5M06A

Crystal structure of mycobacterium tuberculosis pkni kinase domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
245
Chain Sequence
MALASGVTFAGYTVVRMLGCSAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHRDVNPANVVLTSRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDRSLQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Signaling protein
molecule keywords Serine/threonine-protein kinase PknI
total genus 75
structure length 245
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m06A01
4CVAA 4D1XA 4W4WA 4XMOA 3PY0A 5L8JA 3U8WA 4IVCA 5E8UA 4FTKA 3TEIA 4YJNA 4IM2A 2HW6A 4I20A 3ZXTA 4E5BA 4DGNA 2UUEA 2Q83A 4FG8A 2BVAA 4QYEA 3WF8A 5ANOA 2ITYA 3TZ8A 4FGBA 1PMUA 2C6EA 3V8SA 3T9TA 4AW1A 5CNNA 1M7NA 2J5FA 3ODZX 1GY3A 2GNJA 3ULZA 2GS2A 4DTBA 2CNQA 1M2QA 3GFWA 3GUBA 4UBAA 4AXAA 5M4IA 2UZVA 4EYMA 4AG8A 1FBNA 2JAMA 4PTEA 4BC6A 3R83A 5IPJA 4C3PA 1NW1A 1VR2A 2BDFA 2C0OA 2UW8A 4UXLA 3VBQA 4IANA 4JLCA 4DH7A 3VBYA 3ZLXA 1JWHA 2C3KA 3EN9A 3MV5A 3FKNA 3DFCB 1H0WA 4C38A 4FT0A 1NXKA 1LR4A 4E73A 4Z7HA 5AM7A 4B6LA 1GNGA 4AA5A 4ZZMA 2O5KA 3LXKA 4WA9A 3TV6A 5DA3A 4BVUA 4KAOA 4NM3A 5K5NA 3Q4UA 5L2IA 3BE2A 4H39A 3MB6A 2OSCA 3AMYA 3PJCA 5DOSA 2ITQA 2ZMCA 2VTAA 5J5SA 4ZOGA 3QHRA 2XK6A 4ZP5A 1SVHA 2BDWA 2VRXA 3DDPA 3MESA 4IB3A 3EHAA 2HXLA 1WCCA 4FTUA 3BYMA 3V8TA 4BDFA 4FV0A 4J98A 1ZMVA 2VTSA 4YLLA 3OT8A 2UW5A 3CCNA 4JXFA 3DXPA 3P79A 5AX9A 4BGHA 5DR6A 4E1ZA 4TYHA 4ZTMA 2RFEA 3BPRA 3O51A 3WOWA 4R5SA 4U81A 3R6XA 3ORPA 3BHHA 3D0EA 4QT1A 3VN9A 3ZC6A 4C4IA 4D58A 4E4LA 2JBPA 2ERZE 3UE4A 3FBVA 2IVTA 4FKUA 2OWBA 2XK4A 5AA8A 3HMMA 3PUPA 4EC8A 3TZMA 3BV3A 4A9UA 1WVWA 4GYIA 2FH9A 1XH7A 3QLFA 4CFMA 2I0EA 4I5HA 4E6QA 2ZV9A 1UNGA 2HWOA 5KKRC 3KF4A 4D4YA 1UU9A 2B55A 3A7HA 3QD4A 4FKLA 3MPTA 3H10A 1QPCA 3QHWA 5EYCA 2G9XA 4R3RA 4FV1A 4QQJA 5LARA 1H26A 2O0UA 3W8LA 4AGWA 3LW0A 4QMZA 5CF5A 3RPOA 5IA2A 4O6EA 4F65A 5IA3A 5AV4A 3GQLA 3MA3A 4PWNA 2I7QA 3LXPA 4G31A 2C4GA 4O7ZA 5HCZA 2XCHA 2RFSA 4KIPA 4YC6A 3EJ1A 4AE9A 5HE0A 3LCOA 2WOTA 5I9XA 3OY1A 2W1GA 4ITHA 4H05A 3EL7A 3PZHA 5A46A 4I3ZA 4UV0A 2GDOA 3BBTB 4RPVA 4N6ZA 3VUDA 4DEIA 3PVGA 3IKAA 4DHFA 2PVYA 5E8TA 3FXXA 3KKVA 3BHYA 5CYIA 2VWYA 4MF1A 3LVPA 4BCHA 3SG9A 2IVUA 3PVBA 1H1QA 2E9UA 2VTMA 5AP1A 4JBOA 4F6WA 5FDXA 3R21A 3B8RA 1FVVA 2GFCA 1QPEA 1HOWA 2BDJA 3R00A 3E8EA 2I1MA 2R3NA 2OG8A 3QC4A 4OTDA 4DN5A 5DRDA 3TI1A 5EW9A 4FI1A 3NS9A 4LGGA 4ANBA 4EYJA 5HVJA 4Q2AA 4OTIA 5HLPA 4C3FA 2ETRA 4A9SA 4AT4A 4RJ4A 3AC4A 3LKMA 4FTJA 3T9IA 3NNVA 2EB3A 5DG5A 5I9YA 2GNGA 4ANQA 4G9CA 3I7BA 3FLWA 3Q04A 4MXXA 1IA9A 4I41A 2F2CB 4F4PA 3OXZA 5G6VA 5FM2A 1KV1A 4CTCA 3LQ3A 2PVRA 3ENMA 3SQQA 1WBSA 4BZDA 3CKXA 2HZ4A 4GW8A 5CSHA 3JR1A 4F1TA 3ZFMA 5L8KA 2B9JA 3WF9A 1JKLA 4QMYA 3UC3A 4O0UA 5L6WL 3TZ9A 2JC6A 2QO9A 3SXSA 4W4YA 2SRCA 2QD9A 3Q6UA 2ETKA 3ZCLA 2Y9QA 5AMNA 3LXNA 3QQGA 4FK3A 4FTNA 1YW2A 1J7UA 4O2PA 4O27B 3QKMA 4QMOA 2PL0A 4RVLA 4WRSA 4XH6A 3RAIA 4EWHA 4MWIA 4JRVA 4KABA 3UPZA 5JQ8A 4BBEA 1OKYA 3MWUA 4GH2A 1P4OA 4Z7GA 5LXMA 1ZWSA 2IVSA 4JX3A 3ETAA 4H58A 4QMQA 5AV2A 1KOBA 4PY1A 2Z8CA 3W2PA 4FT5A 4L43A 2X2KA 3ZU7A 2FA2A 2W1ZA 2XYUA 4OTFA 1BKXA 2C6TA 1SVGA 4D55A 1XQZA 4CV8A 3FHIA 2UVXA 3R2YA 2QONA 4NTTA 1IASA 1Q8WA 2BZJA 3PLAE 3R7UA 4BDJA 4C58A 2W5BA 4EEVA 1E1XA 1V0BA 3FQSA 5F4NA 5IQBA 3QCXA 2XM9A 5I9ZA 4Q9ZA 3TCPA 2UZDA 3BU6A 1JQHA 2AUHA 5CVFA 2XF0A 1PRYA 2QHMA 3O2MA 1BI7A 2HENA 2WQEA 3PJ1A 4BF2A 3DKOA 3DJ5A 2W9ZB 3QZHA 5HNBA 4J8MA 3N4TA 3ZLSA 1XH5A 3FMJA 3B2TA 3PXFA 2GSFA 1OECA 4L3JA 5E92A 4Z16A 2WFYA 4JI9A 4BDKA 3PE1A 3S0OA 4RA4A 4DFXE 2UW6A 4GFGA 4WNKA 3HV4A 2ITUA 3HMNA 4EC9A 1KOAA 2JFLA 4NJDA 3PXZA 1XH9A 3S1HA 3PY1A 3TT0A 3NIZA 4S30A 5A9UA 1WVYA 2VU3A 4DGLC 4JJRA 2J0KA 2I40A 3FKOA 4YJVA 5A54A 3OOMA 3FUPA 4YZBA 3KA0A 4BICA 2GNIA 5CVHA 4QTDA 4FZ7A 4QQCA 3WF6A 3EMGA 3EQDA 4L01A 5T3QA 3AC2A 3MBLA 3DPKA 2UV2A 4M7IA 3G15A 3Q6WA 4DCEA 5L2WA 2WTCA 5C27A 2JDSA 3GC8A 3OXIA 3Q96A 5DIAA 5HGIA 4ZJJA 3ZO4A 2J2IB 5IQAA 4TTHB 5A4TA 2YITA 2RFDA 3CC6A 4FEWA 4WG5A 3TNHA 4YJUA 3P7AA 3R01A 2YIWA 4LYNA 2GCDA 2P3GX 2OIBA 4U79A 5BMSA 2WMWA 2J90A 4CFVA 2OBJA 3AC8A 5BQ0A 3DAJA 1SNUA 3UO6A 3DA6A 1FVTA 3SDJA 4G3FA 2HK5A 3MH2A 4QQ5A 4V04A 5EM5A 4EOOA 4Y5HA 2YM3A 4NWMA 4GK4A 4BCNA 4D4SA 4TWPA 4GEOA 3R1NA 3VS0A 3QAME 4YUQA 3Q32A 4ZTNA 3FMNA 1JKTA 5HTBA 2G2IA 3POZA 5E8VA 5HO7A 3TNPC 3UP2A 5HZNA 2YZAA 4M0ZA 2XNGA 2PWLA 2VO7A 4PMPA 5A4LA 2JEDA 1CKJA 3UIMA 2J0JA 2V0DA 3EQFA 3FLQA 3OS3A 2OFVA 4AUAA 5I4NA 5J95A 3HLLA 5CU4A 5IQEA 3R02A 4ITIA 3UTOA 3W2CA 1GAGA 3ITZA 4O0SA 1OUYA 3ATTA 4CMTA 2ZV2A 3O0GA 5HBEA 1XJDA 4JL9A 3MFUA 4E6AA 3KFAA 4DF3A 4HW7A 4MH7A 5AUUA 2YDKA 5JN2A 2QODA 3QQFA 1CKPA 4W8DA 3RAHA 5CS6A 4IVDA 4DEDA 1PXLA 2F9GA 2I0VA 2YDIA 3QA8A 3WF7A 4BZNA 5D9HA 1PY5A 3VJNA 5HNIX 4C4GA 4FVPA 3QD0A 3VHEA 3C1XA 2V7OA 3LZBA 4BN1A 3FHRA 4RJ5A 1W84A 3OUNB 5E9EA 4I5PA 5HQ0A 5IF1A 1L3RE 4PMMA 3VIDA 5CZHA 2JDOA 5GJFA 4EHVA 4XOYA 3FDNA 5B7VA 4QP9A 2B1PA 5K4IA 1FOTA 5DR2A 3L1SA 3PSDA 3R71A 4O21A 5HEZA 3W33A 5HCXA 5KX8A 2XVDA 4QMXA 4BB4A 4RWIA 4D1ZA 1TQPA 4IACA 4EH4A 3P5KA 