5M06A

Crystal structure of mycobacterium tuberculosis pkni kinase domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
245
Chain Sequence
b'MALASGVTFAGYTVVRMLGCSAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHRDVNPANVVLTSRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDRSLQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PknI
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Signaling protein
total genus 75
structure length 245
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m06A01
1PF8A 4DE4A 3BRBA 4ZSEA 2UZLA 4PUZA 1Q8UA 1WVYA 3UMXA 1H0WA 3F7ZA 5CXZA 2ZMDA 4GT4A 3FQEA 3FSFA 4QNYA 4QT1A 2JKOA 2W0JA 2I1MA 3R83A 4YNEA 4LOQA 3MBLA 3UQGA 3WILA 4FEWA 4TWOA 2ZVAA 4FICA 4AZFA 2XA4A 3LQ5A 4L42A 3Q9XA 1U5RA 4LQMA 4JQEA 1PXLA 2R3LA 4W4YA 5FP5A 3RMFA 4USEA 3Q9WA 4BDIA 4NK9A 3UG2A 2BILB 4NM5A 4FNYA 4HGEA 4I6QA 3KXMA 4FT9A 4CKIA 4W8EA 2O65A 4FSWA 3ZTXA 4NM0A 3CTQA 4HGSA 2HOGA 4ASZA 2VWXA 2NO3A 2VD5A 1ZOHA 3GT8A 3A8XA 2Z60A 3LW0A 1FINA 3Q04A 5I9YA 4Z55A 2JDSA 2OLCA 3C50A 4FGRA 4QYYA 4PRJA 4CLJA 2ITXA 2XK4A 1ATPE 2XVDA 3UNKA 3R00A 4D1XA 4BCMA 3DNEA 3OCSA 3LJ2A 2B9HA 3HECA 2JAVA 4E8AA 1SYKA 3DTWA 5IF1A 4IAKA 4HVHA 3TJCA 4I94A 4YBKA 3VF8A 3UOLA 3EQGA 4PL5A 3DCVA 4XP2A 3NMUF 3D5UA 2W7XA 3QTRA 4R1VA 4RWJA 3K3IA 5J9ZA 4JX3A 4O6EA 4FI1A 1JSVA 3E7OA 3WYYA 5HQ0A 5HHWA 5HG5A 1YVJA 1Q97A 4YJNA 4E6AA 1F5QA 1SVGA 3QTUA 4UB7A 4GFGA 4XYFA 4B8LA 4FMQA 4GSBA 4OT5A 2XJ2A 4RBLA 1H01A 4BBMA 3ZLSA 2WMWA 1OMWA 5EYMA 4XRJA 3V3VA 5DEWA 5EI8A 4HVSA 4BYIA 2PE2A 3LCSA 4DG2E 5K9IA 3ACJA 1JSUA 3L8SA 3S00A 4MBJA 3HLLA 3AGMA 3C7QA 4GT3A 4KWPA 4AS0A 3ATTA 4XG8A 3EJ1A 2QG7A 4FEXA 1ZZLA 3E3BX 4ARKA 5BUEA 2C6MA 3GU7A 3KXNA 3R8LA 3R30A 3GFEA 2QU6A 5ANDA 3W10A 5HLNA 3MIYA 4QP2A 4YJSA 2YJSA 2WOUA 4OLIA 2ACXA 5FGKA 5K3YA 4AZVA 3WZEA 4DGGA 4QTCA 4HJOA 4C35A 1BKXA 2HY0A 4AXAA 3FZPA 5FQDC 4G2FA 4YJTA 3IW4A 1S9IA 1PMUA 3NCGA 5AP1A 4F63A 1M17A 3LKMA 4FTOA 3OY3A 4KBKA 4GT5A 4FK3A 3U8WA 2GS7A 2Z7RA 4TYHA 3C4CA 3UC3A 3MY5A 4IVDA 4RJ3A 4AN3A 4IWDA 4TYIA 4QP4A 4O0SA 1OITA 2BAKA 2QOBA 4II5A 2ZM4A 3E7VA 4IAZA 3A61A 2YITA 4YP8A 2JBPA 2QURA 3V5TA 4JQ7A 3FMEA 5LWNA 5M56A 1BL7A 1PXIA 1XH4A 3M1SA 2XK7A 3CE3A 5EQPA 3VVHA 1FMKA 2VTPA 1QMZA 3LFCA 4PV0A 1DI9A 1OUYA 3H3CA 3TIYA 4EHEA 5JK3A 4L3PA 4XG4A 5BNJA 2BTSA 4TKSA 3VBXA 2GNJA 5AIKA 1WBTA 3IS5A 2QR7A 4ENYA 2HZ0A 3ZM4A 1AQ1A 2XKEA 3UIBA 3WF6A 2GS6A 2WGJA 4FIHA 3V5QA 2GQRA 3ZBFA 5KKRB 3KB7A 4AX8A 3F2NA 4R7BA 5E4HA 4GW8A 3IW6A 3A7FA 2QLUA 2OFUA 2JFLA 1YHSA 3E63A 3OOGA 1FOTA 3ALOA 3BYUA 4WO5A 5CZHA 4B6LA 1G8SA 3L9PA 2PYWA 3I60A 3QZGA 4TPTA 2OKRA 3E64A 3C51A 4GL9A 2CGUA 1UVRA 5JFXA 3PTGA 4C4JA 3ZZEA 3NUSA 3KY2A 2QOIA 3KXXA 5HVKA 3S1HA 4GJ3A 2UW0A 4GMYA 5LMBA 3FXZA 3V04A 5IU2A 4DCAA 3NNWA 2YCQA 4EH8A 2VX3A 3A7JA 2GTNA 3PJ3A 4FZAB 3HDMA 3DBEA 1MP8A 3FUPA 4ID7A 4WOVA 5LMAA 4EONA 5JSMA 2OJFE 1WZYA 3O50A 5CANA 2R3JA 4GYGA 3QYWA 3QTZA 2YZLA 3ORMA 4BCGA 5M09A 1XWSA 3NNUA 3F5GA 4I5CA 3V8SA 2YDKA 1YHWA 1R78A 2BUJA 2W9ZB 3VF9A 3R7YA 4FV0A 4UZHA 4EZ3A 3R71A 4FSUA 3LM0A 5CU4A 4ITIA 2EVAA 3LFEA 3MH1A 3MFSA 5DFPA 4DHFA 3SHEA 3CGOA 4TTHB 3U9NA 4AF3A 3ZRMA 4BDCA 4HPTE 4L68A 4MTAA 4FT7A 4S2ZA 4BN1A 4CD0A 4FSNA 2WFYA 3VBYA 3PSBA 4O91A 2BKKA 1CKIA 1SM2A 2YCFA 3FHIA 3HZTA 4FNXA 3OW3A 5HD7A 3PZEA 2C6IA 1H24A 4MBIA 4TNDA 4QP3A 1YDTE 4ZSLA 3R7OA 4FKJA 3RK5A 4YURA 1PRYA 2UUEA 3I7BA 3FL4A 3MB7A 2CJMA 3R9DA 4EOQA 4DEHA 2RKUA 3TV7A 2BDJA 4FNWA 3VS1A 5HO7A 2X2KA 3U6HA 5A4EA 4IWQA 4FV4A 2ZJWA 4FV2A 3RAKA 3HMIA 4C33A 3FV8A 4AG8A 1H08A 3MN3A 3R9NA 5M06A 3IDCA 3ZXTA 3MFTA 2O64A 2W4OA 2O2UA 2GNHA 4ZP5A 4YC3A 4AW2A 3QF9A 2OZOA 2JDTA 3ORPA 5I9WA 3JYAA 5IEYA 3TUCA 5K4IA 1YXXA 2FVDA 2OSCA 2R3KA 5D7VA 2WZJA 2JKQA 3EFJA 3FE3A 1SNXA 2XNBA 4YTFA 1GAGA 5AFVA 3PIXA 5GJGA 4EHGA 3JVRA 1XO2B 1YI6A 4FTNA 3BWFA 3TG1A 3ZLYA 3P08A 4DEGA 4FIFA 3R8UA 2W4JA 4E4XA 4O0TA 4YHJA 4BBFA 2XM8A 4X3FA 4D5KA 1PJKA 3KXGA 4KRCA 5T68A 4RWLA 3R1YA 4D2RA 1P4FA 3AC4A 3COMA 3EOCA 1YDRE 3HEGA 4H39A 3NYNA 3PE1A 3QHWA 4O7LA 3I6WA 5ETIA 2YA9A 4ZJJA 3PVWA 4HYHA 4ANMA 4TYEA 2ITVA 4S33A 2RG5A 5BVKA 3LXNA 1PY5A 3GENA 4FL3A 2J5EA 3DZOA 3P23A 1OL2A 5C4KA 4IM2A 5CASA 3JS2A 2C0IA 3ZONA 3EWHA 5DRBA 3EN6A 1RW8A 3OTVA 4AA5A 3F7WA 2X39A 3CIKA 3TNIA 2XK6A 3TT0A 5HGIA 3TJDA 2PVJA 4BGGA 4AGUA 5JFVA 4HNIA 2KULA 3BQCA 4MWHA 4QMYA 5HCYA 2XKDA 4BDDA 2NPQA 2VWZA 5M4CA 4FOBA 2YFXA 2IN6A 3KN6A 5AJQA 4HVDA 3QHRA 4FVQA 2JFMA 3AXWA 4IANA 2Z7QA 4QPAA 4KB8A 3SAYA 4UY9A 3V8WA 3UODA 3A4PA 3FY2A 4JBVA 3ULIA 2YEXA 3CQWA 1KE8A 2EB2A 3PJ1A 5CU2A 1Q62A 4ERWA 5AP3A 3TV6A 4IB5A 5D12A 5CEQA 4H3BA 4ANLA 3QQGA 4FV7A 4DTBA 3CC6A 4FV5A 5M53A 2HCKA 2WMAA 4Z7GA 2RFEA 2BVAA 3KKVA 5CTPA 4BTFA 3ANRA 4IC7A 3BLRA 1M2QA 2F7ZE 3DS6A 5BVNA 3D7TA 4DLJA 2CKQA 3CBLA 2CPKE 4TYGA 3ZXZA 5IEVA 4D55A 4FSQA 1UNHA 2QODA 2R7BA 3R1SA 3W2PA 3B2WA 3ZM9A 3PZHA 4U81A 4FG7A 4BCFA 2PMIA 3S95A 4WIHA 2UW9A 3LMGA 4MNEB 3DBCA 3RCJA 4NH1A 5ITAA 1RQQA 1YXUA 3EYHA 3PG1A 2P55A 4XX9A 1U59A 4M67A 3KFAA 4XUFA 4XS2A 5M4FA 4JLCA 3RPVA 1H8FA 4M0YA 2XKCA 4Q5HA 4TW9A 4QMUA 