5M06A

Crystal structure of mycobacterium tuberculosis pkni kinase domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
245
Chain Sequence
MALASGVTFAGYTVVRMLGCSAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQHMADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHRDVNPANVVLTSRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAPPVDRSLQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Serine/threonine-protein kinase PknI
publication title The crystal structure of PknI from Mycobacterium tuberculosis shows an inactive, pseudokinase-like conformation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 75
structure length 245
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m06A01
4PY1A 4YR8A 3ZS5A 3K5UA 1M2RA 2IW8A 3KF4A 3WILA 2XH5A 5C8MA 4LRMA 1PYEA 2I0HA 2PUIA 3ZUTA 3C5IA 3FKLA 3COHA 4O7TA 5J9LA 2X8EA 2YISA 2OJ9A 3EFJA 1W82A 4H1JA 4BHZA 5AEPA 4DAWA 4FKWA 4LFIA 5EHOA 4QYYA 4JQ8A 1YWNA 2C3KA 4IFGA 4EOMA 2GDOA 5DT4A 1YXUA 5HE1A 5M08A 3FQSA 2R3NA 5CASA 5HTCA 2W1IA 4KRDA 5HORA 1FGIA 1YHSA 1IRKA 3Q60A 4IVCA 2JDVA 2HCKA 3EQGA 3NYVA 3R01A 5EDRA 2QOIA 2X1NA 4WA9A 3TDWA 4EH5A 4GJ2A 3QHRA 4HOKA 3OTUA 4F7NA 1H0VA 3R8MA 5HLWA 4II5A 5BUEA 3VULA 3TG1A 4JBOA 2WNTA 3R73A 3V5LA 1BKXA 1KSWA 3KRWA 5EK7A 3OROA 2E2BA 4B9DA 3IK3A 2PE1A 3OBJA 4C4GA 1ZMUA 2W5BA 1L8TA 4RX9A 3ODYX 3ORIA 5IQGA 3EL7A 4L00A 3UZPA 1URCA 4FX3A 3TDVA 2BRHA 3PPKA 4FT7A 1ZZ2A 3WF6A 4TRLA 3DKGA 4BCMA 4TYHA 4OBPA 1YDTE 3WBLA 4EWQA 4YHTA 4U3YA 3WZUA 2RF9A 4DCEA 3NAXA 1BI8A 2QG5A 4O6LA 4Y73A 2A19B 4HCVA 5F20A 3Q52A 3NW7A 4RJ8A 2EXMA 4EUUA 4LI5A 3BU6A 5AUWA 5IQBA 3QC9A 5J9YA 2SRCA 4EOPA 3DNEA 5BVOA 5B2KA 2JDTA 4AN2A 1Q5KA 1U5RA 1WBOA 2WTKC 3OWLA 3GU5A 4FTNA 2XK8A 4U97A 1PMEA 1WFCA 4FBXA 5IF1A 4K77A 4LV5A 4K6ZA 4XCUA 3KEXA 1R78A 5EQPA 2IW9A 1UU3A 1R0EA 4C4HA 5CI6A 3GB2A 1OKVA 4ZJJA 4EZ3A 4J52A 3TTIA 4DGLC 3PA4A 2DUVA 4JAIA 3KU2A 4QP4A 2B1PA 2WZJA 4IAKA 3IECA 3U4UA 2YERA 3M11A 4X3FA 4F9AA 3E8NA 1SVHA 2ACXA 1ZYDA 4EOIA 4EH7A 1OKWA 1JKKA 2GFSA 5DGZA 4J97A 3R9NA 3DU8A 2WMXA 3VBXA 2PUNA 3UBDA 2X7FA 3QZFA 2A0CX 2C4GA 2C5OA 2XEZA 3LCDA 3UDBA 3ZLSA 3W8QA 4EC9A 4FKRA 1VYWA 3DK6A 3S2PA 3COIA 1OIQA 2NP8A 4CLIA 5IISA 3RNIA 3QRKA 3GQIA 3VQUA 2OZAA 2UZUE 3QRJA 3GCUA 2BZKB 3QLGA 4RWLA 2ITVA 4UBAA 4F9CA 3H10A 2YIWA 5CEIA 4MXYA 1I44A 4MXXA 3SV0A 3UIBA 3DQXA 4I0TA 2ETRA 4J96A 3ZXZA 4UZHA 4QTCA 1OIRA 1Q41A 1KV2A 2R3LA 4G5JA 4YZMA 4BCFA 4XG8A 4U3ZA 4EK3A 2Q0BA 4WUAA 5IA3A 5DR9A 3SRVB 2ZM1A 3PSBA 4U80A 4PMPA 4XH6A 4EHVA 4ZLZA 4EHGA 5CSXA 5F94A 1XH6A 3MFRA 4FE2A 3QQGA 4EEVA 4OBOA 4IB5A 3GU7A 1NY3A 4FL1A 1FPUA 3PG1A 4ZZNA 4AOJA 4YJRA 3QL8A 2P55A 2C6IA 1GAGA 2RKUA 3B2TA 3ROYA 1CMKE 2BUJA 2O0UA 2JDOA 3C4EA 5EKOA 2PZYA 5FTQA 3RPYA 4R6VA 4ERWA 4BBEA 1ZARA 3MH3A 4NH1A 4TYEA 5GIOE 2CHLA 2V22A 4QP2A 4YJPA 1YXXA 5A54A 2JKMA 4KINA 4O0RA 4WRGA 2FYSA 3IW7A 2HWOA 2CKOA 3GFWA 4HYIA 2UVXA 4RIWA 5BYLA 4RWIA 3A8WA 4G5PA 5HNIX 3RJCA 3L9LA 3PJ3A 1H24A 3PXZA 4GUBA 5CENA 2F2UA 5E8ZA 4MBLA 2OIDA 2ZMDA 4JG8A 4JR3A 4QMPA 2BAQA 4F1MA 3I81A 4QT1A 5FM2A 3RPRA 3OHTA 4E8AA 5AP2A 3DPKA 2IVSA 2QLUA 2ZB1A 4JXFA 3CQEA 4YJNA 3VHKA 4ZLYA 2OH0E 3GCSA 2GS7A 2XKCA 3EKKA 3D4QA 3QTRA 3R1QA 4FV0A 4QMZA 5EDPA 3EWHA 2PMNX 3BQCA 3CQWA 4WIHA 4H3PA 3HV6A 5AP7A 4TNBA 2WQBA 3UO6A 2PVKA 4D4VA 4D2RA 4NM7A 5E8TA 3HUBA 4AXAA 2C1AA 1UV5A 3H9FA 3NUPA 4R5SA 4L01A 4DHFA 3GENA 4MXCA 3WYYA 4ASXA 4PX6A 3ZRMA 3EHAA 2BHHA 4MNFA 3S95A 1HCKA 3G6HA 2PMOX 4YTCA 3UNKA 2VNWA 5A4TA 2PK9A 1BMKA 2PMLX 3FMJA 1OB3A 3ACKA 4QYHA 3WZDA 1VR2A 4E4NA 5IMEA 5AUYA 2OW3A 3NIEA 4JR7A 2YIQA 5DG5A 3SDJA 5IQFA 1Q8WA 1X8BA 2IW6A 4B8MA 4UX9A 4IVBA 4OTGA 1MRYA 4AA0A 2IPXA 3QUPA 1UU9A 2CN5A 2QNJA 1WBPA 3KMWA 3RPVA 3IW5A 5FGKA 5IQEA 2FUMA 4O0VA 4B6LA 5FG8A 5HG5A 3L9MA 3QTXA 3D2KA 1R0PA 2WMRA 4RFYA 3ZC5A 4CFFA 1M52A 3H30A 3II5A 3DBFA 2O8YA 3L8PA 4H1MA 3UPZA 3DAKA 3GI3A 1M2PA 4IJPA 2WMAA 3TZ8A 5BPYA 4QP6A 2PVMA 3LLTA 3OCGA 1TQIA 4DFNA 5HO8A 5C4KA 3V3VA 3EQRA 2ZV9A 4G6LA 2C0IA 4PQNA 3BBTB 1QPDA 4G34A 3MFTA 2ITQA 4KBKA 4EJNA 2WAJA 3VO3A 5I0BA 3GFEA 3DAJA 2BFYA 4FNZA 4BYIA 4L44A 4I0RA 4K0YA 4ALWA 5K4IA 5FQDC 5LQFA 1OKYA 3FYJX 3NCGA 3UIUA 2V62A 2ITUA 1KE5A 3MESA 4TYGA 4G6NA 4J99A 3ZLXA 2IVUA 5E7RA 4DFLA 4TL0A 4QP3A 3BHTA 3B2WA 4AFEA 4G6OA 4CXAA 2WIHA 3MWUA 4TWOA 4RJ4A 1I09A 1SMHA 5EFQA 2Z7LA 1NVSA 4UXQA 3BPRA 4X6RA 5EYDA 4KABA 2EVAA 4DG0E 5LVLA 2XJ2A 4ACMA 1XBBA 3CIKA 5E8XA 2OJJA 2UW9A 3JYAA 4NZWB 3FQEA 3I1AA 4R78A 4JDKA 3FMLA 4IM2A 3OY1A 5EM8A 4FICA 3SD0A 2OF2A 3MTLA 2W7XA 4C3PA 4EKLA 4KA3A 5AMNA 4E5WA 4I92A 4RX5A 4NWMA 3R04A 5LXMA 2G15A 2IZUA 1WBVA 1WCCA 2ERZE 3QTWA 3FZRA 4XNEA 3PJ1A 5T6KA 3TKHA 1KE9A 1BYGA 1TVOA 4F7LA 5CU2A 4YZNA 4AAAA 4DFXE 1PJKA 1XQZA 1J7LA 4EJ7A 4FKJA 4D58A 2QR8A 4LYNA 3WF7A 4KUJA 5E1EA 2CSNA 3EB0A 2XNPA 3CSVA 2GTMA 3Q53A 5EYMA 5FRIA 2YABA 1JKLA 1PMUA 5BVDA 3MW1A 5BMMA 2X4ZA 2IZTA 5FD2A 4EH6A 4ZTMA 3VNTA 2A27A 4IAIA 2OH4A 2QKRA 4PMMA 5ANJA 3BRBA 4UEUA 1H1PA 4AWIA 5E8WA 4PP7A 1RDQE 3QHWA 2HW7A 4A9YA 3OW3A 4OT5A 1PXMA 3NYNA 2WMBA 4L6QA 3DK3A 1OL7A 1M2QA 3NVMB 5CSPA 1UVRA 2OXYA 