5KBQA 3F5XA 2OIDA 4CFNA 4DGGA 3PWDA 1FGKA 3LFNA 4DLJA 4NZWB 3VF8A 2OJIA 4L44A 3U87A 4EHZA 5HE1A 4IAAA 3ZM4A 4FVRA 3FE3A 3CQEA 4UYAA 5H2UA 1W8CA 2PYWA 3QX2A 4IZ7A 4K77A 4ORKA 4U5JA 2PHKA 3CGFA 5ETAA 3RM7A 3TNWA 4ANLA 3MPAA 4HYIA 4QMNA 3GU6A 2QU5A 1SZMA 4MD8E 1PXPA 3DXNA 5AV3A 2VUWA 3V5WA 4LMUA 4MEDA 5FDPA 4LRMA 3LCTA 5E8YA 5EK7A 4H1JA 4BDHA 3OOGA 4QTBA 2PE1A 4USEA 2JFMA 3CJFA 3HGKA 3U6HA 2PE2A 3UOLA 4QP2A 4KRCA 4L7SA 4HVDA 4NTSA 2CDZA 5J9LA 3KK9A 2Q0BA 2Y4IC 3V5PA 4CCUA 3ZHPC 2XBJA 2O2UA 3CTHA 3KY2A 3MFSA 3BHUA 3SAYA 4NU1A 4QP7A 3GBZA 3MVHA 4IC8A 2VTPA 2REIA 2WTIA 3WIKA 4IJPA 1MRUA 3ORTA 4CT2A 5BVNA 1SM2A 2WEIA 1MP8A 3KCFA 2VGOA 4NYEA 4PQNA 4HVSA 1XH8A 3CY3A 2BPMA 3VNTA 2WTDA 2XNOA 3VO3A 2BILB 2OZAA 1Q97A 2YM4A 3QFVA 1A48A 2C5VA 2JLDA 1PKDA 5HIBA 3A2CA 4N0SA 4A4XA 3ZLYA 3U9NA 2YABA 3BWJA 2YM6A 3VF9A 2R7BA 4EQMA 3CJGA 4MTAA 3UQGA 3IONA 5DEWA 4FKWA 3UZTA 3HDMA 4TYHB 4WKQA 1SVEA 2YJSA 3IW7A 3OUKA 4B9DA 3GCQA 3PA4A 4M0YA 3V5JA 3VBVA 2AC3A 3DKCA 4PP9A 3R9DA 4F9AA 1OBGA 2Y4PA 4IC7A 2ITXA 4ZMFA 4YTFA 2OO8X 4LV5A 4W8EA 5DRBA 4ZTQA 3KXNA 3ZDUA 4BI1A 5BVKA 3A61A 4X6RA 4KB8A 3FZTA 4K2RA 2V22A 4FL2A 4GJ3A 3CPBA 5HBHA 2W9FB 4XOZA 5FRIA 4ALWA 3KXHA 3MW1A 3KC3A 4YHJA 3LCDA 2W96B 4JBQA 3E5AA 1PMVA 3NUAA 2WZJA 3SRVA 5EYDA 2CMWA 2IZSA 1H4LA 2IZRA 3EN7A 4FE2A 3QUEA 4OT5A 5AAFA 5BNJA 5KKRB 4PTGA 3GQIA 5EW3A 2VX0A 5LQFA 4S2ZA 3TN8A 4EOIA 3E7VA 4C34A 2FO0A 2E9VA 4I24A 1W0XC 3E8NA 2R3OA 4NM0A 4TWOA 4LG4A 4YGAA 1BUHA 3E92A 4U9AA 3FZ1A 5ACKA 3CE3A 3MTFA 4ASXA 3EQPA 2VO6A 4G2FA 1R39A 3KRJA 5M51A 4ACHA 3ZO2A 3DBQA 4WD5A 3LMIA 1JSVA 2WB8A 4CLJA 1V0OA 3BIZA 2XUUA 4MCVA 5I0BA 3E62A 1SNXA 2X8DA 2BIKB 2Z7LA 3NCGA 3QQLA 4WNPA 4FSRA 5IQHA 2QLUA 2BAKA 2JIVA 3IG7A 3N4VA 1UA2A 2RIOA 2XA4A 5BMMA 5E8SA 4P5QA 4V05A 5IA5A 3QRUA 4O0XA 4RVKA 3Q2MA 3VQUA 1Q8UA 4OTRA 1LP4A 3OBJA 4YC3A 1OB3A 2PULA 3R04A 4QYHA 1V0PA 5AUZA 2YM5A 3DBEA 4AP7A 3EFKA 2YCFA 3IS5A 1ZXEA 5HG5A 3OCSA 1S9IA 3BKBA 3CD3A 4TNDA 4XEYA 3MB7A 3NSZA 4FSQA 3DK6A 3O23A 5EQEA 2V7AA 1Y57A 3ELJA 4MD9E 3UNKA 1WFCA 2JDVA 4FV3A 5J9ZA 3AT4A 4YTHA 1WMKA 1H1SA 3A62A 2W4OA 3ACKA 5EM6A 3OP5A 2ESMA 3NAXA 3TIYA 4RFZA 3CGOA 3HZTA 4G6LA 4LFIA 4MVFA 1H0VA 3NPCA 3VJOA 1U5QA 2KTYA 2CLXA 3K3JA 3TACA 5CI7A 5CU3A 4DEEA 2OXXA 4XV2A 3V51A 1P4FA 2A4LA 2B9HA 2C3LA 3D2IA 5D7AA 2CSNA 1DS5A 3OTVA 4Y85A 4ZXTA 4BTFA 5K5XA 4XG3A 5LVPA 3PIXA 1REKA 4LL0A 2ZDUA 2P2HA 2WIPA 4C4FA 2GFSA 5CEIA 1KV2A 2QOKA 4FOBA 3GT8A 2YFXA 2PVJA 4OR5A 3BU3A 3I1AA 3QWJA 3PSCA 4F1OA 4I0SA 2Y6MA 5C03A 5I9UA 3UMWA 1OGUA 3FI4A 3NUUA 3PJ8A 1ZYJA 2IPXA 3P23A 3DNDA 5KCVA 2VTLA 1O6YA 3V01A 4IE9A 1J7IA 5HG8A 4BIBA 4M3QA 3P78A 1J3HA 4GFMA 3DU8A 2A1AB 2B7AA 5FTOA 5JFSA 5C26A 3CIKA 4FKIA 4MXOA 3R30A 3KREA 4YJOA 5C8KA 2C69A 4CKJA 4FNZA 2XKFA 4WNOA 3FEGA 3EZRA 5CSWA 5CX9A 4YLKA 4BIEA 4ZK5A 1IAJA 4DH8A 3UVPA 4E7WA 3LXLA 5IISA 4ZSLA 1FPUA 2H6DA 3HEGA 5ETIA 2BHEA 2YDJA 3TJCA 5HVKA 3ATSA 4RVMA 4EHGA 4MXAA 4YSMA 3KMUA 5FEDA 3VBWA 4C62A 3FY0A 4GUBA 1UNLA 4II5A 2XNNA 3SC1A 4KBAA 5KMLA 3UOJA 4RIYA 1BL6A 3BQCA 5M53A 1H1PA 5CALA 1EH4A 4R7HA 1M14A 4O96A 2JAVA 4MNEA 3VS6A 4RA5A 3NYNA 2QVSE 4RLLA 2EXMA 4AZSA 4DFZE 2F4JA 5I9WA 4JBPA 5EM7A 1WAKA 4YC8A 5EQPA 3OXTA 4F6SA 2O64A 3CTJA 5H8GA 5C4LA 3ORIA 1OMWA 3OWKA 2XNEA 1G8AA 4JG6A 1YWNA 3Q4CA 3SXRA 1YWVA 2PMOX 2Y7JA 2PSQA 3JXWA 3QXPA 2BUJA 4MYGA 3R28A 4HGLA 3JPVA 4U8ZA 3R7EA 1I44A 3MTLA 3OHTA 5E8WA 1W98A 3BEGA 4GG5A 3NVMB 2BZKB 4IQ6A 4GFOA 1OL6A 4RX8A 2CNVA 3W16A 4JDKA 3SKCA 1Z57A 2R3GA 5C8NA 1J1CA 1H1WA 2HZNA 5HNGA 3F61A 3FY2A 3ORMA 1Q24A 4MNEB 4AQCA 4IAKA 2R3QA 4ZZOA 4LUEA 5DLSA 3BGZA 1AQ1A 1B6CB 2FSLX 2Y8OA 2ZYBA 3MVLA 3UVQA 3D5VA 1O6LA 3A7JA 3C4XA 4R1VA 4RIWA 1WBNA 3G0EA 3FQEA 3QTQA 2BRBA 3ET7A 4NFMA 3JVSA 3G6GA 4BTKA 4JQEA 4CRSA 1JLUE 2W1EA 3D15A 2B52A 2UZEA 3CR0A 3ZLWA 3OROA 4CFXA 3F7ZA 4YBKA 3TXOA 4IZAA 2VTJA 3BI6A 4C37A 4QTCA 2GNLA 3GFEA 5M07A 5IA4A 2VWBA 5E1EA 4YURA 5GIPE 1TVOA 3QZFA 4DFBA 3PE2A 3QUPA 5ETFA 2PU8A 3EKKA 4TZRA 2QKRA 3RPSA 3SVVA 4FIIA 1Y6AA 5CTPA 4ZLYA 4FV5A 2UVYA 5AX3A 4RFYA 3QTXA 1ZY4A 2R0UA 4PDSA 3FKLA 4IAZA 4O0RA 4YZMA 5AFVA 3VS5A 3EB0A 5AUXA 2XRWA 3DTWA 4RVTA 4IB5A 4KRDA 4AGUA 2QOHA 4RJ6A 3LM0A 4PL5A 2XS0A 3HP2A 4NFNA 1XO2B 1MQBA 3MPMA 4HJOA 4RGJA 3PJ3A 5FLFA 4DBXA 3GC7A 4FSUA 2GHMA 2E9PA 3BGQA 5HVYA 1NT2A 2O63A 4AX8A 3GU5A 4U97A 3NUSA 3R8ZA 4IDVA 3V5LA 3QXOA 5H8EA 4A4LA 1YHSA 3KCKA 4F9BA 2OJJA 2C6MA 3KU2A 4EKKA 3TKHA 4P90A 3ROYA 3JS2A 1QPJA 3BWFA 4YMJA 2HZIA 1UU8A 2XIYA 3LJ1A 5CQUA 5JQ5A 4EOPA 5A4QA 1HCLA 4AWIA 5HORA 2P4IA 2WQBA 2ZM1A 2LAVA 3KB7A 3C9WA 3IO7A 2JGZA 4CQEA 3NYXA 2W5HA 3E63A 4A07A 4HGEA 3RAKA 3ENHA 4BDCA 3H0ZA 1ZYCA 3DBDA 1FMKA 4FIGA 3SX9A 3VBTA 4F99A 2QO7A 1GZ8A 4J71A 1OI9A 4FBXA 4XG2A 4UZHA 5L6PA 4LUDA 1UV5A 3RWPA 3R1YA 1Q61A 5A6OA 2X7FA 2BALA 4XG6A 5LVMA 1OZ1A 4D0XA 3DLZA 4WHZA 3W2RA 2UW7A 3FL4A 4I4EA 5HX8A 4BTJA 2YAAA 2VTTA 5AIKA 3HECA 2XZSA 4AGCA 1K2PA 4C2WA 2W1DA 5HG7A 4ITJA 3ZC5A 4B4LA 3KRRA 4HVGA 5CXHA 3MIYA 2UZLA 4BBFA 3CTQA 4BI2A 2UW0A 2X2MA 4UWBA 2YIRA 3OTUA 3FZRA 3T8OA 3G51A 5B2KA 4GVJA 