3RJCA 3WZUA 4C4HA 5BUJA 3GC0A 5DBXA 5HCXA 3QC9A 4UN0C 3G51A 4FTKA 4F0GA 3W2SA 3D5VA 3QGWA 4WUNA 5H8BA 2QOHA 4QPSA 5AADA 2XJ0A 2I7QA 3TKUA 4FUYA 4RFYA 3R1QA 1GZKA 3COKA 2HENA 2HZIA 4TWPA 2IPXA 1SNUA 5F9EA 5ANIA 2LAVA 4ACCA 3DAJA 1LR4A 1OIQA 5DYJA 1CKJA 2G1TA 2OIQA 4IB1A 4IE9A 1ZYDA 1YRPA 5L3AA 1ZYCA 2RIOA 3ID6C 1JAMA 5E90A 4ITJA 4FYNA 2WMBA 3NAYA 4W4XA 1OIUA 3VIDA 1F3MC 2GHLA 4FT0A 3LVPA 5GHVA 4IZAA 3KU2A 3WZJA 4BYJA 4EOJA 3PY0A 5LOHA 2Z8CA 4RIWA 2BALA 1SVHA 2X9FA 4C7TA 4YSJA 3PRIA 4HCTA 5J7HA 4YLLA 2PUIA 3FZ1A 3N9XA 2ZMCA 5EOBA 5KMIA 4Q2AA 4AACA 3DQXA 3L8VA 4OBOA 4RIYA 4YO6A 2UZNA 2IZUA 3KRRA 4ALVA 1Y8GA 5C26A 3O51A 4R78A 4D4VA 3EKKA 4I23A 4MWIA 3NVMB 5CU6A 2CCHA 4AQCA 3AC3A 1SVEA 5AX9A 2W1EA 3DB6A 4L43A 3EYGA 4QQJA 5HX6A 5M08A 5M57A 3RVGA 1T45A 3K5UA 3PLSA 3GBZA 4U40A 4DH5A 4DTKA 3FZTA 5IQAA 4MXXA 3R6XA 3TTIA 3R73A 4XLIA 4UALA 4DT8A 2J2IB 2QKWB 4QMXA 4BDKA 1KE9A 1OKYA 4Z9LA 4ZLZA 2C3KA 5AUUA 4O0YA 1Q5KA 4EZ7A 3TUBA 4BRXA 2BDFA 4IB3A 5HE2A 4QMPA 2BZJA 3PA4A 4FKUA 2WHBA 3ROCA 4GK4A 2I6LA 3PSDA 5IA2A 5IUIA 3AQVA 3OFMA 3QTIA 2X8EA 1BYGA 2OI4X 5FBOA 1Q8ZA 3EL7A 4JDJA 1H27A 3FSKA 2X7OA 4U9AA 2PVNA 4RX9A 4E6QA 3MH2A 1FGIA 1UKIA 3EL8A 4BTMA 2EWAA 4Y85A 3PYYA 4FKGA 5HIBA 1Y6AA 2YIYA 2VTOA 3CP9A 2J0JA 3KULA 5KO1A 3UDBA 4LUDA 2E9OA 4NWMA 4BDHA 1OPKA 3BWJA 4QP9A 3QRJA 2OXDA 4I93A 2OXYA 2XCHA 3PVBA 3G0FA 3O96A 3ZHPC 4DF3A 4DG3E 4GEOA 5A3XA 3R9OA 2VTRA 5IMEA 2WIHA 3ORLA 4QYEA 3SGCA 2WD1A 1WMKA 3W2CA 4RRVA 4NW5A 5FM3A 2BZIB 4IDVA 1Q8TA 3GB2A 1P2AA 3R28A 5JH6A 4WT6A 4I0RA 4LYNA 3E88A 3RWQA 3KF4A 4ZLOA 3E87A 4QMLA 5LVLA 3KQ7A 4Q9SA 1XR1A 3BGPA 3ELJA 3GC7A 3BHVA 3EHAA 5DOSA 4A9SA 2P2HA 5CEMA 3OWLA 3GCVA 2OJ9A 4AOJA 5AUTA 4R7HA 1W98A 4ZSJA 4XH6A 1NW1A 2PVMA 2C3IB 2QQ7A 4YZBA 4YZMA 3SW4A 5LCKA 2HY81 3UQCA 4KIPA 4D1ZA 3REPA 4HGTA 1CM8A 1WBWA 3FC1X 4RA5A 5L8LA 4CRSA 4FL2A 4V0GA 2A4LA 3MW1A 4M69B 1YOJA 5C4LA 5KMMA 4X0MA 5EM5A 3D14A 1IA8A 5EDPA 3TTJA 3T3UA 1ZYSA 2QNJA 2H8HA 4RC4A 2P33A 3EN5A 4QTDA 3L9LA 1LUFA 1V0PA 3FDNA 2UW3A 3CPCA 3I7CA 4HZRA 4XG2A 4Y8DA 4YHFA 2VX1A 2C5OA 2W99B 3A60A 3EFLA 3R22A 2HWOA 3HAMA 4MXCA 4EHVA 4KBCA 5BVWA 1KWPA 2ZV8A 4RFZA 3JY9A 3MESA 4D58A 4PL3A 5M4IA 4MD8E 1H07A 4O7WA 5A4QA 5J5SA 2XUUA 3EQCA 3EQRA 1H00A 4EK6A 3LLAA 5CNOA 5BQ0A 3NGAA 3C1XA 3SD0A 2UZDA 3QD0A 1PMNA 5FM2A 2OO8X 5B7VA 4ACDA 4EH2A 2WTDA 1SMHA 3MV5A 4RQKA 2IZRA 5AUYA 5HEZA 2WMUA 5ETFA 2W1FA 2ETRA 4FSTA 3DB8A 3KK9A 3ETAA 3LXLA 3LFFA 2GNFA 3KC3A 3QCQA 2X2LA 4OTRA 3PFQA 3QTSA 4IAFA 3F82A 2ITOA 5HX8A 4BICA 3DU8A 4BCJA 1MRUA 3RK9A 2VWVA 4KD1A 5J9YA 4BZNA 3MH3A 3QC4A 4RC3A 4CTCA 4FR4A 5JN2A 4EWHA 2OW3A 4UWBA 2QKRA 2V22A 5EDRA 2QI8A 3LCTA 2WO6A 2OZAB 5DR2A 3DAKA 4I4FA 2VTAA 4WBBB 4X2NA 5JKGA 1MQBA 3WF9A 4R3PA 1JKLA 3VAPA 4C3PA 3FMDA 3WYXA 3GU8A 4Y95A 3FZRA 4BVUA 4MX9A 4YZDA 3ANQA 4FV3A 4L7SA 2JIIA 1FVTA 1ZLTA 4FEUA 3RM7A 1UNLA 2VTQA 3ZMMA 3FPQA 5TT7A 4DGOA 1UWJA 3FZSA 4EORA 1W84A 3D2IA 5L8JA 1O9UA 4ANBA 4HVIA 3ZRKA 5L8KA 4D28A 5BMSA 4N6ZA 4FSMA 3PG3A 4FTLA 4FTTA 4WD5A 2CKPA 3PXYA 4RPVA 3EQFA 2VNWA 1WVXA 1ZZ2A 4F09A 3PP1A 5DE2A 4H05A 4F1MA 4ZY6A 2JEDA 4BDJA 1H1RA 2BFXA 2XM9A 3NW7A 4EKLA 4AA4A 4S31A 1NY3A 5E7RA 3QQFA 4XG6A 4P5ZA 3CLYA 3EZVA 5L6OA 2OGVA 3SA0A 5DIAA 1I44A 3BHUA 4HGLA 3VW6A 3ZO4A 4DA5A 3ET7A 3PPKA 3O17A 3MTFA 2VTNA 4EH5A 5HNGA 2C5XA 2W5AA 3AGLA 2R3QA 4BHNA 2YWPA 2JIVA 4NCTA 4OBPA 2IVUA 5E9EA 3SRVB 4C34A 1Z5MA 3PP0A 5L2TA 3AD6A 3RHXA 2YIXA 2ZDTA 3LM5A 3V8TA 1XH9A 3THBA 3UPXA 2GHGA 4K2RA 2PHKA 1CDKA 4IMYA 4KNBA 3PWDA 5DEYA 5AP7A 3RGFA 4D0WA 5IMXA 2R64A 5L2WA 1OBDA 4D1SA 2Y4PA 4EJ7A 4PL4A 4D4SA 3KGAA 1OL6A 1VJYA 5A9UA 3O2MA 3OW4A 3C0IA 3KXZA 2GQGA 4M8TA 4O21A 3HRCA 4F6WA 4P5QA 3ORXA 5BYZA 4ZJVA 2B0QA 1JWHA 2XP2A 4BB4A 5E8ZA 4P90A 4USFA 4NKSA 2XCKA 4XRLA 4CFUA 3LLTA 1EH4A 2OBJA 3A99A 3FI3A 1CKPA 2R9SA 4IX4A 4QYGA 3GOKA 4PP7A 3I5NA 4NCTC 2BRGA 2V7OA 2ZB0A 3GU4A 1ZMUA 1O6KA 3NIEA 2YCRA 4V04A 2E2BA 2BR1A 2C4GA 2XK8A 4IZ7A 4EK4A 4JBPA 5CI6A 3U9CA 4J8MA 5CAVA 1TQIA 3AMAA 1JSTA 2F2UA 2IW9A 3Q9ZA 1QPJA 4OTFA 2X6EA 1R1WA 3P86A 2BKZA 4O96A 2BZKB 3OHTA 5EG3A 4Z7HA 4AE6A 4BY9E 2DYLA 5I9XA 3ZZWA 4EOPA 2FSLX 5HBEA 2V0DA 5A6NA 4L44A 4IADA 5F20A 4IAYA 1XKKA 3LZBA 4NU1A 3BBWA 4HYUA 3HV5A 2PVLA 2YJRA 4ZLYA 4ZOGA 4JG7A 2C30A 4ZZNA 5CXHA 2X0GA 4EJNA 1UU8A 4I21A 3LFSA 3MI9A 3QZIA 4E20A 1OIRA 3PXKA 5DI1A 1PXPA 3RK7A 3AT4A 1Q8YA 3FMMA 4GVJA 3Q5ZA 5CSHA 5KX8A 1KE6A 1P5EA 2E9VA 4E73A 3BLQA 1Q4LA 4JRVA 2C5NA 2W9FB 3DBQA 2PZRA 4FKIA 5C8NA 2B1PA 3CXWA 4IDTA 3RPSA 2UVXA 4BC6A 4D5HA 2WEVA 3IG7A 4N57A 2ZV9A 1XH7A 5FEEA 1XBBA 5HG9A 4QTEA 4ALUA 1IAHA 4RJ6A 3KF7A 5C8KA 2CCIA 4G31A 1K2PA 4M13A 4N4SA 1GIIA 4PX6A 4YSMA 3PSCA 3WZKA 2ZOQA 3FLSA 4UWCA 3DXPA 4KS8A 3HL7A 3NPCA 3V6SA 3R2YA 4RZVA 3R2BA 3VBVA 5IA3A 4EUTA 3HV6A 4TXCA 3VS3A 2UW6A 2VO0A 4PP9A 4WNOA 4EC8A 2BHHA 3I0OA 5F95A 4HYIA 3F66A 4EH7A 5ANEA 2VU3A 4PNKA 4BTJA 4NTTA 3SV0A 3UQFA 4GCJA 4L01A 3QRUA 4JT3A 4G34A 5HESA 3CQEA 4JS8A 5TKDA 4G5PA 4FTUA 3KXHA 4R3RA 1L8TA 2B53A 2B4SB 5EHYA 4KBAA 2V62A 4MBLA 3IDBA 4C38A 1J7UA 2R3FA 3BGZA 3FY0A 