2O3PA 1STCE 4BCKA 3F88A 3JY0A 4LRKA 5L8KA 3GU6A 4CRSA 3TKUA 2CKQA 3SGCA 3R7OA 2I0EA 3K5VA 3BX5A 2XVDA 5C26A 5ANGA 3TTJA 2R3MA 4XS2A 3AGLA 3R8ZA 1BL6A 4FSNA 4JDJA 5I9XA 2XEYA 3RKBA 4D55A 1OL1A 4WBOA 2YM4A 4FKPA 4YHFA 3WIKA 4FK3A 2HZIA 2JEDA 3F9NA 4MAOA 4QYEA 4BDBA 4D0WA 3E93A 4KWPA 4ARKA 2F57A 5KBQA 5KMNA 5A9UA 4CMOA 4QYGA 2EU9A 3NNUA 3RTPA 4XLIA 4FIIA 2XYNA 3D94A 2P0CA 3KCKA 2WD1A 3G33A 3SHEA 4FKOA 3Q3BA 5CEPA 4DN5A 2DYLA 2VWIA 2I6LA 4IX3A 3HMPA 4RZVA 2JD5A 4O86A 3F82A 4L3LA 3OP5A 3KF7A 5CLPA 4CLJA 5KZ0A 2VRXA 4CFUA 4JBPA 4D9UA 2ITNA 3UOJA 5CSHA 4Y85A 4YPSA 3R30A 5HIBA 3A7IA 4EYMA 3DDPA 3VRZA 2CGVA 2HXLA 2YM6A 5EHLA 4YO4A 4WBBB 3QLFA 4BC6A 1ZRZA 3UYSA 3NS9A 4QP7A 1Z5MA 3TIZA 4BZDA 3BEAA 2X8IA 4NW6A 2NRUA 3ZEWA 3VQHA 4DEDA 3LJ1A 5H8BA 3TNQB 2QI8A 2PU8A 2J0LA 4N6ZA 4NL0A 5HESA 2C3JA 5HNBA 4AZEA 4ZEGA 1XBAA 2HELA 1JPAA 2R3OA 2ITWA 2UUEA 2X0GA 3RZBA 3DKOA 4IWQA 3IDBA 2V0DA 3AC1A 2XK3A 2JGZA 4LUEA 3EMGA 3Q4CA 4RIXA 4TWPA 1YW2A 2DS1A 4OTRA 4CFVA 2X4FA 3CJGA 4DT8A 3Q9XA 5HBHA 3VUMA 3ZFXA 1RE8A 3NYXA 3L8SA 5FBOA 4CVAA 4DGMA 3FEGA 5KMKA 3FKOA 4PMTA 3LCSA 5CANA 5D11A 4R1VA 2BRNA 3SLSA 3W16A 4M13A 3KXNA 4FKUA 4NT4A 5FUTA 4A9TA 3NNXA 4FYNA 4YJUA 3R7EA 4ZSEA 5AV4A 5K5NA 5KHXA 3GCPA 3ZO1A 2Y4PA 3FPMA 4USFA 3DXQA 4WHZA 5CVGA 4ITJA 3KXXA 2YA9A 4TWCA 4FV7A 2IZRA 3FZSA 3IS5A 1Q3DA 3I0OA 4C0TA 2WEVA 3PRIA 5JKGA 3F66A 4CT1A 3PG3A 2B9HA 3T3UA 2I7QA 2XNGA 4Z16A 1M17A 1GZKA 1OL2A 2V7OA 3DGKA 4GT4A 5CVHA 5B7VA 5M56A 1GOLA 2KULA 3PIYA 5LMKC 3KREA 4I5PA 2YDJA 4YTIA 3RAKA 2XP2A 4FTIA 4XRJA 2H8HA 3MI9A 2CNUA 3ZM4A 3NEWA 3CQUA 2OGVA 5HCYA 3LQ8A 4ALVA 5HU3A 3PA3A 1OGUA 2C68A 4FZAB 5DT3A 3DZOA 3KQ7A 4EHZA 4H05A 2YITA 3HL7A 2UW5A 4FKLA 1J7UA 3JVRA 5JRSA 3ETAA 3GC9A 5ITAA 2QODA 2UVYA 3VUIA 3TV7A 1F5QA 2VWUA 3EN5A 3QALE 4QP8A 5E8YA 4MNEB 2ZDUA 2OWBA 4CG9A 2I40A 3EH9A 3PLSA 3ZTXA 4AZWA 4EC8A 2Z7SA 1JLUE 3QRUA 1WVYA 2XA4A 5M4CA 4IM0A 4BDKA 4F09A 4JX7A 3PUPA 3OUNB 4LOPA 2PVNA 3BE2A 4W8EA 3KRJA 2FSMX 2UZTA 3EFKA 4HVGA 3CGFA 2W99B 3KA0A 4DYMA 3G9NA 4U41A 4U45A 4RVKA 4NCTA 2XJ1A 4V04A 3RK7A 4M0YA 3I79A 3DY7A 3TV4A 1JAMA 3HAMA 3TXOA 4CMUA 4EOQA 1JBPE 2W05A 3BU3A 4CEGA 1OZ1A 4FSUA 4W4WA 4CZUA 5JQ5A 5LVMA 5CSWA 4BDGA 2C5NA 2OJIA 1ZOGA 2WO6A 4JBQA 3QGWA 2C47A 4CFXA 4FEUA 4ORKA 2WMVA 2PVYA 3ZDIA 3F3TA 3KK9A 1JOWB 3DLSA 3MY1A 4IADA 2ETKA 4TN6A 2WELA 4YPDA 4YLKA 5DFPA 1U54B 4D5HA 4CT2A 5JT2A 3UZTA 2BRGA 1FOTA 4D1ZA 4FTAA 2ZMCA 3F5XA 2WTKB 4FSMA 3BLHA 1H1QA 1VZOA 2UZNA 3FMKA 4IM3A 5FXRA 5ACKA 3ZM9A 4GRBA 3QC4A 4JRVA 1DAWA 4FL2A 5ICPA 4OUCA 2EB3A 5A4CA 3FSKA 2IZSA 4JIKA 2RG6A 4LL5A 4PDYA 2NNWB 4YJTA 3F2AA 3R8PA 3NUXA 4YP8A 1MQ4A 4R5YA 2UW7A 4F08A 4PWNA 4XLVA 4IJ9A 4DG3E 4AZVA 1JKSA 2EB2A 4GU9A 4GCJA 4MBJA 4GFMA 2C0TA 4IWPA 2XCHA 3U8WA 1ZWSA 2R3RA 4D4RA 2JC6A 4BTKA 1T45A 2ERKA 3I5ZA 4O22A 4JS8A 5A46A 2XIYA 2DWBA 3FI2A 4APCA 2OXXA 3EFWA 4XOZA 4XYFA 4C2WA 3HYHA 5LMKA 2Q83A 3A99A 3QUDA 4C4EA 2KTYA 2UV2A 4IAAA 4UYNA 1XWSA 3HGKA 5E90A 4FSRA 3MVMA 3UYTA 3VS2A 4RX8A 4FT9A 3VVHA 3E8EA 3ITZA 4KBCA 4AS0A 4UY9A 4HVIA 4C59A 4E1ZA 4L3JA 3QQKA 4AE6A 1B6CB 2R3QA 3PWDA 3KXGA 3GNIB 3IPHA 3ZDUA 3LPBA 2VWBA 4QMLA 4XJ0A 5AAEA 3FZPA 3GOKA 1RJBA 5CALA 5IH4A 5I5ZA 1F3MC 5FEDA 4F4PA 2XF0A 3QD4A 3JUHA 2REIA 4TNDA 3C1XA 4GW8A 4QTEA 3PLAE 1CDKA 4KKGA 1Q3WA 4RLLA 3MPMA 2VWVA 3IKAA 4AN9A 4J8MA 3UZRA 4ZP5A 4EQUA 2Z02A 5CTPA 1O6KA 3G5DA 4I93A 3BKBA 5HGIA 1SM2A 2HZ4A 3PTGA 5K3YA 1PMVA 2F49A 2YAKA 4LQMA 2W9FB 4I4FA 2ZM4A 4MXZA 3E3BX 4JL9A 1FGKA 5LWNA 1A48A 1R1WA 4TWNA 5DR6A 4G31A 4RPVA 2J6MA 4GK3A 4RX7A 5EHYA 4D1XA 3CBLA 4BIEA 4FV4A 5CAUA 3OG7A 3BWFA 1M7NA 4Z7GA 2B52A 4MQ2A 2R3HA 4EYJA 2QHMA 4FZ7A 4HZSA 3QRTA 4WO5A 3AC5A 3UIXA 4JG6A 5I9WA 3R9HA 3UQFA 3WZJA 4FV1A 2QOOA 5H8GA 4KKHA 4BRXA 4I0SA 3U6IA 1E1XA 4KSQA 3AG9A 5HVKA 4FMQA 5LVPA 3LM0A 2YHVA 3G0FA 4FG8A 4X3FC 3ROCA 4BBFA 1OUYA 1U4DA 3N51A 3H0ZA 4ITIA 5AUZA 3RHKA 3DK7A 2PWLA 2V7AA 3R63A 3L8XA 3G6GA 5AM6A 3UO4A 3F3ZA 4QQJA 1ZLTA 1Q97A 2XS0A 3VS4A 3MH0A 3LE6A 5CAVA 3LCTA 1WBNA 4B0GA 1K3AA 4ZMEA 1KWPA 4QTDA 2QQ7A 1QCFA 4XG6A 3E62A 4ZTRA 2RG5A 3E88A 4H36A 4RJ6A 5FEEA 4YU2A 4QPSA 2QD9A 5M53A 4L7FA 2Z8CA 4LOQA 3VJNA 3ZZEA 3OD6X 3OOMA 2R7IA 4LUDA 2VWZA 1ZOEA 5AA8A 4QMWA 3Q32A 5DRDA 4FZ6A 3PIZA 1XHAA 3AT3A 3ORLA 3BV3A 3CXWA 4I5HA 2A1AB 4AP7A 2YJSA 4BR3A 5HLPA 3RWPA 2XJ0A 5H3QA 3UIMA 5AP0A 2GQRA 5KMOA 1APME 2PE0A 4G3EA 1IAHA 3L9PA 5IZFA 4E5AX 5IPJA 4CD0A 4G3DA 3O51A 3QQUA 4X2KA 3QWKA 5ANEA 3ZRKA 3I6WA 3D5WA 4C4FA 4D4SA 5IU2A 3EN9A 5EQEA 3P7BA 4F9WA 2UZOA 3E5AA 5AADA 5IDNA 3FJQE 4A07A 4MXAA 5FM3A 4TW9A 3RK9A 5BNJA 4ZY6A 5DEWA 3BGQA 4E4MA 5DA3A 3BU5A 1EH4A 3A8XA 1W8CA 3POZA 1V0OA 3Q6WA 3MN3A 4FUYA 4GL9A 4ZIMA 5IH6A 5FDPA 3GVUA 5IG1A 3CR0A 1RQQA 5LMAA 3V5WA 4AGWA 4ALUA 3LIJA 1AGWA 3LJ0A 5HG7A 4QMNA 3TACA 3HVCA 3QQFA 4DEBA 4L46A 4OR5A 3MPTA 4U42A 4GMYA 4F64A 5LVOA 3QFVA 3M42A 2G2IA 3PJ8A 3PSDA 1WZYA 3EQFA 2UW3A 5D12A 2BFXA 4E5BA 4KBAA 1FQ1B 4DITA 3RPOA 1MUOA 4X2JA 3LXLA 3T9IA 1PY5A 2OK1A 2PVLA 5HI2A 2CMWA 4OLIA 5E92A 4E6CA 2W1DA 3BIZA 2GQGA 3BYSA 5CU4A 3HMMA 4RA5A 3SOAA 4I24A 3BGPA 3CS9A 