4O81A 3Q4ZA 5JK3A 1PKGA 4FKVA 2CN5A 2BKZA 4DYMA 4MQ1A 4YO6A 4UX9A 2WNTA 3AD4A 3P08A 3QYZA 4FV2A 4U7ZA 4Y72A 1KE8A 5C01A 2F57A 4BKJA 1OL1A 2EB2A 5EG3A 5TO8A 4EH6A 3ORXA 1PXNA 3AMBA 4NW6A 3R8LA 3TTJA 2P0CA 4MD7E 3EQBA 3KEXA 2C5OA 2X9FA 3SV0A 4PTCA 4X0MA 3Q3BA 3TKUA 1R0PA 2A2AA 4FTRA 2R3IA 2WTKC 4FTMA 1OITA 4O7SA 5HI2A 2GQRA 4NH1A 4GJ2A 3C4EA 3KMWA 4GYGA 3THBA 3W32A 3TM0A 3AGLA 4ZTSA 3WZUA 3ZZEA 5JZJA 4PDOA 5JSMA 3CP9A 2AC5A 2PZIA 3HDNA 4O0VA 2FSMX 3UJGA 4OTGA 3T3VA 3FL5A 3ID6C 3GU8A 3FLZA 5DH3A 3UO4A 2J4ZA 3MI9A 3EFLA 4LOOA 5CT7A 3TUCA 4C36A 5IA1A 5CF6A 2VAGA 2NNWB 4G5PA 5E91A 3FSKA 2R2PA 3DKGA 3CLYA 2VWZA 4YJSA 5DBXA 3FZPA 3VS3A 4I0TA 3U9CA 2G15A 3DOGA 2OZOA 2YWPA 3GOKA 4JOAA 4WRGA 2XIZA 1Z5MA 5EYKA 5TKDA 2GMXA 2Z7RA 4RJ7A 5E90A 5EOBA 3QGWA 1PHKA 1F3MC 4AZWA 4AOJA 1R3CA 4LRKA 4TNBA 2C5XA 3TIZA 4EZ7A 3LMHA 1KUTA 3G9NA 3F82A 4JAJA 3GENA 4U6RA 3EN6A 3MSSA 3IQ7A 2PUNA 1OL7A 2Z2WA 2ZB0A 4XG8A 3BGPA 4Q5EA 4RIWB 2R3HA 4RX7A 2ZAZA 5DYJA 2W05A 2ZVAA 4QP4A 3F88A 4ACMA 1OL5A 5AWMA 4DEBA 1OIUA 2VGPA 3AMAA 1YI4A 3HUBA 4YO4A 3G2FA 4F0IA 3DQXA 4EK6A 4M12A 3ZONA 4EJ7A 2HIWA 2QOQA 4TN6A 1OPKA 4CFFA 4I94A 5FQDC 2ZM4A 2VTIA 3N9XA 3C13A 3TUBA 1I09A 2IWIA 5CY3A 5JGAA 3KN6A 2ACXA 3NRMA 3QCQA 4G3EA 4O7YA 4U3ZA 5J8IA 5KMJA 4U41A 1OPJA 4YZDA 5BUJA 4X3FC 4USDA 3E7OA 4EKLA 4QMUA 2B54A 4O7WA 3I81A 3W2SA 2UZBA 1PYEA 5JGDA 2CKPA 2ITZA 3A4PA 4QMWA 2VNYA 1XHAA 2DYLA 3C5UA 4FTCA 4ZJIA 3OVVA 1T45A 2I0HA 4C4HA 1BI8A 2Z02A 4HPTE 4M13A 4DGMA 4FTLA 1RQQA 3QRIA 2H9VA 4FTQA 3DFAA 3EL8A 4GL9A 1WZYA 1MRVA 4RSSA 2UVZA 3ACJA 4CNHA 4QPSA 1IEPA 2BIYA 4L53A 3RZBA 2VWXA 2WHBA 2UZUE 4FKSA 4EK5A 5B2LA 4JG8A 2BAQA 2JITA 4N4SA 2WMXA 5KHWA 2WMRA 2IZTA 2QOLA 4IDTA 4U43A 1ZYSA 5M44A 3DQWA 3OC1A 4JRNA 2WMUA 2A27A 4FTAA 3H9RA 2E9NA 4I6HA 4D28A 4NKAA 3U6IA 4N70A 4RRVA 3B2WA 4GS6A 3K2LA 4QTAA 3RPVA 4BCQA 2C3JA 2RG6A 4LL5A 5C4KA 5JT2A 2XK7A 5HIDA 5IQIA 2WMAA 3DCVA 3KVWA 4PNKA 2UW4A 3O8PA 4O2ZA 1ZOEA 3TTIA 3JUHA 1GOLA 3PIZA 5LMBA 2W1IA 1YI3A 2PVNA 1JAMA 5EW8A 2ZOQA 3OCGA 3NLBA 3IW8A 3LFQA 2XJ2A 1KE9A 4BYJA 3PJ2A 3DK3A 4IWDA 4IZ5A 1PMEA 3F66A 4GT4A 4AA0A 2W1CA 5EDPA 4BY9E 2J0IA 4FKTA 3GU4A 3BCEA 4WOVA 5CSVA 4HVHA 5DN3A 2WQMA 4FNYA 3W2QA 4BGGA 1YOJA 3FC2A 2OLCA 3LFEA 2ERKA 4JR7A 2VTQA 4QYYA 2BTRA 5F20A 4O0TA 4R5YA 4F0GA 1G3NA 3QALE 4BCJA 2BRNA 5BVWA 4FIJA 1GJOA 5IA0A 3DKFA 2RG5A 4IVAA 2WMQA 3EN4A 3QD3A 4RBLA 3QCYA 2JIIA 4XLVA 5IEVA 1SYKA 2W1HA 5KMOA 3KXMA 3OT3A 4FTTA 4I21A 1P14A 3AC5A 3QKLA 4GV1A 2PMLX 4FA2A 2OJ9A 3K5UA 4A9TA 1AGWA 5ETCA 3FZSA 4FK6A 3COMA 3RPRA 2JKMA 4U40A 3LFSA 4FKGA 4ZIMA 3V04A 3VUHA 4B8LA 5ANEA 3VWAA 4E4MA 5CNOA 1YI6A 3QYWA 4L7FA 3VUMA 2XRUA 3UG1A 3QRJA 4FT7A 1YQJA 3M1SA 4PRJA 5HO8A 1PXMA 1CMKE 3PPZA 3OF0A 3ULIA 4ZTRA 1REJA 3F2RA 3FZOA 3RHKA 3COIA 4MBJA 3GP0A 4APPA 3OY3A 5LVNA 2CCIA 2B4SB 4MKCA 3VUKA 4F7NA 5HICA 5IZFA 2PUPA 2IW9A 3FV8A 3TKIA 3GCSA 2Z7QA 3HA6A 4U42A 3TV4A 4CFWA 5IQGA 4NL0A 4TYEA 5M4UA 3UIUA 4DTKA 1BMKA 4FKQA 4G1WA 4R7IA 5JGBA 1CTPE 2GQSA 5JFXA 3UOHA 2J5EA 5BYZA 4ZY6A 3R7OA 5FGKA 3RCJA 2XK9A 4IX5A 4CMUA 3P7CA 5C9CA 3U55A 4F6UA 4PL3A 3D5XA 5J1WA 5CENA 1M52A 2F2UA 5A3XA 3OWLA 5A14A 3QZIA 2O65A 3GNIB 1R1WA 2O8YA 3QC9A 5KMNA 1BX6A 3F69A 3FLSA 5AV0A 3P1AA 2UW3A 1PXKA 4IWOA 4W4XA 3UQCA 4GCJA 3ZSHA 1OL2A 2XNBA 5EYMA 4FEXA 2P2IA 3NNWA 2QC6A 3I4BA 3NNXA 3BYOA 2PTKA 4MNFA 5ICPA 4AGDA 3K5VA 5KNJA 1H01A 3ORLA 1BLXA 3C50A 5EHLA 4GK2A 4IX3A 4FSMA 3RJCA 3ZEPA 4EOMA 3C4ZA 4I22A 4P2KA 3NUYA 4YJRA 4MAOA 2XB7A 4ACCA 3D7TB 3WZEA 5CF4A 5CQWA 3S00A 5CSPA 4XS2A 4F70A 1LEZA 3MA6A 2R9SA 3KQ7A 3BHTA 1YRPA 5CT0A 2HW7A 4HPUE 3ZBXA 4XRLA 3NIEA 1RDQE 3F6XA 3DAKA 2WO6A 3MVJA 2OKRA 3PDTA 5FP5A 4IJ9A 4JIAA 3VUGA 4ASZA 4EOLA 4AZEA 5K9IA 1OUKA 3F9NA 3NAYA 4FYNA 1JNKA 1XH6A 1F5QA 3A8XA 4J99A 3S3IA 4EL9A 3SW7A 4HCTA 2JIUA 5F95A 3O17A 4XG4A 4ANMA 2FSTX 4D2RA 4DAWA 3CSVA 1JVPP 2J9MA 2VWIA 3FI2A 1YDSE 3LQ5A 1APME 3FLNC 3S95A 1OM1A 3DS6A 2VZ6A 2HY0A 4RQVA 4I0RA 3H4JA 4ACGA 4EH2A 2PMNX 4K33A 4KD1A 2IO6A 1E1VA 2OICA 3D94A 3TZ7A 3SOCA 3FMHA 4JR3A 3ZDIA 4D9UA 4RC4A 5DWRA 3AQVA 4WIHA 3R8PA 4TY1A 2R4BA 4IMYA 2IW8A 5CAOA 3HRBA 3SLSA 5EI2A 5I9VA 3FMDA 4KINA 3E93A 4H1MA 3ZXZA 2OJGA 5DGZA 2QLQA 3MS9A 4CTBA 4ZTHA 4ASDA 4U45A 2BMCA 5A4CA 4HYHA 4QOXA 2J51A 3KRLA 4EBVA 3PIYA 4WNMA 4CKIA 3N4UA 4TYJA 5CSXA 4C4EA 2BFYA 5TF9A 5LVOA 4YZCA 5DT4A 1XBAA 4A4OA 4D4VA 2PMIA 2FSOX 2CN8A 2WTVA 3Q9YA 5T6KA 5JEBA 2PVLA 3NR9A 4LM5A 4HNIA 2B9FA 5AM6A 4PUZA 4L68A 3IPHA 3PPJA 1U46A 3V5QA 4BR3A 4FNWA 5CEQA 4RQKA 2PVFA 4JIKA 2WD1A 1UU3A 4NSTA 4F9YA 3R63A 2QO2A 3WE8A 3C4WA 4OW8A 4ZS0A 4CT1A 4XG7A 3BEAA 4YTIA 3WZJA 3EYGA 1UKHA 3LCKA 4N6YA 1JBPE 4P4CA 3UQFA 4ZMEA 4FZ6A 3Q53A 2YEXA 3L9PA 5FBNC 4OTQA 4JX7A 4QP6A 5AA9A 3DZQA 5CANA 3OFMA 4E93A 3QWKA 2QOOA 2XCKA 4ZAUA 2YN8A 5D41A 2R3FA 3SG8A 4XV1A 5LOHA 3Q5ZA 1QPDA 4CD0A 3G33A 3M42A 4O7TA 4HZRA 3AGMA 3AOXA 3KF7A 4GT5A 5D10A 3C0IA 3Q60A 5EOLA 4EQUA 4KSQA 4M84A 1FMOE 3CS9A 3HL7A 3ZSGA 2F7XE 3WBLA 3CPCA 2G2FA 5LJJA 3OWPA 3ZM9A 1KSWA 1XR1A 3ZOSA 2OJFE 2FB8A 1ZMUA 2OXDA 4FIFA 3JYAA 4PDPA 