3FMHA 3FI2A 5CVGA 4GJ2A 2PVFA 2O63A 1KE7A 3QLFA 2UVYA 5JZJA 5A4CA 5KCVA 5M51A 4A4OA 2WKMA 2VTLA 4L3JA 3CGFA 3MVJA 4BCPA 3QZHA 3M11A 4JNWA 3C4FA 5FEDA 4BI1A 4U43A 1G3NA 1OI9A 3IGGA 3JVSA 3F5UA 2JGZA 5J95A 3P78A 4DT9A 3N4TA 3U54A 2YWVA 3EN9A 4CKRA 4EBWA 4QMNA 1PXNA 2H34A 4JQ8A 1OGUA 3MFUA 4BGQA 4LOPA 3DDQA 3TKIA 4AZEA 2CN8A 4BHZA 3AC1A 4XP3A 4O0WA 4EH4A 2CGWA 4XJ0A 4O2ZA 5DVRA 1XBAA 4CFXA 1ZOGA 4TYHB 4ERKA 3I6UA 3K54A 4RVKA 2HELA 3FC2A 1OL7A 3EQHA 2VV9A 5FBNC 3OS3A 2XZSA 3CR0A 2ITQA 3WBLA 4RGJA 1ZRZA 2C1AA 2IVVA 4RA4A 3DBDA 5I9UA 4IX6A 3POOA 3NCZA 3QRTA 4U44A 4UX9A 4GS6A 5I0BA 3T3VA 4DCEA 5FXRA 1H0VA 3P9JA 2VWWA 5AEPA 1IR3A 4R5SA 3UOHA 3UVRA 4YBJA 2WEIA 4TNBA 1PMVA 2CHLA 5E8XA 1YWRA 5FTQA 3UVQA 2B52A 3C5UA 3R04A 1ZY5A 2R3IA 2BIYA 5CSVA 3DLSA 3HV7A 4L46A 4KUJA 3UTOA 4KKHA 1K3AA 4IVAA 4Z16A 1R3CA 1R0PA 4FIIA 4B0GA 2OJGA 1IA9A 4FKWA 4HOKA 4DFLA 4QMSA 5JGDA 3WIGA 3U51A 4BIBA 5J9LA 4AT3A 4J53A 4G1WA 3AMBA 3COHA 4F65A 4JIAA 3O8UA 1PXJA 2BTRA 3P7AA 2JLDA 4M7IA 2RGPA 4CG8A 2VTMA 3FLNC 4X21A 5JRSA 3PY3A 5JQ5A 5FDXA 1LEZA 2Y0AA 4J97A 2XYNA 5KE0A 5LVNA 4JX7A 4H1MA 3MY0A 3ORKA 3Q60A 4YJPA 5EKNA 3OBJA 4GK3A 5JGBA 2WMTA 3GNIB 3F88A 5CEPA 2ITZA 3GUBA 2QOQA 2Z2WA 3PWYA 5EQEA 3SVVA 3BI6A 5CVFA 4AGCA 4ZTSA 5KBQA 4ZS4A 5KZ0A 2YIWA 2XIKA 2GDOA 3CSVA 4KKGA 4CFMA 5ICPA 5LQFA 4GH2A 4M0ZA 4FZFB 4PQNA 3SOCA 3Q4CA 4AW0A 2WTVA 3BHTA 4O86A 1H1PA 2QHNA 5H8GA 5ANKA 3DFAA 4QQTA 3FLQA 5CQUA 4FKVA 2V7AA 5KKRC 2RFDA 4R7IA 5FXQA 3Q2JA 4RVMA 1W7HA 3R1NA 5I9VA 3SC1A 2WQEA 4LMUA 4LI5A 2CGVA 1F0QA 1PXMA 3UYSA 5B2MA 2XNMA 5IISA 2YM6A 3UJGA 3W33A 3F3ZA 4I1ZA 3BYMA 1HOWA 3OD6X 4L8MA 4QMMA 5JMSA 3D9VA 4AE9A 4BZDA 5IG1A 2R7IA 4XLVA 2XIXA 3MVLA 2QLQA 2J51A 4YU2A 3TCPA 3GVUA 5KNJA 3VS7A 5FG8A 1YWVA 3ORNA 3E93A 3EQDA 3OTUA 4OTQA 4CFNA 4TY1A 4C3FA 5D10A 2OFVA 3I79A 4FG8A 3HV4A 2ITPA 1UV5A 1UNGA 4CNHA 3A4OX 4IM3A 2HXLA 5CENA 4C36A 3P0MA 5LMKC 1UU7A 4AT5A 4OTHA 3EMGA 4FTAA 5HLWA 3RKBA 4X2KA 4X6RA 4AGDA 1QPDA 3PPJA 3ZS5A 3SX9A 3IPHA 3KRXA 4RJ5A 1PXOA 4OTDA 5DN3A 4EWQA 4WUAA 4FKTA 4NJDA 1H28A 2VNYA 2A2AA 3BKBA 4K33A 4AFEA 4C0TA 1ZMVA 1GIJA 3L9NA 1NT2A 3K2LA 3UBDA 4G3FA 5JEBA 4PY1A 1RDQE 3WE8A 4C4FA 5G6VA 2XIRA 4X3FB 1M52A 2WMRA 3W55A 1ERKA 2OF4A 3GCUA 3BPRA 4NM3A 2FSOX 3PJCA 3TWJA 3GQIA 3CPBA 1KSWA 3DXNA 3A7GA 2XB7A 5D11A 2HZNA 3PA3A 2VTTA 2CKEA 4CLIA 2O5KA 2C0TA 1STCE 2OJJA 4L00A 2GHMA 3U6IA 1UU3A 4XP0A 3FLWA 2WIPA 4MH7A 3D5WA 3VULA 3S4QA 4GG7A 4QMVA 3B2TA 1FQ1B 2VGOA 3H0YA 4G3DA 5BVEA 4A7CA 3NUXA 5E8UA 1W8CA 3KN5A 3MVMA 4QP1A 2NRYA 3EKNA 3UPZA 3MJ1A 4XNEA 3I1AA 3DFCB 1O6LA 1WCCA 4ONAA 3QUPA 4Y5QA 3VHKA 4CTBA 5JFSA 5KMJA 4LOOA 4O7RA 5AUZA 3D15A 3NS9A 4FKLA 3R8ZA 2PK9A 3UNZA 4U42A 4HCUA 3MSSA 4MVFA 4U41A 5EI6A 5FD2A 5DGZA 4NTSA 2XBAA 4H3PA 1PMEA 1PW2A 3NYOA 3FPMA 4IEBA 3W32A 4DH7A 1PKGA 1V0OA 2PVRA 2E9NA 5CT0A 2W06A 2YM4A 4HNFA 4ACMA 3BEGA 3AC2A 4FYOA 5DWRA 3MDYA 3KRWA 1J1CA 3ALNA 5CALA 3SG9A 4IX3A 3HUCA 3I5ZA 2GNGA 2ITUA 3ORIA 3D7TB 3KREA 4KINA 1Z57A 4H3QA 3UZPA 3QWJA 4ACHA 4CV9A 3C4WA 3OT8A 3S0OA 1W83A 4MAOA 4ZZOA 2G01A 4USDA 2X8IA 3VBTA 3OWJA 5HBHA 4JR7A 5M55A 3LJ1A 3OWKA 2VTJA 5FLFA 3EQBA 3HAVA 5DHJA 4E6CA 4XHKB 4Z3VA 3LFDA 3OEZA 5EFQA 3F2AA 3OCTA 2GU8A 2B7AA 4WSYA 3IK3A 2G9XA 3OC1A 2CN5A 4QP7A 2EXCX 4UBAA 3UGCA 3ZCLA 3ODZX 4FIGA 3P5KA 4YC8A 2J6MA 4EOKA 4Q9ZA 3OF0A 1J7LA 3M2WA 3NIZA 5BVDA 4TT7A 2PL0A 2QO9A 4RMZA 4L53A 1AD5A 4KKEA 3PDTA 4I5HA 2YDIA 3NUUA 3VS0A 1H1WA 5C9CA 4B7TA 2ERKA 3R7UA 2UVZA 3TI1A 2IZTA 5AP4A 2VWYA 3DPKA 4QQCA 5T6KA 2XF0A 4UWYA 3TL8A 2XNNA 3UO5A 4ANSA 4YJOA 2PMOX 4FZ7A 1YQJA 4E26A 1X8BA 5IA4A 4FOCA 4JAJA 1Q3WA 2ETMA 4WKQA 5CY3A 5EYCA 4F08A 4LGGA 3EN7A 3DGKA 3QKMA 4C4GA 4BTKA 2IW6A 2WTIA 3NDMA 2V55A 4N6YA 1E9HA 4I0TA 5KMNA 2B54A 2BAQA 4V01A 3DTCA 4YJRA 3PXRA 1R0EA 2PE0A 3M42A 3BYOA 4W8DA 1U54B 1XJDA 1WBOA 1M7QA 3SOAA 4EK5A 3GI3A 2IG7A 4YPSA 5EKOA 4PMMA 3VRZA 3DY7A 1REKA 1K9AA 4MQ1A 2A27A 4I5MA 4L9IA 4C37A 3CS9A 3ZSGA 4GIHA 3TDVA 5CF5A 3ODYX 3VUKA 2HW6A 2UV2A 3D4QA 1JKTA 3NW5A 4ZIMA 3VW8A 1I09A 1WBNA 3P1AA 4W4VA 4DAWA 4GG5A 5D7AA 4E5BA 4F9YA 4F9CA 2OJIA 4C3RA 2HAKA 3TV4A 4QQ5A 4CSVA 3HNGA 2C6LA 1RJBA 4ACGA 2FO0A 4LFIA 4RX7A 4DFNA 5H2UA 3TDWA 5AM7A 2J50A 4NZWB 4KAOA 3D0EA 4GIIA 4YC6A 5EQYA 4MK0A 3FWQA 3FXWA 3Q4ZA 5FRIA 4JDHA 2UZWE 5AAFA 4EYMA 5M07A 4GVAA 1NVSA 2XEYA 2IW8A 3WIKA 5DPVA 2HZ4A 2XH5A 1OZ1A 2WPAA 2J7TA 2W4KA 3C4XA 3NW6A 4G9CA 2IVSA 1B38A 3U6JA 4J96A 2I0HA 1Y91A 2OH4A 1H1QA 5HTCA 4CZTA 5IQCA 3IW8A 3MY1A 3KULB 4PF4A 3RWPA 1UKHA 3NUAA 5KBRA 3ZC6A 5AMNA 2YERA 4K77A 4DG0E 1GZOA 1PYXA 4XG3A 2W1CA 5H3QA 4FV8A 3R9HA 4A9TA 5L2IA 3HYHA 2VTHA 2C3JA 4I92A 5CEIA 1Z9XA 5LARA 3NYXA 2XEZA 2R3PA 3W1FA 4FZ6A 2YZAA 4TN6A 2E9UA 2PUPA 3LFAA 4OT6A 1URWA 4IFGA 4DFZE 4QOXA 2XIYA 3FKOA 2XRUA 5J1WA 3FHRA 4O81A 4F7SA 3FLYA 3HX4A 4L6QA 2WMQA 4HZSA 2VRXA 4R77A 5DLSA 3AD5A 3MFRA 1U5QA 5FTGA 2QOLA 1ZWSA 3BCEA 4LM5A 1TQMA 2EB3A 1XHAA 3P7CA 4FTIA 4WA9A 3OBGA 5A4LA 1OPLA 4GRBA 4BZOA 3FL5A 4EBVA 3PVUA 1BUHA 5D1JA 4BBEA 2GFCA 3VWAA 2WTKC 3ENHA 4D0XA 4V0GB 3TZ8A 2VTSA 2F49A 4LL5A 