 3ZO4A 1KUTA 4OBOA 4RX9A 1YHWA 3AOXA 1OI9A 2C0TA 2C3LA 3M11A 4CMTA 2QVSE 4F1MA 2P4IA 1PXKA 3C13A 4GJ3A 4MD7E 4ANMA 3N4VA 4ENYA 2LGCA 1J91A 3EB0A 4O0TA 3QZGA 3MIYA 4FV5A 1FOTA 5HNGA 5JEBA 3TCPA 3UBDA 5HLPA 3V3VA 3WYYA 4HW7A 5BVDA 4CLJA 3CLYA 2HXLA 4JBPA 1MRVA 4W4VA 4CGAA 5T3QA 4WNMA 5IH6A 1P4OA 4FZ7A 3R9NA 2XJ0A 2PWLA 3HV4A 4FEVA 4ZTNA 2FUMA 4V05A 3LJ2A 1P5EA 2B9FA 4J97A 4G3DA 4PTGA 2W9FB 5DNRA 2PZYA 2GNJA 1YOMA 3FLSA 4CNHA 5BVFA 3SKCA 4RA4A 5EOBA 2OIQA 5GHVA 4D9UA 2YDKA 4G6LA 5TO8A 2V62A 3I5ZA 5J8IA 3RAWA 4FKJA 2WB8A 4XG6A 3GU7A 4HJOA 4EYJA 1H00A 1H0VA 1Q41A 4X3FB 4RJ6A 4D4VA 4F64A 4WOVA 4PMSA 3BPRA 4RG0A 2YCFA 1Q8ZA 5HCYA 4EH9A 3JS2A 3WF5A 4F1TA 3RMFA 5ANEA 2F9GA 3PPKA 4PP7A 3EOCA 3NUUA 3VBTA 3QCQA 4QTEA 2WMUA 3H9OA 4Y83A 5TOZA 5DOSA 3BE9A 2XYUA 2AUHA 4KABA 1PYEA 2BKZA 4YP8A 4RC4A 5CU4A 4AG8A 5E7RA 2G01A 3AC1A 4NT4A 2VTOA 4QTAA 2QCSA 4KKGA 1UU9A 1UV5A 1LR4A 3BLQA 2UVYA 4XUFA 3RPVA 2G15A 3E63A 2WOTA 5CX9A 4QYHA 5ANKA 4DEIA 4BRXA 4I5HA 3Q4CA 1TQPA 4KBAA 3ZEPA 2XNPA 4HPTE 4K2RA 3RPRA 4IW0A 3HLLA 4ZEGA 3ZXTA 3PY3A 4A9YA 5M06A 4Y73A 5A14A 5J9ZA 4I0SA 1M2PA 4HNIA 5DR2A 4EORA 4Y95A 2OG8A 5ACBC 3FMMA 3GUBA 3WF6A 5IF1A 4FUYA 1R0EA 4RSSA 3NUPA 4EH2A 2B9JA 1V1KA 3HMMA 3MPTA 4YTFA 4O7NA 5K5XA 5I9XA 1SZMA 3OCSA 4FV1A 3VF8A 4AW1A 2QNJA 4D58A 5IH5A 1YKRA 4X3FA 1KE5A 2G9XA 2RF9A 4YHFA 4JBOA 2YACA 5EHOA 4EHGA 4F6UA 5A4TA 5IA4A 2I6LA 3PJ1A 5BYZA 2X81A 4PQNA 4ZLZA 1AD5A 5CAUA 3ZLYA 4I21A 2WTWA 3UMWA 3PE2A 2OJFE 3O23A 4B0GA 4ZSAA 3O7LD 4R6VA 2CSNA 4XG8A 3S2PA 3R04A 5C27A 3OP5A 2OJIA 4H39A 1OL7A 2BFXA 5FUTA 4CVAA 3FPQA 3FI8A 2Z7SA 4BZNA 3I4BA 4BHZA 4NKAA 4RIYB 4CFMA 5J5SA 4FKOA 4CG9A 3QTSA 4FE2A 4KSPA 3OEZA 5CALA 5KCVA 2VX3A 5M57A 2V5QA 4RIOA 3B8RA 4RVKA 5C4LA 1WCCA 1JOWB 2Y4IC 2YM7A 1ZXEA 3O51A 4I92A 4CEGA 5IISA 3QWKA 5JQ5A 3A99A 4RRVA 3O8UA 5BYYA 3BHHA 2WU7A 4WIHA 4DH3A 2BR1A 4FKPA 2QG7A 2UZWE 4A4LA 4IVDA 4ZOGA 5CZHA 4F63A 4C2VA 1DS5A 3A60A 3ATSA 3ORMA 5CS6A 4B6LA 3TKIA 2R3NA 4BTFA 4ZTMA 4RIXB 4G1WA 4GCJA 4NTSA 5C1QB 3GC7A 3AC3A 4JX3A 5HNIX 3FMKA 1Z9XA 4K1BA 2Q83A 1U54B 4UALA 3L9MA 3H9FA 1GZ8A 3B2TA 2IWIA 4GL9A 4AT5A 5BQ0A 2HZNA 1KE6A 3ZUUA 3E7VA 4MX9A 2C1BA 2UUEA 2YIWA 3E8EA 4OT5A 4MWHA 4QYEA 4U3YA 4ZXTA 4QMXA 4C4GA 5JFXA 2F4JA 1T45A 1SVHA 3EQCA 3LFCA 5AP6A 5FLFA 4B4LA 5D1JA 3FKNA 3PA4A 5AUXA 4E5AX 3V5WA 2ZAZA 2J0KA 4IANA 5HKMA 4J99A 3N4TA 4JG6A 3GFEA 5DHJA 3PE1A 5FTGA 4EK8A 4E6DA 2VNYA 3F69A 3QKLA 1UNLA 3DGKA 2H6DA 4QMOA 2UW0A 4FV9A 2W1IA 3UVPA 1B38A 2E9OA 1WBVA 3ZU7A 2X8DA 4UY9A 1YXXA 2QOQA 2G1TA 2HXQA 4I0RA 4X2KA 4CT2A 1Q24A 4XLIA 4FEQA 4R7HA 2WO6A 3TTIA 2P0CA 4JQEA 3EFKA 3TKUA 1P4FA 2G2FA 4DGLC 1UNHA 3W8LA 4D2SA 2OI4X 3O8TA 2GNGA 3MN3A 4BI2A 2YM4A 1K3AA 3IQ7A 4XLVA 1OUKA 2UVZA 2X39A 4JOAA 4E6AA 4E73A 2WZJA 3PSDA 4NFNA 1WMKA 3SG9A 1OL6A 2JDOA 4NKSA 3V8WA 4IX5A 2X9EA 3BIZA 3IDBA 1M7QA 3LFDA 4U80A 1GAGA 2VX0A 4DG3E 3UIXA 4AGUA 5M53A 3QZFA 2C6MA 1OIQA 4HYIA 4DFLA 4NCTA 2ZV9A 3CY3A 5EYKA 3C4XA 4MQ1A 5AP0A 3R22A 2PZRA 2XK8A 1FGKA 3KEXA 4I41A 3R8VA 3TV7A 4EQUA 3ZLXA 3ZXZA 3SW4A 5BMSA 3F3TA 3V5QA 4YJQA 4LOOA 3PXFA 4Q9ZA 2BAKA 4Q9SA 4WNPA 3TUDA 1XH9A 3MH3A 2YM8A 1LP4A 1KOBA 2G2IA 2PL0A 3NX8A 4QMQA 1Y6BA 3UGCA 2R3QA 4F09A 4KBCA 5HEZA 2F57A 5IQGA 3QHRA 4YTCA 4USDA 5KZ0A 4JX7A 1WVWA 3PRIA 5CANA 1PXPA 2GHMA 3BYOA 1YI4A 2BHEA 2R7IA 3LCSA 3CGFA 3MW1A 3D5UA 4TWCA 2CKQA 1BKXA 3PA3A 3H0ZA 3JYAA 2GNFA 4EUUA 4GS6A 3OOMA 3TNQB 2QQ7A 5DR6A 4WO5A 5CXHA 4YMJA 3MPMA 1A48A 4HVHA 4RX7A 3EMGA 4AWIA 2CNVA 2ITPA 4WRSA 3OTVA 3PJCA 1O6YA 4EQCA 3TKHA 4X2NA 4BTMA 2C6IA 4PMMA 1ZY4A 3EQBA 4OW8A 5AAEA 1P14A 3VWAA 4XG3A 5HG7A 5AUWA 2XRUA 4GUEA 4FODA 3LHJA 5E9EA 3CTQA 4CFNA 4YJRA 5ITAA 3OFMA 4YSJA 2VZ6A 2UW6A 3W2PA 2WGJA 2BAQA 4IAIA 4MHAA 4ALVA 4D2RA 1I44A 4J8MA 2BZKB 4LYNA 2YA9A 5H2UA 4BCKA 4BB4A 3F61A 1H1PA 2CKOA 2JIIA 4FSTA 2XUUA 3QKKA 3OWPA 5AV4A 4YJOA 2QG5A 3E3BX 3IGGA 3FZRA 3UIBA 4GT4A 4LRJA 5HLNA 3LPBA 3NR9A 1TQMA 3M42A 3AD4A 3E64A 4XX9A 3SG8A 3ZUVA 2OXYA 2PMOX 1ZARA 3WZDA 5BUEA 4YPSA 3O71A 5L8LA 5EOLA 5DBXA 2HZIA 2RG5A 1OKYA 2WMSA 4XV1A 4OLIA 4WUAA 4PV0A 3RZBA 2LAVA 3ORPA 3HL7A 2PVYA 4FKQA 2QO2A 3LXPA 3KFAA 1OUYA 3HMNA 3UIMA 3T9IA 3PA5A 5EQEA 4FKRA 4LOQA 5IEYA 4TKSA 4F0FA 2O0UA 3LFEA 1PXLA 3S95A 2IW6A 3EZVA 2VTSA 4LFIA 3VBXA 4RC2A 3W2CA 1KOAA 1PJKA 3MDYA 1H26A 4CT1A 1MQ4A 2WTVA 3SX9A 3ZC6A 4UX9A 3DNDA 3Q2JA 3UYTA 3FC2A 3U8WA 2C3JA 4YJSA 5T6KA 3RKBA 4Z7GA 2BALA 5CLPA 5DT3A 4LGGA 3ROCA 3V5LA 4IVCA 1SVEA 3K3IA 3R7YA 3WIKA 