3FWQA 4XP3A 5CWZA 3A4OX 3LFFA 5FBOA 5H8BA 3HAVA 2J50A 3QLGA 5CAQA 2PZRA 5H9BA 4AOIA 5LMKC 3LM5A 4O7VA 2QOFA 3EOCA 3UIXA 2HAKA 3QQKA 4U3YA 3FI8A 5JRQA 2X6EA 2X81A 3F3TA 2A0CX 5EHOA 2WQNA 3I5NA 2IN6A 3ORNA 2YIXA 1YXVA 3DT1A 2UW9A 3RAWA 5I5ZA 3EQRA 5HCYA 3BQRA 4C7TA 5BPYA 4FZFB 4O83A 3NUXA 2PY3A 3QTUA 5LCKA 2WPAA 3ANRA 5BYLA 4WG4A 2WEVA 4LGHA 3DGKA 4BDDA 4DEGA 1OPLA 3O71A 4DA5A 4E6DA 3MIAA 3RI1A 1KE5A 1VJYA 5CVGA 4S34A 2F49A 4WT6A 5DVRA 3ZTXA 4FICA 1O6KA 4AW5A 2FGIA 1FINA 2CHLA 2VO3A 2YCQA 1ZMWA 5ANKA 1J7LA 4FR4A 3L9LA 1M2PA 3ORKA 3P7BA 5EH0A 4GSBA 3WYXA 1L8TA 2QG5A 3RMFA 4FEVA 1YKRA 4ZLZA 3TL8A 3FI3A 4WUNA 1PMNA 4IAIA 4EOQA 1XWSA 3VS4A 2C3IB 1B39A 3V5TA 4U44A 4X6QC 3TUDA 5FG8A 2XMYA 3FMLA 1YDRE 4BZOA 4CCBA 2ZV7A 1F0QA 3ZO3A 2X7GA 2W99B 3U4UA 3EYHA 4EK4A 2QOCA 3WILA 1Y8YA 3DJ6A 3I60A 5EI8A 4AF3A 4YZNA 1Y6BA 5HE3A 2OFUA 1Q8TA 3BU5A 2VN9A 2C6IA 4I1ZA 1W83A 5AP7A 5EKNA 3CY2A 4XX9A 3HAMA 2DQ7X 5E7RA 4IWPA 4F64A 5IQDA 4I6BA 2C1BA 4G5JA 2YHVA 4X2FA 2QR8A 2JBOA 1WBTA 2Q0NA 3HRFA 3G6HA 2QKWB 3QUDA 4FT3A 4PMTA 4E4XA 1GIHA 2RGPA 3MFTA 5EFQA 2VNWA 4DFYA 3FYJX 2ZV8A 5E8XA 4X3FB 3HRCA 1O9UA 2VWWA 5B0XA 5HBJA 2YA9A 5JKGA 2BROA 4X7QA 3DNEA 5F9EA 5CLPA 1Y8GA 4K0YA 5FEQA 2YCRA 4BBMA 4AN9A 4K9YA 2E9OA 1CM8A 4Y95A 5KBRA 3UPXA 2RKUA 3ZUVA 4FEQA 4FSNA 1NA7A 3PYYA 4RIOA 3F2AA 4E6CA 4F63A 2UZOA 2E2BA 4K1BA 2EU9A 4OBQA 1NY3A 3M11A 4DEAA 1Q8YA 4YHFA 5DHJA 2F7ZE 3S4QA 2WMVA 5CAVA 1PXJA 2C6OA 5AUYA 4X2KA 2WU7A 2XK8A 4FMQA 4ZS4A 3OEZA 4FTOA 4ZY5A 4X2GA 2NPQA 2WQOA 3LIJA 2PVKA 1DAYA 4AU8A 3L8PA 1IAHA 5KMIA 2BHHA 3HYHA 4FSYA 1H25A 3BYVA 1S9JA 2WMTA 3P9JA 4I4FA 4R6VA 3CXWA 3HV6A 4FIEA 4BDBA 3LHJA 3PTGA 3DK7A 3D5WA 3EFJA 2EWAA 4QMMA 4XHKB 3VW8A 3GC0A 3REPA 3RPYA 5DI1A 5HD7A 1XKKA 5HIEA 1Q62A 1URWA 3KULB 5EI6A 3RKBA 4NUSA 2J0MB 3F5PA 5FEEA 4BDIA 3KVXA 2EXCX 2X1NA 2ONLC 2C68A 4G3GA 3IW5A 2IW6A 3BLQA 4DFLA 1UU7A 2XBAA 5IH6A 3I7CA 3EFWA 4GU9A 2C6KA 5CEOA 4QNYA 4J1RA 5L6OA 3HNGA 3EH9A 3DBCA 4YHTA 4J7BA 2YCSA 4GG7A 1CKIA 5T68A 1JOWB 3SD0A 5K3YA 3R22A 4BCPA 3G5DA 4IFGA 2R3MA 4K8AA 3NYVA 4Q5HA 2QHNA 3F5UA 3A60A 1PXOA 4C3RA 4CKRA 4PF4A 4JNWA 4RC2A 3R9NA 3MFRA 3NGAA 3RK7A 2XEYA 2QOBA 4FYOA 4L9IA 4EHEA 4YP8A 3FMEA 4FC0A 5HX6A 2CPKE 3NUNA 2QURA 2Y6OA 2I0YA 4ENYA 3F3VA 4O86A 3O96A 4I6QA 1QCFA 4GK3A 1JPAA 2CKOA 4GU6A 3F3ZA 2XIRA 4JBVA 4LV8A 4OGRA 2C0TA 3KXZA 3QF9A 3E3PA 2RL5A 3PXQA 2Z7SA 5BUEA 4L52A 2WOUA 3P4KA 4DT8A 1IR3A 2BZIB 3RVGA 4BDGA 5L2TA 3SA0A 4A9YA 3P0MA 4PMSA 3C7QA 3OCBA 5AAGA 3DAEA 4TYIA 4ALUA 2YIQA 5HHWA 3PP0A 4X2JA 2CJMA 4H3BA 2ITNA 3BBWA 3MH0A 2J0LA 1Q5KA 3HV5A 4V0GA 5E1SA 3UBDA 4UALA 3HKOA 3UC4A 2QCSA 5HLWA 3ALNA 3GC9A 2WAJA 4M15A 1TKIA 1W7HA 2GTNA 2JKOA 4FVQA 4QO9A 3D4QA 4RIXA 3FLYA 2H96A 3O50A 5CI6A 5J7HA 4DLIA 3I0QA 3VBXA 4F7JA 3KXGA 3H3CA 4WBOA 3TJDA 1ATPE 2XM8A 2YJRA 4I6FA 3QCSA 3A99A 2CNUA 4BRXA 3BHVA 4TL0A 4NM5A 3FYKX 4FV9A 2WGJA 4UXQA 4BIDA 4EH3A 3UIBA 2FYSA 1ZAOA 3M2WA 4OTWA 5IQCA 2GS6A 3PA5A 4L67A 3LAUA 4D5HA 2C30A 4FSWA 2ITTA 4BGQA 2YISA 1Q8ZA 1UVRA 4R77A 2IG7A 2PZ5A 2W4KA 3GVUA 3MJ2A 4IHPA 5FTQA 1MQ4A 4TT7A 4ACDA 1UNHA 3DXQA 3LPBA 2VV9A 4U80A 4GKHA 5AADA 1YXUA 5H3QA 1G5SA 5FXRA 5GJGA 4L3PA 1GZOA 2CGWA 2G2HA 3JVRA 3W8QA 4XP0A 3COKA 4XG9A 3TNQB 3D5UA 3NNUA 3ZS5A 1KE6A 2PUUA 4QP8A 4NIFB 5HD4A 2Y0AA 2WKMA 4AW0A 4AZVA 4V01A 3W10A 3VULA 2HWPA 3OD6X 4O7LA 2H34A 4J8NA 3QQHA 4M69B 1E9HA 3DBFA 4TWNA 5DEYA 4ZSGA 3RCDA 3ZEWA 4XNEA 5EKOA 1ZARA 4E5WA 2W4JA 2X39A 1UWJA 4TXCA 2XNPA 1Z9XA 1YHWA 2R3RA 3MVMA 5HE2A 3R7VA 2ZB1A 5IEYA 3HP5A 4RLKA 3E8DA 3NVKI 3HVCA 3BLRA 2IVVA 4FKJA 3WZDA 1LPUA 4QQTA 3Q9ZA 3R9OA 5CAPA 3VUIA 3GEQA 3VS7A 4PV0A 3BLHA 3PXKA 3QTSA 3QRKA 3F2NA 2BCJA 4AACA 1U54A 3O7LB 5IMXA 4FSTA 4ERWA 4YBJA 2WELA 4EORA 5IUHA 4ZSJA 3HV7A 3GB2A 3LOKA 4FKRA 3D9VA 3IW4A 4IX6A 4FNXA 4DTAA 2VWUA 5HU3A 3NWWA 2VX3A 1V1KA 3W2OA 5D7VA 3R1QA 4KBCA 3MY5A 1AD5A 3ZBFA 4EBWA 4CG9A 3CQUA 1WBOA 1PW2A 4AN3A 4BYIA 3MH1A 5L3AA 5LWNA 4I92A 5CU6A 3TWJA 1DM2A 3LLTA 4JVGA 4IVBA 4XRJA 3WI6A 3COHA 2X4FA 3MGYA 4AZTA 3QKKA 3L9NA 1YWRA 3EQGA 3QD2B 4FZDB 5BVFA 1PXIA 4IM0A 2A19B 4PNIA 5C8MA 1YDTE 5F94A 2VD5A 5CZIA 4FL1A 3AG9A 3BYSA 2CKEA 3Q5IA 4QP1A 4B7TA 5GIOE 2XP2A 4A06A 5KUPA 2LGCA 2W0JA 4UWCA 4H36A 1RW8A 4HCVA 5G1XA 2R3PA 2WTWA 4TPTA 4ZEGA 2RF9A 1XBCA 1H24A 5CEKA 4C59A 3MY1A 2XIXA 3LE6A 4S33A 2X4ZA 1MUOA 4Z55A 4ONAA 3VW6A 4HGTA 5KMKA 4FL3A 3VHKA 3MDYA 2HY81 3PY3A 5J1VA 1M2RA 3TG1A 2UZTA 5M56A 1P5EA 1U54B 2DWBA 4O91A 5IH4A 5JZNA 2BRHA 1UKIA 4LMNA 5J9YA 1GIIA 1OIRA 2YIYA 4JDJA 3RK9A 2QQ7A 4JAIA 4QP3A 3SHEA 4DG0E 3SXFA 1K3AA 3IGOA 4C33A 4KKEA 3ZMMA 1FVRA 1H00A 4S32A 2HCKA 4YPSA 3WARA 3KGAA 3PVUA 5ANIA 4E4NA 5IUIA 3OW4A 1HCKA 2C5NA 3RHXA 2ZDTA 3R73A 3VS1A 1GZKA 4HYSA 4XBRA 5AP4A 4EH7A 4IB0A 1OKZA 2ONLA 3PWYA 2VTOA 1Q41A 4FG9A 3NUPA 1FGIA 5CEPA 4L00A 2JKKA 4CZUA 4EH9A 5HU9A 1R0EA 3F5GA 2XNMA 4GMYA 2VTHA 3IOKA 5EHYA 5GNKA 4D1SA 3MY0A 4YTCA 3U6JA 2R5TA 4FX3A 3LJ0A 4XYFA 3QRTA 4OBOA 5D12A 2XEZA 3OWJA 4YJQA 1WBWA 4APCA 4DC2A 2OF2A 1ZYDA 3Q4TA 4G6OA 4I5MA 3GCVA 2P55A 3I5ZA 3V3VA 5JFVA 3OMVA 