4YJQA 2B9IA 3QXPA 4CVAA 1JKSA 5IA1A 3CKXA 4X2JA 3PIYA 2PVYA 4FT3A 3LFQA 4PTEA 2Q0BA 2ITWA 3G5DA 1OL1A 4AWIA 5CF4A 4K18A 4DEBA 2C6OA 3HV3A 3NR9A 4O0UA 3CEKA 2R3HA 5E8SA 4EEVA 5HTBA 3OY1A 5C03A 2A0CX 5A46A 2R3GA 1VYWA 4APCA 3O23A 3Q32A 4FODA 2GMXA 3OZ6A 3BEAA 5AV1A 5ANOA 3VHEA 4F0IA 4EK3A 1NA7A 2BRMA 3B8RA 3H30A 2WMVA 2YM3A 2F2CB 3V6RA 5F1ZA 1ZXEA 1YI3A 5JGAA 3OWPA 4UV0A 3F69A 3ULZA 2Y6MA 4JOAA 4O82A 4I4EA 4FZDB 1OIYA 5CX9A 4BGHA 4EHZA 5AWMA 4F64A 1BI8A 2UZBA 5BUIA 5LXMA 1G8AA 2Y8OA 2YCSA 3QALE 5DT0A 4DH8A 1BI7A 4JG8A 5EM6A 3JY0A 3MVHA 2Y4IB 4C62A 3NUNA 4F99A 5FDPA 4MF1A 3EQPA 4KRDA 4LL0A 2IO6A 4CCBA 3QXOA 3Q53A 3KRLA 3WF8A 5M4UA 2XKFA 1CSNA 2YACA 1Q24A 2CKOA 3LAUA 5KMOA 4J71A 2R0UA 4O0RA 3TNPC 3UVPA 2W1ZA 5IQFA 3TNQB 2WMSA 1OUKA 4O6LA 5AV2A 3RAWA 4WRGA 1M2PA 3FI8A 4DBNA 4FKOA 1TQPA 4F1OA 3VQUA 2QHMA 2YDJA 3BE2A 5DNRA 4RLKA 2E9PA 4QMZA 5BMMA 3OUNB 3KVWA 4D9UA 2XYUA 4TWNA 4J99A 3HRFA 2IZSA 2QCSA 3I0QA 3QKKA 4ZAUA 4F70A 2GFSA 4PDYA 1ZARA 5IA5A 1H25A 5AAGA 3PVGA 3QD2B 1ZAOA 3C4EA 5A14A 4CMTA 3LFNA 5IQEA 2J0LA 3GCSA 1OPJA 3ITZA 4RIXA 5BPYA 4E1ZA 5JQ8A 2CNUA 3GFWA 3QQJA 4JXFA 1OKVA 3DK6A 4XOYA 5KMLA 5HNBA 3UC4A 5HE3A 1FGKA 5H8EA 3RAIA 1P4OA 3TZ9A 4GYIA 4ZMEA 3GOPA 2X2MA 4FVPA 4E93A 5ACKA 1M7NA 3POZA 3QZFA 4S32A 4U3ZA 3HDNA 3E92A 2CMWA 3EB0A 4KABA 1WAKA 3DA6A 5IH5A 4IH8A 2CNQA 2PY3A 4G17A 4CQEA 1Q61A 3V5WA 3NNXA 3UIMA 5CSPA 4LV5A 4F6UA 4G3GA 3DDPA 5HICA 2C69A 2YM8A 4D4YA 2HYYA 3A8WA 2JKMA 1YOLA 1TVOA 3BLHA 4RLLA 3SRVA 2QONA 3CD3A 1FVRA 3QCSA 2J0KA 2QOFA 4QMQA 5CEKA 3H9OA 4XV2A 3LMIA 4Y72A 3Q3BA 3CJFA 4RVTA 3KK8A 3OP5A 5DA3A 3EQIA 4I6HA 4ENXA 4YZ9A 4YGAA 4O0XA 5M44A 4DBXA 4FNZA 5L6WL 3S3IA 4L52A 3OVVA 4MD7E 3Q5IA 3I4BA 5CS6A 5C8MA 2UZUE 5CWZA 2R4BA 4KIQA 3SLSA 1URCA 1Q99A 2VO3A 3DLZA 2F9GA 2GNIA 4E6DA 4IZ5A 4IZYA 3RHKA 1PYEA 4DGMA 3BELA 3KL8A 5HG8A 5B2KA 2WTJA 3LOKA 3R7EA 3KEXA 4IWPA 2R2PA 3DNDA 4F7JA 4MXOA 4A06A 3CY2A 2GCDA 5E1EA 5KZIA 5LVMA 5LJJA 2VGPA 2H6DA 2C6TA 2WOTA 3VUGA 4PMSA 2F7EE 4RT7A 3F61A 3R7IA 4ORKA 1RE8A 1H26A 5HCZA 3UE4A 4U3YA 4BI2A 2WU7A 3QL8A 5FUTA 4EUUA 2DQ7X 3MPAA 2X7GA 3QUEA 5DR9A 4H58A 2CLQA 2WTWA 2X6DA 3L9MA 4JIKA 2YISA 4U80A 4BDEA 4BCKA 3GC8A 3QUDA 3JPVA 2Z7SA 2ZAZA 4BDBA 4MXAA 2F4JA 2WMXA 4F1TA 2X81A 3UZTA 3QCYA 3BV3A 5T3QA 3VJNA 3R0TA 3TUDA 3BHHA 4PTGA 4YZCA 4A4XA 2PU8A 3TEIA 4AT4A 2JKKA 3BU5A 4PTCA 2SRCA 2X7FA 3QFVA 3CY3A 3OXIA 5I9ZA 3ROYA 3NAXA 2JD5A 3E62A 4OW8A 2OICA 3LQ3A 3AC8A 5CAOA 2J9MA 2RFNA 1PHKA 3QBNA 5AIRA 5EYDA 4XV3A 2FSMX 3PJ2A 3Q6UA 4ZSGA 3QQUA 4FIJA 3VN9A 3RPRA 4X3JA 3U87A 4U0IA 2VO6A 2FGIA 4APPA 3VUIA 5B0XA 4CKJA 3ZYAA 3WARA 2CNVA 1YXTA 3IO7A 3V5JA 1YXSA 2F57A 4FV9A 5BVOA 3E8DA 4CEGA 2V5QA 3JUHA 2W1GA 2WELA 3R01A 3RAHA 3TXOA 4D4RA 4F6SA 1B6CB 4RSSA 4U7ZA 2XNGA 5G1XA 4OUCA 4ANQA 1GIHA 4DEAA 4P4CA 1AGWA 3OG7A 5J8IA 2Y9QA 1LEWA 4IHPA 2NP8A 3HVCA 3QLGA 3UZRA 4YO4A 1NVRA 2PZ5A 3WE4A 4BKJA 4EQUA 2C5VA 4E5WA 5JT2A 5BVFA 1Y57A 1ZMWA 5JZNA 3ATSA 2CGXA 5AA9A 2GSFA 2YIRA 3IOKA 4BCNA 1OVEA 4DC2A 3GU5A 2Q83A 3CJGA 2W96B 4ZTNA 5HVYA 2BDWA 2CLXA 2NNWB 2O3PA 4DLIA 3ZFMA 4EI4A 5AUXA 5HKMA 5FTOA 1JOWB 3ZLXA 2PE1A 3A7HA 4LRJA 4AW1A 3DJ5A 4DEEA 2XNPA 3IONA 4O7ZA 5FP6A 4DTAA 3AT2A 3T9IA 5CU0A 3ZFXA 1UWHA 5JRQA 2FYSA 5HLPA 1HCLA 4TRLA 4U79A 5ANJA 1R39A 1YI4A 4W4WA 3ACKA 3TZ7A 4BIEA 5HO8A 4RVLA 4FV6A 5L6PA 1MQ4A 2HXQA 4YR8A 2GQSA 3MGYA 4X2FA 1Y8YA 4O7NA 4ZS0A 4FE2A 5IEXA 3BGQA 3GQLA 2IVTA 4ZXTA 5K5NA 1DAYA 3F9NA 4I6FA 5EOLA 4ALWA 2QG5A 3II5A 4KIOA 5LVOA 5AUWA 2WU6A 2WTCA 3HRBA 2UZVA 1HCKA 4BDGA 4CV8A 4EH3A 3VNTA 4MXZA 2EUFB 2PWLA 2W5HA 4YMJA 4FKRA 4M97A 2PVKA 4NM7A 5AV0A 5GIOE 3C0HA 3TNHA 3HMPA 4NYEA 3PLAE 3WF7A 4CG9A 2BAJA 5A54A 4CGAA 4IM0A 4WHZA 1S9JA 2UZOA 1E1XA 2QO2A 3CTHA 3D7ZA 4IAIA 2QU5A 5HU3A 3GXLA 4XEYA 3UO4A 5AA8A 4BCOA 2PTKA 5IUGA 3GP0A 2BRNA 3MPTA 4IBMA 5HE1A 1KE5A 1OECA 1JQHA 4ASEA 3RP9A 3AG9A 4GU6A 3KCFA 2OH0E 2ZV2A 4IJ9A 3LCKA 4BCQA 1YKRA 4JAIA 3QTXA 4DH1A 5BX0A 4N0SA 1J7IA 4FKPA 4JDKA 3HGKA 3HMNA 4NFMA 3ZSHA 4F4PA 2ONLA 4JI9A 1KUTA 4U8ZA 3V01A 4AGWA 3N51A 1UU9A 3FXXA 4F9AA 4QYHA 2J5FA 3HKOA 2RFSA 4AZWA 3FI4A 4AOTA 3EZRA 4AN2A 5EHOA 3O8TA 4RWIA 2YAKA 3QQKA 4XV9A 5FXSA 2BZHB 2IWIA 3H10A 3Q9YA 4IAAA 3G6GA 4J8NA 4QP8A 4AOIA 5FEQA 2PZIA 4EQMA 1MRVA 3PE2A 2VTIA 3SW7A 4G6OA 4PWNA 3K3JA 2LGCA 3Q4UA 5E92A 4ZTLA 4FBXA 1IRKA 2J0MB 3OXTA 4NJ3A 1L3RE 4O0VA 4TZRA 1MUOA 2ETKA 3RNIA 3BYSA 4MQ2A 2VWBA 5E8VA 4O7VA 4YZNA 1YWNA 3DT1A 4BDFA 4O38A 4M12A 4XG7A 3ZDIA 5C1QB 1PXKA 2UW4A 4PNIA 4ZTRA 3AOXA 2JIUA 4G5JA 3QYZA 3CCNA 4M3QA 5HG7A 3HP5A 4G9RA 3SXRA 4AW5A 3D83A 2JAMA 3EH9A 2ONLC 4U45A 2FA2A 4FV1A 5DH3A 4CT2A 2XJ1A 4RQVA 5GJDA 3GCQA 2A19B 2PMNX 3GCPA 4R6VA 3MJ2A 5D9HA 4ZEGA 4JBQA 3TM0A 3UMWA 1QPEA 3AC5A 4KA3A 5AV4A 4YHTA 1FPUA 3OT3A 5IQIA 2GPHA 4XBUA 3NYVA 2ZDUA 4KS7A 1FVVA 1OL5A 2OG8A 4BCHA 2Z02A 5HVJA 3WI6A 4P7EA 3R8VA 3QRIA 3KCKA 4BR3A 4CFVA 2QD9A 3O71A 5KHXA 4RG0A 5GIPE 3WOWA 3DZQA 4FTJA 5EHLA 4XV1A 3SXFA 1M2RA 3BYVA 3ORZA 4TL0A 2X1NA 4FTQA 5F94A 3AD4A 2JITA 2O8YA 2YAAA 2PUNA 3PJ8A 4HPUE 4M14A 3HA8A 4S34A 5CSXA 