3PJ3A 2HOGA 4F70A 2R3HA 3QTIA 5AP2A 4NM3A 1J1CA 2XM9A 3QRKA 3RTPA 3W2SA 2XNBA 3QC4A 3OWKA 4U44A 4Y8DA 3QQJA 5AP7A 2VTHA 4WBOA 5AV0A 2JAVA 3GBZA 4V04A 4EBWA 5IQDA 1G8AA 1XWSA 4M67A 4TRLA 4C4HA 5HCZA 3LCOA 1IASA 3QXPA 1F0QA 2Y6MA 2W1HA 4FTUA 1GJOA 4PY1A 3UNZA 4NSTA 3RAHA 1ND4A 4AX8A 3QQGA 4AN2A 2FA2A 4PRJA 2BAJA 5EW9A 3Q9YA 3QCSA 4KS7A 2X8EA 4RVMA 1WBTA 4FT3A 4I6BA 4DH5A 3MVMA 4FTOA 1OL2A 4LOPA 4V01A 1VEBA 3W32A 2O8YA 4ARKA 2OU7A 4A4XA 1UA2A 1L3RE 1ERKA 1AGWA 2XIKA 4IB0A 4NL0A 3BU5A 1XJDA 5L6WL 3DKGA 4XS2A 1ATPE 2H96A 1OBGA 2R3JA 3HV3A 3MVHA 4BTKA 5IA3A 3R21A 4XOZA 4X0MA 2ETMA 4F7NA 3OT3A 2BROA 4YJUA 3RPSA 3TG1A 5BX0A 4GYGA 5DI1A 1FMOE 5IQAA 4KIPA 5CU2A 1QMZA 4DF3A 4Y5QA 3OUNB 4JBQA 3RHXA 4JR7A 5DRDA 1Q8TA 1HCLA 3S4QA 5CVHA 2IZUA 3FQEA 3PXZA 3PVGA 3KK9A 5J1WA 4IFCA 2PVRA 2WOUA 4XHKB 5AM7A 3VHKA 4ZMFA 4TY1A 4RWJA 3DFAA 4G16A 2VWIA 2RG6A 3OWLA 3P79A 4D0XA 4E5BA 3OWJA 3G2FA 3FLQA 2W1GA 5LMKC 2W17A 4ITJA 3FV8A 3ORKA 2QKWB 2W5BA 1JKKA 2C6EA 3CC6A 4XCUA 4C3FA 4MTAA 3TIYA 2WMVA 4ITHA 4RJ4A 1VR2A 2WAJA 3CD8A 2XIZA 3SXRA 2WNTA 1YXVA 1WVXA 1PMUA 3W55A 3ODZX 2Z7RA 2GCDA 4DTKA 1ZOHA 4QPSA 2JDVA 3R83A 3IW6A 4PL4A 4FKTA 3VW8A 3W33A 4EL9A 3SDJA 2BCJA 2IVVA 4H3PA 5FEQA 2W06A 4TZRA 2EB2A 4ZSGA 5HNBA 3GXLA 4IAZA 2WD1A 3A8XA 2PTKA 1VZOA 2BDJA 4DE4A 1BX6A 3LXKA 3MJ1A 4KIQA 1E1VA 1REJA 4OTFA 4OTGA 2HK5A 3GCQA 5DVRA 4CV9A 2XZSA 4ZZNA 3KMMA 2C0OA 4EOKA 1LPUA 3UQGA 1OM1A 4CXAA 4XP0A 3SV0A 3FJQE 3KXNA 5AADA 4E5WA 4ASZA 3TDVA 5IG1A 1PKGA 4ASDA 3EZRA 4WD5A 4GG7A 2R7BA 2XKEA 3MS9A 3NRMA 2XH5A 3MVLA 4L46A 2YEXA 3B8QA 4GSBA 3R28A 3VS1A 2NNWB 4D9TA 3EQRA 5EKOA 4QMSA 4YLKA 4BCIA 3VULA 4EWQA 4BCJA 2AC3A 2WTKC 2ONLA 3FKOA 5HIDA 2NPQA 2J0MB 3DU8A 3HRBA 3II5A 1YXSA 1PF8A 2YCRA 3BLRA 4ITIA 3R8MA 3EFLA 4FTJA 4IIRA 5BYLA 4TTHB 5HG5A 4RQVA 4C2WA 2V0DA 3NZ0A 5CTPA 1YOJA 2X7GA 4RZWA 3LCTA 4EHZA 3TT0A 4AZTA 4CLIA 3UO5A 4FEXA 3BX5A 4FKIA 2C6OA 4ONAA 4FVPA 5EW3A 2R9SA 3DB6A 3NCGA 2R5TA 3QCXA 5CQUA 4BCNA 5HESA 4I0TA 3VRZA 1YWVA 2CKPA 5F94A 4FOCA 3KCFA 3R1NA 1FQ1B 5J95A 1YWRA 2GNLA 1GNGA 4GT5A 4NU1A 4RWIA 5IQCA 1ZLTA 3MY0A 3RM6A 4O7VA 4F0GA 3CJGA 3IKAA 4FT5A 1FINA 3FEGA 4YZ9A 3BGZA 4NYEA 1GZOA 1H4LA 4IQ6A 3NYOA 1J7UA 4GK3A 3UJGA 3D0EA 5DFPA 3COMA 4CCBA 1Q3DA 5AP4A 3LIJA 4DEBA 2XIXA 3D2IA 2R0UA 3G0FA 4TYEA 3CIKA 3SGCA 1FVRA 3MV5A 4BDBA 4EJ7A 4GH2A 2Y4PA 1E1XA 3PDTA 4PTCA 4RVTA 2YWVA 4ZMEA 1ZZ2A 4JQ7A 5H8EA 1Q8UA 2J0LA 4I1ZA 1NA7A 2GMXA 4AN9A 2C0IA 2YIYA 3BI6A 3QC9A 5M07A 3DXQA 5HE3A 4AAAA 1MRUA 5F9EA 3MY5A 4MH7A 5DG5A 1Z57A 3C5IA 4ZJJA 3DZOA 2O63A 1LEWA 5I9ZA 5IDPA 1GIHA 3FHRA 4S30A 1KE9A 2GU8A 3I7BA 4X21A 2ITXA 4QP4A 4YJVA 4JIKA 5HU3A 4IBMA 4MEDA 5D10A 3V01A 4ERKA 5CF8A 4DT9A 4L42A 5LVLA 3KULA 4TYJA 4ZTQA 3LVPA 4YZCA 1F3MC 1G5SA 2I0YA 3PXKA 3KVWA 2WQNA 2F7ZE 1YOLA 3Q60A 4LUDA 5IUHA 5M4CA 3DDQA 3MH0A 3ORXA 3QX2A 4QNAA 3OY3A 5GJFA 3AG9A 3PXYA 5LMBA 2BDFA 1PY5A 5IH4A 2VWVA 4LV8A 3I6UA 5A46A 2E9NA 2OW3A 3ZZEA 4G5JA 3EL7A 3WE4A 5KNJA 5L2SA 2BRMA 3D5XA 3VS6A 2PU8A 3PVUA 4WKQA 2FO0A 2PK9A 4RLKA 4CRSA 4EBVA 5AAFA 4ZJVA 4RFMA 1KE7A 4DBNA 1Q8YA 4O0SA 4DGOA 5GJDA 4YR8A 2ERKA 1UKHA 5CAVA 5GIOE 1TVOA 4FV6A 3F3WA 4X3FC 2BRGA 1PW2A 4RVLA 4O22A 4AW0A 4CFFA 3KF4A 5E8XA 5HG8A 4GFGA 4IZ5A 1FGIA 3QTZA 4ACCA 3HEGA 2HYYA 1UWHA 2CJMA 2FSOX 4CKRA 4S2ZA 4O21A 3VC4A 2JDRA 1JSUA 2R3PA 1PXOA 2EVAA 4ZS0A 4O86A 1OBDA 5KBQA 3HAMA 4LM5A 4RQKA 3TM0A 1NVRA 3WIGA 4MD8E 3R63A 4UZDA 2JBOA 1YI6A 5HIBA 3KB7A 2B9HA 4G3FA 3E3PA 3EHAA 3SRVA 4RIWA 2YISA 3PUPA 4W4XA 5FDXA 3V04A 1M7NA 5CU6A 2B54A 2PVKA 4L3LA 1JAMA 3GOPA 5E4HA 3I5NA 5KBRA 3MJ2A 4P5ZA 3HV6A 4EK5A 3EN7A 3RP9A 5JRSA 2J90A 2Z02A 2DYLA 4YZMA 3S3IA 4HVDA 1YVJA 2JC6A 3COHA 5HVKA 1VYWA 2OJJA 3OXZA 3O17A 3P86A 4UXLA 5K4JA 3A61A 3ZM9A 2XS0A 1JLUE 4OTDA 3HMPA 3EWHA 3VUDA 4BDHA 4BIEA 4UEUA 3K5UA 1PXMA 3TI1A 2XVDA 3SHEA 1XH7A 3BEAA 4FL2A 4FNYA 1WVYA 4WNOA 3ET7A 2C1AA 1CKPA 4II5A 4M0YA 2P2HA 3AD6A 4YZNA 5M4IA 4ZSEA 5B2KA 4AGDA 2VO3A 2FGIA 1U5RA 5GJGA 5A4LA 1PXNA 5CU3A 4IWOA 2PMLX 3VBVA 3NLBA 5HLWA 3WF7A 3IW8A 4GFMA 1LEZA 4N6ZA 4DEEA 1K2PA 3UTOA 3R8LA 2BTRA 3BWJA 4ASXA 2PHKA 4WG5A 1S9IA 3FQSA 3AMBA 3FLWA 4UN0C 3U9CA 4O27B 5DGZA 1GZNA 5JFSA 3PJ2A 4IB1A 1REKA 5EHLA 1YXUA 5BUJA 2XNNA 4IC7A 1BMKA 3F2AA 4QTBA 3HAVA 4OGRA 4E1ZA 2XNMA 2ESMA 3A4OX 4BGHA 4AZFA 1H07A 3DK6A 3Q4TA 2IJMA 2ITNA 1FPUA 4O0XA 4HYSA 4CFUA 2WQEA 5IZFA 3KF7A 5HE0A 4MXZA 4DEDA 3GC0A 3UMXA 2OGVA 3NUYA 2HW7A 3PIYA 3DJ7A 4DG0E 1DI8A 3E88A 3OCGA 2PMIA 3KRLA 