3H9FA 4IWQA 4RC3A 5M55A 3L8VA 3UZRA 3EN5A 3BRBA 4WSYA 3BZ3A 4O0WA 1CDKA 2WMBA 4G6NA 4D9TA 1ZRZA 4UN0C 3U51A 1URCA 2X8IA 5CU0A 1YVJA 5IDPA 3NZ0A 1DI9A 4EI4A 3O8TA 3UG2A 2C5YA 1MRYA 1DI8A 3I6WA 1XH4A 3C0HA 3SW4A 4N57A 2NRUA 3NDMA 5FXSA 3ZYAA 4IAYA 4ARKA 4MK0A 2PPQA 2NRYA 3H9OA 4AOTA 5HTCA 3C0GA 3IGGA 4AT5A 4HNFA 4QMPA 3ZZWA 4DEHA 4V0GB 4XLIA 1SMHA 4KUJA 4XP2A 3O8UA 2ETMA 4BDEA 2X0GA 4HOKA 5ANDA 5KMMA 4BCGA 2WXVA 4LRJA 2HYYA 3QGYA 3NYOA 3UGCA 3FJQE 4EOJA 4C02A 4FKPA 2JKQA 2GS7A 4IEBA 1VZOA 2XJ0A 3MYGA 3Q9WA 4QPAA 4UYNA 3QTWA 4FSZA 2OZAB 3VRYA 5AUWA 3EQCA 4CMOA 2I6LA 4GKIA 2GU8A 4KBKA 3UP7A 4YJTA 4R3CA 4XUFA 3RM6A 3PG3A 1KWPA 4F7SA 4M68A 3EZVA 1JSUA 5M57A 3NCZA 4FV7A 2OK1A 3IW6A 1QL6A 4AA4A 2EUFB 2C0IA 4FT9A 2Y4IB 1ZOHA 3HV3A 4XV9A 3WZKA 4DBNA 3WIGA 4BCMA 4IADA 4L45A 3UYTA 3ANQA 1TQMA 2B0QA 2RFNA 1WBPA 3FXZA 3CEKA 4I5CA 4CRLA 2VO0A 1CSNA 2R7IA 3II5A 2OXYA 4FOCA 3FQHA 4QYGA 3V8WA 3C4CA 3PXRA 4BHZA 1IG1A 1VYZA 2J6MA 3TV7A 4ZTLA 3DJ7A 3TDVA 1H28A 4OBPA 3NW6A 3R8MA 3RP9A 4ZJVA 5HLNA 3W1FA 2Z60A 3LFBA 3LMGA 3ZO1A 1YXSA 3KMMA 3H30A 3NW5A 3Q2JA 3R0TA 1U5RA 5FD2A 4F0FA 3QU0A 4WUAA 4C35A 3A7GA 1BYGA 2O3PA 5AP2A 5AAEA 4C0TA 1GIJA 3BE9A 3E3BX 4Y73A 5IDNA 3KULA 3C4FA 3UNZA 1ND4A 5AUVA 3K3IA 5TT7A 3PG1A 3QA0A 3HUCA 1ZOGA 4AE6A 3E64A 1Q4LA 3G90X 4D5KA 5BUIA 2WIHA 1ZZ2A 4U0IA 2V55A 3CD8A 3K54A 2YAKA 4JG7A 1OKWA 4RJ8A 3UVRA 4RZVA 1H07A 2C47A 3AXWA 5ACBC 3DY7A 4BHNA 4X3JA 1ZY5A 1K9AA 2B9IA 3D7ZA 3L8XA 3L8SA 4HYUA 4MXCA 4RT7A 3R8UA 3QTRA 5EM8A 4FTIA 3KK8A 2OGVA 2XH5A 3F3UA 3WE4A 4BDAA 2CGXA 1H08A 2KULA 5GHVA 3DTCA 4YJPA 4EONA 5A6NA 4RG0A 3JY0A 4X21A 3C5IA 4HGSA 3F7WA 5TR6A 5ANGA 5DT3A 4YNOA 3IDCA 5AJQA 5CXZA 4M97A 1BL7A 3DDQA 4MQ2A 2QU6A 5GINE 4L6QA 2W17A 4DITA 2W1FA 1STCE 2ITPA 4F1MA 2R3JA 3FSFA 3PSBA 1JSTA 1OKVA 3H0YA 5D11A 3I0OA 3UNJA 4C2VA 5KZ0A 4IX4A 4D0WA 4FV4A 3A7FA 3AT2A 1XBBA 1VEBA 3RK5A 4XCUA 3A7IA 2G01A 3E8CA 2C6DA 3ODYX 3R1SA 4UY9A 1W82A 5CEMA 3V6SA 3ZFYA 2YM8A 4KKGA 4NK9A 4FKOA 4X2NA 2C6LA 4OLIA 3QQJA 1TQIA 1M17A 3D83A 1UWHA 2W06A 2YZLA 2R3LA 4D2SA 3I79A 4KS7A 3ZH8A 5AV1A 3UYSA 4F08A 3A8WA 2VTRA 3GCPA 3W18A 4G3DA 4QMTA 4RWLA 4AFJA 2OH4A 4MX9A 2PE0A 4EUTA 3AT3A 5EDRA 2CLQA 1H27A 2PZYA 3EIDA 5M06A 2BR1A 3PFQA 4EOSA 3LFCA 3DV3A 3FPQA 3ZUUA 3KRXA 4UEUA 3ZRLA 4NJ3A 1QMZA 5FUTA 3QTZA 2B53A 2ITWA 2OH0E 4XJ0A 4YLJA 5AIRA 2DUVA 5HKMA 3AC1A 3RTPA 5E8ZA 3SRVB 4ZY4A 4S31A 4ERKA 3VC4A 4AZFA 2JDTA 3PLSA 4UB7A 3QQUA 4JQ8A 1G8SA 3PXYA 2BAJA 3Q9XA 5DT0A 3ROCA 4GUEA 4E5AX 5L2SA 3UODA 4R7BA 1P2AA 2GTMA 4LQMA 2OI4X 1YOMA 5HG9A 2X9EA 3IK3A 3IDBA 1RE8A 4EJNA 3TNIA 1T46A 5F1ZA 3RALA 5M08A 2QR7A 4Z9LA 3S2PA 3RNIA 4MBLA 4QRCA 3VVHA 4TKSA 4F9WA 4Z3VA 4IZYA 5IH5A 3FC1X 4JQ7A 4RIXB 3R8VA 2H8HA 2YACA 2OU7A 1GZNA 1U4DA 3ALOA 2PVMA 2GPHA 4XV3A 1U59A 1M7QA 4ZLOA 1H1RA 2BZHB 2HZ0A 4L42A 4B8MA 5C1QB 4NCTC 4E8AA 3OBGA 4O6LA 2XYNA 4BCKA 2OF4A 1PF8A 4CSVA 4O22A 5AP5A 4KSPA 1PJKA 3MH3A 3R7YA 1YOLA 3LFDA 5EDQA 3VS2A 3UOKA 2QG7A 2XKCA 4MWHA 2FUMA 2OIQA 3SOAA 4IM3A 4EK8A 4AAAA 3BYUA 3LCSA 3OEFX 3NEWA 3WYYA 3GI3A 3EQHA 2QOIA 5LMAA 3GOPA 3R9RA 5DPVA 2NO3A 4EH8A 4R1YA 4AN2A 3O7LD 4DH1A 5M09A 4ANSA 4O7NA 1ERKA 2UZWE 3PRIA 4L46A 4H3QA 4OUCA 4CLIA 4JDIA 1OBDA 5AUTA 4CGAA 4PX6A 4G17A 3LJ2A 4FUXA 1Q3WA 4G16A 4RZWA 1ZLTA 4I23A 4DH5A 5IQFA 4QMSA 3OZ6A 5IG1A 4PL4A 3LFAA 3ZRMA 5BYYA 4O0YA 4IB1A 3FMMA 1J91A 4OT6A 4FGRA 3Q52A 2CGUA 2PUIA 4KKHA 3DLSA 4L3LA 3DB6A 4RJ3A 2QNJA 4HCUA 1FQ1B 4HVIA 2PZPA 4YNEA 5M4CA 5DE2A 3ZSIA 4MXZA 5BVDA 4RX5A 4NW5A 4EK3A 4G9RA 4HZSA 1JKKA 3VQHA 4ZSAA 2X6DA 2XIKA 5J87A 5CAUA 3D2KA 3FMKA 4ALVA 3ERKA 2WU6A 3POOA 4KS8A 3PA3A 2PVHA 5B2MA 4K6ZA 3PVWA 4BI0A 3EQIA 4H3PA 4CFUA 4Y46A 4A7CA 4DG2E 4BCIA 2GQGA 5FM3A 2PK9A 3R9HA 3C51A 4GVAA 4IW0A 3U54A 5GJDA 5FTGA 5IU2A 4TYGA 5HESA 2P33A 2X8EA 3KN5A 4IFCA 5KZIA 5LVLA 4BCFA 4WBBB 4ASEA 5JH6A 4KNBA 5AEPA 4C61A 2YERA 3KL8A 2NP8A 3RWQA 4AS0A 4IBMA 3D14A 2AYPA 3GXLA 5DFPA 5E4HA 5CF8A 1Y91A 2R64A 5ANJA 4E20A 3TDWA 4DH3A 3QBNA 4Y83A 4ZZNA 4IAFA 4M67A 5DR9A 2BFXA 4JS8A 5LMKA 3VRZA 4FEUA 3CQWA 4FIHA 5KE0A 4IH8A 4J97A 3ZRKA 1YXTA 3G0FA 2JD5A 4P7EA 4USFA 3IECA 4RX9A 3SGCA 2CGVA 3HX4A 4FZAB 5LCJA 4O84A 5CU2A 1OVEA 1ZZLA 2GNHA 4YZ9A 4B99A 4LOPA 3QTIA 5K4JA 5JRSA 3W55A 4J52A 4DE4A 4J96A 1IRKA 1IA8A 4KA3A 3QX4A 4M14A 4W4VA 2IZUA 4X3FA 4DGOA 2W5AA 3EWHA 4FV8A 5AP0A 2VTNA 2YWVA 3GU7A 4WO5A 5IUGA 1NVRA 4RMZA 2BKKA 3BX5A 4CEGA 1LEWA 2BRMA 2DS1A 3AD6A 2CCHA 4YR8A 4FG7A 3UO5A 4K11A 2ITOA 4J53A 2CKQA 3D7TA 4KWPA 4R78A 3UMXA 1KE7A 3IDPA 3MN3A 1Q99A 4Q9SA 4L8MA 1NVSA 4PDYA 4AW2A 3E87A 3U4WA 4DFNA 5LWMA 5M4FA 3HMOA 2X7OA 3ORZA 3PP1A 3NW7A 4J95A 3GCUA 3NX8A 4TW9A 3LQ8A 2V62A 4P5ZA 1RJBA 4KIQA 2VX1A 3JY9A 4F9CA 3KXXA 5L8LA 3FXWA 4RWKA 3OCTA 3HMIA 2OW3A 2HELA 1WBVA 4QYFA 4DFUA 5ITAA 4RFMA 1NVQA 2UZNA 4NM7A 5KHXA 2WTJA 3DB8A 4GT3A 4AFEA 4KIOA 4OTHA 2ZJWA 4MHAA 3T3UA 4EQCA 4M8TA 4RWJA 4TWCA 4C4JA 3F3WA 4ZSEA 5IEXA 3DZOA 3FPMA 4R3PA 4CXAA 4CZTA 1PYXA 3B8QA 4Y5QA 4RIYB 3CBLA 2ITVA 3BELA 2XKDA 5FXQA 4UZDA 2W7XA 4IIRA 3ZUTA 3AD5A 2GNFA 2V5QA 3OG7A 3PPKA 