3F3TA 3VUDA 5DT4A 4BCIA 1DM2A 4J52A 3LFBA 5LMKA 4ASXA 5CAQA 4S30A 4J1RA 3SQQA 3U55A 4RX5A 3RINA 1LPUA 2JDRA 5C27A 4QP6A 4Y73A 4CFFA 4RFMA 4FSZA 2W5BA 1XH8A 3LMHA 4YTCA 2HWPA 3U4UA 1TKIA 4OTGA 3EFWA 3PPZA 1V0BA 4FT5A 5EW8A 4EK8A 1GZ8A 4O84A 2FUMA 2BMCA 3QWKA 5DG5A 5CYIA 4TYJA 5AV3A 2H9VA 3IQ7A 5CU3A 2DS1A 4FG9A 5IZFA 3RCDA 2R0IA 2R5TA 2J90A 5AP6A 4YJUA 1YHVA 3RPOA 4GU9A 3UOKA 1Y6BA 3Q96A 5A6OA 3DKGA 4QMWA 2PZYA 1ZOEA 3FLZA 3F5PA 4IIRA 4TWCA 3E8EA 4O27B 2KTYA 4ZTMA 5IQBA 3AT3A 2XBJA 2YM7A 4IACA 4WG3A 5CT7A 4PMPA 4ZTHA 3SXSA 4NL0A 3CKWA 5CQWA 1YXVA 3FJQE 3LJ0A 1JNKA 4E4MA 4E7WA 3UG1A 4JBOA 4FUXA 4LRKA 2C6DA 3FEGA 3QX4A 1GOLA 4XMOA 4K11A 2VO7A 2WQMA 2C3LA 1YDSE 3GC9A 3QD3A 1IASA 4QMOA 4M68A 5AP5A 2OXXA 3ZH8A 4A07A 3Q4TA 1BLXA 3BV2A 1OM1A 2G15A 4CFWA 1P14A 1Q3DA 2XIZA 2ZM1A 3W2RA 3ZOSA 1MRYA 2DWBA 1JBPE 5IDPA 3NUPA 4F0FA 3NVKI 4IX5A 3NEWA 1CMKE 3ZUVA 2HW7A 3ZU7A 5AP2A 4FTRA 2X4FA 3QGYA 4CCUA 3NNVA 2WB8A 1A9UA 2HK5A 3SKCA 4JVGA 4E5AX 5E1SA 2VX0A 4DEIA 4GK2A 3IOPA 4XOZA 3QKLA 2W1IA 5IDNA 4NT4A 2WQBA 4WNMA 4RX8A 3COIA 3NUYA 4MXYA 5DT3A 3G90X 3H0ZA 3VO3A 4YNOA 3Q6WA 2QC6A 1JVPP 3IKAA 2X8DA 4I0SA 4LRMA 4QMTA 3G2FA 3D5XA 4G16A 4UYAA 3UO6A 4D2SA 2REIA 3T9TA 4C2WA 3ZO3A 4BI0A 3FMLA 2W1DA 4B4LA 4DGNA 3R21A 2BHEA 1GJOA 4X3FC 1XQZA 1W82A 3NWWA 2QOOA 1YOMA 3BZ3A 1A06A 3MS9A 3RPYA 4GUEA 4EOOA 2UZEA 5TO8A 4EC9A 2OWBA 3ZDUA 4EL9A 3V51A 3F5XA 5JFWA 4MNEA 3OROA 5D41A 3UYTA 3OMVA 5J1VA 4PDOA 1KOBA 3QTQA 3R9RA 4U97A 4C4EA 1DAWA 1BL6A 1BX6A 2HIWA 3LXPA 4CRLA 2XRWA 5CSWA 5ACBC 3F6XA 4A4LA 3FMKA 3LHJA 5I5ZA 5ETAA 2C68A 3L1SA 3L8PA 2CDZA 3ZEPA 3DJ7A 2W05A 4FC0A 4DH3A 3AMYA 1FBNA 3LQ8A 4M15A 1B39A 2PPQA 2XS0A 2YM5A 3N4VA 4WRSA 1ZYJA 3MA3A 4WG4A 2C6EA 3ERKA 5E8YA 1IEPA 3MH0A 2B9FA 3BHYA 4Y83A 3UIUA 2AUHA 1H4LA 3QA8A 3SG8A 3C9WA 4QYFA 4BDAA 1VZOA 1ND4A 4LG4A 2C1BA 4PDSA 2R3NA 2ZV7A 5E91A 3E5AA 3RM6A 4LMNA 4AA0A 4YLJA 2WQOA 4EOIA 4QTAA 4GFOA 4FX3A 4UZDA 2UW5A 4C59A 4G3EA 3LCOA 3FYJX 3FZOA 4RIWB 3T8OA 3G6HA 4DFUA 3DJ6A 4NIFB 3ZO1A 2BIKB 3W8LA 4DFBA 3RZBA 3H4JA 2NRUA 4X2GA 1BMKA 5IH6A 3NZ0A 2P0CA 3NRMA 2ZYBA 4IWOA 4RIYB 3O0GA 1QPCA 3EFKA 4MCVA 3UIXA 3D2KA 2GNLA 5AUVA 2QO7A 4EZ5A 3PXQA 4H1JA 1OKZA 1GNGA 4FEQA 2R3MA 2C47A 4WG5A 4OTWA 4K1BA 2FSTX 2C5YA 3CTJA 4R3CA 5AM6A 3F3UA 3C5IA 1H1SA 4CZUA 2XMYA 3QAME 3BU6A 4Y5HA 2C0OA 2ITYA 4QRCA 3VUMA 4DN5A 3G9NA 2YABA 3PY1A 2FB8A 3HMOA 2PZPA 2OU7A 4R5YA 2QOCA 5CF8A 2ZB1A 3V5PA 4YTIA 5B2LA 3DBFA 4Q5EA 5J87A 1LP4A 5IPJA 3OEFX 5HNIX 1U54A 4JRNA 2BRHA 2Q0NA 4FK6A 1VEBA 4B9DA 5A4TA 2XK3A 3Q52A 3UP7A 2EU9A 4NUSA 4AP7A 3VS4A 4ZY4A 4WNPA 2JDVA 4ZZMA 5GINE 4CMUA 1W0XC 3CD8A 1O6YA 3LCDA 4L7FA 2VUWA 1VR2A 1QL6A 3F2RA 3OUKA 4FKSA 4B8MA 3FQSA 4I22A 4LV8A 4UEUA 4WBOA 3BU3A 5TR6A 3RTPA 3R63A 3RI1A 1G5SA 4J95A 1WFCA 4G3CA 2VWIA 2OIDA 4LUEA 5L2SA 5E8TA 3ORTA 3ZLWA 1PKDA 3LE6A 3EIDA 3QX2A 1M14A 2AC3A 3FAAA 3DQWA 4FIEA 3BQRA 3LIJA 4RWKA 4YJVA 4CXAA 1XBCA 3L8XA 2PMLX 5CVHA 4J7BA 3FBVA 2JC6A 1WBSA 5GJFA 2JDOA 4OR5A 3E3PA 4L45A 4JL9A 4AFJA 4KSQA 5EM8A 2A1AB 4CMOA 4EOLA 5AAEA 3PA5A 5EH0A 5HD4A 3OOMA 2UW8A 3LPBA 4RIOA 3P79A 5TF9A 4X6QC 4YPDA 3HMMA 1CTPE 3TIZA 3ZRLA 3DK7A 5KHWA 4DFYA 2VAGA 4MNFA 3BX5A 4HW7A 3LXKA 4JDIA 1GY3A 4GV1A 4ASDA 2QR8A 2WTKB 4AAAA 2C6KA 3NLBA 4GUBA 1UA2A 4U5JA 4DINA 3UNJA 4JG6A 4NFNA 5EK7A 3DKCA 3MIAA 1SZMA 3MTLA 3E8CA 4GKHA 4H36A 3OCBA 5HIEA 3ZUUA 4KSPA 4FTMA 3OXZA 4AU8A 5LWMA 5DRDA 2J4ZA 2P4IA 4C2VA 3MWUA 3JR1A 2P3GX 2X4ZA 3G0EA 5EW9A 3W18A 4DYMA 3F3WA 3H9FA 5AX3A 2PVHA 4ITHA 4LGHA 3VBWA 4B99A 4OTIA 5EI2A 5IQHA 3A2CA 3DK3A 4V05A 5C01A 2BRBA 4R1YA 5CAUA 3IECA 3C4ZA 3NSZA 2BPMA 3VRYA 4YUQA 2RF9A 4A9RA 4MKCA 2UZTA 1KV1A 4NW6A 4O7YA 4DFXE 4AN9A 5HE0A 4EOMA 1REJA 3FMNA 3VS5A 4G6LA 3WZDA 4O7TA 4WNKA 3BIZA 3O7LD 4FSRA 3A7IA 4OGRA 4GKIA 3G15A 3ENMA 3P4KA 3U4WA 1JLUE 1OBGA 4HYSA 5HU9A 3DV3A 4QNAA 4I3ZA 4X7QA 2P2IA 1NVQA 1J3HA 4I20A 4NKAA 5BYLA 4A9YA 3KRJA 4FTCA 4O83A 5EW3A 3DKFA 4RJ4A 4EQCA 2ITNA 3QRKA 5CEOA 1XH5A 2UW7A 2BCJA 3TACA 3TNWA 3G9LX 2G2FA 4ZJIA 2YHVA 4QTBA 5EM7A 3FKNA 2VWUA 1DS5A 4RZWA 3VC4A 2Y7JA 2H96A 1J1BA 2ESMA 4I5PA 4BF2A 4FA2A 4K0YA 3S2PA 4FEVA 4JJRA 4EKKA 4YTHA 3W16A 4DGLC 4FL1A 5TOZA 5K5XA 2ITTA 4OBQA 5ETCA 3IW5A 2BFYA 3SDJA 2DUVA 2XNEA 3V5LA 5IQGA 4UXQA 4I6BA 3MA6A 1APME 4A9UA 4IC8A 4C61A 5CAPA 2G2IA 3H9RA 5H9BA 3FMJA 5IA0A 1U46A 2QOKA 4RJ8A 1ZY4A 2YIQA 3A62A 5I4NA 2RL5A 5CLPA 2BROA 4RJ7A 3PRFA 3QA0A 3QQHA 3QTWA 3UOJA 4MHAA 2F7XE 3R02A 3GGFA 1NXKA 5KMKA 3F3VA 1VYZA 3GEQA 4FKQA 4FVRA 4O22A 1V1KA 4P2KA 3OCGA 3TN8A 1Q8WA 2J0IA 3DKOA 3FYKX 3G33A 3NX8A 4F9BA 3ZFYA 2IJMA 4EH6A 4C58A 2I40A 5KUPA 2O0UA 1YW2A 3KVXA 4E4LA 3IW7A 4EYJA 2PSQA 4L67A 5E8WA 1WBPA 2WAJA 3DOGA 4HVGA 4FGBA 3Q2MA 4MYGA 2OZAA 3R8PA 3W2QA 5CI7A 4AUAA 5K4JA 3VJOA 4XBRA 4F7NA 1WBVA 3GU6A 5LCJA 3KA0A 2ZM3A 2CSNA 4K8AA 4BIDA 3VBQA 4JR3A 2FH9A 3CQUA 4XCUA 3JXWA 4I24A 4IB0A 4PDPA 2RG6A 4O2PA 3W2OA 2WQNA 4ZMFA 1XH6A 4K9YA 3BBTB 2X9EA 5LVPA 4CT1A 5HORA 3BE9A 4AZTA 4RIXB 2YN8A 3ZBXA 4F7LA 1U4DA 5GNKA 5BYYA 4MEDA 3HUBA 3KMMA 3PXZA 5HI2A 2Y4IC 3KMUA 3VS2A 