3TN8A 2PYWA 3EYGA 4HYHA 3OC1A 5K5NA 2OH0E 2WQBA 2C30A 2QR7A 2YCQA 3R7VA 4E4XA 5CASA 4AZVA 3WOWA 2XK7A 4DGMA 1URCA 3IOKA 2YAAA 3QD0A 1W98A 3DDPA 4G34A 4L45A 5KMNA 1PMVA 2QKRA 5FEDA 4TW9A 2W4JA 3DJ6A 3R00A 4U42A 1UU3A 5A4EA 3E93A 2HY81 3FMLA 2I0HA 2YERA 3DKOA 2ITWA 2ZB0A 4XG4A 4BCGA 4FIHA 1A9UA 3AMYA 2PVJA 2OIBA 4IZYA 5KMMA 2C6DA 2XKDA 1YDRE 2VTRA 4IHPA 4QMMA 2GTMA 3AT4A 1OL1A 3CR0A 3NYVA 4HCVA 4IM0A 3GU8A 4FEUA 3FDNA 3ZC5A 4TXCA 2WPAA 4Z7HA 5CEOA 5JGDA 2XMYA 3SQQA 3EKKA 4BYIA 1A06A 5EYDA 4QRCA 4O0UA 5M44A 5A54A 3UC4A 1QPCA 3DTCA 4U0IA 4RGJA 1UKIA 2JKKA 4E6QA 2WMBA 1FVVA 4LMNA 4FI1A 3HP5A 4YLJA 4ORKA 4B8MA 5JRQA 4AT3A 3G33A 1BL7A 4DFBA 2PUPA 3P5KA 4L01A 5EYMA 4E93A 3NUSA 2CN8A 4USFA 4BIDA 4JAJA 3KMWA 3P7BA 2BPMA 3MY1A 2XEYA 3ELJA 4BGQA 2WFYA 3U54A 4M69B 2R3MA 3FBVA 1IR3A 4EZ7A 3FZPA 5LCKA 4Z16A 1PRYA 5LWMA 2R4BA 4WG4A 3FWQA 2PVMA 3G90X 4FNXA 3UQCA 3JXWA 2XNGA 2QODA 3TZ7A 4MQ2A 4DFYA 1APME 3B2WA 4XOYA 5HE1A 4C4EA 2PUNA 3GQLA 4IC8A 3QHWA 2W5HA 4N57A 4BHNA 2GSFA 3IG7A 1J1BA 3MSSA 4F9CA 4MXOA 2BUJA 2ITZA 2C5NA 3R8ZA 2SRCA 4EH6A 3NEWA 4RX8A 4IJPA 3F88A 4KAOA 4NZWB 3ULIA 3PXQA 5EYCA 4F65A 4KUJA 1E9HA 2UZDA 3N4UA 3GB2A 3Q3BA 4O2ZA 1BI8A 3W10A 5IMXA 4FOBA 4I20A 5ANJA 2B52A 3Q04A 2FSLX 3UODA 3KRRA 5A3XA 4MNFA 4O0VA 3AC4A 1Q62A 2Y7JA 4D5HA 4DA5A 5FQDC 3RNIA 3NIZA 4E4NA 5AUVA 3I0OA 4GIHA 5CSVA 4CTBA 4JQ8A 3OY1A 3PSCA 4U43A 3NYXA 1CKJA 3K5VA 3BYSA 5CY3A 3VAPA 5AP1A 3PTGA 3BE2A 2C4GA 1B39A 2OZOA 2WKMA 4O0WA 5M56A 4FG7A 2XYNA 4TNDA 2FSMX 4E20A 2GQRA 4WG3A 3NAYA 3VIDA 3LOKA 2C3IB 4M15A 2OFVA 3VS5A 3HA6A 2A4LA 3LFQA 3DCVA 3PVWA 2X9FA 3VUHA 4Z55A 5CU0A 1JSTA 3RWPA 4EKLA 3MH2A 3ZM4A 2VN9A 2CN5A 2FB8A 3H10A 5AAGA 1H1QA 3IS5A 4JDHA 2YITA 4AA0A 3A4PA 2H9VA 4NWMA 4RPVA 3RHKA 3H0YA 1RQQA 3VS0A 3ZCLA 4C58A 4APCA 4DFNA 3WZUA 3P9JA 4C02A 4F7LA 3ZBFA 3HV7A 5IEVA 2GNIA 5CXZA 3L9NA 3M1SA 4IVBA 3THBA 4X2JA 5JQ8A 4U6RA 2WMXA 3AC8A 3CTHA 3LCKA 4L53A 4F4PA 3C0IA 4J7BA 5FXSA 3VVHA 4BCOA 2GPHA 4PP9A 4G2FA 3PPJA 1AQ1A 4FYNA 2PE1A 4S34A 4QP9A 4G3CA 3ATTA 4EONA 4HCTA 4D4SA 2J50A 3VUIA 3NNVA 3W2QA 2FYSA 4NW6A 4PDOA 5HBHA 3FI3A 4QQ5A 4F99A 3VS4A 1PXIA 1RW8A 3CQEA 2FSTX 2R3GA 3DK7A 2OZAB 3BU3A 3G51A 1X8BA 4O84A 3KCKA 4OBPA 3R8PA 1VJYA 5E1EA 5LJJA 4Q2AA 2AC5A 3EYHA 5D41A 3A2CA 3HKOA 3FY0A 4FZDB 3MFUA 2J5EA 2YN8A 3QUPA 5HD7A 5IQHA 5HG9A 2W1FA 4DN5A 4FIFA 4KRCA 3OW4A 5I4NA 5M4UA 3G15A 3LM0A 4BICA 2J7TA 4QP1A 1Q3WA 2XJ1A 4F7JA 5IPJA 4IEBA 4HZRA 3UZRA 5CT0A 4AZSA 5DN3A 3BYMA 3RK7A 5L6PA 3MB6A 4MXCA 3UP7A 4CKIA 5L8KA 3T8OA 3WZKA 3RPYA 3ZLWA 3OHTA 3DAEA 4O83A 4RJ8A 4XH6A 4RWLA 2WTDA 4GJ2A 3ZRLA 3PY0A 4FNZA 4AW2A 4IDVA 2R3LA 4BCQA 4FVQA 3QD3A 2RFDA 1MRYA 2YZAA 3N9XA 3KK8A 4C4FA 3S0OA 3FI2A 2YHVA 3O96A 4GMYA 3EN9A 4IADA 3BELA 4IMYA 3ORTA 3NW7A 2NRYA 3DBEA 3R71A 5HI2A 3W18A 3T3UA 4O82A 3TNHA 1NT2A 5HGIA 2PY3A 3AMAA 3KA0A 2OZAA 2BHHA 2IVUA 2E9VA 1ZWSA 2QLUA 2VO7A 2ZM3A 3IOPA 4G31A 1YDSE 3R9DA 3TL8A 3TACA 3ZLSA 2ONLC 4A4OA 2VTPA 2W0JA 4AUAA 1GZKA 1ZY5A 3WZEA 4ERWA 4FV4A 3ZRMA 3QF9A 4IDTA 4U7ZA 4RX5A 3JVSA 4XNEA 3RJCA 5CNNA 5DYJA 3F2NA 4O7RA 4IE9A 4MXAA 5LVOA 3AGMA 3LM5A 4AE6A 3GU4A 2FH9A 1OMWA 2X4FA 5FTOA 2XKFA 5FP6A 1J7LA 3PLAE 4HGTA 3U6HA 2ZV2A 3HX4A 4NUSA 3SD0A 5IA5A 3G0EA 1GOLA 3GCVA 3LMHA 4AXAA 1RJBA 5B7VA 2JFLA 2KULA 4TWOA 4B9DA 4DFZE 2YIQA 4Z3VA 3PJ8A 2WEVA 4KS8A 4WNKA 4FICA 3UOLA 5TR6A 4L3PA 3FSFA 4MBIA 4CV8A 3MH1A 4EOJA 1J3HA 4XBUA 2BRBA 4WA9A 1U4DA 4Q5HA 2I7QA 2A27A 4XV9A 4CTCA 3JY0A 5F95A 3MPAA 3ZFYA 1V0OA 4B7TA 4YURA 2J9MA 5HBEA 5EM8A 2VUWA 2BKKA 3VJOA 3ZSHA 3H9RA 5IEXA 2VWYA 3GC9A 1NXKA 1WAKA 4I6HA 3H30A 4XRLA 4W4WA 4BDGA 3KRXA 1EH4A 3E5AA 2X1NA 2F49A 1O6KA 3A7GA 2B1PA 4G3GA 5AUZA 3VS7A 3LQ5A 3ZO3A 3NMUF 5AUYA 3R02A 5J9LA 4FV2A 4KKHA 4QYYA 5GNKA 4FK3A 2UZBA 2W4KA 3MFSA 4RJ7A 3IW7A 4V0GA 4WHZA 1XH6A 3D83A 5JN2A 5FBOA 3FYKX 5CSHA 5D7VA 5C8NA 3V6RA 3BBTB 5L2IA 3SRVB 1Q5KA 1ZYDA 4GV1A 4XEYA 2O5KA 3F3VA 4AP7A 4EOMA 3MGYA 4F9BA 3G5DA 3C0HA 5J9YA 4FKSA 1RDQE 3Q4UA 4ACHA 5CEKA 3K54A 5L8JA 3RCJA 4H36A 2XF0A 3ZUTA 3NUXA 5F20A 4QTDA 3CBLA 4YHTA 3BYUA 1IEPA 3VUKA 4B99A 3BCEA 3KU2A 2R3IA 3F3UA 4FKVA 4I6FA 3QQLA 3DAKA 3TJDA 3A7JA 4G9CA 4GU9A 3GNIB 3UQFA 4O6LA 4AACA 4CZUA 4FT9A 1IAJA 3FMEA 2Y9QA 4YTHA 2VO6A 2ZOQA 4O7WA 2XA4A 4PDPA 4S32A 1FMKA 3F7ZA 5AEPA 4Q5EA 3HVCA 5GINE 3F6XA 2QLQA 3HUBA 5D7AA 1QCFA 1PYXA 4J8NA 3SA0A 4DAWA 2RGPA 1XBBA 4EK4A 3O0GA 5AUTA 4M68A 2IO6A 3QXOA 3U4WA 5EI6A 4XRJA 4N0SA 3Q32A 3F7WA 3V5TA 2Y0AA 4OTIA 2HCKA 