4WG3A 4ENXA 3N51A 2XJ1A 1Q3DA 3QL8A 4B0GA 1JKSA 2HXQA 4JT3A 5FP6A 4EOKA 4EZ5A 5DNRA 4DT9A 4YU2A 4FV6A 2BTSA 4G34A 4QTEA 4NKSA 4A9RA 4EZ3A 2R0IA 2HOGA 4NT4A 2JDRA 5D1JA 5IMEA 1R78A 4MXYA 4GIIA 4F7LA 2IJMA 3PRFA 1OIQA 1YXXA 4XBUA 4O82A 4O38A 4F09A 4DCAA 2G1TA 4ID7A 4NCTA 2VWVA 2J7TA 2QI8A 2C1AA 4K18A 4MBIA 4TRLA 1A9UA 3WF5A 5AP3A 3V6RA 1DAWA 5BVEA 3L9MA 4EWQA 3P86A 3I6UA 5A4EA 3CKWA 4EH5A 4CG8A 2XK3A 1H8FA 3PZEA 3ZFXA 4DINA 5BVOA 1WVXA 3VAPA 4FODA 4YPDA 2EVAA 3R2BA 1OIYA 2WTKB 2GHGA 3MJ1A 3E88A 4QMVA 4GIHA 1B38A 1LUFA 4G3CA 5CASA 3AC3A 4BCOA 5KO1A 4LI5A 4FUYA 3QZGA 4DG3E 2ZMDA 3G9LX 4PP7A 2WMSA 3HMPA 3UDBA 4BTMA 5EQYA 3R7IA 2F7EE 2X2LA 2FVDA 4D4RA 1YHVA 3GGFA 1X8BA 3RGFA 5BX0A 3LLAA 2ZM3A 5AP6A 3KRWA 4QNAA 4GRBA 3RINA 4Y8DA 3NMUF 4YSJA 2BRGA 1A06A 3FAAA 3HA8A 2GHLA 3OW3A 4I93A 4JDHA 4UWYA 5JFWA 4O7RA 2YM7A 5JMSA 1VYWA 4AT3A 2R3KA 3EKNA 4E26A 5TOZA 4CV9A 1J1BA 4LOQA 3UZPA 3BV2A 4QMLA 4EUUA 2XKEA 3IOPA
chains in the Genus database with same CATH superfamily
4CVAA 4D1XA 4W4WA 4XMOA 3PY0A 5L8JA 3U8WA 4IVCA 5E8UA 4FTKA 3TEIA 4YJNA 4IM2A 2HW6A 4I20A 3ZXTA 4E5BA 4DGNA 2UUEA 2Q83A 4FG8A 2BVAA 4QYEA 3WF8A 5ANOA 2ITYA 3TZ8A 4FGBA 1PMUA 2C6EA 3V8SA 3T9TA 4AW1A 5CNNA 1M7NA 2J5FA 3ODZX 1GY3A 2GNJA 3ULZA 2GS2A 4DTBA 2CNQA 1M2QA 3GFWA 3GUBA 4UBAA 4AXAA 5M4IA 2UZVA 4EYMA 3W0QA 4AG8A 1FBNA 2JAMA 4PTEA 4BC6A 3R83A 5IPJA 4C3PA 1NW1A 1VR2A 2BDFA 2C0OA 2UW8A 4UXLA 3VBQA 4IANA 4JLCA 4DH7A 3VBYA 3ZLXA 1JWHA 2C3KA 3EN9A 3MV5A 3FKNA 3DFCB 1H0WA 4C38A 4FT0A 1NXKA 1LR4A 4E73A 4Z7HA 5AM7A 4B6LA 1GNGA 4AA5A 4ZZMA 2O5KA 4DDIA 3LXKA 4WA9A 3TV6A 5DA3A 4BVUA 4KAOA 4NM3A 5K5NA 3Q4UA 5L2IA 3BE2A 4H39A 3MB6A 2OSCA 3AMYA 3PJCA 5DOSA 2ITQA 2ZMCA 2VTAA 5J5SA 4ZOGA 3QHRA 2XK6A 4ZP5A 1SVHA 2BDWA 2VRXA 3DDPA 3MESA 4IB3A 3EHAA 2HXLA 1WCCA 4FTUA 3BYMA 3V8TA 4BDFA 4FV0A 4J98A 1ZMVA 2VTSA 4YLLA 3OT8A 2UW5A 3CCNA 4JXFA 3DXPA 3P79A 5AX9A 4BGHA 5DR6A 4E1ZA 4TYHA 4ZTMA 2RFEA 3BPRA 3O51A 3WOWA 4R5SA 4U81A 3R6XA 3ORPA 3BHHA 3D0EA 4QT1A 3VN9A 3ZC6A 4C4IA 4D58A 4E4LA 2JBPA 2ERZE 3UE4A 3FBVA 2IVTA 4FKUA 2OWBA 2XK4A 5AA8A 3HMMA 3PUPA 4EC8A 3TZMA 3BV3A 4A9UA 1WVWA 4GYIA 2FH9A 1XH7A 3QLFA 4CFMA 2I0EA 4I5HA 3W0OA 2ZV9A 4E6QA 1UNGA 2HWOA 5KKRC 3KF4A 4D4YA 1UU9A 2B55A 3A7HA 3QD4A 4FKLA 5BV3A 3MPTA 3H10A 1QPCA 3QHWA 5EYCA 2G9XA 4R3RA 4FV1A 4QQJA 5LARA 1H26A 2O0UA 3W8LA 4AGWA 3LW0A 4QMZA 5CF5A 3RPOA 5IA2A 4O6EA 4F65A 5IA3A 5AV4A 3GQLA 3MA3A 4PWNA 2I7QA 3LXPA 4G31A 2C4GA 4O7ZA 5HCZA 2XCHA 2RFSA 4KIPA 4YC6A 3EJ1A 4AE9A 5HE0A 3LCOA 2WOTA 5I9XA 3OY1A 2W1GA 4ITHA 4H05A 3EL7A 3PZHA 5A46A 4I3ZA 4UV0A 2GDOA 3BBTB 4RPVA 4N6ZA 3VUDA 4DEIA 3PVGA 3IKAA 4DHFA 2PVYA 5E8TA 3FXXA 3KKVA 3BHYA 5CYIA 2VWYA 4MF1A 3LVPA 4BCHA 3SG9A 2IVUA 3PVBA 1H1QA 2E9UA 2VTMA 5AP1A 4JBOA 4F6WA 3UDTA 5FDXA 3R21A 3B8RA 1FVVA 2GFCA 1QPEA 1HOWA 2BDJA 3R00A 3E8EA 2I1MA 2R3NA 2OG8A 3QC4A 4OTDA 4DN5A 5DRDA 3TI1A 5EW9A 4FI1A 3NS9A 4LGGA 4ANBA 4EYJA 5HVJA 4Q2AA 4OTIA 5HLPA 3KIOC 4C3FA 2ETRA 4A9SA 4AT4A 4RJ4A 3AC4A 3LKMA 4FTJA 3T9IA 3NNVA 2EB3A 5DG5A 5I9YA 2GNGA 4ANQA 4G9CA 3I7BA 3FLWA 3Q04A 4MXXA 1IA9A 4I41A 2F2CB 4F4PA 3OXZA 5G6VA 5FM2A 1KV1A 4CTCA 3LQ3A 2PVRA 3ENMA 3SQQA 1WBSA 4BZDA 3CKXA 2HZ4A 4GW8A 5CSHA 3JR1A 4F1TA 3ZFMA 5L8KA 2B9JA 3WF9A 1JKLA 4QMYA 3UC3A 4O0UA 5L6WL 3TZ9A 2JC6A 2QO9A 3SXSA 4W4YA 2SRCA 2QD9A 3Q6UA 2ETKA 3ZCLA 2Y9QA 5AMNA 3LXNA 3QQGA 4FK3A 4FTNA 1YW2A 1J7UA 4O2PA 4O27B 3QKMA 4QMOA 2PL0A 4RVLA 4WRSA 4XH6A 3RAIA 3VONA 4EWHA 4MWIA 4JRVA 4KABA 3UPZA 5JQ8A 4BBEA 1OKYA 3MWUA 4GH2A 1P4OA 4Z7GA 5LXMA 1ZWSA 2IVSA 4JX3A 3ETAA 4H58A 4QMQA 5AV2A 1KOBA 4PY1A 2Z8CA 3W2PA 4FT5A 4L43A 2X2KA 3ZU7A 2FA2A 2W1ZA 2XYUA 4OTFA 1BKXA 2C6TA 1SVGA 4D55A 1XQZA 4CV8A 3FHIA 2UVXA 3BL9A 2QONA 3R2YA 1IASA 4NTTA 1Q8WA 2BZJA 3PLAE 3R7UA 3W0PA 4BDJA 4C58A 2W5BA 4EEVA 1E1XA 1V0BA 3FQSA 5F4NA 5IQBA 3QCXA 2XM9A 5I9ZA 4Q9ZA 3TCPA 2UZDA 3BU6A 1JQHA 2AUHA 5CVFA 2XF0A 1PRYA 2QHMA 3O2MA 1BI7A 2HENA 2WQEA 3PJ1A 4BF2A 3DKOA 3DJ5A 2W9ZB 3QZHA 5HNBA 4J8MA 3N4TA 3ZLSA 1XH5A 3FMJA 3B2TA 3PXFA 2GSFA 1OECA 4L3JA 5E92A 4Z16A 2WFYA 4JI9A 4BDKA 3PE1A 3S0OA 4RA4A 4DFXE 2UW6A 4GFGA 4WNKA 3HV4A 2ITUA 3HMNA 4EC9A 1KOAA 2JFLA 4NJDA 3PXZA 1XH9A 3S1HA 3PY1A 3TT0A 3NIZA 4S30A 5A9UA 1WVYA 2VU3A 4DGLC 4JJRA 2J0KA 2I40A 3FKOA 4YJVA 5A54A 3OOMA 3FUPA 4YZBA 3KA0A 4BICA 2GNIA 5CVHA 4QTDA 4FZ7A 4QQCA 3WF6A 3EMGA 3EQDA 4L01A 5T3QA 3AC2A 3MBLA 3DPKA 2UV2A 4M7IA 3G15A 3Q6WA 4DCEA 5L2WA 2WTCA 5C27A 2JDSA 1XMMA 3GC8A 3OXIA 3Q96A 5DIAA 5HGIA 4ZJJA 3ZO4A 2J2IB 5IQAA 4TTHB 5A4TA 2YITA 2RFDA 3CC6A 4FEWA 4WG5A 3TNHA 4YJUA 3P7AA 3R01A 2YIWA 4LYNA 2GCDA 2P3GX 2OIBA 4U79A 5BMSA 2WMWA 2J90A 4CFVA 2OBJA 3AC8A 5BQ0A 3DAJA 1SNUA 3UO6A 3DA6A 1FVTA 3SDJA 4G3FA 2HK5A 3MH2A 4QQ5A 4V04A 5EM5A 4EOOA 4Y5HA 2YM3A 4NWMA 4GK4A 4BCNA 4D4SA 4TWPA 4GEOA 3R1NA 3VS0A 3QAME 4YUQA 3Q32A 4ZTNA 3FMNA 1JKTA 5HTBA 2G2IA 3POZA 5E8VA 5HO7A 3TNPC 3UP2A 5HZNA 2YZAA 4M0ZA 2XNGA 2PWLA 2VO7A 4PMPA 5A4LA 4QDEA 2JEDA 1CKJA 3UIMA 2J0JA 2V0DA 3EQFA 3FLQA 3OS3A 2OFVA 4AUAA 5I4NA 5J95A 3HLLA 5CU4A 5IQEA 3R02A 4ITIA 3UTOA 