1KV2A 3ZC5A 4PMTA 1A48A 3EN4A 3ZUTA 2WNTA 3FQHA 2XK9A 4HCVA 2WXVA 4L3LA 3VS6A 4F9WA 5IH4A 1GZNA 1E1VA 3DAEA 4UYNA 2XNOA 3MB6A 2EXMA 1IG1A 2AYPA 3MPMA 5F4NA 1DI8A 4C4IA 4ZSAA 1J91A 4XG9A 1KOAA 1OB3A 3DXQA 4AZSA 3WF5A 3MYGA 2PUUA 2VN9A 3PIZA 4IJPA 4O7SA 4Y46A 4DEDA 4EH9A 2OF2A 5DR6A 3TKHA 1JPAA 4E4NA 3FKLA 3P7BA 4M84A 3QQLA 5CNNA 3TZMA 1IAJA 2W17A 2I0EA 2R3RA 4GFMA 1FMOE 3O7LB 3PUPA 5HBJA 4EOSA 4G6NA 4ZTQA 2JBOA 3VQHA 1Q41A 4U6RA 2I0VA 5AP0A 2OIBA 5IQDA 2B9JA 4I41A 4FSYA 4IVCA 2OK1A 2B55A 5IUHA 4IVBA 3D94A 2ERZE 3ZEWA 4NSTA 2PULA 2R3OA 2G2HA 4RC2A 4UXLA 1QCFA 3KMWA 5CF6A 2GTMA 3W8QA 4ZY5A 4D9TA 5CZIA 3QD4A 3IDPA 4J98A 2VZ6A 4DITA 3QCXA 4MD9E 4QO9A 5HIDA 2QVSE 3R8MA 4YLKA 3ZO2A 3C0GA 4N70A 2GS2A 5ANGA 5EDQA 3ZSIA 5HZNA 4K6ZA 4ZK5A 2Z7LA 1T46A 4IW0A 1WVWA 3R7VA 4IQ6A 3C13A 3I81A 3B8QA 3QU0A 4IFCA 1OKWA 2AC5A 3HA6A 3K5VA 4C02A 3VUHA 3O8PA 3PXFA 3RALA 3IGOA 3N4UA 1JKKA 2W1HA 3UP2A 3E8NA 5EYKA 3HP2A 2I0YA 2Y6OA
chains in the Genus database with same CATH superfamily
1PF8A 4DE4A 3BRBA 4ZSEA 2UZLA 4PUZA 1Q8UA 1WVYA 3UMXA 1H0WA 3F7ZA 5CXZA 2ZMDA 4GT4A 3FQEA 3FSFA 4QNYA 4QT1A 2JKOA 2W0JA 2I1MA 3R83A 4YNEA 4LOQA 3MBLA 3UQGA 3WILA 4FEWA 4TWOA 2ZVAA 4FICA 4AZFA 2XA4A 3LQ5A 4L42A 3Q9XA 1U5RA 4LQMA 4JQEA 1PXLA 2R3LA 4W4YA 5FP5A 3RMFA 4USEA 3Q9WA 4BDIA 4NK9A 3UG2A 2BILB 4NM5A 4FNYA 4HGEA 4I6QA 3KXMA 4FT9A 4CKIA 4W8EA 2O65A 4FSWA 3ZTXA 4NM0A 3CTQA 4HGSA 2HOGA 4ASZA 2VWXA 2NO3A 2VD5A 1ZOHA 3GT8A 3A8XA 2Z60A 3LW0A 1FINA 3Q04A 5I9YA 4Z55A 2JDSA 2OLCA 3C50A 4FGRA 4QYYA 4PRJA 4CLJA 2ITXA 2XK4A 1ATPE 2XVDA 3UNKA 3R00A 4D1XA 4BCMA 3DNEA 2ZFYA 3OCSA 3LJ2A 2B9HA 3HECA 2JAVA 4E8AA 1SYKA 3DTWA 5IF1A 4IAKA 4HVHA 3TJCA 4I94A 4YBKA 3VF8A 3UOLA 3EQGA 4PL5A 3DCVA 4XP2A 3NMUF 3D5UA 2W7XA 3QTRA 4R1VA 4RWJA 3K3IA 5J9ZA 4JX3A 4O6EA 4FI1A 1JSVA 3E7OA 3WYYA 5HQ0A 5HHWA 5HG5A 1YVJA 1Q97A 4YJNA 4E6AA 1F5QA 1SVGA 3QTUA 4UB7A 4GFGA 4XYFA 4B8LA 4FMQA 4GSBA 4OT5A 2XJ2A 4RBLA 1H01A 4BBMA 3ZLSA 2WMWA 1OMWA 5EYMA 4XRJA 1TFFA 5DEWA 5EI8A 3V3VA 4BYIA 2PE2A 3LCSA 4HVSA 4DG2E 5K9IA 3ACJA 1JSUA 3L8SA 3S00A 4MBJA 3HLLA 3AGMA 3C7QA 4GT3A 4KWPA 4AS0A 3ATTA 4XG8A 3EJ1A 2QG7A 4FEXA 1ZZLA 3E3BX 4ARKA 5BUEA 2C6MA 3GU7A 3KXNA 3R8LA 3R30A 3GFEA 2QU6A 5ANDA 3W10A 5HLNA 3MIYA 4QP2A 4YJSA 2YJSA 2WOUA 4OLIA 2ACXA 5FGKA 5K3YA 4AZVA 3WZEA 4DGGA 4QTCA 4HJOA 4C35A 1BKXA 2HY0A 4AXAA 3FZPA 5FQDC 4G2FA 4YJTA 3IW4A 1S9IA 1PMUA 3NCGA 5AP1A 4F63A 1M17A 3LKMA 4FTOA 3OY3A 4KBKA 4GT5A 3W0PA 4FK3A 3U8WA 2GS7A 2Z7RA 4TYHA 3C4CA 3UC3A 3MY5A 4IVDA 4RJ3A 4AN3A 4IWDA 4TYIA 4QP4A 4O0SA 1OITA 2BAKA 2QOBA 4II5A 2ZM4A 3E7VA 4IAZA 3A61A 2YITA 4YP8A 2JBPA 2QURA 3V5TA 4JQ7A 3FMEA 5LWNA 5M56A 1BL7A 1PXIA 1XH4A 3M1SA 2XK7A 3CE3A 5EQPA 3VVHA 1FMKA 2VTPA 1QMZA 3LFCA 4PV0A 1DI9A 1OUYA 3H3CA 3TIYA 4EHEA 5JK3A 4L3PA 4XG4A 5BNJA 2BTSA 4TKSA 3VBXA 2GNJA 5AIKA 1WBTA 3IS5A 2QR7A 4ENYA 2HZ0A 3ZM4A 1AQ1A 2XKEA 3UIBA 3WF6A 2GS6A 2WGJA 4FIHA 3V5QA 2GQRA 3ZBFA 5KKRB 3KB7A 4AX8A 3F2NA 4R7BA 5E4HA 4GW8A 3IW6A 3A7FA 2QLUA 2OFUA 2JFLA 1YHSA 3E63A 3OOGA 1FOTA 3ALOA 3BYUA 4WO5A 5CZHA 4B6LA 1G8SA 3L9PA 2PYWA 3I60A 3QZGA 4TPTA 2OKRA 3E64A 3C51A 4GL9A 2CGUA 1UVRA 5JFXA 3PTGA 4C4JA 3ZZEA 3NUSA 3KY2A 2QOIA 3KXXA 5HVKA 3S1HA 4GJ3A 2UW0A 4AAYA 4GMYA 5LMBA 3FXZA 3V04A 5IU2A 4DCAA 3NNWA 2YCQA 4EH8A 2VX3A 3A7JA 2GTNA 3PJ3A 4FZAB 3HDMA 3DBEA 1MP8A 3FUPA 4ID7A 4WOVA 5LMAA 4EONA 5JSMA 2OJFE 1WZYA 3O50A 5CANA 2R3JA 4GYGA 3QYWA 3QTZA 2YZLA 3ORMA 4BCGA 5M09A 1XWSA 3NNUA 3F5GA 4I5CA 3V8SA 2YDKA 1YHWA 1R78A 2BUJA 2W9ZB 3VF9A 3R7YA 4FV0A 4UZHA 4EZ3A 3R71A 4FSUA 3LM0A 5CU4A 4ITIA 2EVAA 3LFEA 3MH1A 3MFSA 5DFPA 4DHFA 3SHEA 3CGOA 4TTHB 3U9NA 4AF3A 3ZRMA 4BDCA 4HPTE 4L68A 4MTAA 4FT7A 4S2ZA 4BN1A 4CD0A 4FSNA 2WFYA 3VBYA 3PSBA 4O91A 2BKKA 1CKIA 1SM2A 2YCFA 3FHIA 3HZTA 4FNXA 3OW3A 5HD7A 3PZEA 2C6IA 1H24A 4MBIA 4TNDA 4QP3A 1YDTE 4ZSLA 3R7OA 4FKJA 3RK5A 4YURA 1PRYA 2UUEA 3I7BA 3FL4A 3MB7A 2CJMA 3R9DA 4EOQA 4DEHA 2RKUA 3TV7A 2BDJA 4FNWA 3VS1A 5HO7A 2X2KA 3U6HA 5A4EA 4IWQA 4FV4A 2ZJWA 4FV2A 3RAKA 3HMIA 4C33A 3FV8A 4AG8A 1H08A 3MN3A 3R9NA 5M06A 3IDCA 3ZXTA 3MFTA 2O64A 2W4OA 2O2UA 2GNHA 4ZP5A 4YC3A 4AW2A 3QF9A 2OZOA 2JDTA 3ORPA 3VONA 3JYAA 5I9WA 5IEYA 3TUCA 5K4IA 1YXXA 2FVDA 2OSCA 2R3KA 5D7VA 2WZJA 2JKQA 3EFJA 3FE3A 1SNXA 2XNBA 4YTFA 1GAGA 5AFVA 3PIXA 5GJGA 4EHGA 3JVRA 1XO2B 1YI6A 4FTNA 3BWFA 3TG1A 3ZLYA 3P08A 4DEGA 4FIFA 3R8UA 2W4JA 4E4XA 1ST0A 4O0TA 4YHJA 4BBFA 2XM8A 4X3FA 4D5KA 1PJKA 3KXGA 4KRCA 5T68A 4RWLA 3R1YA 4D2RA 1P4FA 3AC4A 3COMA 3EOCA 1YDRE 3HEGA 4H39A 3NYNA 3PE1A 3QHWA 4O7LA 3I6WA 5ETIA 2YA9A 4ZJJA 3PVWA 4HYHA 4ANMA 4TYEA 2ITVA 4S33A 2RG5A 5BVKA 3LXNA 1PY5A 3GENA 4FL3A 2J5EA 3DZOA 3P23A 1OL2A 5C4KA 4IM2A 5CASA 3JS2A 2C0IA 3ZONA 3EWHA 5DRBA 3EN6A 1RW8A 3OTVA 4AA5A 3F7WA 2X39A 3CIKA 3TNIA 2XK6A 3TT0A 5HGIA 3TJDA 2PVJA 4BGGA 4AGUA 5JFVA 4HNIA 2KULA 3BQCA 4MWHA 4QMYA 5HCYA 2XKDA 4BDDA 2NPQA 2VWZA 5M4CA 4FOBA 2YFXA 2IN6A 3KN6A 5AJQA 4HVDA 3QHRA 4FVQA 2JFMA 3AXWA 4IANA 2Z7QA 4QPAA 4KB8A 3SAYA 4UY9A 3V8WA 3UODA 3A4PA 3FY2A 4JBVA 3ULIA 2YEXA 3CQWA 1KE8A 2EB2A 3PJ1A 