1JSTA 2W1HA 3W2CA 1KE8A 4NU1A 3R22A 4ZZMA 2R2PA 4EH4A 5FDXA 3MB7A 2IVTA 4ACDA 2VTOA 4QTBA 3QCXA 4H39A 3VBWA 4ENYA 4EOLA 1H01A 1TQMA 5F1ZA 3RWQA 1R39A 3WARA 5KMJA 3DOGA 4RIXB 5EW8A 4YZ9A 4YC6A 4O7RA 4OTDA 5CF6A 5H8EA 3S1HA 4DTKA 2GSFA 4KNBA 5CAPA 5FTGA 2EUFB 3TI1A 4IQ6A 4EUTA 3UVPA 2YIYA 1Q8TA 4I23A 2CLQA 4K11A 2CNVA 2JFLA 1CKIA 4EZ5A 5K4JA 3F2RA 2BDJA 5DEYA 2VTPA 3UOKA 5HTBA 4P5QA 3LM5A 1SNUA 2RIOA 1REKA 5HHWA 4IE9A 2ZV7A 2GNJA 4FTJA 5D7VA 2XZSA 4FIEA 1XH4A 4DTBA 4GEOA 4N0SA 3ACJA 3BHHA 3KB7A 4R3CA 3UNZA 5JH6A 2AC5A 2B7AA 4AT5A 3GCQA 3W32A 2QO9A 2ZDTA 3RI1A 3Q5IA 5J7HA 3CY3A 3ORZA 5L8JA 3R7UA 4OW8A 5FXQA 5JEBA 1E9HA 4BY9E 2BVAA 3RPSA 2QCSA 4D0XA 4C7TA 2DQ7X 4X2GA 1ERKA 3R1SA 4E7WA 4BDJA 3DBDA 3HAVA 2VTIA 4AGUA 4KRCA 5CZIA 4U7ZA 3SA0A 5CXHA 2QVSE 3O8TA 2GNIA 3IW8A 3CJFA 3QYWA 4JLCA 4XG7A 3KULA 4FIJA 3NUYA 3Q5ZA 2UZDA 4JAJA 3LFBA 2WGJA 4I6FA 2BKKA 2HIWA 3CY2A 4MD7E 3FQHA 4TY1A 2CGXA 5GINE 4FSYA 5AIKA 5CEKA 3CCNA 2FH9A 4MQ1A 3DBEA 3IOKA 1YWVA 2QOFA 4XRLA 3MA6A 1FINA 2Y8OA 4I6BA 5IDPA 5J1WA 4RVLA 1OIUA 4X0MA 2C6EA 5DT0A 4YHJA 4IFCA 2OJGA 2R5TA 5C9CA 5IUHA 3GU8A 4GFGA 2HK5A 2PL0A 2NRYA 1FVTA 1CKJA 2CLXA 2GS6A 3G0EA 2W4JA 4RFMA 1PXLA 4C3RA 4O91A 4JRNA 3UOLA 3HLLA 3AC3A 3EN7A 2H96A 3FMDA 4IAFA 3ORPA 5AUVA 3QKKA 1F0QA 3JPVA 3R0TA 4Y5HA 4CV8A 2WU6A 1UNHA 2HWPA 4RC2A 1PMNA 5J5SA 4QMUA 5CNNA 3SVVA 1WVWA 3R7IA 3GCVA 4WSYA 1M14A 2C3IB 3KKVA 3F6XA 1UU7A 2R3IA 4PNIA 1G8SA 3U6HA 3ZSHA 4HVDA 3BYUA 5CQUA 4M14A 5CWZA 1SNXA 3SW7A 3DQWA 3F3VA 1B38A 2FSLX 4FL3A 3TNIA 3P7CA 3V6SA 1YRPA 5KMIA 3M1SA 4O21A 1GIIA 5IH5A 4XV3A 3VS6A 3QBNA 4RIYB 4BCQA 4BCHA 2C5VA 2GHMA 3CP9A 2VTSA 3DLZA 4EHEA 3GU4A 3C4ZA 4V05A 3NWWA 2F7EE 4IEBA 1SVEA 3CLYA 3BZ3A 1OL5A 4ZOGA 4IC7A 4FTTA 4OGRA 1H1SA 2HY0A 4F0GA 4FODA 1DI8A 3DV3A 4Q5EA 3NRMA 4GVJA 3UE4A 3ZU7A 3NR9A 4XUFA 3QWJA 2B9IA 2VTHA 4XX9A 4UALA 4O27B 2VUWA 2FSTX 3C50A 1JNKA 2ZYBA 5CU0A 5E8UA 5TR6A 1H8FA 4HPUE 4DH3A 2BHEA 4EH8A 2OIBA 3RCDA 5JFXA 4K8AA 3V51A 3ANQA 2WFYA 1JQHA 4FTOA 4ZSJA 5HD4A 5C03A 4FV2A 4L43A 3CGOA 2AYPA 4M0ZA 1NA7A 4LG4A 3V04A 3MVJA 3SOCA 3KC3A 3MGYA 3ZRLA 1XO2B 2YIXA 3KL8A 3W1FA 2C6MA 3ORTA 1Y91A 3I60A 4NTTA 2I0YA 4Q9SA 4E20A 5F9EA 5HE2A 3AQVA 3ZZWA 4OTWA 4ZY4A 1H0WA 4P5ZA 4BB4A 4QMVA 4AW1A 3NNWA 1PXOA 1UWHA 5HQ0A 4D4YA 3D2IA 3QZGA 2WTWA 3P78A 3T3VA 4F99A 5HBJA 2XNOA 3D83A 1AQ1A 3CPBA 3GQLA 4DFBA 5CF5A 3IDPA 3MJ2A 3VIDA 1FVRA 2QOHA 2YCFA 1DS5A 1XH5A 3GOPA 3GXLA 4V0GB 4WNPA 3V5TA 4ZTNA 3PZHA 4FSQA 4GU6A 3FLZA 2BDWA 3DBCA 5H2UA 3W10A 3D5XA 1VYZA 2B9FA 4IZ7A 1VJYA 3N4TA 1O6YA 3KMMA 5M09A 2QLQA 4N4SA 1LEZA 4A4XA 3PVUA 1O6LA 3DFCB 4S2ZA 3VS5A 2R64A 3QQLA 3A2CA 4RQKA 2J0KA 3OOGA 4ZMFA 3F61A 4F6SA 2QO7A 3PWYA 1VEBA 1NVRA 1TQPA 3O0GA 3PE2A 3G9LX 4L45A 3PVWA 3P7AA 2OG8A 2YWPA 1BX6A 4BCPA 3FLWA 1XH7A 3R02A 3ZMMA 5IQHA 4R7HA 3MS9A 2YM5A 4FTUA 4ZSLA 3V5QA 1OKZA 1PXIA 3QRIA 5ANOA 4TZRA 2B55A 4UV0A 5D9HA 1WMKA 3AD4A 2WTIA 4IW0A 3TJCA 3NVKI 2E9UA 2W1EA 3SG8A 4XP2A 1MQBA 3FMNA 4F7JA 5BVNA 1SYKA 4BI1A 3POOA 3OC1A 4WKQA 1PRYA 2GHGA 2IVVA 4YNEA 3FPQA 3MY5A 4L42A 1YHWA 2JBOA 4EI4A 3LQ3A 4L7SA 1JSUA 4Y46A 5L2IA 4AW2A 5L6OA 2C6DA 3NDMA 3OCSA 2BILB 2ZM3A 2C6LA 3CKXA 3FXXA 3OS3A 3SW4A 4DEAA 4L3PA 2JKKA 2F4JA 3MIYA 4F1TA 3NUSA 3JY9A 1IASA 5CI7A 2ITTA 5E91A 4BDAA 4C3FA 2XM9A 5D7AA 4FT5A 1WVXA 5M4IA 5EH0A 5AP6A 1GIHA 2I1MA 1YXVA 3LFCA 4TTHB 2C0OA 2QOQA 4XP0A 4IVAA 4J7BA 5HCXA 3EFLA 3F69A 1GJOA 3ORXA 4MYGA 4B4LA 4O7VA 4TYIA 1Q61A 2RFSA 3FZOA 3KCFA 4RJ5A 1AD5A 3UC3A 4ANBA 1ND4A 3MV5A 3VUKA 5ETAA 1UWJA 2QO2A 2WMUA 3EN6A 5F4NA 2UZLA 3TNWA 4DCAA 2VWWA 3NSZA 4LOOA 3O7LB 5GHVA 4O81A 4D1SA 3DXPA 3QAME 2ETMA 5AJQA 5JSMA 4FKQA 4DH7A 4JDHA 1H07A 5BUIA 3FLQA 2HZ0A 3O17A 4FT3A 3T9TA 4GK4A 3OXTA 4HW7A 2PUUA 4NM5A 3LXNA 3BHYA 2PULA 1NT2A 4FKSA 5M4UA 3P1AA 2V5QA 4NFNA 4IIRA 2XCKA 1ATPE 4HNIA 4NJ3A 4YBJA 2HYYA 5DLSA 4C58A 4HGLA 2CGWA 3AXWA 4U43A 4FKGA 4NFMA 4ZSAA 5M4FA 4MD9E 4NCTC 4O0UA 3QU0A 5BUJA 5CU6A 1MP8A 3PYYA 3OUKA 2GNFA 5CS6A 4MHAA 4MX9A 4TPTA 2VO0A 2YZLA 2F2CB 2O63A 3QA0A 1Q62A 3HX4A 4O96A 4TYHB 4APPA 3AD5A 4CNHA 4M68A 4RVTA 2QOLA 2ZAZA 1BL7A 4AA5A 5EQYA 3C13A 2XK7A 4NW5A 2ITYA 3BV2A 4PTEA 4TKSA 3WYXA 4DBXA 3ENMA 2C3LA 3R9OA 4DF3A 2BTRA 2QOBA 2QURA 3CKWA 5DPVA 5JQ8A 3P08A 5EM7A 4BTFA 3FMMA 3LMIA 3NYOA 4O0XA 1KE7A 5EI6A 3K3JA 4IZ5A 4O0YA 3IGOA 5EM5A 3PP1A 4DH1A 4UWYA 4CCBA 4QMSA 5CF4A 2WEIA 4M69B 5K9IA 5EG3A 4I3ZA 4S30A 3RCJA 3IOPA 4LMUA 4C33A 5L2SA 4FNXA 5EOBA 3MYGA 1PF8A 2OFUA 5E4HA 3WF5A 5M07A 3PXYA 5EW3A 1U46A 4GT3A 1V1KA 4FSTA 2C5YA 4L67A 3F2NA 4AF3A 3A7FA 3I5NA 4XP3A 2W96B 5EM6A 4UZDA 4X3FB 5M06A 4F63A 2ITOA 3O96A 4XG9A 2IJMA 4IH8A 4O7WA 5C8KA 3A61A 3W18A 4PP9A 2J4ZA 4E26A 1W83A 3W2RA 4C35A 4ID7A 1Y6AA 4A06A 4DEHA 3Q4UA 1XH9A 4NK9A 3CTJA 4EOKA 5DIAA 5AV0A 2W5AA 2W1GA 2X7GA 4AA4A 4BVUA 3QCSA 4QMOA 3ZXTA 4ASZA 4O0TA 4E4XA 3D15A 2OZAB 3SXRA 1XKKA 3NUAA 4EZ7A 5CF8A 4LGGA 1FBNA 1IA8A 3ZFMA 3ORKA 3ZO2A 1FMOE 2ESMA 3LCKA 3RM6A 4FEXA 2VTAA 2B53A 2XBJA 4FOCA 3RM7A 4D5KA 4EK5A 3CTQA 4MTAA 2VV9A 2G1TA 3I0QA 4U81A 4DBNA 1J91A 1WAKA 5J95A 1OVEA 3SXFA 5HLNA 4YLLA 