3W2CA 1GAGA 3ITZA 4O0SA 1OUYA 3ATTA 4CMTA 3TYKA 2ZV2A 3O0GA 5HBEA 1XJDA 4JL9A 3MFUA 4E6AA 3KFAA 4DF3A 4HW7A 4MH7A 5AUUA 2YDKA 5JN2A 2QODA 3QQFA 1CKPA 4W8DA 3RAHA 5CS6A 4IVDA 4DEDA 1PXLA 2F9GA 2I0VA 2YDIA 3QA8A 3WF7A 4BZNA 5D9HA 1PY5A 3VJNA 5HNIX 4C4GA 4FVPA 4AXEA 3QD0A 3VHEA 3C1XA 2V7OA 3LZBA 4BN1A 3FHRA 4RJ5A 1W84A 3OUNB 5E9EA 4I5PA 5HQ0A 5IF1A 1L3RE 4PMMA 3VIDA 5CZHA 2JDOA 5GJFA 1ST0A 4EHVA 4XOYA 3FDNA 5B7VA 4QP9A 2B1PA 5K4IA 1FOTA 5DR2A 3L1SA 3PSDA 3R71A 4O21A 5HEZA 3W33A 5HCXA 5KX8A 2XVDA 4QMXA 4BB4A 4RWIA 4D1ZA 4LDTA 1TQPA 4IACA 4EH4A 3P5KA 5KBQA 3F5XA 2OIDA 4CFNA 4DGGA 3PWDA 1FGKA 3LFNA 4DLJA 4NZWB 3VF8A 2OJIA 2NYAA 4L44A 3U87A 4EHZA 5HE1A 4IAAA 3ZM4A 4FVRA 3FE3A 3CQEA 4UYAA 5H2UA 1W8CA 2PYWA 3QX2A 4IZ7A 4K77A 4ORKA 4U5JA 2PHKA 3CGFA 5ETAA 3RM7A 3TNWA 4ANLA 3MPAA 4HYIA 4QMNA 3GU6A 2QU5A 1SZMA 4MD8E 1PXPA 3DXNA 5AV3A 2VUWA 3V5WA 4LMUA 4MEDA 5FDPA 4LRMA 3LCTA 5E8YA 5EK7A 4H1JA 4BDHA 3OOGA 4QTBA 2PE1A 4USEA 2JFMA 3CJFA 3HGKA 3U6HA 2PE2A 3UOLA 4QP2A 4KRCA 4L7SA 4HVDA 4NTSA 2CDZA 5J9LA 3KK9A 2Q0BA 2Y4IC 3V5PA 4CCUA 3ZHPC 2XBJA 2O2UA 3CTHA 3KY2A 3MFSA 3BHUA 3SAYA 4NU1A 4QP7A 3GBZA 3MVHA 4IC8A 2VTPA 2REIA 2WTIA 3WIKA 4IJPA 1MRUA 3ORTA 4CT2A 5BVNA 3BLAA 1SM2A 2WEIA 1MP8A 3KCFA 2VGOA 4NYEA 4PQNA 4HVSA 1XH8A 3CY3A 2BPMA 3VNTA 2WTDA 2XNOA 3VO3A 2BILB 2OZAA 1Q97A 2YM4A 3QFVA 1A48A 2C5VA 2JLDA 1PKDA 5HIBA 3A2CA 3BL7A 4N0SA 4A4XA 3ZLYA 3U9NA 2YABA 3BWJA 2YM6A 3VF9A 2R7BA 4EQMA 3CJGA 4MTAA 3UQGA 3IONA 5DEWA 4FKWA 3UZTA 3HDMA 4TYHB 4WKQA 1SVEA 2YJSA 3IW7A 3OUKA 1TFFA 4B9DA 3GCQA 3PA4A 4M0YA 3V5JA 3VBVA 2AC3A 3W0NA 3DKCA 4PP9A 3R9DA 4F9AA 1OBGA 2Y4PA 4IC7A 2ITXA 4ZMFA 4YTFA 2OO8X 4LV5A 4DHIB 4W8EA 5DRBA 4ZTQA 3KXNA 3ZDUA 4BI1A 5BVKA 3A61A 4X6RA 4KB8A 3FZTA 4K2RA 2V22A 4FL2A 4GJ3A 3CPBA 5HBHA 2W9FB 4XOZA 5FRIA 4ALWA 3KXHA 3MW1A 3KC3A 4YHJA 3LCDA 2W96B 4JBQA 3E5AA 1PMVA 3NUAA 2WZJA 3SRVA 5EYDA 2CMWA 2IZSA 1H4LA 2IZRA 3EN7A 4FE2A 3QUEA 4OT5A 5AAFA 5BNJA 5KKRB 4PTGA 3GQIA 5EW3A 2VX0A 5LQFA 4S2ZA 3TN8A 4EOIA 3E7VA 4C34A 2FO0A 2E9VA 4I24A 1W0XC 3E8NA 2R3OA 4NM0A 4TWOA 4LG4A 4YGAA 1BUHA 3E92A 4U9AA 3FZ1A 5ACKA 3CE3A 3MTFA 4ASXA 3EQPA 2VO6A 4G2FA 1R39A 3KRJA 5M51A 4ACHA 3ZO2A 3DBQA 4WD5A 3LMIA 1JSVA 2WB8A 4CLJA 1V0OA 3BIZA 2XUUA 4MCVA 5I0BA 3E62A 1SNXA 2X8DA 2BIKB 2Z7LA 3NCGA 3QQLA 4WNPA 3TMOA 4FSRA 5IQHA 2QLUA 2BAKA 2JIVA 3IG7A 3N4VA 1UA2A 2RIOA 2XA4A 5BMMA 5E8SA 4P5QA 1G8JA 4V05A 5IA5A 3QRUA 4O0XA 4RVKA 3Q2MA 3VQUA 1Q8UA 4OTRA 1LP4A 3OBJA 4YC3A 1OB3A 2PULA 3R04A 4QYHA 1V0PA 5AUZA 2YM5A 4DDGA 3DBEA 4AP7A 3EFKA 2YCFA 3IS5A 1ZXEA 5HG5A 3OCSA 1S9IA 3BKBA 2ZFYA 3CD3A 4TNDA 3MB7A 3NSZA 4FSQA 4XEYA 3DK6A 3O23A 5EQEA 2V7AA 1ZYLA 1Y57A 3ELJA 4MD9E 3UNKA 1WFCA 2JDVA 4FV3A 5J9ZA 3AT4A 4YTHA 1WMKA 1H1SA 3A62A 2W4OA 3ACKA 5EM6A 3OP5A 2ESMA 3NAXA 3TIYA 4RFZA 3CGOA 3HZTA 4G6LA 4LFIA 4MVFA 1H0VA 3NPCA 3VJOA 1U5QA 2KTYA 2CLXA 3K3JA 3TACA 5CI7A 5CU3A 4DEEA 2OXXA 4XV2A 3V51A 1P4FA 2A4LA 2B9HA 2C3LA 3D2IA 5D7AA 2CSNA 1DS5A 3OTVA 4Y85A 4ZXTA 4BTFA 5K5XA 4XG3A 5LVPA 3PIXA 1REKA 4LL0A 2ZDUA 2P2HA 2WIPA 4C4FA 2GFSA 5CEIA 1KV2A 2QOKA 4FOBA 3GT8A 2YFXA 2PVJA 4OR5A 3BU3A 3I1AA 3QWJA 3PSCA 4F1OA 4I0SA 2Y6MA 5C03A 5I9UA 3UMWA 1OGUA 3FI4A 3NUUA 3PJ8A 1ZYJA 2IPXA 2XAOA 3P23A 3DNDA 5KCVA 2VTLA 1O6YA 3V01A 4IE9A 1J7IA 5HG8A 4BIBA 4M3QA 3P78A 1J3HA 4GFMA 3DU8A 2A1AB 2B7AA 5FTOA 5JFSA 5C26A 3CIKA 4FKIA 4MXOA 3R30A 3KREA 4YJOA 5C8KA 2C69A 4CKJA 4FNZA 2XKFA 4WNOA 3FEGA 3EZRA 5CSWA 5CX9A 4YLKA 4BIEA 4ZK5A 1IAJA 4DH8A 3UVPA 4E7WA 3LXLA 5IISA 4ZSLA 1FPUA 2H6DA 3HEGA 5ETIA 2BHEA 2YDJA 3TJCA 5HVKA 3ATSA 4RVMA 4EHGA 4MXAA 4YSMA 3KMUA 5FEDA 3VBWA 4C62A 3FY0A 4GUBA 1UNLA 4II5A 2XNNA 3SC1A 4KBAA 5KMLA 3UOJA 4RIYA 1BL6A 3BQCA 5M53A 1H1PA 5CALA 1EH4A 4R7HA 1M14A 4O96A 2JAVA 4MNEA 3VS6A 4RA5A 3NYNA 2QVSE 4RLLA 2EXMA 4AZSA 4DFZE 2F4JA 5I9WA 4JBPA 5EM7A 1WAKA 4YC8A 5EQPA 3OXTA 4F6SA 2O64A 2XANA 3CTJA 5H8GA 5C4LA 3ORIA 1OMWA 3OWKA 2XNEA 1G8AA 4JG6A 1YWNA 3Q4CA 3SXRA 1YWVA 2PMOX 2Y7JA 2PSQA 3JXWA 3QXPA 2BUJA 4MYGA 3R28A 4HGLA 3JPVA 4U8ZA 3R7EA 1I44A 3MTLA 3OHTA 5E8WA 1W98A 3BEGA 4GG5A 3NVMB 2BZKB 4IQ6A 4GFOA 1OL6A 4RX8A 2CNVA 3W16A 4JDKA 3SKCA 1Z57A 2R3GA 5C8NA 1J1CA 1H1WA 2HZNA 5HNGA 3F61A 3FY2A 3ORMA 1Q24A 4MNEB 4AQCA 4IAKA 2R3QA 4ZZOA 4LUEA 5DLSA 3BGZA 1AQ1A 1B6CB 2FSLX 2Y8OA 2ZYBA 3MVLA 3UVQA 3D5VA 1O6LA 3A7JA 3C4XA 4R1VA 4RIWA 1WBNA 3G0EA 3FQEA 3QTQA 2BRBA 3ET7A 4NFMA 3JVSA 3G6GA 4BTKA 4JQEA 4CRSA 1JLUE 2W1EA 3D15A 2B52A 2UZEA 3CR0A 3ZLWA 3OROA 4CFXA 3F7ZA 4YBKA 3TXOA 4IZAA 2VTJA 3BI6A 4C37A 4QTCA 2GNLA 3GFEA 5M07A 5IA4A 2VWBA 5E1EA 4YURA 5GIPE 1TVOA 3QZFA 2AEGA 4DFBA 3PE2A 3QUPA 5ETFA 2PU8A 3EKKA 4TZRA 2QKRA 3RPSA 3SVVA 4FIIA 1Y6AA 5CTPA 4ZLYA 4FV5A 2UVYA 5AX3A 4RFYA 3QTXA 1ZY4A 2R0UA 4PDSA 3FKLA 4IAZA 4O0RA 4YZMA 5AFVA 3VS5A 3EB0A 5AUXA 2XRWA 3DTWA 4RVTA 4IB5A 4KRDA 4AGUA 2QOHA 4RJ6A 3LM0A 4PL5A 2XS0A 3HP2A 4NFNA 1XO2B 1MQBA 3MPMA 4HJOA 4RGJA 3PJ3A 5FLFA 4DBXA 3GC7A 4FSUA 2GHMA 2E9PA 3BGQA 5HVYA 1NT2A 2O63A 4AX8A 4BJJB 3GU5A 4U97A 3NUSA 3R8ZA 4IDVA 3V5LA 3QXOA 5H8EA 4A4LA 1YHSA 3KCKA 