5CU2A 1Q62A 4ERWA 5AP3A 3TV6A 4IB5A 4F78A 5D12A 5CEQA 4H3BA 4ANLA 3QQGA 4FV7A 4DTBA 3CC6A 4FV5A 5M53A 2HCKA 2WMAA 4Z7GA 2RFEA 2BVAA 3KKVA 5CTPA 4BTFA 3ANRA 4IC7A 3BLRA 1M2QA 2F7ZE 3DS6A 5BVNA 3D7TA 4DLJA 2CKQA 3CBLA 2CPKE 4TYGA 3ZXZA 5IEVA 4D55A 4FSQA 1UNHA 2QODA 2R7BA 3R1SA 3W2PA 3B2WA 3ZM9A 3PZHA 4U81A 4FG7A 4BCFA 2PMIA 3S95A 4WIHA 2UW9A 3LMGA 4MNEB 3DBCA 3RCJA 4NH1A 5ITAA 1RQQA 1YXUA 3EYHA 3PG1A 2P55A 4XX9A 1U59A 4M67A 3KFAA 4XUFA 4XS2A 5M4FA 4JLCA 3RPVA 1H8FA 3PFYA 4M0YA 2XKCA 4Q5HA 4TW9A 4QMUA 3RJCA 4LDTA 3WZUA 4C4HA 3GC0A 5BUJA 5DBXA 5HCXA 3QC9A 4UN0C 3G51A 4FTKA 4F0GA 3W2SA 3D5VA 3QGWA 4WUNA 5H8BA 2QOHA 4QPSA 5AADA 3AKLA 2XJ0A 2I7QA 3TKUA 4FUYA 4RFYA 3R1QA 1GZKA 3COKA 2HENA 2HZIA 4TWPA 2IPXA 1SNUA 5F9EA 5ANIA 2LAVA 4ACCA 3DAJA 1LR4A 1OIQA 5DYJA 1CKJA 1ST4A 2G1TA 2OIQA 4IB1A 4IE9A 1ZYDA 1YRPA 5L3AA 1ZYCA 2RIOA 3ID6C 1JAMA 5E90A 4ITJA 4FYNA 2WMBA 3NAYA 4W4XA 1OIUA 3VIDA 1F3MC 2GHLA 4FT0A 3LVPA 5GHVA 4IZAA 3KU2A 3WZJA 4BYJA 4EOJA 3PY0A 5LOHA 2Z8CA 4RIWA 2BALA 1SVHA 2X9FA 4C7TA 4YSJA 3PRIA 4HCTA 5J7HA 4YLLA 2PUIA 3FZ1A 3N9XA 2ZMCA 5EOBA 5KMIA 4Q2AA 4AACA 3DQXA 3L8VA 4OBOA 4RIYA 4YO6A 2UZNA 2IZUA 3KRRA 4ALVA 1Y8GA 5C26A 3O51A 4R78A 4D4VA 3EKKA 4I23A 4MWIA 3NVMB 5CU6A 2CCHA 4AQCA 3AC3A 1SVEA 5AX9A 2W1EA 3DB6A 4L43A 3EYGA 4QQJA 5HX6A 5M08A 5M57A 3RVGA 1T45A 3K5UA 3PLSA 3GBZA 4U40A 4DH5A 4DTKA 3FZTA 5IQAA 4MXXA 3O5AA 3R6XA 3R73A 4XLIA 3TTIA 4UALA 4DT8A 2J2IB 2QKWB 4QMXA 4BDKA 1KE9A 1OKYA 4Z9LA 4ZLZA 2C3KA 5AUUA 4O0YA 1Q5KA 4EZ7A 3TUBA 4BRXA 2BDFA 4IB3A 5HE2A 4QMPA 2BZJA 3PA4A 4FKUA 2WHBA 3ROCA 4GK4A 2I6LA 3PSDA 5IA2A 5IUIA 3AQVA 3OFMA 3QTIA 2X8EA 1BYGA 2OI4X 5FBOA 1Q8ZA 3EL7A 4JDJA 1H27A 3FSKA 2X7OA 4U9AA 2PVNA 4RX9A 4E6QA 3MH2A 1FGIA 1UKIA 3EL8A 4BTMA 2EWAA 4Y85A 3PYYA 4FKGA 5HIBA 1Y6AA 2YIYA 2VTOA 3CP9A 2J0JA 3KULA 5KO1A 3UDBA 4LUDA 2E9OA 4NWMA 4BDHA 1OPKA 3BWJA 3BLAA 4QP9A 3QRJA 2OXDA 4I93A 2OXYA 2XCHA 3PVBA 3G0FA 3O96A 3ZHPC 4DF3A 4DG3E 4GEOA 5A3XA 3R9OA 2VTRA 5IMEA 2WIHA 3ORLA 4QYEA 3SGCA 2WD1A 1WMKA 3W2CA 4RRVA 4NW5A 5FM3A 2BZIB 4IDVA 1Q8TA 3GB2A 1P2AA 3R28A 5JH6A 4WT6A 4I0RA 4LYNA 3E88A 3RWQA 3KF4A 4ZLOA 3E87A 4QMLA 5LVLA 3KQ7A 4Q9SA 1XR1A 3BGPA 3ELJA 3GC7A 3BHVA 3EHAA 5DOSA 4A9SA 2P2HA 5CEMA 3OWLA 3GCVA 2OJ9A 4AOJA 5AUTA 4R7HA 1W98A 4ZSJA 4XH6A 1NW1A 2PVMA 2C3IB 2QQ7A 4YZBA 4YZMA 3SW4A 5LCKA 2HY81 3UQCA 4KIPA 4D1ZA 3REPA 4HGTA 1CM8A 1WBWA 3FC1X 4RA5A 5L8LA 4CRSA 4FL2A 4V0GA 2A4LA 3MW1A 4M69B 1YOJA 5C4LA 5KMMA 4X0MA 5EM5A 3D14A 1IA8A 5EDPA 3TTJA 3T3UA 1ZYSA 2QNJA 2H8HA 4RC4A 2P33A 3EN5A 4QTDA 3L9LA 1LUFA 1V0PA 3FDNA 2UW3A 3CPCA 3I7CA 4HZRA 4XG2A 4Y8DA 4YHFA 2VX1A 2C5OA 2W99B 3A60A 3EFLA 3R22A 2HWOA 3HAMA 4MXCA 4EHVA 4KBCA 5BVWA 1KWPA 2ZV8A 4RFZA 3JY9A 3MESA 4D58A 4PL3A 5M4IA 4MD8E 1H07A 4O7WA 5A4QA 5J5SA 2XUUA 3EQCA 3EQRA 1H00A 4EK6A 3LLAA 5CNOA 5BQ0A 3NGAA 3C1XA 3SD0A 2UZDA 3QD0A 1PMNA 5FM2A 2OO8X 5B7VA 4ACDA 4EH2A 2WTDA 1SMHA 3MV5A 4RQKA 2IZRA 5AUYA 5HEZA 2WMUA 5ETFA 2W1FA 2ETRA 4FSTA 3DB8A 3KK9A 3ETAA 3LXLA 3LFFA 2GNFA 3KC3A 3QCQA 2X2LA 4OTRA 3PFQA 3QTSA 4IAFA 3F82A 2ITOA 5HX8A 4BICA 3DU8A 4BCJA 1MRUA 3RK9A 2VWVA 4KD1A 5J9YA 4BZNA 3MH3A 3QC4A 4RC3A 4CTCA 4FR4A 5JN2A 4EWHA 2OW3A 4UWBA 2QKRA 2V22A 4LV7A 5EDRA 2QI8A 3LCTA 2WO6A 2OZAB 5DR2A 3DAKA 4I4FA 2VTAA 4WBBB 4X2NA 5JKGA 1MQBA 3WF9A 4R3PA 1JKLA 3VAPA 4C3PA 3FMDA 3WYXA 3GU8A 4Y95A 3FZRA 4BVUA 4MX9A 4YZDA 3ANQA 4FV3A 4L7SA 2JIIA 1FVTA 1ZLTA 4FEUA 3RM7A 1UNLA 2VTQA 3ZMMA 3FPQA 5TT7A 4DGOA 1UWJA 3FZSA 4EORA 1W84A 3D2IA 5L8JA 1O9UA 4ANBA 4HVIA 3ZRKA 5L8KA 4D28A 5BMSA 4N6ZA 4FSMA 3PG3A 4FTLA 4FTTA 4WD5A 2CKPA 3PXYA 4RPVA 3EQFA 2VNWA 1WVXA 1ZZ2A 4F09A 3PP1A 5DE2A 4H05A 4F1MA 4ZY6A 2JEDA 4BDJA 1H1RA 2BFXA 2XM9A 3NW7A 4EKLA 4AA4A 4S31A 1NY3A 5E7RA 3QQFA 4XG6A 4P5ZA 3CLYA 3EZVA 5L6OA 2OGVA 3SA0A 5DIAA 1I44A 3BHUA 4HGLA 3VW6A 3ZO4A 4DA5A 3ET7A 3PPKA 3O17A 3MTFA 2VTNA 4EH5A 5HNGA 2C5XA 2W5AA 3AGLA 2R3QA 4BHNA 2YWPA 2JIVA 4NCTA 4OBPA 2IVUA 5E9EA 3SRVB 4C34A 1Z5MA 3PP0A 5L2TA 3AD6A 3RHXA 2YIXA 2ZDTA 3LM5A 3V8TA 1XH9A 3THBA 3UPXA 2GHGA 4K2RA 2PHKA 1CDKA 4IMYA 4KNBA 3PWDA 5DEYA 5AP7A 3RGFA 4D0WA 5IMXA 2R64A 5L2WA 1OBDA 4D1SA 2Y4PA 4EJ7A 4PL4A 4D4SA 3KGAA 1OL6A 1VJYA 5A9UA 3O2MA 3OW4A 3C0IA 3KXZA 2GQGA 4M8TA 4O21A 3HRCA 4F6WA 4P5QA 3ORXA 5BYZA 4ZJVA 2B0QA 1JWHA 2XP2A 4BB4A 5E8ZA 4P90A 4USFA 4NKSA 2XCKA 4XRLA 4CFUA 3LLTA 1EH4A 2OBJA 3A99A 3FI3A 1CKPA 2R9SA 4IX4A 4QYGA 3GOKA 4PP7A 3I5NA 4NCTC 2BRGA 2V7OA 2ZB0A 3GU4A 1ZMUA 1O6KA 3NIEA 2YCRA 4V04A 2E2BA 2BR1A 2C4GA 2XK8A 4IZ7A 4EK4A 4JBPA 5CI6A 3U9CA 4J8MA 5CAVA 4FJVA 1TQIA 3AMAA 1JSTA 2F2UA 2IW9A 3Q9ZA 1QPJA 4OTFA 2X6EA 1R1WA 3P86A 2BKZA 4O96A 2BZKB 3OHTA 5EG3A 4Z7HA 4AE6A 4BY9E 2DYLA 5I9XA 3ZZWA 4EOPA 2FSLX 5HBEA 2V0DA 5A6NA 4L44A 4IADA 5F20A 4IAYA 1XKKA 3LZBA 4NU1A 3BBWA 4HYUA 3HV5A 2PVLA 2YJRA 4ZLYA 4ZOGA 4JG7A 2C30A 4ZZNA 5CXHA 2X0GA 4EJNA 1UU8A 4I21A 3LFSA 3MI9A 3QZIA 4DDGA 4E20A 1OIRA 3PXKA 5DI1A 1PXPA 3RK7A 3AT4A 1Q8YA 3FMMA 4GVJA 3Q5ZA 5CSHA 5KX8A 1KE6A 1P5EA 2E9VA 4E73A 3BLQA 1Q4LA 4JRVA 2C5NA 2W9FB 3DBQA 2PZRA 4FKIA 5C8NA 