2BAJA 3N4VA 3SC1A 3R2BA 3ZLYA 3QZHA 4S33A 4DEEA 5AFVA 3Q04A 1UNGA 3OY3A 3FI3A 5I9VA 4FVRA 1OBGA 1GIJA 3HP2A 3BLQA 3LHJA 2W06A 4J71A 3LFEA 3HECA 4FK6A 2GNLA 4IAYA 4BZOA 3CE3A 2E9VA 2UW8A 2YJRA 3PXFA 3Q2MA 4X21A 4ZS0A 2W1FA 3TL8A 4A9SA 3G2FA 4FKVA 3UC4A 1IR3A 1Y6BA 2C6OA 3PPJA 1ZY4A 2VWXA 1OITA 2JAMA 4ACGA 3PY0A 4O7YA 3IW4A 4RIWB 4ANSA 1OUKA 2X39A 3LQ5A 5ETIA 3AD6A 1GZOA 2G01A 3ZO3A 4CQEA 2XK4A 4FZDB 2GQSA 3LAUA 1WBSA 4Q2AA 3W8LA 1FMKA 1PXKA 4IB0A 2A4LA 4RWKA 4WG4A 5JZNA 3W2QA 3PXKA 3VUHA 4HVHA 4FC0A 5AUTA 4KIPA 1XBCA 4Y5QA 4GFOA 2XIZA 3H3CA 4YTHA 4ANLA 2CN8A 4CFNA 4WG5A 4Z9LA 4RQVA 4WG3A 4OTHA 5ANKA 3DB6A 3I7BA 1YOLA 2JAVA 2QG7A 3SX9A 3F7ZA 3MSSA 3T8OA 3TNPC 1MRVA 3EQPA 5AAGA 3UPXA 4NM0A 1DAYA 3U87A 3MJ1A 2Y0AA 4R77A 5AV2A 3D5VA 3DBQA 4C62A 4GKIA 4O0SA 4RLKA 3E3PA 4USDA 4UYAA 1P4FA 2R3GA 4M3QA 4PUZA 3QXOA 5M55A 4BDFA 1OPLA 3PXQA 3VS3A 4YUQA 3QX4A 3I4BA 3ZHPC 2F7XE 3OEZA 4ZSGA 4KS7A 3LFAA 3Q6UA 3LXKA 3WZKA 1P14A 4EWHA 3KXHA 3DNDA 3FXWA 3Q96A 3MTFA 3UO5A 4QMMA 4JQ7A 3QTUA 3BCEA 2JKOA 5CT7A 4GT5A 4I20A 4WT6A 2P2IA 3ENHA 4MXOA 2J51A 3GC7A 1A06A 4YJOA 2WMTA 1RW8A 4CMTA 3UQCA 3MFUA 3HMIA 5KZIA 3R83A 3TUCA 4BF2A 5JGDA 2JDSA 1QL6A 3Q9YA 3ATSA 3F5PA 4G17A 3KVXA 2Y4IC 3UMXA 3TZ9A 1B39A 3FL4A 5H9BA 4BGGA 4EORA 3QCQA 3TUBA 2UW4A 3DKFA 2VGOA 2WU7A 3NUNA 4RC4A 4YGAA 5KHWA 3RAIA 5A4LA 3FBVA 1CM8A 1QPEA 2C30A 5AV3A 3ZBFA 2UW0A 1CTPE 2W1CA 4FUXA 3BE9A 5LOHA 1OPJA 4IACA 3DFAA 3HEGA 3EJ1A 5FXSA 5IMXA 2R4BA 1HOWA 2P33A 2VTNA 4O7NA 4I22A 3OCTA 4JVGA 3PZEA 2Q0NA 5DHJA 1M7QA 3TV6A 4BCIA 5C01A 4C61A 4IDTA 5KCVA 1PXJA 3Q9WA 2UZWE 2XRUA 5CX9A 2VO3A 4JDIA 2W0JA 4FV3A 4QYFA 1QMZA 2JFMA 5DI1A 5F95A 5GJFA 2PVFA 2OF4A 5G1XA 2VX1A 3WIGA 5IQIA 2FGIA 3D0EA 3E63A 4J98A 3HP5A 3BYMA 1K9AA 1J7IA 3LVPA 3Q2JA 4JBVA 4M67A 1E1VA 1PYXA 5IEVA 5LWMA 2WTDA 2BPMA 3HRFA 2QOCA 3QX2A 2XBAA 3KY2A 4FKIA 5CNOA 5ETCA 2XKFA 2BRMA 4BKJA 3EYGA 4DH8A 4HCUA 3NAYA 3COKA 4ZTLA 1J3HA 4CKIA 2FSOX 3QYZA 4FV9A 4EBWA 5BVKA 2W9ZB 2ONLC 3ERKA 2XKEA 4TXCA 5CVFA 4QQCA 1UNLA 3TEIA 3NX8A 3WI6A 4RGJA 5HG8A 3R8VA 3FY2A 3BYOA 2WTVA 5EI8A 4DT9A 4Z3VA 5CXZA 3BI6A 2VN9A 3LFSA 1OL6A 3KVWA 4EQCA 2F9GA 4TYJA 3U6JA 2J0MB 4AQCA 3PIXA 5EDQA 4CFWA 1DI9A 5GIPE 2JIIA 2YWVA 3QQJA 1KUTA 2WB8A 3KXMA 3QUEA 4DG2E 2R3PA 4LL0A 1PKGA 5AP1A 5KBRA 4YZDA 2VTTA 4U5JA 1FVVA 4R3PA 5CEQA 4ENXA 5JGBA 3SKCA 2PE2A 3W2PA 5AAFA 4B99A 2PYWA 2GFCA 2YACA 3B8RA 3REPA 4BDHA 3DT1A 4NJDA 2PVRA 4DLIA 5AA9A 2BMCA 3QTIA 4P7EA 2PY3A 3FHIA 4R7BA 3VN9A 4U6RA 2BRBA 4AX8A 2J5FA 2VO7A 4U79A 5HVJA 5FP5A 3LXPA 3ELJA 1UU8A 3MFSA 3EQDA 4AZTA 4DC2A 3QD3A 3NIZA 4M97A 4UWBA 3ZEPA 2QONA 5BVEA 2HW6A 1HCLA 3V8TA 4FZFB 3NW6A 4HJOA 3NZ0A 3BEGA 3LW0A 3OT8A 4U44A 4A4LA 3F5UA 1ZXEA 3D7TA 3TKIA 4G9CA 1V0PA 3QTZA 4G1WA 3L1SA 4D2SA 4I94A 4HGEA 2VTMA 4HGSA 5KKRC 4GKHA 3OVVA 4I1ZA 4ANMA 5CQWA 4FT0A 1QPCA 2WTJA 3PJ2A 3TUDA 3FXZA 3DTWA 4YBKA 3QD0A 4ONAA 1Q8YA 2R3FA 3D5UA 3QKMA 4O0WA 4PMSA 5AV1A 3VS7A 4C38A 4FTQA 4HZRA 4O82A 3LKMA 2G2FA 2X2LA 1ZZLA 2HXQA 2YM3A 4RC3A 2RFDA 3U54A 3FV8A 2OO8X 2UW6A 1SVGA 1ZAOA 1T46A 4DINA 3FSFA 3JXWA 1YXSA 2HAKA 2YCQA 3D14A 3O8UA 5ETFA 2Y6OA 4FNWA 5TT7A 2LAVA 2I0VA 1Z9XA 2QHNA 4DGNA 4IZYA 4AW0A 5JMSA 4BCNA 3TZMA 2WMSA 5A6NA 4N6YA 1LR4A 1H1WA 4C2VA 3AT4A 3QA8A 3FI4A 3QZIA 3UODA 4G3CA 5DNRA 1G5SA 3OMVA 4KD1A 4Y72A 4BDIA 4F65A 2ONLA 4NTSA 4Y83A 2GU8A 3ID6C 1GZ8A 5D1JA 4JNWA 2CKPA 2UVZA 3NLBA 4WNKA 2W4OA 2QU5A 4FSZA 4P4CA 4WNOA 3R8UA 5B2MA 4UB7A 3VBYA 3S00A 2J5EA 4C4JA 5TO8A 3CTHA 3F3UA 3R6XA 4GIIA 2R0UA 4XV9A 5J87A 3VUDA 2XB7A 4M8TA 5HVYA 1Y57A 4BI0A 3V5JA 3FLSA 3G51A 3L8VA 4IVDA 4OTIA 1ZMWA 2BKZA 2OKRA 3ALOA 2GHLA 3HMNA 2W5HA 3AT2A 2OLCA 4FI1A 2C6KA 3WZEA 1YOMA 3MY0A 3DB8A 4PDOA 4CZTA 4E93A 4B8LA 2C1BA 1OBDA 2EXCX 4AUAA 3DJ5A 3BLRA 2YFXA 5D41A 3EKNA 1YI6A 4GVAA 4AOIA 3U51A 4KS8A 1ZMVA 3MBLA 4RWJA 3DZQA 1LP4A 4A9RA 2GCDA 4K2RA 4MKCA 3ATTA 3HV3A 5I9UA 5M44A 4ZK5A 3VAPA 3P5KA 4X7QA 3UQGA 4FSWA 1ZYSA 2PVJA 5GJDA 5GNKA 4EH2A 3CD3A 2F7ZE 1ZYCA 2X81A 3GGFA 1PXNA 3KK8A 3E8CA 2J0JA 4A9UA 5HBEA 1Q24A 2OJFE 1G3NA 2CJMA 4C36A 4QMQA 3TT0A 3E7VA 4AT4A 2OICA 3MVLA 4A7CA 4EL9A 3P0MA 1WBTA 4ZTHA 2X2MA 1OI9A 2YDIA 4OTQA 4MVFA 4O7LA 2NPQA 3FZTA 4OT6A 5L2TA 2CCIA 3ZBXA 4NSTA 4K1BA 1KOAA 5EI2A 2Y7JA 3O7LD 3ULIA 2BZJA 2RFEA 4AW5A 3MA3A 5KUPA 3HDMA 4WUNA 5D10A 2CNQA 5EW9A 2JIUA 3AC4A 4X2NA 4RT7A 3TJDA 4XG4A 3C0IA 3B8QA 3S0OA 4DA5A 5DE2A 3EQCA 3VBQA 2YIRA 3PY3A 4F0FA 4HYUA 4FTKA 2XRWA 3R28A 3OTVA 4JX3A 4EH9A 3MDYA 1JKTA 4P2KA 4QNAA 4FG9A 1BI7A 4R3RA 4QMXA 4FTCA 2R9SA 5C8NA 1IEPA 2IN6A 2QC6A 4J8NA 4MNEA 3UP7A 5HKMA 4C4IA 1YOJA 2XMYA 4GYGA 5EYKA 4KB8A 5A3XA 2OZOA 5BVWA 3EIDA 3W2OA 2AC3A 3WE8A 1S9JA 4A4OA 4FGBA 5A14A 5IA1A 3DA6A 3HUCA 3FC2A 3ZYAA 5LJJA 2YN8A 4RBLA 2XKDA 4PTCA 4O6EA 3VF8A 4MWIA 5AIRA 1XJDA 4S31A 5JK3A 1WBWA 1YI3A 3KRRA 3DTCA 4XV1A 3HKOA 4PV0A 3S4QA 4PRJA 3H0YA 5GJGA 4QP9A 4MCVA 3HV4A 4JJRA 4YZCA 4IWDA 2VX0A 4NKAA 1Y8GA 3DJ6A 5E9EA 5L8LA 5FP6A 3HRCA 4FEVA 4G16A 4QRCA 4BHNA 3BHUA 3E8DA 3HZTA 3FKNA 4RFZA 3VBTA 4BYJA 3IQ7A 3FAAA 3NUUA 4EONA 2E9OA 4O2ZA 2BZIB 4YURA 4DTAA 3CEKA 