4F9BA 2OJJA 2C6MA 3KU2A 4EKKA 3TKHA 4P90A 3ROYA 3JS2A 1QPJA 3BWFA 4YMJA 2HZIA 1UU8A 2XIYA 3LJ1A 5CQUA 5JQ5A 4EOPA 5A4QA 1HCLA 4AWIA 5HORA 2P4IA 2WQBA 2ZM1A 2LAVA 3KB7A 3C9WA 3IO7A 2JGZA 4CQEA 3NYXA 2W5HA 3W0MA 3E63A 4A07A 4HGEA 3RAKA 3ENHA 4BDCA 3H0ZA 1ZYCA 3DBDA 1FMKA 4FIGA 3SX9A 3VBTA 4F99A 2QO7A 1GZ8A 4J71A 1OI9A 4FBXA 4XG2A 4UZHA 5L6PA 4LUDA 1UV5A 3RWPA 3R1YA 1Q61A 5A6OA 2X7FA 2BALA 4XG6A 5LVMA 1OZ1A 4D0XA 3DLZA 4WHZA 3W2RA 2UW7A 3FL4A 4I4EA 5HX8A 4BTJA 2YAAA 2VTTA 5AIKA 3HECA 2XZSA 4AGCA 1K2PA 4C2WA 2W1DA 5HG7A 4ITJA 3ZC5A 4B4LA 3KRRA 4HVGA 5CXHA 3MIYA 2UZLA 4BBFA 3CTQA 4BI2A 2UW0A 2X2MA 4UWBA 2YIRA 3OTUA 3FZRA 3T8OA 3G51A 5B2KA 4GVJA 4O81A 3Q4ZA 5JK3A 1PKGA 4FKVA 2CN5A 2BKZA 4DYMA 4MQ1A 4YO6A 4UX9A 2WNTA 3AD4A 3P08A 3QYZA 4FV2A 4U7ZA 4Y72A 1KE8A 5C01A 2F57A 4BKJA 1OL1A 2EB2A 5EG3A 5TO8A 4EH6A 3ORXA 1PXNA 3AMBA 4NW6A 3R8LA 3TTJA 2P0CA 4MD7E 3EQBA 3KEXA 2C5OA 2X9FA 3SV0A 4PTCA 4X0MA 3Q3BA 3TKUA 1R0PA 2A2AA 4FTRA 2R3IA 2WTKC 4FTMA 1OITA 4O7SA 5HI2A 2GQRA 4NH1A 4GJ2A 3C4EA 3KMWA 4GYGA 3THBA 3W32A 3TM0A 3AGLA 4ZTSA 3WZUA 3ZZEA 5JZJA 4PDOA 5JSMA 3CP9A 2AC5A 2PZIA 3HDNA 4O0VA 2FSMX 3UJGA 4OTGA 3T3VA 3FL5A 3ID6C 3GU8A 3FLZA 5DH3A 3UO4A 2J4ZA 3MI9A 3EFLA 4LOOA 5CT7A 3TUCA 4C36A 5IA1A 5CF6A 2VAGA 2NNWB 4G5PA 5E91A 3FSKA 2R2PA 3DKGA 3CLYA 2VWZA 4YJSA 5DBXA 3FZPA 3VS3A 4I0TA 3U9CA 2G15A 3DOGA 2OZOA 2YWPA 3GOKA 4JOAA 4WRGA 2XIZA 1Z5MA 5EYKA 5TKDA 2GMXA 2Z7RA 4RJ7A 5E90A 5EOBA 2XAMA 3QGWA 1PHKA 1F3MC 4AZWA 4AOJA 1R3CA 4LRKA 4TNBA 2C5XA 3TIZA 4EZ7A 3LMHA 1KUTA 3G9NA 3F82A 4JAJA 3GENA 4U6RA 3EN6A 3MSSA 3IQ7A 2PUNA 1OL7A 2Z2WA 2ZB0A 4XG8A 3BGPA 4Q5EA 4RIWB 2R3HA 4RX7A 2ZAZA 5DYJA 2W05A 2ZVAA 4QP4A 3F88A 4ACMA 1OL5A 5AWMA 4DEBA 1OIUA 2VGPA 3AMAA 1YI4A 3HUBA 4YO4A 3G2FA 4DHJA 4F0IA 3DQXA 4EK6A 4M12A 3ZONA 4F78A 4EJ7A 2HIWA 2QOQA 4TN6A 1OPKA 4CFFA 4I94A 5FQDC 2ZM4A 2VTIA 3N9XA 3C13A 3TUBA 1I09A 2IWIA 5CY3A 5JGAA 3KN6A 2ACXA 3NRMA 3QCQA 4G3EA 4O7YA 4U3ZA 5J8IA 5KMJA 4U41A 1OPJA 4YZDA 5BUJA 4X3FC 4USDA 3E7OA 4EKLA 4QMUA 2B54A 4O7WA 3I81A 3W2SA 2UZBA 1PYEA 5JGDA 2CKPA 2ITZA 3A4PA 4QMWA 2VNYA 1XHAA 2DYLA 3C5UA 4FTCA 4ZJIA 3OVVA 1T45A 2I0HA 4C4HA 1BI8A 2Z02A 4HPTE 4M13A 4DGMA 4FTLA 1RQQA 3QRIA 2H9VA 4FTQA 3DFAA 3EL8A 4GL9A 1WZYA 1MRVA 4RSSA 2UVZA 3ACJA 4CNHA 3AKLA 4QPSA 1IEPA 2BIYA 4L53A 3RZBA 2VWXA 2WHBA 2UZUE 4FKSA 4EK5A 5B2LA 4JG8A 2BAQA 2JITA 4N4SA 2WMXA 5KHWA 2WMRA 2IZTA 2QOLA 4IDTA 4U43A 1ZYSA 5M44A 3DQWA 3OC1A 4JRNA 2WMUA 2A27A 4FTAA 3H9RA 2E9NA 4I6HA 4D28A 4NKAA 3U6IA 4N70A 4RRVA 3B2WA 4GS6A 3K2LA 4QTAA 3RPVA 4BCQA 2C3JA 2RG6A 4LL5A 5C4KA 5JT2A 2XK7A 5HIDA 5IQIA 2WMAA 3DCVA 3KVWA 4PNKA 2UW4A 3O8PA 4O2ZA 1ZOEA 3TTIA 3JUHA 1GOLA 3PIZA 5LMBA 2W1IA 1YI3A 2PVNA 1JAMA 5EW8A 2ZOQA 3OCGA 3NLBA 3IW8A 3LFQA 2XJ2A 4AXCA 1KE9A 4BYJA 3PJ2A 3DK3A 4IWDA 4IZ5A 1PMEA 3F66A 4GT4A 4AA0A 2W1CA 5EDPA 4BY9E 2J0IA 4FKTA 3GU4A 3BCEA 4WOVA 5CSVA 4HVHA 5DN3A 2WQMA 4FNYA 3W2QA 4BGGA 1YOJA 3FC2A 2OLCA 3LFEA 2ERKA 4JR7A 2VTQA 4QYYA 2BTRA 5F20A 4O0TA 4R5YA 4F0GA 1G3NA 3QALE 4BCJA 2BRNA 5BVWA 4FIJA 1GJOA 5IA0A 3DKFA 2RG5A 4IVAA 2WMQA 3EN4A 3QD3A 4RBLA 1OGYA 3QCYA 2JIIA 4XLVA 5IEVA 1SYKA 2W1HA 5KMOA 3KXMA 3OT3A 4FTTA 4I21A 1P14A 3AC5A 3QKLA 4GV1A 2PMLX 4FA2A 2OJ9A 3K5UA 4A9TA 1AGWA 5ETCA 3FZSA 4FK6A 3COMA 3RPRA 2JKMA 4U40A 3LFSA 4FKGA 4ZIMA 3V04A 3VUHA 4B8LA 5ANEA 3VWAA 4E4MA 5CNOA 1YI6A 3QYWA 4L7FA 3VUMA 2XRUA 3UG1A 3QRJA 4FT7A 1YQJA 3M1SA 4PRJA 5HO8A 1PXMA 1CMKE 3PPZA 3OF0A 3ULIA 4ZTRA 1REJA 3F2RA 3FZOA 3RHKA 3COIA 4MBJA 3GP0A 4APPA 3OY3A 5LVNA 2CCIA 2B4SB 4MKCA 3VUKA 4F7NA 5HICA 5IZFA 2PUPA 2IW9A 3FV8A 3TKIA 3GCSA 2Z7QA 3HA6A 4U42A 3TV4A 4CFWA 5IQGA 4NL0A 4TYEA 5M4UA 3UIUA 4DTKA 1BMKA 4FKQA 4G1WA 4R7IA 5JGBA 1CTPE 2GQSA 5JFXA 3UOHA 2J5EA 5BYZA 4ZY6A 3R7OA 5FGKA 3RCJA 2XK9A 4IX5A 4CMUA 3P7CA 5C9CA 3U55A 4F6UA 4PL3A 3D5XA 5J1WA 5CENA 1M52A 2F2UA 5A3XA 3OWLA 5A14A 3QZIA 2O65A 3GNIB 1R1WA 2O8YA 3QC9A 5KMNA 1BX6A 3F69A 3FLSA 5AV0A 3P1AA 2UW3A 1PXKA 4IWOA 4W4XA 3UQCA 4GCJA 3ZSHA 1OL2A 2XNBA 5EYMA 4FEXA 2P2IA 3NNWA 4MUQA 2QC6A 3I4BA 3NNXA 3BYOA 2PTKA 4MNFA 5ICPA 4AGDA 3K5VA 5KNJA 1H01A 3ORLA 1BLXA 3C50A 5EHLA 4GK2A 3PUFC 4FSMA 4IX3A 3RJCA 3ZEPA 4EOMA 3C4ZA 4I22A 4P2KA 3NUYA 4YJRA 4MAOA 2XB7A 4ACCA 3D7TB 3WZEA 5CF4A 4FJVA 5CQWA 3S00A 5CSPA 4XS2A 4F70A 1LEZA 3MA6A 2R9SA 3KQ7A 3BHTA 1YRPA 5CT0A 2HW7A 4HPUE 3ZBXA 4XRLA 3NIEA 1RDQE 3F6XA 3DAKA 2WO6A 3MVJA 2OKRA 3PDTA 5FP5A 4IJ9A 4JIAA 3VUGA 4ASZA 4EOLA 4AZEA 5K9IA 1OUKA 3F9NA 3NAYA 4FYNA 1JNKA 1XH6A 1F5QA 3A8XA 4J99A 3S3IA 4EL9A 3SW7A 4HCTA 2JIUA 5F95A 3O17A 4XG4A 4ANMA 2FSTX 4D2RA 4DAWA 4AXFA 3CSVA 1JVPP 2J9MA 2VWIA 3FI2A 1YDSE 3LQ5A 1APME 3FLNC 3S95A 1OM1A 3DS6A 2VZ6A 2HY0A 4RQVA 4I0RA 3H4JA 4ACGA 4EH2A 2PMNX 4K33A 4KD1A 2IO6A 1E1VA 2OICA 3D94A 3TZ7A 3SOCA 3FMHA 4JR3A 3ZDIA 4D9UA 4RC4A 5DWRA 3AQVA 4WIHA 3R8PA 4TY1A 2R4BA 4IMYA 2IW8A 5CAOA 3HRBA 3SLSA 5EI2A 5I9VA 3FMDA 4KINA 3E93A 4H1MA 3ZXZA 2OJGA 5DGZA 2QLQA 3MS9A 4CTBA 4ZTHA 4ASDA 4U45A 2BMCA 5A4CA 4HYHA 4QOXA 2J51A 3KRLA 4EBVA 3PIYA 4WNMA 4CKIA 3N4UA 4TYJA 5CSXA 4C4EA <