2B1PA 3CXWA 4IDTA 3RPSA 2UVXA 4BC6A 3W0SA 4D5HA 2WEVA 3IG7A 4N57A 2ZV9A 1XH7A 5FEEA 1XBBA 5HG9A 4QTEA 4ALUA 1IAHA 4RJ6A 3KF7A 5C8KA 2CCIA 4G31A 1K2PA 4M13A 4N4SA 1GIIA 4PX6A 4YSMA 3PSCA 3WZKA 2ZOQA 3FLSA 4UWCA 3DXPA 4KS8A 3HL7A 3NPCA 3V6SA 3R2YA 4RZVA 3R2BA 3VBVA 5IA3A 4EUTA 3HV6A 4TXCA 3VS3A 2UW6A 2VO0A 4PP9A 4WNOA 4EC8A 2BHHA 3I0OA 5F95A 4HYIA 3F66A 4EH7A 5ANEA 2VU3A 4PNKA 4BTJA 4NTTA 3SV0A 3UQFA 4GCJA 4L01A 3QRUA 4JT3A 4G34A 5HESA 3CQEA 4JS8A 5TKDA 4G5PA 4FTUA 3KXHA 4R3RA 1L8TA 2B53A 2B4SB 5EHYA 4KBAA 2V62A 4MBLA 3IDBA 4C38A 1J7UA 2R3FA 2XARA 3BGZA 3FMHA 3FY0A 3FI2A 5CVGA 4GJ2A 2PVFA 2O63A 1KE7A 3QLFA 2UVYA 5JZJA 5A4CA 5KCVA 5M51A 4A4OA 2WKMA 2VTLA 4L3JA 3CGFA 3MVJA 4BCPA 3QZHA 3M11A 4JNWA 3C4FA 5FEDA 4BI1A 4U43A 1G3NA 1OI9A 3IGGA 3JVSA 3F5UA 2JGZA 5J95A 3P78A 4DT9A 3N4TA 3U54A 2YWVA 3EN9A 4CKRA 4EBWA 4QMNA 1PXNA 2H34A 2NYAA 1OGUA 3MFUA 4JQ8A 4BGQA 4LOPA 3DDQA 3TKIA 4AZEA 2CN8A 4BHZA 3AC1A 4XP3A 4O0WA 4EH4A 2CGWA 4XJ0A 4O2ZA 5DVRA 1XBAA 4CFXA 1ZOGA 4TYHB 4ERKA 3I6UA 3K54A 4RVKA 2HELA 3FC2A 1OL7A 3EQHA 2VV9A 5FBNC 3OS3A 2XZSA 3CR0A 2ITQA 3WBLA 4RGJA 1ZRZA 2C1AA 2IVVA 4RA4A 3DBDA 5I9UA 4IX6A 3POOA 3NCZA 3QRTA 4U44A 4UX9A 4GS6A 5I0BA 3T3VA 4DCEA 5FXRA 1H0VA 3P9JA 2VWWA 5AEPA 1IR3A 4R5SA 3UOHA 3UVRA 4YBJA 2WEIA 4TNBA 1PMVA 2CHLA 5E8XA 1YWRA 5FTQA 3UVQA 2B52A 3C5UA 3R04A 1ZY5A 2R3IA 2BIYA 5CSVA 3DLSA 3HV7A 4L46A 4KUJA 3UTOA 4KKHA 1K3AA 4IVAA 4Z16A 1R3CA 1R0PA 4FIIA 4B0GA 2OJGA 1IA9A 4FKWA 4HOKA 4DFLA 4QMSA 5JGDA 3WIGA 3U51A 4BIBA 5J9LA 4AT3A 4J53A 4G1WA 3AMBA 3COHA 3AKKA 4F65A 4JIAA 3O8UA 1PXJA 2BTRA 3P7AA 2JLDA 3BL7A 4M7IA 2RGPA 4CG8A 2VTMA 3FLNC 4X21A 5JRSA 3PY3A 5JQ5A 5FDXA 1LEZA 2Y0AA 4J97A 2XYNA 5KE0A 5LVNA 4JX7A 4H1MA 3MY0A 3ORKA 3Q60A 4YJPA 5EKNA 3OBJA 4GK3A 5JGBA 2WMTA 3GNIB 3F88A 5CEPA 2ITZA 3GUBA 2QOQA 2Z2WA 3PWYA 5EQEA 3UDZA 3SVVA 3BI6A 5CVFA 4AGCA 4ZTSA 5KBQA 4ZS4A 4QEBA 5KZ0A 2YIWA 2XIKA 2GDOA 3CSVA 4KKGA 4CFMA 5ICPA 5LQFA 4GH2A 4M0ZA 4FZFB 4PQNA 3SOCA 4QDEA 3Q4CA 4AW0A 2WTVA 3BHTA 4O86A 1H1PA 2QHNA 5H8GA 5ANKA 3DFAA 4QQTA 3FLQA 5CQUA 4FKVA 2V7AA 5KKRC 2RFDA 4R7IA 5FXQA 3Q2JA 4RVMA 1W7HA 3R1NA 5I9VA 3SC1A 2WQEA 4LMUA 4LI5A 2CGVA 1F0QA 1PXMA 3UYSA 5B2MA 2XNMA 5IISA 2YM6A 3UJGA 3W33A 3F3ZA 4I1ZA 3BYMA 1HOWA 3OD6X 4L8MA 4QMMA 5JMSA 3D9VA 4AE9A 4BZDA 5IG1A 2R7IA 4XLVA 2XIXA 3NFFB 3MVLA 2QLQA 2J51A 4YU2A 3TCPA 3GVUA 5KNJA 3VS7A 5FG8A 1YWVA 3ORNA 3E93A 3EQDA 3OTUA 4OTQA 4CFNA 4TY1A 4C3FA 5D10A 2OFVA 3I79A 4FG8A 3HV4A 2ITPA 3W0QA 1UV5A 1UNGA 4CNHA 3A4OX 4IM3A 2HXLA 5CENA 4C36A 3P0MA 5LMKC 1UU7A 4AT5A 4OTHA 3EMGA 4FTAA 5HLWA 3RKBA 4X2KA 4X6RA 4AGDA 1QPDA 3PPJA 3ZS5A 3SX9A 3IPHA 3KRXA 4RJ5A 1PXOA 4OTDA 5DN3A 4EWQA 4WUAA 4FKTA 4NJDA 1H28A 2VNYA 2A2AA 3BKBA 4K33A 4AFEA 4C0TA 1ZMVA 1GIJA 3L9NA 1NT2A 3K2LA 3UBDA 4G3FA 5JEBA 4PY1A 1RDQE 3WE8A 4C4FA 5G6VA 3UDSA 2XIRA 4X3FB 1M52A 2WMRA 3W55A 1ERKA 2OF4A 3GCUA 3BPRA 4NM3A 2FSOX 3PJCA 3TWJA 3GQIA 3CPBA 1KSWA 3DXNA 3A7GA 2XB7A 5D11A 2HZNA 3PA3A 2VTTA 2CKEA 4CLIA 2O5KA 2C0TA 1STCE 2OJJA 4L00A 2GHMA 3U6IA 1UU3A 4XP0A 3FLWA 2WIPA 4MH7A 3D5WA 3VULA 3S4QA 4GG7A 4QMVA 3B2TA 1FQ1B 2VGOA 3H0YA 4G3DA 5BVEA 4A7CA 3NUXA 5E8UA 1W8CA 3KN5A 3MVMA 4QP1A 2NRYA 3EKNA 3UPZA 3MJ1A 4XNEA 3I1AA 3DFCB 1O6LA 1WCCA 4ONAA 3QUPA 4Y5QA 3VHKA 4CTBA 5JFSA 5KMJA 4LOOA 4O7RA 5AUZA 3D15A 3NS9A 4FKLA 3R8ZA 2PK9A 3UNZA 4U42A 4HCUA 3MSSA 4MVFA 4U41A 5EI6A 5FD2A 5DGZA 2XAOA 4NTSA 2XBAA 4H3PA 1PMEA 1PW2A 3NYOA 3FPMA 4IEBA 3W32A 4DH7A 1PKGA 4JMQA 1V0OA 2PVRA 2E9NA 5CT0A 2W06A 2YM4A 4HNFA 4ACMA 3BEGA 3AC2A 4FYOA 5DWRA 3MDYA 3KRWA 1J1CA 3ALNA 5CALA 3SG9A 4IX3A 3HUCA 3I5ZA 2GNGA 2ITUA 3ORIA 3D7TB 3KREA 4KINA 1Z57A 4H3QA 3UZPA 3QWJA 4ACHA 4CV9A 3C4WA 3OT8A 3S0OA 1W83A 4MAOA 4ZZOA 2G01A 4USDA 2X8IA 3VBTA 3OWJA 5HBHA 4JR7A 5M55A 3LJ1A 3OWKA 2VTJA 5FLFA 3EQBA 3HAVA 5DHJA 4E6CA 4XHKB 4Z3VA 3LFDA 3OEZA 5EFQA 3F2AA 3OCTA 2GU8A 2B7AA 4WSYA 3IK3A 2G9XA 3OC1A 2CN5A 4QP7A 2EXCX 4UBAA 3UGCA 3ZCLA 2XALA 3ODZX 3P5KA 4FIGA 4YC8A 2J6MA 4EOKA 4Q9ZA 3OF0A 1J7LA 3M2WA 3NIZA 5BVDA 4TT7A 3W0NA 2PL0A 2QO9A 4RMZA 4L53A 1AD5A 4KKEA 3PDTA 4I5HA 2YDIA 3NUUA 4DHJA 3VS0A 1H1WA 5C9CA 4B7TA 2ERKA 3R7UA 2UVZA 3TI1A 2IZTA 5AP4A 2VWYA 3DPKA 4QQCA 5T6KA 2XF0A 4UWYA 3TL8A 2XNNA 3UO5A 4ANSA 4YJOA 2PMOX 4FZ7A 1YQJA 4E26A 1X8BA 5IA4A 4FOCA 4JAJA 1Q3WA 2ETMA 4WKQA 5CY3A 5EYCA 4F08A 4LGGA 3EN7A 3DGKA 3QKMA 4C4GA 4BTKA 2IW6A 2WTIA 3NDMA 2V55A 4N6YA 1E9HA 4I0TA 5KMNA 2B54A 2BAQA 4V01A 3DTCA 4YJRA 3PXRA 1R0EA 2PE0A 3M42A 3BYOA 3KIOC 4W8DA 1U54B 1XJDA 1WBOA 1M7QA 3SOAA 4EK5A 3GI3A 2IG7A 4YPSA 5EKOA 4PMMA 3VRZA 3DY7A 1REKA 1K9AA 4MQ1A 2A27A 4I5MA 4L9IA 4C37A 3CS9A 3ZSGA 4GIHA 3TDVA 5CF5A 3ODYX 3VUKA 2HW6A 2UV2A 3D4QA 1JKTA 3NW5A 4ZIMA 3VW8A 1I09A 1WBNA 3P1AA 4W4VA 4BJJA 4DAWA 4GG5A 5D7AA 4DHIB 4E5BA 4F9YA 4F9CA 2OJIA 4C3RA 2HAKA 3TV4A 4QQ5A 4CSVA 3HNGA 2C6LA 1RJBA 4ACGA 2FO0A 4LFIA 4RX7A 4DFNA 5H2UA 3TDWA 5AM7A 2J50A 4NZWB 4KAOA 3D0EA 4GIIA 4YC6A 5EQYA 4MK0A 3FWQA 3FXWA 3Q4ZA 5FRIA 4JDHA 2UZWE 5AAFA 4EYMA 5M07A 4GVAA 1NVSA 2XEYA 2IW8A 3WIKA 5DPVA 2HZ4A 2XH5A 1OZ1A