2IO6A 3PE1A 3QKLA 5I9YA 3JVSA 3OZ6A 1H1RA 2WIPA 4NM3A 1U54A 3V5PA 3PPZA 2R3KA 4PF4A 5IQAA 4FVPA 2BALA 2FO0A 4QTAA 5JRQA 5HCZA 4B7TA 4UN0C 5HE3A 4HVSA 5KMMA 3DAEA 3BGZA 2XNMA 3N4UA 3O23A 3P23A 3FDNA 1KV1A 3OEFX 2GMXA 4FTRA 3NGAA 2VU3A 1YQJA 3DS6A 3EYHA 4U40A 3HA6A 4QPAA 4RJ3A 2B0QA 2X9EA 5TOZA 4X6QC 3MH1A 4AE9A 3KRLA 5IEYA 5CSVA 2VO6A 4BTMA 5CAOA 4GK2A 1JVPP 3ORNA 2NO3A 4JG7A 1IAJA 2YM8A 4IX4A 4GSBA 3UJGA 5L6WL 3IO7A 3RAWA 4C37A 1J1BA 4AACA 2X2KA 3LFNA 1JWHA 4V01A 5BQ0A 2VTLA 3DDQA 3LFDA 4ZLOA 1H26A 2WXVA 3QTSA 5CY3A 4W4VA 5LARA 4E73A 2X8DA 4FA2A 3VW8A 3EQIA 3G90X 3NPCA 2ZJWA 2Y9QA 1ZOHA 2CPKE 2Y6MA 4XEYA 4RIOA 3G15A 4ERKA 5AP5A 3BQRA 5A4EA 4N57A 2PSQA 4I41A 3R8LA 3R00A 1K2PA 1LEWA 3NW5A 4Q5HA 4ACHA 2FVDA 4BZNA 4G3FA 3FC1X 4ITHA 4CKJA 2XYUA 4YSMA 4E6AA 1YXTA 2J9MA 4QMTA 5FTOA 4DFYA 2HOGA 3E92A 5CEOA 2E9PA 2WPAA 3I7CA 2XNNA 4L8MA 3VUGA 3QD2B 1Z57A 3AMBA 4BTJA 5JGAA 5M57A 3ZO4A 4GUEA 2Z2WA 3OWKA 4KIOA 4XOYA 3DJ7A 4DGGA 5CYIA 3ODZX 1P5EA 1ZY5A 5E1SA 3GT8A 5TF9A 5LCJA 3A4PA 5DN3A 3WF8A 4K33A 2OU7A 4HCTA 2WMQA 4MWHA 4K9YA 1OMWA 1W0XC 5DH3A 4ZS4A 2X6DA 3D9VA 3HMOA 2P3GX 4BDEA 3H9RA 4G2FA 4J1RA 1GY3A 1J1CA 4YSJA 4I21A 3EL8A 3ET7A 4EOSA 4PL3A 4AZFA 4P90A 4FEQA 4XV2A 2H6DA 3PVGA 3ZSIA 4EBVA 4LRJA 3UG1A 4H3BA 1ZYJA 1G8AA 2PVHA 5CAQA 3VS0A 4AFJA 5J9ZA 3C4FA 4H58A 4UXLA 4ZTSA 4BGQA 3A60A 1URWA 2VX3A 5DRBA 3W33A 3C51A 3COMA 2GTNA 2YZAA 2QR7A 3FI8A 4CCUA 3FUPA 3P4KA 2JKQA 5AWMA 4F1OA 2X6EA 1W98A 3C7QA 4KAOA 3TM0A 2AUHA 3OWJA 3R1YA 4YJQA 4DLJA 4FV8A 5AP4A 4Z7HA 5IEXA 4L9IA 1H00A 4XHKB 5C27A 3RINA 4GV1A 4ZXTA 4BN1A 2JDRA 3AMYA 3LMGA 3VS1A 1H25A 3DKCA 3THBA 4H3QA 4EOJA 1Q8UA 4Y95A 4WD5A 3BBWA 3KN6A 3RVGA 3R1NA 5L6PA 3PDTA 4J53A 4L52A 4R1YA 4YC3A 3BWJA 3H4JA 3A62A 4M7IA 4YJSA 5DR2A 1NVQA 1YKRA 3PP0A 4MH7A 4S32A 3RHXA 2XM8A 3WF9A 2YM7A 1TKIA 3NCZA 4NYEA 3LFFA 3VC4A 5L2WA 4EKKA 3MVHA 1YI4A 3SQQA 4TT7A 2CCHA 3KMUA 4GYIA 3HDNA 4ASEA 3U55A 1NW1A 2YCSA 5IA0A 1OIYA 4FIFA 2PZPA 1H28A 4MF1A 3TZ7A 3UG2A 5IA2A 2BR1A 3HNGA 3KRXA 3OXZA 5FLFA 1YVJA 5M51A 2Y4IB 1H27A 3A7GA 3P86A 2WHBA 4EK8A 4YJVA 3A7JA 3U9NA 2ZV8A 4FOBA 3MH2A 3VF9A 2YEXA 1U59A 4YMJA 3IW6A 3AGMA 3O50A 2X9FA 5CZHA 2IG7A 3MB6A 3GBZA 2C5XA 2PZIA 3FMEA 5ANDA 4E6QA 4F0IA 4U0IA 1XH8A 3D7ZA 5BVFA 3R71A 4M15A 3ORMA 2O64A 1Y8YA 3R7YA 3HRBA 4RZWA 3C0HA 5FBNC 3D7TB 4FR4A 3VW6A 1UKHA 5IQDA 3SAYA 4BCGA 2RFNA 3ZH8A 4AGCA 2Z60A 4ZJVA 5B0XA 2OXDA 3ANRA 1NXKA 4O38A 3R9RA 2UZBA 4X2FA 2V55A 3LFQA 2PTKA 1IA9A 4U8ZA 4PTGA 2XIRA 4IANA 3KN5A 4JOAA 4E4LA 1UA2A 3OCBA 4M84A 4AG8A 1W84A 3IG7A 2XK6A 5J8IA 4LMNA 3EQHA 4BDDA 3FL5A 5JZJA 4IMYA 3JS2A 2EWAA 2QU6A 4NIFB 4USEA 2XNBA 3EOCA 3FE3A 4MEDA 4ASDA 4AU8A 1REJA 3E64A 3IONA 3V01A 1LPUA 1QPJA 4ZAUA 5BYYA 1KOBA 2GNGA 3OBGA 3K54A 1P4OA 3IGGA 5AM7A 1YWRA 3GP0A 4DGOA 4O7SA 5IUIA 3C9WA 2RGPA 3QGYA 3PJCA 3WOWA 4W4YA 3MPAA 3ULZA 3UP2A 1A9UA 1H08A 2ITXA 2QKWB 4F6WA 4FGRA 1OM1A 4XG3A 1W7HA 4EQMA 2H9VA 2WOUA 2XIXA 3LCOA 2C6TA 3K2LA 2R0IA 3VRYA 1H4LA 2BAKA 2O2UA 3OXIA 4FNYA 2W1ZA 3NNVA 4G3GA 3DXNA 3TNHA 4D9TA 5JFSA 2OBJA 2GPHA 1IG1A 4GIHA 2HZNA 1YDRE 2PZ5A 4KKEA 4ZJIA 4Q9ZA 5C4LA 4GJ3A 3R7VA 1Q99A 5E8SA 4RSSA 3ZONA 2WTCA 5DBXA 3CD8A 5LCKA 5KE0A 3PFQA 2VZ6A 2BROA 3QXPA 5IUGA 4HPTE 4DEIA 4I6QA 2QOKA 2PMIA 4WOVA 2GS2A 3UTOA 5FEQA 3RAHA 4CSVA 1CKPA 3AMAA 4ACCA 1PW2A 3LLAA 2PHKA 5G6VA 5IA4A 4CFMA 5E8VA 4I5CA 4U9AA 4KSPA 4FV6A 4I4EA 2J0IA 4O84A 4F7SA 4XBUA 3FLYA 3FY0A 3A4OX 3E7OA 2IWIA 3SRVA 1KE6A 4IBMA 3Q9ZA 2B54A 5AX3A 3ZCLA 2X7OA 3LJ2A 3PA5A 4HNFA 3E87A 3QQHA 4HYHA 4IDVA 2WOTA 2YCRA 3IDCA 4RMZA 3KGAA 4MBIA 5HG9A 4AT3A 5HIEA 5KKRB 4QOXA 4K18A 2ITPA 4YTFA 5I9ZA 3R2YA 2CGUA 5HO7A 4N70A 2J2IB 3ZC6A 3PSCA 4BCJA 2VNYA 4HYSA 4M12A 5HU9A 5AP3A 2VTJA 3VBVA 5JFWA 3KULB 4BIDA 5JN2A 4ANQA 4AGDA 1O9UA 3GUBA 4RG0A 5ACBC 3L9NA 4FIHA 3UOHA 4ZY5A 5HIDA 4IAZA 5HZNA 2ZOQA 2ITZA 3PRFA 4DFUA 2VAGA 4DH5A 3EN4A 4F9BA 3TN8A 3WE4A 3KXZA 4BBMA 3FWQA 3O71A 3U9CA 3V6RA 4JQEA 4IX5A 2P4IA 4CV9A 4CTBA 5IA5A 4EK6A 2CKEA 2C69A 4GS6A 2XK9A 3OF0A 4LV8A 4JT3A 4MD8E 2R7BA 4WRSA 5HD7A 3OT3A 4AOTA 4GH2A 3U4WA 3UMWA 4I5MA 3CC6A 2WQEA 3OWPA 3ZOSA 4BICA 2WQMA 4XMOA 5AX9A 4Z55A 4RVMA 3VWAA 3M2WA 4FTLA 3RALA 3O2MA 4FYOA 4IC8A 1JSVA 3NMUF 4BGHA 4E6DA 3RK5A 3W55A 4F9YA 2UZEA 4F70A 3ZSGA 3GEQA 2BIKB 3C4XA 5BMSA 2ZB0A 2VGPA 3QTQA 4OBQA 4W8DA 2OI4X 3LOKA 4CTCA 4LGHA 4L68A 5B2LA 3HA8A 4RIYA 2OFVA 5HICA 4IB1A 3LMHA 4QQ5A 2ZVAA 1Q8ZA 4FKTA 4CG8A 2PZRA 5EYCA 2WQOA 4IB3A 4UWCA 2VTRA 4YNOA 5ANIA 4DEGA 5A6OA 5DYJA 3SG9A 3N9XA 4EOOA 2PUPA 2Z7RA 3HV7A 5K5XA 2HY81 1PHKA 1V0BA 3Q4ZA 3R9DA 3QF9A 4AZSA 1CSNA 1Q4LA 3EZRA 5HX6A 5BX0A 2XIKA 2JBPA 1BUHA 4FG7A 5AUXA 2WKMA 1OPKA 3K3IA 4GG5A 4DFZE 3EQBA 2XUUA 3PXRA 4G9RA 1R3CA 3C0GA 4PL4A 4C34A 2OSCA 4L53A 2Z7QA 4PDSA 4QMYA 2FB8A 4RA4A 5L3AA 3FZ1A 2FA2A 3F3WA 3GC8A 4D28A 3FHRA 3GC0A 5LVNA 4JIAA 2O65A 5DOSA 4QP1A 5A4QA 2BZHB 2E9NA 4PL5A 2BDFA 3AC2A 4GG7A 1PKDA 3ZUVA 2B4SB 3UGCA 4DE4A 1GNGA 2RL5A 2W17A 5DVRA 3TWJA 5AUUA 4YLJA 2PPQA 2J50A 3V8SA 5EOLA 3UNJA 4J95A 2BCJA 3PY1A 4CRLA 3FYKX 3DCVA 3JR1A 4OTFA 4R7IA 3V8WA 3QCYA 3ZLWA 