2A19B 4GFOA 4BBEA 3SLSA 2NP8A 5ETIA 2P33A 1IRKA 3PYYA 3U55A 4APPA 3E8CA 4NK9A 5CT7A 4RLLA 4BGGA 4H05A 2XK6A 4ZAUA 3QWJA 3MTFA 5FBNC 5EHYA 3NNUA 1CMKE 3N51A 1CSNA 2VAGA 2Y8OA 2YABA 4FZ6A 2IPXA 4QMPA 4YTIA 3R7OA 3VUGA 4W8DA 3EQGA 5BVWA 1OPLA 4F9YA 2RIOA 2HENA 1S9JA 4FTMA 3TZ9A 3QD4A 3E8NA 4AOJA 1JSVA 3P7CA 2I1MA 2CKEA 3P08A 4TYIA 3UNKA 5DWRA 3KVXA 3LKMA 4A9RA 1PMEA 5HTCA 3GP0A 2HY0A 4FZAB 3LZBA 4J53A 4WUNA 3O2MA 4L7SA 4DEGA 1XQZA 1OPKA 2X6EA 3R0TA 3FLZA 5CENA 4EWHA 2XM8A 3OT8A 2IG7A 3RVGA 1BYGA 2X2LA 2WU6A 3NVMB 3JY9A 2VTAA 2BVAA 2AYPA 4HNFA 3U6JA 1KSWA 3RK9A 1WBSA 1YDTE 4MCVA 2XCHA 4EH4A 4X7QA 3PP0A 3P1AA 4EOIA 2BIKB 2QU5A 3GT8A 3PRFA 5FP5A 4QMWA 3W1FA 2PSQA 4O2PA 3KXHA 2A1AB 4HYUA 3DY7A 4R7IA 4YBKA 4YNOA 2ZMCA 4B8LA 4JLCA 4O38A 3LXNA 2QOFA 4HGLA 3QTQA 1YWNA 4WSYA 5BNJA 5IA1A 3WILA 1OIYA 4H3QA 2X4ZA 2WMAA 5A4QA 5J7HA 2PUIA 3LLAA 3FMJA 4MBLA 2R3KA 4BCPA 2CLQA 3O50A 2EUFB 3CTJA 3DTWA 3HMIA 4U8ZA 4D55A 3HP2A 3IO7A 3TUBA 3KULB 3E8DA 2OXDA 2ITUA 2GHGA 3OD6X 4BC6A 4J71A 4F6WA 2GFSA 3TUCA 4P2KA 3EN5A 4GKIA 3V51A 4IZAA 4H1MA 2GDOA 4IB3A 4I24A 2EU9A 4OTHA 3UOKA 5JT2A 1BL6A 3ORZA 4JIAA 3IDPA 3U51A 2JBPA 3LXLA 4JDJA 1H1SA 3GCUA 4R5SA 3UZPA 3LLTA 2YWPA 3SW7A 4E6CA 2YM5A 5KKRC 3F5UA 5LCJA 1XH4A 4FG9A 4M12A 3F2RA 4QP7A 2XJ2A 3QGYA 3LE6A 4G5PA 3GFWA 4PX6A 5FRIA 1H25A 3Q52A 3RPOA 3FL4A 3C51A 2ZVAA 2ETRA 4FV0A 3R7IA 3VBYA 2YZLA 4FVRA 4D4YA 1ZAOA 5H9BA 3NIEA 4DEAA 4E8AA 3BQRA 4AS0A 4L68A 2CNQA 3PY1A 5IUGA 2YFXA 3EN4A 2OF4A 4ZLYA 2QOIA 3WZJA 3D15A 3ZS5A 2UVXA 3I79A 4GU6A 3R9HA 1ZRZA 3ALNA 1Y57A 2YCSA 3ACJA 3R1YA 5E92A 3MYGA 2F7EE 4HVIA 5IQFA 1YRPA 1UVRA 4AOTA 2W1CA 3F5XA 5IUIA 3TXOA 4IZ7A 4UV0A 5B0XA 4RT7A 4OT6A 5J87A 4EOPA 4QMYA 1YXTA 4KB8A 5F4NA 4IAAA 4ACGA 4EOOA 4AA4A 5L6OA 2BZHB 3V5PA 2CGUA 3CXWA 4TNBA 1R39A 3NS9A 4NM5A 4FTRA 1WBOA 2BZJA 3WYXA 5LVMA 4QTCA 1W0XC 2ZDUA 5E8SA 4YUQA 3ZTXA 5CZIA 2C68A 1KWPA 4YO6A 3FL5A 4YJTA 5T68A 2VTMA 4AQCA 4YPDA 4EK6A 4FUXA 4HGEA 2UW4A 2ZDTA 3QA8A 4ZY6A 4NW5A 4RIWB 2J4ZA 3DPKA 5AV3A 4FTLA 4UBAA 3RI1A 3BU6A 3UVQA 4EK3A 5AV1A 5A6OA 4CQEA 4FR4A 1U5QA 1ZOGA 4ZTHA 3D5WA 1CDKA 2W4OA 1OECA 5KX8A 2YAKA 4FV7A 4GRBA 4EOQA 3ZZWA 5K9IA 3KRJA 4ZS4A 2I0EA 4CD0A 3OEFX 2E9PA 4CFVA 3C4FA 5KMKA 3QU0A 4PMTA 2EXCX 3AQVA 2XBJA 4L44A 4IWQA 1YQJA 3QLFA 3E87A 1QL6A 4F6SA 4FKLA 3VJNA 4ACDA 4D1ZA 4LI5A 4L52A 4GIIA 2F2CB 4A06A 3FZOA 4C4IA 2WMTA 4DGNA 4ZLOA 1G3NA 2O3PA 5ANDA 3ZFMA 1JKLA 4MWIA 2NO3A 1R3CA 5BMMA 4E4LA 5AA9A 1NVQA 4QQJA 2E2BA 4EH5A 5DRBA 3UYSA 5CQWA 1OL5A 3QYWA 4ZK5A 5H8BA 1JPAA 3NDMA 5CVGA 1YI3A 3OROA 2V22A 1GIJA 3TTJA 4YZBA 3TZ8A 1SNXA 4FZFB 3QLGA 4I5MA 4U81A 4F0IA 1MP8A 3DBQA 4YO4A 3COIA 5TT7A 3RM7A 3K2LA 4JG7A 4XG7A 3SOCA 3VF9A 2HAKA 2X7OA 3BQCA 3ORNA 4JS8A 5CSWA 2C5XA 3MA6A 4J1RA 4HVSA 3L8PA 1XBAA 2QHNA 3OZ6A 3PSBA 4X2FA 5IDNA 3AGLA 4CSVA 3P78A 1UU7A 2XNOA 4FGRA 4LV5A 3RINA 3UO4A 4C7TA 2CGXA 3T3VA 1BUHA 4AGWA 1JQHA 4FX3A 2J51A 3QALE 4ZIMA 4FK6A 3OOGA 4AF3A 4I6QA 2IZSA 4Y46A 5CSXA 4O91A 5FTQA 4K77A 3ZO1A 3VN9A 5CEMA 5KKRB 3ODYX 4U3ZA 2RKUA 5AJQA 4UXQA 3QCYA 3NAXA 2JD5A 3Q53A 1MQBA 2JFMA 1B6CB 4FIGA 4EH7A 2QHMA 3DT1A 3G6HA 4IH8A 4L8MA 4L9IA 5FM2A 5L3AA 4PNIA 5LVPA 5EM5A 3QA0A 3QGWA 2QONA 3CKXA 4R5YA 4MKCA 5AIRA 3S00A 4FKGA 3ENMA 3FZTA 3Q96A 3WI6A 2JEDA 3ZSGA 4DT8A 2Z7LA 2Z60A 4XV3A 2QOLA 4AFEA 4BN1A 1XO2B 4MNEA 3MBLA 5FXQA 1Q61A 2UZUE 3C9WA 2GNHA 4NTTA 1U46A 2WXVA 3MFTA 4BDEA 4QQTA 1GY3A 2CHLA 4EYMA 4FNWA 2Q0NA 3QQFA 2Z8CA 3P23A 5KE0A 4QQCA 5FGKA 4IACA 2ITYA 3VBWA 4AW5A 4BI0A 2UZTA 3GCSA 3DV3A 4FSRA 2Q0BA 2ZM1A 5EDRA 1ZOEA 4ANBA 1OB3A 3QUDA 4M3QA 5E8ZA 2ZM4A 1XH5A 3SXSA 4CCUA 4OTRA 3QRJA 2PVLA 2W5AA 3LFSA 3BKBA 3R9OA 5CEQA 4BDKA 2IVSA 2ZV7A 3C0GA 3ID6C 4UZHA 5H8GA 3R7UA 4PWNA 3R30A 4FSMA 5HO8A 3PIZA 3BEGA 4EZ5A 3GU6A 4LRKA 4TPTA 2QURA 3L8SA 3VS2A 1ZMWA 4JDIA 3VUMA 3ZO2A 4FGBA 2ITVA 2QO9A 3V6SA 3QTWA 4UB7A 5ACKA 4QMLA 2UW5A 4PNKA 1Y8GA 2IZRA 4ZSLA 5HZNA 4O81A 3I81A 4GVJA 4M8TA 3UNJA 4QMZA 4RJ3A 5A9UA 4FIEA 4S31A 4FTIA 3FHIA 5CI6A 3ZRKA 3KMUA 4H1JA 1DAYA 2PVNA 4NCTC 3FZ1A 4XP3A 4TN6A 1W8CA 4QYFA 2R3RA 4YGAA 3BHVA 3VHEA 3K3JA 4CMOA 3HRCA 3SC1A 1JVPP 2WELA 2J2IB 5ETCA 5C26A 5ICPA 4YLLA 4L6QA 5FG8A 1Y6AA 3GGFA 1SNUA 4CKJA 2WMQA 4FL1A 3EJ1A 5HICA 2NRUA 3QQHA 3O7LB 1H1WA 2GS2A 3ALOA 3ULZA 2OLCA 4HGSA 5G6VA 3LFFA 5I0BA 2GQSA 3FZSA 4G9RA 3W2OA 5M51A 5ANIA 2IVTA 2QOOA 3DXPA 2JIVA 4IX4A 4ALWA 2Z7QA 3AXWA 2GFCA 3DZQA 4YC6A 3TNWA 4F08A 4GEOA 4JAIA 2H8HA 3RALA 1JKTA 1J7IA 3H4JA 3Q4ZA 