4CKRA 4QNYA 5I4NA 5IQCA 3MIAA 1MRUA 4FEWA 1BLXA 1GZNA 3P9JA 4IX6A 4O7ZA 4XBRA 4YC8A 2UZVA 4I6HA 3S3IA 5DWRA 3H9OA 5T68A 3W2SA 3O8PA 4V0GA 4XG2A 4YZBA 2JIVA 4YO6A 4PDPA 3OW4A 3C4WA 2J90A 4EK4A 2BIYA 5C1QB 4MK0A 5KNJA 2WMWA 4KIQA 1PXPA 5KO1A 1L3RE 4JI9A 3OFMA 1YHVA 3C5UA 1UKIA 2BTSA 1SZMA 4QO9A 5CT0A 2JLDA 4AN3A 3I6UA 3TCPA 4HGTA 4EH3A 5KMLA 1OECA 4ZTQA 2VTQA 2B9JA 2G2HA 3FLNC 4FV5A 4F6UA 1LUFA 3BYVA 3SXSA 4FVQA 4LM5A 2JITA 3FMHA 2GNHA 3BELA 4S34A 4ZZOA 3ZFYA 2O5KA 4X3JA 1P2AA 5TKDA 4CGAA 1XR1A 4Y8DA 4IWOA 1S9IA 3UVRA 3EZVA 2CDZA 2WQNA 3RGFA 3AC8A 2LGCA 3F5GA 3KFAA 3R21A 3AOXA 3PVBA 4O2PA 2VD5A 4IZAA 4FTMA 4WNMA 3RMFA 3TIYA 4O83A 1U5QA 2HENA 4RRVA 4C02A 5HE0A 5CEMA 4BCOA 2XNEA 4NUSA 2P2HA 5CU3A 2G9XA 3Q4TA 3ZUUA 2OIQA 5HX8A 3VJOA 2H34A 2A2AA 4NKSA 3C4CA 4W4XA 2R3JA 4QQTA 2W4KA 3UVQA 4FIGA 4BDCA 4IHPA 2YAAA 5T3QA 3CPCA 3P79A 2ZV2A 5HEZA 4PNKA 5LMBA 3HV5A 1YDSE 4BIBA 3VHEA 4BI2A 5EKNA 5KX8A 3ALNA 2VWYA 3F7WA 2YDKA 2J7TA 5HNGA 3A7HA 5BYZA 5J1VA 3LZBA 5JFVA 3BHVA 3RP9A 4RJ7A 1DM2A
chains in the Genus database with same CATH superfamily
4PY1A 4YR8A 3ZS5A 3K5UA 1M2RA 2IW8A 3KF4A 3WILA 2XH5A 5C8MA 4LRMA 1PYEA 2I0HA 2PUIA 3ZUTA 3C5IA 3FKLA 3COHA 4O7TA 5J9LA 2X8EA 2YISA 2OJ9A 3EFJA 1W82A 4H1JA 4BHZA 5AEPA 4DAWA 4FKWA 4LFIA 5EHOA 4QYYA 4JQ8A 1YWNA 2C3KA 4IFGA 4EOMA 2GDOA 5DT4A 1YXUA 5HE1A 5M08A 3FQSA 2R3NA 5CASA 5HTCA 2W1IA 4KRDA 5HORA 1FGIA 1YHSA 1IRKA 3Q60A 4IVCA 2JDVA 2HCKA 3EQGA 3NYVA 3R01A 5EDRA 2QOIA 2X1NA 4WA9A 3TDWA 4EH5A 4GJ2A 3QHRA 4HOKA 3OTUA 4F7NA 1H0VA 3R8MA 5HLWA 4II5A 5BUEA 3VULA 3TG1A 4JBOA 2WNTA 3R73A 3V5LA 1BKXA 1KSWA 3KRWA 5EK7A 3OROA 2E2BA 4B9DA 3IK3A 2PE1A 3OBJA 4C4GA 1ZMUA 2W5BA 1L8TA 4RX9A 3ODYX 3ORIA 5IQGA 3EL7A 4L00A 3UZPA 1URCA 4FX3A 3TDVA 2BRHA 3PPKA 4FT7A 1ZZ2A 3WF6A 4TRLA 3DKGA 4BCMA 4TYHA 4OBPA 1YDTE 3WBLA 4EWQA 4YHTA 4U3YA 3WZUA 2RF9A 4DCEA 3NAXA 1BI8A 2QG5A 4O6LA 4Y73A 2A19B 4HCVA 5F20A 3Q52A 3NW7A 4RJ8A 2EXMA 4EUUA 4LI5A 3BU6A 5AUWA 5IQBA 3QC9A 5J9YA 2SRCA 4EOPA 3DNEA 5BVOA 5B2KA 2JDTA 4AN2A 1Q5KA 1U5RA 1WBOA 2WTKC 3OWLA 3GU5A 4FTNA 2XK8A 4U97A 1PMEA 1WFCA 4FBXA 5IF1A 4K77A 4LV5A 4K6ZA 4XCUA 3KEXA 1R78A 5EQPA 2IW9A 1R0EA 1UU3A 4C4HA 5CI6A 3GB2A 1OKVA 4ZJJA 4EZ3A 4J52A 3TTIA 4DGLC 3PA4A 2DUVA 4JAIA 3KU2A 4QP4A 2B1PA 2WZJA 4IAKA 3IECA 3U4UA 2YERA 3M11A 4X3FA 4F9AA 3E8NA 1SVHA 2ACXA 1ZYDA 4EOIA 4EH7A 1OKWA 1JKKA 2GFSA 5DGZA 4J97A 3R9NA 3DU8A 2WMXA 3VBXA 2PUNA 3UBDA 2X7FA 3QZFA 2A0CX 2C4GA 2C5OA 2XEZA 3LCDA 3UDBA 3ZLSA 3W8QA 4EC9A 4FKRA 1VYWA 3DK6A 3S2PA 3COIA 1OIQA 2NP8A 4CLIA 5IISA 3RNIA 3QRKA 3GQIA 3VQUA 2OZAA 2UZUE 3QRJA 3GCUA 2BZKB 3QLGA 4RWLA 2ITVA 4UBAA 4F9CA 3H10A 2YIWA 5CEIA 4MXYA 4DHJA 1I44A 4MXXA 3SV0A 3UIBA 3DQXA 4I0TA 2ETRA 4J96A 3ZXZA 4LDTA 4UZHA 4QTCA 1OIRA 1Q41A 1KV2A 2R3LA 4G5JA 4YZMA 4BCFA 4XG8A 4U3ZA 4EK3A 2Q0BA 4WUAA 3UDTA 5IA3A 5DR9A 3SRVB 2ZM1A 3PSBA 4U80A 4PMPA 4XH6A 4EHVA 4ZLZA 1XMLA 5CSXA 5F94A 1XH6A 3MFRA 4FE2A 3QQGA 4EEVA 4OBOA 4IB5A 3GU7A 1NY3A 4FL1A 1FPUA 3PG1A 4ZZNA 4AOJA 4YJRA 3QL8A 2P55A 2C6IA 1GAGA 2RKUA 3B2TA 3ROYA 1CMKE 2BUJA 2O0UA 2JDOA 3C4EA 5EKOA 2PZYA 5FTQA 3RPYA 4R6VA 4ERWA 4BBEA 1ZARA 3MH3A 4NH1A 4TYEA 5GIOE 2CHLA 2V22A 4QP2A 4YJPA 1YXXA 5A54A 2JKMA 4KINA 4O0RA 4WRGA 2FYSA 3IW7A 2HWOA 2CKOA 3GFWA 4HYIA 2UVXA 4RIWA 5BYLA 4RWIA 3A8WA 4G5PA 5HNIX 3RJCA 3L9LA 3PJ3A 1H24A 3PXZA 4GUBA 5CENA 2F2UA 5E8ZA 4MBLA 2OIDA 2ZMDA 4JG8A 4JR3A 4QMPA 2BAQA 4F1MA 3I81A 4QT1A 5FM2A 3RPRA 3OHTA 4E8AA 5AP2A 3DPKA 2IVSA 2QLUA 2ZB1A 4JXFA 3CQEA 4YJNA 3VHKA 4ZLYA 2OH0E 3GCSA 2GS7A 2XKCA 3EKKA 3D4QA 3QTRA 3R1QA 4FV0A 4QMZA 5EDPA 3EWHA 2PMNX 3BQCA 3CQWA 4WIHA 4H3PA 3HV6A 5AP7A 4TNBA 2WQBA 3UO6A 2PVKA 4D4VA 4D2RA 4NM7A 5E8TA 3HUBA 4AXAA 2C1AA 1UV5A 3H9FA 3NUPA 4R5SA 4L01A 4DHFA 3GENA 4MXCA 3WYYA 4ASXA 4PX6A 3ZRMA 3EHAA 2BHHA 4MNFA 3S95A 1HCKA 3G6HA 2PMOX 4YTCA 3UNKA 2VNWA 5A4TA 2PK9A 1BMKA 2PMLX 3FMJA 1OB3A 3ACKA 4QYHA 3WZDA 1VR2A 4E4NA 5IMEA 5AUYA 2OW3A 3NIEA 4JR7A 2YIQA 5DG5A 3SDJA 5IQFA 1Q8WA 1X8BA 2IW6A 4B8MA 4UX9A 4IVBA 4OTGA 1MRYA 4AA0A 2IPXA 3QUPA 1UU9A 2CN5A 2QNJA 1WBPA 3KMWA 3RPVA 3IW5A 5FGKA 5IQEA 2FUMA 4O0VA 4B6LA 5FG8A 5HG5A 3L9MA 3QTXA 3D2KA 1R0PA 2WMRA 4RFYA 3ZC5A 4CFFA 1M52A 3H30A 3II5A 3DBFA 2O8YA 3L8PA 4H1MA 3UPZA 3DAKA 3GI3A 1M2PA 4IJPA 2WMAA 3TZ8A 5BPYA 4QP6A 2PVMA 3LLTA 3OCGA 1TQIA 4DFNA 5HO8A 5C4KA 3V3VA 3EQRA 2ZV9A 4G6LA 2C0IA 4PQNA 3BBTB 1QPDA 4G34A 3MFTA 2ITQA 4KBKA 4EJNA 2WAJA 3VO3A 5I0BA 3GFEA 3KIOC 3DAJA 2BFYA 4FNZA 4BYIA 4L44A 4I0RA 4K0YA 4ALWA 5K4IA 5FQDC 5LQFA 1OKYA 3FYJX 3NCGA 3UIUA 2V62A 2ITUA 1KE5A 3MESA 4TYGA 4G6NA 4J99A 3ZLXA 2IVUA 5E7RA 4DFLA 4TL0A 4QP3A 3BHTA 3B2WA 4AFEA 4G6OA 4CXAA 2WIHA 3MWUA 4TWOA 4RJ4A 1I09A 1SMHA 5EFQA 2Z7LA 1NVSA 4UXQA 3BPRA 4X6RA 5EYDA 4KABA 2EVAA 4DG0E 5LVLA 2XJ2A 4ACMA 1XBBA 3CIKA 5E8XA 2OJJA 2UW9A 3JYAA 4NZWB 3FQEA 3I1AA 4R78A 4JDKA 3FMLA 4IM2A 3OY1A 5EM8A 4FICA 3SD0A 2OF2A 3MTLA 2W7XA 4C3PA 4EKLA 4KA3A 5AMNA 4E5WA 4I92A 4RX5A 4NWMA 3R04A 5LXMA 2G15A 2IZUA 1WBVA 1WCCA 2ERZE 3QTWA 3FZRA 4XNEA 3PJ1A 5T6KA 3TKHA 1KE9A 1BYGA 1TVOA 4F7LA 5CU2A 4YZNA 4AAAA 4DFXE 1PJKA 1XQZA 1J7LA 4EJ7A 4FKJA 4D58A 2QR8A 4LYNA 3WF7A 4KUJA 5E1EA 2CSNA 3EB0A 3UDZA 2XNPA 3CSVA 2GTMA 3Q53A 5EYMA 5FRIA 2YABA 1JKLA 1PMUA 5BVDA 3MW1A 5BMMA 2X4ZA 2IZTA 5FD2A 4EH6A 4ZTMA 3VNTA 2A27A 4IAIA 2OH4A 2QKRA 4PMMA 5ANJA 3BRBA 4UEUA 1H1PA 4AWIA 5E8WA 4PP7A 1RDQE 3QHWA 2HW7A 4A9YA 3OW3A 4OT5A 1PXMA 3NYNA 2WMBA 4L6QA 3DK3A 1OL7A 4DHIB 1M2QA 3NVMB 5CSPA 1UVRA 2OXYA 2O3PA 1STCE 4BCKA 3F88A 3JY0A 4LRKA 5L8KA 3GU6A 4CRSA 3TKUA 2CKQA 3SGCA 3R7OA 2I0EA 3K5VA 3BX5A 2XVDA 5C26A 5ANGA 3TTJA 2R3MA 4XS2A 3AGLA 3R8ZA 1BL6A 4FSNA 4JDJA 5I9XA 2XEYA 3RKBA 4D55A 1OL1A 4WBOA 2YM4A 4FKPA 4YHFA 3WIKA 4FK3A 2HZIA 2JEDA 3F9NA 4MAOA 4QYEA 4BDBA 2XALA 4D0WA 3E93A 4KWPA 4ARKA 2F57A 5KBQA 5KMNA 5A9UA 4CMOA 4QYGA 2EU9A 3NNUA 3RTPA 4XLIA 4FIIA 2XYNA 3D94A 2P0CA 3KCKA 2WD1A 3G33A 3SHEA 4FKOA 3Q3BA 5CEPA 4DN5A 2DYLA 2VWIA 2I6LA 4IX3A 3HMPA 4RZVA 2JD5A 4O86A 3F82A 4L3LA 3OP5A 3KF7A 5CLPA 4CLJA 5KZ0A 2VRXA 4CFUA 4JBPA 4D9UA 2ITNA 3UOJA 5CSHA 4Y85A 4YPSA 3R30A 5HIBA 3A7IA 4EYMA 3DDPA 3VRZA 2CGVA 2HXLA 2YM6A 5EHLA 4YO4A 4WBBB 3QLFA 4BC6A 1ZRZA 3UYSA 3NS9A 4QP7A 1Z5MA 3TIZA 4BZDA 3BEAA 2X8IA 4NW6A 2NRUA 3ZEWA 3VQHA 4DEDA 3LJ1A 5H8BA 3TNQB 2QI8A 2PU8A 2J0LA 4N6ZA 4NL0A 5HESA 2C3JA 5HNBA 4AZEA 4ZEGA 1XBAA 2HELA 1JPAA 2R3OA 2ITWA 2UUEA 2X0GA 3RZBA 3DKOA 4IWQA 3IDBA 2V0DA 3AC1A 2XK3A 2JGZA 4LUEA 3EMGA 3Q4CA 4RIXA 4TWPA 1YW2A 2DS1A 4OTRA 4CFVA 2X4FA 3CJGA 4DT8A 3Q9XA 5HBHA 3VUMA 3ZFXA 1RE8A 3NYXA 3L8SA 5FBOA 4DHZA 4CVAA 4DGMA 3FEGA 5KMKA 3FKOA 4PMTA 3LCSA 5CANA 5D11A 4R1VA 2BRNA 3SLSA 3W16A 4M13A 3KXNA 4FKUA 4NT4A 5FUTA 4A9TA 3NNXA 4FYNA 4YJUA 3R7EA 4ZSEA 5AV4A 5K5NA 5KHXA 3GCPA 3ZO1A 2Y4PA 3FPMA 4USFA 3DXQA 4WHZA 5CVGA 4ITJA 3KXXA 2YA9A 4TWCA 4FV7A 2IZRA 3FZSA 3IS5A 1Q3DA 3I0OA 4C0TA 2WEVA 3PRIA 5JKGA 3F66A 4CT1A 3PG3A 2B9HA 3T3UA 2I7QA 2XNGA 4Z16A 1M17A 1GZKA 1OL2A 2V7OA 3DGKA 4GT4A 5CVHA 5B7VA 5M56A 1GOLA 2KULA 3PIYA 5LMKC 3KREA 4I5PA 2YDJA 4YTIA 3RAKA 2XP2A 4FTIA 4XRJA 2H8HA 3MI9A 2CNUA 3ZM4A 3NEWA 3CQUA 2OGVA 5HCYA 3LQ8A 1XMMA 4ALVA 5HU3A 3PA3A 1OGUA 2C68A 4FZAB 5DT3A 3DZOA 3KQ7A 4EHZA 4H05A 2YITA 3HL7A 2UW5A 4FKLA 1J7UA 3JVRA 5JRSA 3ETAA 4DDGA 3GC9A 5ITAA 2QODA 2UVYA 3VUIA 3TV7A 1F5QA 2VWUA 3EN5A 3QALE 4QP8A 5E8YA 4MNEB 2ZDUA 2OWBA 4CG9A 2I40A 3EH9A 3PLSA 3ZTXA 4AZWA 4EC8A 2Z7SA 1JLUE 3QRUA 1WVYA 2XA4A 5M4CA 4IM0A 4BDKA 4F09A 4JX7A 3PUPA 3OUNB 4LOPA 2PVNA 3BE2A 4W8EA 3KRJA 2FSMX 2UZTA 3EFKA 4HVGA 3CGFA 2W99B 3KA0A 4DYMA 3G9NA 4U41A 4U45A 4RVKA 4NCTA 2XJ1A 4V04A 3RK7A 4M0YA 3I79A 3DY7A 3TV4A 1JAMA 3HAMA 3TXOA 4CMUA 4EOQA 1JBPE 2W05A 3BU3A 4CEGA 1OZ1A 4FSUA 4W4WA 4CZUA 5JQ5A 3RNYA 5LVMA 5CSWA 4BDGA 2C5NA 2OJIA 1ZOGA 2WO6A 4JBQA 3QGWA 2C47A 4CFXA 4FEUA 4ORKA 2WMVA 2PVYA 3ZDIA 3F3TA 3KK9A 1JOWB 3DLSA 3MY1A 4IADA 2ETKA 4TN6A 2WELA 4YPDA 4YLKA 5DFPA 1U54B 4D5HA 4CT2A 5JT2A 3UZTA 2BRGA 1FOTA 4D1ZA 4FTAA 2ZMCA 3F5XA 2WTKB 4FSMA 3BLHA 1H1QA 1VZOA 2UZNA 3FMKA 4IM3A 5FXRA 5ACKA 3ZM9A 4GRBA 3QC4A 4JRVA 1DAWA 4FL2A 5ICPA 4OUCA 2EB3A 5A4CA 3FSKA 2IZSA 4JIKA 2RG6A 4LL5A 4PDYA 2NNWB 4YJTA 3F2AA 3R8PA 3NUXA 4YP8A 1MQ4A 4R5YA 2UW7A 4F08A 4PWNA 4XLVA 4IJ9A 4DG3E 4AZVA 1JKSA 2EB2A 4GU9A 4GCJA 4MBJA 4GFMA 2C0TA 4IWPA 2XCHA 3U8WA 1ZWSA 2R3RA 4D4RA 2JC6A 4BTKA 1T45A 2ERKA 3I5ZA 4O22A 4JS8A 5A46A 2XIYA 2DWBA 3FI2A 4APCA 2OXXA 3EFWA 4XOZA 4XYFA 4C2WA 3HYHA 5LMKA 2Q83A 3A99A 3QUDA 4C4EA 2KTYA 2UV2A 4IAAA 4UYNA 1XWSA 3HGKA 5E90A 4FSRA 3MVMA 3UYTA 3VS2A 4RX8A 4FT9A 3VVHA 3E8EA 3ITZA 4KBCA 4AS0A 4UY9A 4HVIA 4C59A 4E1ZA 4L3JA 3QQKA 4AE6A 1B6CB 2R3QA 3PWDA 3KXGA 3GNIB 3IPHA 3ZDUA 3LPBA 2VWBA 4QMLA 4XJ0A 5AAEA 3FZPA 3GOKA 3W0RA 1RJBA 5CALA 5IH4A 5I5ZA 1F3MC 5FEDA 1TFFA 4F4PA 2XF0A 3QD4A 3JUHA 2REIA 4TNDA 3C1XA 4GW8A 4QTEA 3PLAE 1CDKA 4KKGA 1Q3WA 4RLLA 3MPMA 2VWVA 3IKAA 4AN9A 4J8MA 3UZRA 4ZP5A 4EQUA 2Z02A 5CTPA 1O6KA 3G5DA 4I93A 3BKBA 5HGIA 1SM2A 2HZ4A 3PTGA 5K3YA 1PMVA 2F49A 2YAKA 4LQMA 2W9FB 4I4FA 2ZM4A 4MXZA 3E3BX 4JL9A 1FGKA 5LWNA 1A48A 3W0PA 1R1WA 4TWNA 5DR6A 4G31A 4RPVA 2J6MA 4GK3A 4RX7A 5EHYA 4D1XA 3CBLA 4BIEA 4FV4A 5CAUA 3OG7A 3BWFA 1M7NA 4Z7GA 2B52A 4MQ2A 2R3HA 4EYJA 2QHMA 4FZ7A 4HZSA 3QRTA 4WO5A 3AC5A 3UIXA 4JG6A 5I9WA 3R9HA 3UQFA 3WZJA 4FV1A 2QOOA 5H8GA 4KKHA 4BRXA 4I0SA 3U6IA 1E1XA 4KSQA 3AG9A 5HVKA 4FMQA 3W0QA 3LM0A 5LVPA 2YHVA 3G0FA 4FG8A 4X3FC 3ROCA 4BBFA 1OUYA 1U4DA 3N51A 3H0ZA 4ITIA 5AUZA 3RHKA 3DK7A 2PWLA 2V7AA 3R63A 3L8XA 3G6GA 5AM6A 3UO4A 3F3ZA 4QQJA 1ZLTA 1Q97A 2XS0A 3VS4A 3MH0A 3LE6A 5CAVA 3LCTA 1WBNA 4B0GA 1K3AA 4ZMEA 1KWPA 4QTDA 2QQ7A 1QCFA 4XG6A 3E62A 4ZTRA 2RG5A 3E88A 4H36A 4RJ6A 5FEEA 4YU2A 4QPSA 2QD9A 5M53A 4L7FA 2Z8CA 4LOQA 3VJNA 3ZZEA 3OD6X 3OOMA 2R7IA 4LUDA 2VWZA 1ZOEA 5AA8A 4QMWA 3Q32A 5DRDA 4FZ6A 3PIZA 1XHAA 3AT3A 3ORLA 3BV3A 3CXWA 4I5HA 2A1AB 4AP7A 2YJSA 4BR3A 5HLPA 3RWPA 2XJ0A 5H3QA 3UIMA 5AP0A 2GQRA 5KMOA 1APME 2PE0A 4G3EA 1IAHA 3L9PA 5IZFA 4E5AX 5IPJA 4CD0A 4G3DA 3O51A 3QQUA 4X2KA 3QWKA 5ANEA 3ZRKA 3I6WA 3D5WA 4C4FA 4D4SA 5IU2A 3EN9A 5EQEA 3P7BA 4F9WA 2UZOA 3E5AA 5AADA 5IDNA 3FJQE 4A07A 4MXAA 5FM3A 4TW9A 3RK9A 5BNJA 4ZY6A 5DEWA 3BGQA 4E4MA 5DA3A 3BU5A 1EH4A 3A8XA 1W8CA 