3F9NA 1NY3A 4P7EA 4M7IA 4O7YA 2CCHA 3FLYA 3E92A 4ZZMA 4DFXE 4M97A 5L2WA 1MUOA 2WMWA 4BDJA 4FT0A 5GIPE 2ITTA 4AE9A 1H28A 3KN6A 4MYGA 4DC2A 5E8WA 4I5PA 4IWPA 1TKIA 2W1EA 1H27A 4Y72A 2PMNX 4FSYA 4DINA 3NW5A 4DLJA 5E91A 3C7QA 4QOXA 4I3ZA 4BDIA 3CPCA 1WZYA 2B53A 5EM6A 4GVAA 2V7OA 4MAOA 3WBLA 3MA3A 5C8MA 5DLSA 3LJ1A 4K33A 4QP6A 4FA2A 2ZJWA 4NJ3A 5I9WA 2XP2A 3NCZA 2WTIA 3KGAA 4FTNA 4GYIA 3S1HA 5KHWA 5DEYA 2BRHA 1IA9A 3OMVA 1QPDA 1W7HA 2VWZA 5C4KA 4DTBA 3DKCA 2C6KA 3LFNA 4XP2A 1O6LA 3ZOSA 2HZ0A 2UW9A 5DE2A 3L1SA 4P90A 2X2KA 3D94A 3IK3A 3G6GA 3ZYAA 2DWBA 3ITZA 5EI8A 2YDIA 3RCDA 4BBMA 4R1YA 3DLZA 3I0QA 4JDKA 2X8IA 4I94A 3PZEA 4ANQA 1R78A 5HE2A 4ZY4A 4DITA 3FXZA 3JUHA 2Z2WA 3KXGA 5L2TA 5IA2A 4A9UA 3QD2B 1XHAA 1JNKA 2FVDA 2WMRA 3LMIA 3EQPA 5HCXA 4DH7A 5K4IA 4FSUA 4XG2A 4R3RA 4YJNA 3UOHA 4L3JA 2JGZA 1IG1A 3VBQA 4G6OA 3CQWA 4C3RA 4CMUA 5AUUA 3OVVA 2XK4A 2YM3A 1F5QA 2YM6A 2PE2A 5E1SA 4N70A 1YHSA 2XBAA 3CEKA 3DFCB 3TWJA 2G2HA 4R77A 5DPVA 4KKEA 1M2QA 2X2MA 1SYKA 4ID7A 4DCAA 3ZONA 4U5JA 2QU6A 2JKQA 3COKA 5JFWA 3OTUA 3F5GA 4RWKA 5HVYA 2DQ7X 3RGFA 3Q9ZA 4O0RA 2R64A 2C5OA 2P55A 4KSQA 3FPMA 3QRIA 4KWPA 4LL5A 4ZTSA 3FYJX 3AT2A 4I93A 3RAKA 3Q9WA 4R3CA 4DLIA 5M09A 3U9NA 3DBCA 1SVGA 2B55A 3MESA 1L8TA 3SOAA 3VRYA 4L00A 4KA3A 2C6LA 3EH9A 3VQHA 5AP3A 5AMNA 2CMWA 2J5FA 5DA3A 4AGCA 2VTJA 5BVEA 1I09A 3PZHA 3Q6WA 4LQMA 3CSVA 2PUUA 2WEIA 4NM7A 4JI9A 4GK4A 5CF5A 5KMLA 1CKIA 5DT4A 1DI9A 1STCE 5FDPA 2VU3A 1KE8A 2R2PA 3DS6A 3R2YA 4FIIA 4JBVA 3ZSIA 4JRVA 1ZZLA 3GENA 4K6ZA 4EHVA 2CCIA 4O7SA 1H01A 2WTJA 3OW3A 5ANGA 2PPQA 2VD5A 3L8VA 3PWYA 4ZSJA 3JPVA 4K8AA 4EOSA 4L7FA 2DS1A 2HELA 4EJNA 3A8WA 2VWWA 3FQHA 4MXYA 2XIRA 1JWHA 2HWPA 4OUCA 2XK9A 4YC8A 3QZHA 2QOCA 4RIYA 3C50A 1O9UA 3FMDA 5HO7A 3BRBA 3U4UA 4DHFA 4F9AA 5HX8A 3PG3A 3NPCA 2IW9A 5IQBA 3M2WA 3NW6A 3ZH8A 5CEPA 3BZ3A 5BVKA 3EQIA 5JGBA 5DIAA 3DQWA 4BF2A 4FKWA 3OUKA 4IVAA 1SMHA 4CFWA 4MBJA 4W8EA 4FSZA 3IONA 1M14A 3PP1A 4O6EA 4C33A 3Q2MA 3A62A 2CDZA 3R1QA 2RFNA 3O8PA 3HRFA 5H3QA 4ANLA 3BHTA 4RIXA 4O7ZA 3MI9A 4DBXA 5CF6A 3C4EA 5EDQA 4NM0A 4Y85A 3H3CA 1U54A 5G1XA 4IB5A 5HHWA 5CF4A 5A4CA 1W83A 2KTYA 2R0IA 2GS7A 3DAJA 3BBWA 5A6NA 1PMNA 1XR1A 1SM2A 2VTLA 3BHUA 1ZMUA 4GW8A 3LJ0A 4GG5A 4TYGA 5DH3A 2PULA 3WF8A 4JRNA 3WE8A 5LXMA 2PZPA 2JAMA 5HX6A 2BZIB 2J0IA 4EQMA 3UIUA 4MXXA 2B7AA 2OSCA 2V55A 4OR5A 3DOGA 4U41A 4XMOA 5AM6A 3C1XA 3C5UA 3FUPA 3KL8A 3PG1A 2QOBA 3GI3A 5EFQA 2VWBA 4BVUA 3GCPA 3GOKA 2VTQA 3D7TB 2ITQA 3DKFA 2ZMDA 2OK1A 1YHVA 1T46A 2GS6A 3FE3A 3BGQA 3HECA 3PWDA 4IX3A 3V8TA 2P3GX 3EKNA 2Y4IB 5I9VA 5DR9A 4O0YA 2BRNA 5HQ0A 4UWYA 1JBPE 2JKOA 5JKGA 2QC6A 2JKMA 5AFVA 3UO6A 4N4SA 4IAYA 3SXFA 3NWWA 4D5KA 3CPBA 3HV5A 5B2MA 1U59A 4UWCA 2GQGA 3GVUA 4DGGA 4A7CA 4WRGA 2VO0A 3UE4A 3P4KA 3QL8A 4FIJA 1H24A 1G8SA 4NH1A 3E62A 3I60A 3EFJA 3AD5A 4FTAA 4ANSA 3LFAA 4K9YA 2IZTA 4FV3A 4CFXA 1OKVA 3BYVA 4BDDA 2C69A 3FMHA 4QP3A 4V0GB 5E90A 4KD1A 4Z9LA 2VTTA 3VQUA 4DH1A 2HWOA 3ERKA 3U6IA 5JMSA 3TNIA 3DBFA 4R1VA 3IPHA 1UU8A 3GU5A 3ORIA 3Q5IA 3DLSA 2YJRA 3BV2A 3R7EA 4TL0A 4P5QA 4TT7A 5C03A 2VWXA 3BHYA 3TNPC 3NVKI 5FD2A 3DXNA 3UP2A 4EZ3A 2OIDA 2PVHA 4C35A 3OG7A 5HIEA 3C4WA 3SVVA 4UYNA 1H8FA 3FSKA 4TYHB 4D1XA 5LOHA 1XKKA 3R2BA 3ZDIA 5EK7A 4I5CA 2OF2A 5AV2A 3KN5A 4FTTA 3D7TA 4BDCA 1TQIA 2EXMA 4JXFA 1KV1A 4UWBA 5ETAA 4DTAA 3AT3A 1R0PA 2VGOA 4JG8A 4ASEA 4MVFA 4R3PA 3HDMA 4QPAA 2H34A 3QRUA 3CE3A 4IM2A 4C59A 2C6TA 3ETAA 4A9SA 1UNGA 1WBWA 3I7CA 4FTCA 5DT0A 1WBNA 4MF1A 4ZTLA 3A7IA 2JIUA 4XYFA 5E8UA 5LVNA 4PTEA 5CYIA 2OWBA 2ITOA 2E9UA 2F7XE 4IAKA 4RJ5A 4XBRA 3KKVA 2R3FA 2PVFA 4ACMA 5JH6A 4YJPA 1OKZA 3FC1X 3LMGA 2EB3A 4C34A 2C5VA 4QP8A 4JL9A 2ACXA 2B9IA 4IFGA 4BBFA
chains in the Genus database with same CATH superfamily
2JITA 2UW3A 5M55A 4BZDA 3D7ZA 3MIAA 3NUAA 2YIXA 3KXZA 3F3ZA 2GHLA 5EKNA 1ZYCA 4HVGA 4X6RA 1XBCA 1H08A 3TV6A 4EH3A 1DAWA 1P2AA 2ZYBA 2X6DA 3TV4A 2C5YA 3VNTA 3ACKA 2J6MA 3MFRA 3FI4A 2CPKE 3OBJA 4TYHA 3IDCA 3LQ3A 3HUCA 3GQIA 4CRLA 5E8TA 2J0JA 4BCMA 2XNEA 1WFCA 3KRWA 4YBJA 3D5VA 3W8QA 1CTPE 4BZOA 5AIKA 5IQEA 4LG4A 3JVRA 2BTSA 4YNEA 2UV2A 3P0MA 3KXXA 3QRTA 3NSZA 5I9UA 4HZSA 5AWMA 2VGPA 3DBDA 4O96A 2OJ9A 4J98A 4K11A 4S33A 3F5PA 3LAUA 2ZV8A 1BI7A 3VS3A 3QTRA 3EN6A 4C37A 2XCKA 3UPZA 3NFFB 4O7LA 5EQPA 3MB7A 2O65A 4JNWA 4D4RA 2ETKA 5BVNA 4QMUA 2UZLA 2F2UA 3HYHA 4G17A 2W05A 2RL5A 4J96A 4EI4A 2Y6OA 3NGAA 3FY2A 3R1SA 5KMIA 2XEZA 2O64A 4C62A 3LQ8A 5HVJA 3AC5A 1BLXA 4MD9E 4ZP5A 4C3PA 3OCBA 5K3YA 4F7SA 2C47A 