3POZA 1V0OA 3Q6WA 3MN3A 4FUYA 4GL9A 4ZIMA 5IH6A 5FDPA 3GVUA 5IG1A 3CR0A 1RQQA 5LMAA 3V5WA 4AGWA 4ALUA 3LIJA 1AGWA 3LJ0A 5HG7A 4QMNA 3TACA 3HVCA 3QQFA 4DEBA 4L46A 4OR5A 3MPTA 4U42A 4GMYA 4F64A 5LVOA 3QFVA 3M42A 2G2IA 3PJ8A 3PSDA 1WZYA 3EQFA 2UW3A 5D12A 2BFXA 4E5BA 4KBAA 1FQ1B 4DITA 3RPOA 1MUOA 4X2JA 3LXLA 3T9IA 1PY5A 2OK1A 2PVLA 5HI2A 2CMWA 4OLIA 5E92A 4E6CA 2W1DA 3BIZA 2GQGA 3BYSA 5CU4A 3HMMA 4RA5A 3SOAA 4I24A 3BGPA 3CS9A 1JSTA 2W1HA 3W2CA 1KE8A 4NU1A 3R22A 4ZZMA 2R2PA 3NFGB 4EH4A 5FDXA 3MB7A 2IVTA 4ACDA 2VTOA 4QTBA 3QCXA 4H39A 3VBWA 4ENYA 4EOLA 1H01A 1TQMA 5F1ZA 3RWQA 1R39A 3WARA 5KMJA 4MUQA 3DOGA 4RIXB 5EW8A 4YZ9A 4YC6A 4O7RA 4OTDA 5CF6A 5H8EA 3S1HA 4DTKA 2GSFA 4KNBA 5CAPA 5FTGA 2EUFB 3TI1A 3P5JC 4IQ6A 4EUTA 3UVPA 2YIYA 1Q8TA 4I23A 2CLQA 4K11A 2CNVA 2JFLA 1CKIA 4EZ5A 5K4JA 3F2RA 2BDJA 5DEYA 2VTPA 3UOKA 5HTBA 4P5QA 3LM5A 1SNUA 2RIOA 1REKA 5HHWA 4IE9A 2ZFYA 2GNJA 2ZV7A 4FTJA 2XZSA 4FIEA 5D7VA 1XH4A 4DTBA 4GEOA 4N0SA 3ACJA 3BHHA 3KB7A 4R3CA 3UNZA 5JH6A 2AC5A 2B7AA 4AT5A 3GCQA 3W32A 2QO9A 2ZDTA 3RI1A 3Q5IA 5J7HA 3CY3A 3ORZA 5L8JA 3R7UA 4OW8A 5FXQA 5JEBA 1E9HA 4BY9E 2BVAA 3RPSA 2QCSA 4D0XA 4C7TA 2DQ7X 4X2GA 1ERKA 3TYKA 3R1SA 4E7WA 4BDJA 3DBDA 3HAVA 2VTIA 4AGUA 4KRCA 5CZIA 4U7ZA 3SA0A 5CXHA 2QVSE 3O8TA 2GNIA 3IW8A 3CJFA 3QYWA 4JLCA 4XG7A 3KULA 4FIJA 3NUYA 3Q5ZA 2UZDA 4JAJA 3LFBA 2WGJA 4I6FA 2BKKA 2HIWA 3CY2A 4MD7E 3FQHA 4TY1A 2CGXA 5GINE 4FSYA 5AIKA 5CEKA 3CCNA 2FH9A 4MQ1A 3DBEA 3IOKA 1YWVA 2QOFA 4XRLA 3MA6A 1FINA 2Y8OA 4I6BA 5IDPA 5J1WA 4RVLA 1OIUA 4X0MA 2C6EA 5DT0A 4YHJA 4IFCA 2OJGA 2R5TA 5C9CA 5IUHA 3GU8A 4GFGA 2HK5A 2PL0A 2NRYA 1FVTA 1CKJA 2CLXA 2GS6A 3G0EA 2W4JA 4RFMA 1PXLA 4C3RA 4O91A 4JRNA 3UOLA 3HLLA 3AC3A 3EN7A 2H96A 3FMDA 4IAFA 3ORPA 5AUVA 3QKKA 1F0QA 3JPVA 3R0TA 4Y5HA 4CV8A 2WU6A 1UNHA 2HWPA 4RC2A 1PMNA 5J5SA 4QMUA 5CNNA 3SVVA 1WVWA 3R7IA 3GCVA 4WSYA 1M14A 2C3IB 3KKVA 3F6XA 1UU7A 2R3IA 4PNIA 1G8SA 3U6HA 3ZSHA 4HVDA 3BYUA 5CQUA 4M14A 5CWZA 1SNXA 3SW7A 3DQWA 3F3VA 1B38A 2FSLX 4FL3A 3TNIA 3P7CA 3V6SA 1YRPA 5KMIA 3M1SA 4O21A 1GIIA 5IH5A 4XV3A 3VS6A 3QBNA 4RIYB 4BCQA 4BCHA 2C5VA 2GHMA 3CP9A 2VTSA 3DLZA 4EHEA 3GU4A 3C4ZA 4V05A 3NWWA 2F7EE 2XANA 4IEBA 1SVEA 3CLYA 3BZ3A 1OL5A 4ZOGA 4IC7A 4FTTA 4OGRA 1H1SA 2HY0A 4F0GA 4FODA 1DI8A 3DV3A 4Q5EA 3NRMA 4GVJA 3UE4A 3ZU7A 3NR9A 4XUFA 3QWJA 1ST0A 2B9IA 2VTHA 4XX9A 4UALA 4O27B 2VUWA 2FSTX 3C50A 1JNKA 2ZYBA 5CU0A 5E8UA 5TR6A 1H8FA 4HPUE 4DH3A 2BHEA 4EH8A 2OIBA 3RCDA 5JFXA 4K8AA 3V51A 3ANQA 2WFYA 1JQHA 4FTOA 4ZSJA 5HD4A 5C03A 4FV2A 4L43A 3CGOA 2AYPA 4M0ZA 1NA7A 4LG4A 3V04A 3MVJA 3SOCA 3KC3A 3MGYA 3ZRLA 1XO2B 2YIXA 3KL8A 3W1FA 2C6MA 3ORTA 1Y91A 3I60A 4NTTA 2I0YA 4Q9SA 4E20A 5F9EA 5HE2A 3AQVA 3ZZWA 4OTWA 4ZY4A 1H0WA 3AKLA 4P5ZA 4BB4A 4QMVA 4AW1A 3NNWA 1PXOA 1UWHA 5HQ0A 4D4YA 3D2IA 4AXDA 3QZGA 2WTWA 3P78A 3T3VA 4F99A 5HBJA 2XNOA 3D83A 1AQ1A 3CPBA 3GQLA 4DFBA 5CF5A 3IDPA 3MJ2A 3VIDA 1FVRA 2QOHA 2YCFA 1DS5A 1XH5A 3GOPA 3GXLA 4V0GB 4WNPA 3V5TA 4ZTNA 3PZHA 4FSQA 4GU6A 3FLZA 2BDWA 3DBCA 5H2UA 3W10A 3D5XA 1VYZA 2B9FA 4IZ7A 1VJYA 3N4TA 1O6YA 3KMMA 2XAOA 5M09A 2QLQA 4N4SA 1LEZA 4A4XA 3PVUA 1O6LA 3DFCB 4S2ZA 3VS5A 2R64A 3QQLA 3A2CA 4RQKA 2J0KA 3OOGA 4ZMFA 3F61A 4F6SA 2QO7A 3PWYA 1VEBA 1NVRA 1TQPA 3O0GA 3PE2A 3G9LX 4L45A 3PVWA 3P7AA 2OG8A 2YWPA 1BX6A 4BCPA 3FLWA 1XH7A 3R02A 3ZMMA 5IQHA 4R7HA 3MS9A 2YM5A 4FTUA 4ZSLA 3V5QA 1OKZA 1PXIA 3QRIA 5ANOA 4TZRA 2B55A 4UV0A 5D9HA 1WMKA 3AD4A 2WTIA 4IW0A 3TJCA 3NVKI 2E9UA 2W1EA 3SG8A 4XP2A 1MQBA 3FMNA 4F7JA 3UDSA 5BVNA 1SYKA 4BI1A 3POOA 3OC1A 4WKQA 1PRYA 2GHGA 2IVVA 4YNEA 3FPQA 3MY5A 4L42A 1YHWA 2JBOA 4QEBA 3LQ3A 4L7SA 1JSUA 4Y46A 4EI4A 5L2IA 4AW2A 5L6OA 2C6DA 3NDMA 3OCSA 2BILB 2ZM3A 2C6LA 3CKXA 3FXXA 3OS3A 3SW4A 4DEAA 4L3PA 2JKKA 2F4JA 3MIYA 4F1TA 3NUSA 3JY9A 1IASA 5CI7A 2ITTA 5E91A 4BDAA 4C3FA 2XM9A 5D7AA 4FT5A 1WVXA 5M4IA 5EH0A 5AP6A 1GIHA 2I1MA 1YXVA 3LFCA 4TTHB 2C0OA 2QOQA 4XP0A 4IVAA 4J7BA 5HCXA 3EFLA 3F69A 1GJOA 3ORXA 4MYGA 4B4LA 4O7VA 4TYIA 1Q61A 2RFSA 3FZOA 3KCFA 4RJ5A 1AD5A 3UC3A 4ANBA 1ND4A 3MV5A 3VUKA 5ETAA 1UWJA 2QO2A 2WMUA 3EN6A 5F4NA 2UZLA 3TNWA 4DCAA 2VWWA 3NSZA 4LOOA 3O7LB 5GHVA 4O81A 4D1SA 3DXPA 3QAME 2ETMA 5AJQA 5JSMA 4FKQA 4DH7A 4JDHA 1H07A 5BUIA 3FLQA 2HZ0A 3O17A 4FT3A 3T9TA 4GK4A 3OXTA 4HW7A 2PUUA 4NM5A 3LXNA 3BHYA 2PULA 1NT2A 4FKSA 5M4UA 3P1AA 2V5QA 4NFNA 4IIRA 2XCKA 1ATPE 4HNIA 4NJ3A 4YBJA 2HYYA 5DLSA 4C58A 4HGLA 2CGWA 3AXWA 4U43A 4FKGA 4NFMA 4ZSAA 5M4FA 4MD9E 4NCTC 4O0UA 3QU0A 5BUJA 5CU6A 1MP8A 3PYYA 3OUKA 2GNFA 5CS6A 4MHAA 4MX9A 4TPTA 2VO0A 2YZLA 2F2CB 2O63A 3QA0A 1Q62A 3HX4A 4O96A 4TYHB 4APPA 3AD5A 4CNHA 4M68A 4RVTA 2QOLA 2ZAZA 1BL7A 4AA5A 5EQYA 3C13A 2XK7A 4NW5A 2ITYA 3BV2A 4PTEA 4TKSA 3WYXA 4DBXA 3ENMA 2C3LA 3R9OA 4DF3A 2BTRA 2QOBA 2QURA 3CKWA 5DPVA 5JQ8A 3P08A 5EM7A 4BTFA 3FMMA 3LMIA 3NYOA 4O0XA 1KE7A 5EI6A 3K3JA 4IZ5A 4O0YA 3IGOA 5EM5A 3PP1A 4DH1A 4UWYA 4CCBA 4QMSA 5CF4A 2WEIA 4M69B 5K9IA 5EG3A 4I3ZA 4S30A 3RCJA 3IOPA 4LMUA 4C33A 5L2SA 4FNXA 5EOBA 3MYGA 1PF8A 2OFUA 5E4HA 3WF5A 5M07A 3PXYA 5EW3A 1U46A 4GT3A 1V1KA 4FSTA 2C5YA 4L67A 3F2NA 4AF3A 3A7FA 3I5NA