4J52A 5EG3A 3C4ZA 2BMCA 1OGYA 3D14A 3OXTA 3ENHA 4KINA 3DA6A 4CZTA 1OKWA 5DEWA 5EDPA 3G9LX 5LWNA 4BI1A 4GUBA 5EQYA 4FSNA 2HIWA 4Y5HA 5CWZA 4AU8A 4C61A 5AX9A 5CAOA 3CJFA 2V7AA 4RA5A 2W9ZB 3MWUA 5KZIA 1OIRA 2WIPA 4G6NA 2VV9A 3QUEA 4I23A 4X2GA 3HNGA 2W1ZA 3CP9A 4WT6A 1V0PA 5BPYA 2WTCA 1QPJA 5M4FA 1KV2A 3RK5A 4RFYA 3ZHPC 3FXWA 4AT4A 4OTWA 2QI8A 3WARA 2OFUA 3MVJA 4LUEA 3KC3A 3NNWA 3BWFA 3KQ7A 2UW8A 1RE8A 4GKHA 4K0YA 2W99B 4QP2A 4YHJA 4C36A 3EQFA 2W96B 4IX6A 3IGOA 5TF9A 3WF9A 1W84A 1K9AA 3CQUA 1UWJA 5F1ZA 5I5ZA 3BLHA 3OCTA 3UG1A 3UOJA 4QYGA 1OZ1A 4N6YA 5TKDA 4M84A 5CI7A 5CNOA 4BDFA 5B2LA 2YJSA 5ETFA 4E7WA 3C4CA 4ZZOA 4G3EA 3I6WA 5JZJA 4A07A 2OBJA 3FXXA 1WBPA 3R73A 4FEWA 5KMOA 1ZYSA 4R78A 2UZEA 5BUIA 2I40A 5D11A 4BIBA 3PIXA 3D2KA 4QMTA 3O5AA 3ROYA 5AA8A 5IQIA 1QPEA 1FBNA 3ORLA 4LRMA 4QT1A 4PF4A 4FV8A 5M08A 3MTLA 2QD9A 4OBQA 3KREA 1PXJA 4HPUE 2RFEA 3Q9XA 3TDWA 4BCHA 1Z5MA 5JK3A 4L43A 4M13A 4PDYA 4X6QC 1VYZA 3NNXA 2VRXA 3IW4A 3QQKA 4GT3A 1PHKA 4JVGA 4KBKA 1URWA 2JLDA 4DYMA 5ANOA 4EHEA 1LUFA 1Q8WA 5EM7A 4K18A 1XMLA 4WBBB 2UZOA 4H3BA 3A7HA 3Q5ZA 2I0VA 3QX4A 4EKKA 5KO1A 3W16A 2UZVA 4BKJA 2HZ4A 3NYNA 3D9VA 3HZTA 5HBJA 3F82A 4FC0A 2WQMA 3ZMMA 4YU2A 2W1DA 2OH4A 3LW0A 3EQDA 3VO3A 4KIOA 2JDTA 3CCNA 4ENXA 4C38A 1ZYJA 4U40A 4EH8A 2BFYA 4FKUA 4XJ0A 2BDWA 3DQXA 2CNUA 4HCUA 2REIA 5E8VA 4RZVA 4I4FA 3CS9A 2YIRA 1DM2A 4D0WA 3QZIA 4AZWA 4GK2A 4E26A 1YW2A 4W4YA 5D9HA 2QOHA 2XAOA 5IMEA 1Y8YA 5FXRA 1Y91A 3EL8A 4KRDA 5KUPA 4LGHA 4EOLA 2YDJA 2UZNA 2WQOA 3UG2A 4AA5A 4AN3A 5AP5A 4FYOA 3ZFXA 4PUZA 2IW8A 5HORA 2JDSA 3PVBA 5C9CA 2BIYA 2CLXA 5C8KA 1G8JA 2DUVA 5JZNA 1OITA 2OXXA 3L9LA 5HD4A 5J1VA 3DK3A 3REPA 4EEVA 3ANRA 3CD3A 4RFZA 1M2RA 1GIIA 2QO7A 3AC2A 4BDAA 5CAPA 3PLSA 3R9RA 3UZTA 4RMZA 4XG9A 4X3JA 4J95A 4ZJIA 3BGPA 4AFJA 2PZIA 1OVEA 3QYZA 1H0WA 2WHBA 4TWNA 4AOIA 2ZB1A 3IW5A 1R1WA 3TIZA 4E4MA 5JGAA 4KNBA 3ZDUA 4F1OA 2PE0A 2P2IA 4IJ9A 5AX3A 1NVSA 2PZ5A 4EC8A 4I22A 3NUNA 4FSQA 4U79A 5EI2A 4H58A 4EUTA 3TZMA 4C4JA 2W7XA 2A0CX 3E7OA 5LQFA 4FTKA 5LARA 4C0TA 5JFVA 2CGWA 4YZDA 3JR1A 4U97A 5LMAA 3CGOA 2A2AA 2BILB 4DG2E 2R3OA 3BL7A 3R6XA 4BTJA 4NJDA 3GC8A 3GEQA 4XV2A 2VNWA 4PL5A 3A7FA 4QNYA 3LCDA 3UPXA 4MNEB 4BY9E 3U87A 3QFVA 3P7AA 4BYJA 4U45A 4DEHA 2HW6A 3PXRA 4M0ZA 1M17A 2O2UA 1HOWA 3KY2A 3L9PA 4NFMA 5KHXA 2XKCA 5KMJA 4DH8A 4FG8A 3HMOA 3QKMA 4F9WA 5IU2A 3FLNC 5HU9A 1ZMVA 3EIDA 4R7BA 2GTNA 5D12A 3OXIA 4FTQA 3PFQA 4RBLA 2IN6A 4HOKA 2OKRA 2QR8A 2WTKB 3KXMA 2C3KA 2XRWA 3QBNA 5LMKA 4BR3A 3HDNA 1M52A 3TEIA 3V8SA 5BVOA 3QTXA 3PPZA 4PDSA 4IWDA 3ANQA 4PL3A 5CEIA 4JT3A 5CVFA 3R8UA 2B4SB 1Q97A 2VTIA 4IM3A 3EQHA 3OF0A 3D4QA 5IA0A 4MK0A 3TJCA 3W2RA 4NIFB 3HA8A 5EW8A 4ZTRA 3Q6UA 4L67A 4LMUA 3HGKA 4EC9A 4ZY5A 4FMQA 4FSWA 3UC3A 5JSMA 1CM8A 2X7FA 4O7TA 3EFWA 4JR3A 2RFSA 3FAAA 4YC3A 4IAFA 5CAQA 3RAIA 1IA8A 3FMNA 2XB7A 3OBGA 1OGUA 4JJRA 5C01A 4FBXA 4M14A 3UDBA 3ZEWA 2OJGA 3FKLA 4QMNA 4RC3A 2XK3A 2XIYA 3OS3A 3VW6A 1IAHA 3LFBA 2VX1A 3CY2A 4FT7A 4UYAA 1NW1A 1FVTA 2WIHA 2ERZE 3IECA 3DJ5A 3DNEA 5E8YA 3DB8A 4PMPA 5CSPA 5I9YA 3QAME 1OIUA 3QQUA 3QTUA 3CKWA 4YSMA 3W0NA 4D28A 1V0BA 4LL0A 4AZEA 4CG8A 4U9AA 4D1SA 4QO9A 3F66A 4BCFA 3R01A 3T9TA 3BV3A 4P4CA 4DCEA 3L8XA 1PKDA 1Q4LA 1Q99A 4FL3A 4A9TA 1HCKA 4DFUA 2VTNA 2OO8X 3V5JA 2OICA 4ALUA 1W82A 3ZBXA 2VWUA 2X0GA 3POZA 3UVRA 5HTBA 2CGVA 1H1RA 1OPJA 2B0QA 4I4EA 4QMVA 3I1AA 4TWPA 5FEEA 4USEA 3POOA 3RWQA 5FM3A 1XH8A 1JKSA 2EWAA 2UW7A 3G9NA 5EH0A 2QOKA 4OTQA 3SAYA 3ZO4A 1KUTA 4OBOA 4RX9A 1YHWA 3AOXA 1OI9A 2C0TA 2C3LA 4AXCA 3M11A 4CMTA 2QVSE 4F1MA 2P4IA 1PXKA 3C13A 4GJ3A 4MD7E 4ANMA 3N4VA 4ENYA 2LGCA 1J91A 3EB0A 4O0TA 3QZGA 3MIYA 4FV5A 1FOTA 5HNGA 5JEBA 3TCPA 3UBDA 5HLPA 3V3VA 3WYYA 4HW7A 5BVDA 4CLJA 3CLYA 2HXLA 4JBPA 1MRVA 4W4VA 4CGAA 5T3QA 4WNMA 5IH6A 1P4OA 4FZ7A 3R9NA 2XJ0A 2PWLA 3HV4A 4FEVA 4ZTNA 2FUMA 4V05A 3LJ2A 1P5EA 2B9FA 4J97A 4G3DA 4PTGA 2W9FB 5DNRA 2PZYA 2GNJA 1YOMA 3FLSA 4CNHA 5BVFA 3SKCA 4RA4A 5EOBA 2OIQA 5GHVA 4D9UA 2YDKA 4G6LA 5TO8A 2V62A 3I5ZA 5J8IA 3RAWA 4FKJA 2WB8A 4XG6A 3GU7A 4HJOA 4EYJA 1H00A 1H0VA 1Q41A 4X3FB 4RJ6A 4D4VA 4F64A 4WOVA 4PMSA 3BPRA 4RG0A 2YCFA 1Q8ZA 5HCYA 4EH9A 3JS2A 3WF5A 4F1TA 3RMFA 5ANEA 2F9GA 3PPKA 4PP7A 3EOCA 3NUUA 3VBTA 3QCQA 4QTEA 2WMUA 3H9OA 4Y83A 5TOZA 5DOSA 3BE9A 2XYUA 2AUHA 4KABA 1PYEA 2BKZA 4YP8A 4RC4A 5CU4A 4AG8A 5E7RA 2G01A 3AC1A 4NT4A 2VTOA 4QTAA 2QCSA 4KKGA 1UU9A 1UV5A 1LR4A 3BLQA 2UVYA 4XUFA 3RPVA 2G15A 3E63A 2WOTA 5CX9A 4QYHA 5ANKA 4AAYA 4DEIA 4BRXA 4I5HA 3Q4CA 1TQPA 4KBAA 3ZEPA 2XNPA 4HPTE 4K2RA 3RPRA 4IW0A 3HLLA 4ZEGA 3ZXTA 3PY3A 4A9YA 5M06A 4Y73A 5A14A 5J9ZA 4I0SA 1M2PA 4HNIA 5DR2A 4EORA 4Y95A 2OG8A 5ACBC 3FMMA 3GUBA 3WF6A 5IF1A 4FUYA 1R0EA 4RSSA 3NUPA 4EH2A 2B9JA 1V1KA 3HMMA 3MPTA 4YTFA 4O7NA 5K5XA 5I9XA 1SZMA 3OCSA 4FV1A 3VF8A 4AW1A 2QNJA 4D58A 5IH5A 1YKRA 4X3FA 1KE5A 2G9XA 2RF9A 4YHFA 4JBOA 2YACA 5EHOA 4EHGA 4F6UA 5A4TA 5IA4A 2I6LA 3PJ1A 5BYZA 2X81A 4PQNA 4ZLZA 1AD5A 5CAUA 3ZLYA 4I21A 2WTWA 3UMWA 3PE2A 2OJFE 3O23A 4B0GA 4ZSAA 3O7LD 4R6VA 2CSNA 4XG8A 3S2PA 3R04A 5C27A 4MUQA 3OP5A 2OJIA 4H39A 1OL7A 2BFXA 5FUTA 4CVAA 3FPQA 3FI8A 2Z7SA 4BZNA 3I4BA 4BHZA 4NKAA 4RIYB 4CFMA 5J5SA 4FKOA 4CG9A 3QTSA 4FE2A 4KSPA 3OEZA 5CALA 5KCVA 2VX3A 5M57A 2V5QA 4RIOA 3B8RA 4RVKA 5C4LA 1WCCA 1JOWB 2Y4IC 2YM7A 1ZXEA 3O51A 4I92A 4CEGA 5IISA 3QWKA 5JQ5A 3A99A 4RRVA 3O8UA 5BYYA 3BHHA 2WU7A 4WIHA 4DH3A 2BR1A 4FKPA 2QG7A 2UZWE 4A4LA 4IVDA 4ZOGA 5CZHA 2NYAA 4F63A 4C2VA 1DS5A 2AEGA 3A60A 3ATSA 3ORMA 5CS6A 4B6LA 3TKIA 2R3NA 4BTFA 4ZTMA 4RIXB 4G1WA 4GCJA 4NTSA 5C1QB 3GC7A 3AC3A 4JX3A 5HNIX 3FMKA 1Z9XA 4K1BA 2Q83A 1U54B 4UALA 3L9MA 3H9FA 1GZ8A 3B2TA 2IWIA 4GL9A 4AT5A 5BQ0A 2HZNA 1KE6A 3ZUUA 3E7VA 4MX9A 2C1BA 2UUEA 2YIWA 3E8EA 4OT5A 4MWHA 4QYEA 4U3YA 4ZXTA 4QMXA 4C4GA 5JFXA 2F4JA 1T45A 1SVHA 3EQCA 3LFCA 5AP6A 5FLFA 4B4LA 5D1JA 3FKNA 3PA4A 5AUXA 4E5AX 3V5WA 2ZAZA 2J0KA 4IANA 5HKMA 4J99A 3N4TA 4JG6A 3GFEA 5DHJA 3PE1A 5FTGA 4EK8A 4E6DA 2VNYA 3F69A 3QKLA 1UNLA 3DGKA 2H6DA 4QMOA 2UW0A 4FV9A 2W1IA 3UVPA 1B38A 2E9OA 1WBVA 3ZU7A 2X8DA 4UY9A 1YXXA 2QOQA 2G1TA 2HXQA 4I0RA 4X2KA 4CT2A 1Q24A 4XLIA 4FEQA 4R7HA 2WO6A 3TTIA 2P0CA 4JQEA 3EFKA 3TKUA 1P4FA 2G2FA 4DGLC 1UNHA 3W8LA 4D2SA 2OI4X 3O8TA 2GNGA 3MN3A 4BI2A 2YM4A 1K3AA 3IQ7A 4XLVA 1OUKA 2UVZA 2X39A 4JOAA 4E6AA 4E73A 2WZJA 3PSDA 4NFNA 1WMKA 3SG9A 1OL6A 2JDOA 4NKSA 3V8WA 4IX5A 2X9EA 3BIZA 3IDBA 1M7QA 3LFDA 4U80A 1GAGA 2VX0A 4DG3E 3UIXA 4AGUA 5M53A 3QZFA 2C6MA 1OIQA 4HYIA 4DFLA 4NCTA 2ZV9A 3CY3A 5EYKA 3C4XA 4MQ1A 5AP0A 3R22A 2PZRA 2XK8A 1FGKA 3KEXA 4I41A 3R8VA 3TV7A 4EQUA 3ZLXA 3ZXZA 3SW4A 5BMSA 3F3TA 3V5QA 4YJQA 4LOOA 3PXFA 4Q9ZA 2BAKA 4Q9SA 4WNPA 3TUDA 1XH9A 3MH3A 2YM8A 1LP4A 1KOBA 2G2IA 2PL0A 3NX8A 4QMQA 1Y6BA 3UGCA 2R3QA 4F09A 4KBCA 5HEZA 2F57A 5IQGA 3QHRA 4YTCA 4USDA 5KZ0A 4JX7A 1WVWA 3PRIA 5CANA 1PXPA 2GHMA 3BYOA 1YI4A 2BHEA 2R7IA 3LCSA 3CGFA 3MW1A 3D5UA 4TWCA 2CKQA 1BKXA 3PA3A 3H0ZA 3JYAA 2GNFA 4EUUA 4GS6A 3OOMA 3TNQB 2QQ7A 5DR6A 4WO5A 5CXHA 4YMJA 3MPMA 1A48A 4HVHA 4RX7A 3EMGA 4AWIA 2CNVA 2ITPA 4WRSA 3OTVA 3PJCA 1O6YA 4EQCA 3TKHA 4X2NA 4BTMA 2C6IA 4PMMA 1ZY4A 3EQBA 4OW8A 5AAEA 1P14A 3VWAA 4XG3A 5HG7A 5AUWA 2XRUA 4GUEA 4FODA 3LHJA 5E9EA 3CTQA 4CFNA 4YJRA 5ITAA 3OFMA 4YSJA 2VZ6A 2UW6A 3AKLA 2WGJA 2BAQA 4IAIA 4MHAA 3W2PA 4ALVA 4D2RA 1I44A 4J8MA 2BZKB 4LYNA 2YA9A 5H2UA 4BCKA 4BB4A 3F61A 1H1PA 2CKOA 2JIIA 4FSTA 2XUUA 3QKKA 3OWPA 5AV4A 4YJOA 2QG5A 3E3BX 3IGGA 3FZRA 3UIBA 4GT4A 4LRJA 5HLNA 3LPBA 3NR9A 1TQMA 3M42A 3AD4A 3E64A 4XX9A 3SG8A 3ZUVA 2OXYA 2PMOX 1ZARA 3WZDA 5BUEA 4YPSA 3O71A 5L8LA 5EOLA 5DBXA 2HZIA 2RG5A 1OKYA 2WMSA 4XV1A 4OLIA 4WUAA 4PV0A 3RZBA 2LAVA 3ORPA 3HL7A 3UDTA 2PVYA 4FKQA 2QO2A 3LXPA 3KFAA 1OUYA 3HMNA 3UIMA 3T9IA 3PA5A 5EQEA 4FKRA 4LOQA 5IEYA 4TKSA 4F0FA 2O0UA 3LFEA 1PXLA 3S95A 2IW6A 3EZVA 2VTSA 4LFIA 3VBXA 4RC2A 3W2CA 1KOAA 1PJKA 3MDYA 1H26A 4CT1A 1MQ4A 2WTVA 3SX9A 3ZC6A 4UX9A 3DNDA 3Q2JA 3UYTA 3FC2A 3U8WA 2C3JA 4YJSA 5T6KA 3RKBA 4Z7GA 2BALA 5CLPA 5DT3A 4LGGA 3ROCA 3V5LA 4IVCA 1SVEA 3K3IA 3R7YA 3WIKA 3PJ3A 2HOGA 4F70A 2R3HA 3QTIA 5AP2A 4NM3A 1J1CA 2XANA 2XM9A 3QRKA 3RTPA 3W2SA 2XNBA 3QC4A 3OWKA 4U44A 4Y8DA 1ST4A 3QQJA 5AP7A 2VTHA 4WBOA 5AV0A 2JAVA 3GBZA 4V04A 4EBWA 5IQDA 1G8AA 1XWSA 4M67A 4TRLA 4BJJA 5HCZA 3LCOA 1IASA 3QXPA 4C4HA 1F0QA 2Y6MA 2W1HA 4FTUA 1GJOA 4PY1A 3UNZA 4NSTA 3RAHA 1ND4A 4AX8A 3QQGA 4AN2A 2FA2A 4PRJA 2BAJA 5EW9A 3Q9YA 3QCSA 4KS7A 2X8EA 4RVMA 1WBTA 4FT3A 4I6BA 4DH5A 3MVMA 1ST0A 4FTOA 1OL2A 4LOPA 4V01A 1VEBA 3W32A 2O8YA 4ARKA 2OU7A 4A4XA 1UA2A 1L3RE 1ERKA 1AGWA 2XIKA 4IB0A 4NL0A 1XJDA 3BU5A 5L6WL 3DKGA 4XS2A 1ATPE 2H96A 1OBGA 2R3JA 3HV3A 3MVHA 4BTKA 5IA3A 3R21A 4XOZA 4X0MA 2ETMA 4F7NA 3OT3A 2BROA 4YJUA 3RPSA 3TG1A 5BX0A 4GYGA 5DI1A 1FMOE 5IQAA 4KIPA 5CU2A 1QMZA 4DF3A 4Y5QA 3OUNB 4JBQA 3RHXA 4JR7A 5DRDA 1Q8TA 1HCLA 3S4QA 5CVHA 2IZUA 3FQEA 3PXZA 3PVGA 3KK9A 5J1WA 4IFCA 2PVRA 2WOUA 4XHKB 5AM7A 3VHKA 4ZMFA 4TY1A 4RWJA 3DFAA 4G16A 2VWIA 2RG6A 3OWLA 3P79A 4D0XA 4E5BA 3OWJA 3G2FA 3FLQA 2W1GA 5LMKC 2W17A 4ITJA 3FV8A 3ORKA 2QKWB 2W5BA 1JKKA 2C6EA 3CC6A 4XCUA 4C3FA 4MTAA 3TIYA 2WMVA 4ITHA 4RJ4A 1VR2A 2WAJA 3CD8A 2XIZA 3SXRA 2WNTA 1YXVA 1WVXA 4DHIB 1PMUA 3W55A 3ODZX 2Z7RA 2GCDA 4DTKA 1ZOHA 4QPSA 2JDVA 3R83A 3IW6A 4PL4A 4FKTA 3VW8A 3W33A 4EL9A 3SDJA 2BCJA 2IVVA 4H3PA 5FEQA 2W06A 4TZRA 2EB2A 4ZSGA 5HNBA 3GXLA 4IAZA 2WD1A 3A8XA 2PTKA 1VZOA 2BDJA 4DE4A 1BX6A 3LXKA 3MJ1A 4KIQA 1E1VA 1REJA 4OTFA 4OTGA 2HK5A 3GCQA 5DVRA 4CV9A 2XZSA 2ZFYA 4ZZNA 3KMMA 2C0OA 4EOKA 1LPUA 3UQGA 1OM1A 4CXAA 4XP0A 3SV0A 3FJQE 3KXNA 5AADA 4E5WA 4ASZA 3TDVA 5IG1A 1PKGA 4ASDA 3EZRA 4WD5A 4GG7A 2R7BA 2XKEA 3MS9A 3NRMA 2XH5A 3MVLA 4L46A 2YEXA 3B8QA 4GSBA 3R28A 3VS1A 2NNWB 4D9TA 3EQRA 5EKOA 4QMSA 4YLKA 4BCIA 3VULA 4EWQA 4BCJA 2AC3A 2WTKC 3BLAA 2ONLA 3FKOA 5HIDA 2NPQA 2J0MB 3DU8A 3HRBA 3II5A 1YXSA 1PF8A 2YCRA 3BLRA 4ITIA 3R8MA 3EFLA 4FTJA 4IIRA 3PFYA 4TTHB 5BYLA 5HG5A 4RQVA 4C2WA 2V0DA 3NZ0A 5CTPA 1YOJA 2X7GA 4RZWA 3LCTA 4EHZA 3TT0A 4AZTA 4CLIA 3UO5A 4FEXA 3BX5A 4FKIA 2C6OA 4ONAA 4FVPA 5EW3A 2R9SA 3DB6A 1VLRA 2R5TA 3NCGA 3QCXA 5CQUA 4BCNA 5HESA 4I0TA 3VRZA 1YWVA 2CKPA 5F94A 4FOCA 3KCFA 3R1NA 1FQ1B 5J95A 1YWRA 2GNLA 1GNGA 4GT5A 4NU1A 4RWIA 5IQCA 1ZLTA 2XARA 3MY0A 3RM6A 4O7VA 4F0GA 3CJGA 3IKAA 4FT5A 1FINA 3FEGA 4YZ9A 3BGZA 4NYEA 1GZOA 1H4LA 4IQ6A 3NYOA 1J7UA 4GK3A 3UJGA 3D0EA 5DFPA 3COMA 4CCBA 1Q3DA 5AP4A 3LIJA 4DEBA 2XIXA 3D2IA 2R0UA 3G0FA 4TYEA 3CIKA 3SGCA 1FVRA 3MV5A 4BDBA 4EJ7A 4GH2A 2Y4PA 1E1XA 3PDTA 4PTCA 4RVTA 2YWVA 4ZMEA 1ZZ2A 4JQ7A 5H8EA 1Q8UA 2J0LA 4I1ZA 1NA7A 2GMXA 4AN9A 2C0IA 2YIYA 3BI6A 3QC9A 5M07A 3DXQA 5HE3A 4AAAA 1MRUA 5F9EA 3MY5A 4MH7A 5DG5A 1Z57A 3C5IA 4ZJJA 3DZOA 2O63A 1LEWA 5I9ZA 5IDPA 1GIHA 3FHRA 4S30A 1ZYLA 1KE9A 2GU8A 3I7BA 4X21A 2ITXA 4QP4A 4YJVA 4JIKA 5HU3A 4IBMA 4MEDA 5D10A 3V01A 4ERKA 5CF8A 3TMOA 4DT9A 4L42A 5LVLA 3KULA 4TYJA 4ZTQA 3LVPA 4YZCA 1F3MC 1G5SA 2I0YA 3PXKA 3KVWA 2WQNA 2F7ZE 1YOLA 3Q60A 4LUDA 5IUHA 5M4CA 3DDQA 3MH0A 3ORXA 3QX2A 4DHJA 4QNAA 3OY3A 5GJFA 3AG9A 3PXYA 5LMBA 2BDFA 1PY5A 5IH4A 2VWVA 4LV8A 3I6UA 5A46A 2E9NA 2OW3A 3ZZEA 4G5JA 3EL7A 3WE4A 5KNJA 5L2SA 2BRMA 3D5XA 3VS6A 2PU8A 3PVUA 4WKQA 2FO0A 2PK9A 4RLKA 4CRSA 4EBVA 5AAFA 4ZJVA 4RFMA 1KE7A 4DBNA 1Q8YA 4O0SA 4DGOA 1G8KA 5GJDA 4YR8A 2ERKA 1UKHA 5CAVA 5GIOE 1TVOA 4FV6A 3F3WA 4X3FC 2BRGA 1PW2A 4RVLA 4O22A 4AW0A 4CFFA 3KF4A 5E8XA 5HG8A 4GFGA 4IZ5A 1FGIA 3QTZA 4ACCA 3HEGA 2HYYA 1UWHA 2CJMA 2FSOX 4CKRA 4S2ZA 4O21A 3VC4A 2JDRA 1JSUA 2R3PA 1PXOA 2EVAA 4ZS0A 4O86A 1OBDA 5KBQA 3HAMA 4LM5A 4RQKA 3TM0A 1NVRA 3WIGA 4MD8E 3R63A 4UZDA 2JBOA 1YI6A 5HIBA 3KB7A 2B9HA 4G3FA 3E3PA 3EHAA 3SRVA 4RIWA 2YISA 3PUPA 4W4XA 5FDXA 3V04A 1M7NA 5CU6A 2B54A 2PVKA 4L3LA 1JAMA 3GOPA 5E4HA 3I5NA 5KBRA 3MJ2A 4P5ZA 3HV6A 4EK5A 3EN7A 3AKJA 5JRSA 2J90A 2Z02A 3RP9A 2DYLA 4YZMA 3S3IA 4HVDA 1YVJA 2JC6A 3COHA 5HVKA 1VYWA 2OJJA 3OXZA 3O17A 3P86A 4UXLA 5K4JA 3A61A 3ZM9A 2XS0A 1JLUE 4OTDA 3HMPA 3EWHA 3VUDA 4BDHA 4BIEA 4UEUA 3K5UA 1PXMA 3TI1A 2XVDA 3SHEA 1XH7A 3BEAA 4FL2A 4FNYA 1WVYA 4WNOA 3ET7A 2C1AA 1CKPA 4II5A 4M0YA 2P2HA 3AD6A 4YZNA 5M4IA 4DDGA 4ZSEA 5B2KA 4AGDA 2VO3A 2FGIA 1U5RA 5GJGA 5A4LA 1PXNA 5CU3A 4IWOA 2PMLX 3VBVA 3NLBA 5HLWA 3WF7A 3IW8A 4GFMA 1LEZA 4N6ZA 4DEEA 1K2PA 3UTOA 3R8LA 2BTRA 3BWJA 4ASXA 2PHKA 4WG5A 1S9IA 3FQSA 3AMBA 3FLWA 4UN0C 3U9CA 4O27B 5DGZA 1GZNA 5JFSA 3PJ2A 4IB1A 1REKA 5EHLA 1YXUA 5BUJA 2XNNA 4IC7A 1BMKA 3F2AA 4QTBA 3HAVA 4OGRA 4F78A 4E1ZA 2XNMA 2ESMA 3A4OX 4BGHA 4AZFA 1H07A 3DK6A 3Q4TA 2IJMA 2ITNA 1FPUA 4O0XA 4HYSA 4CFUA 2WQEA 5IZFA 3KF7A 5HE0A 4MXZA 4DEDA 3GC0A 3UMXA 2OGVA 3NUYA 2HW7A 3PIYA 3DJ7A 4DG0E 1DI8A 3E88A 3OCGA 2PMIA 3KRLA 3TN8A 2PYWA 3EYGA 4HYHA 3OC1A 5K5NA 2OH0E 2WQBA 2C30A 2QR7A 2YCQA 3R7VA 4E4XA 5CASA 4AZVA 3WOWA 2XK7A 4DGMA 1URCA 3IOKA 2YAAA 3QD0A 1W98A 3DDPA 4G34A 4L45A 5KMNA 1PMVA 2QKRA 5FEDA 4TW9A 2W4JA 3DJ6A 3R00A 4U42A 1UU3A 5A4EA 3E93A 2HY81 3FMLA 2I0HA 2YERA 3DKOA 2ITWA 2ZB0A 4XG4A 4BCGA 4FIHA 1A9UA 3AMYA 2PVJA 2OIBA 4IZYA 5KMMA 2C6DA 2XKDA 1YDRE 2VTRA 4IHPA 4QMMA 2GTMA 3AT4A 1OL1A 3CR0A 3NYVA 4HCVA 4IM0A 3GU8A 4FEUA 3FDNA 3ZC5A 4TXCA 2WPAA 4Z7HA 5CEOA 5JGDA 2XMYA 3SQQA 3EKKA 4BYIA 1A06A 5EYDA 3KIOC 4QRCA 4O0UA 5M44A 5A54A 3UC4A 1QPCA 3DTCA 4U0IA 4RGJA 1UKIA 2JKKA 4E6QA 2WMBA 1FVVA 4LMNA 4FI1A 3HP5A 4YLJA 4ORKA 4B8MA 5JRQA 4AT3A 3G33A 1BL7A 4DFBA 2PUPA 3P5KA 4L01A 5EYMA 4E93A 3NUSA 2CN8A 4USFA 4BIDA 4JAJA 3KMWA 3P7BA 2BPMA 3MY1A 2XEYA 3ELJA 4BGQA 2WFYA 3U54A 4M69B 2R3MA 3FBVA 1IR3A 4EZ7A 3FZPA 5LCKA 4Z16A 1PRYA